4PTGA

Structure of a carboxamine compound (26) (2-{2-[(cyclopropylcarbonyl)amino]pyridin-4-yl}-4-methoxypyrimidine-5-carboxamide) to gsk3b
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
347
structure length
333
Chain Sequence
KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogen synthase kinase-3 beta
publication title Discovery of new acylaminopyridines as GSK-3 inhibitors by a structure guided in-depth exploration of chemical space around a pyrrolopyridinone core.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 99
structure length 333
sequence length 347
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ptgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ptgA01
1E9HA 2R9SA 1FQ1B 5HG5A 3U8WA 5HIDA 2HZNA 2JDRA 4AWIA 5FTOA 4AOIA 4HW7A 5TOZA 5KKRB 1OBGA 3DTCA 3WIGA 1FBNA 4JBQA 2XM9A 4RWJA 3G0FA 3A4PA 4JX3A 4LOQA 4X21A 3Q60A 1Q99A 2P33A 4Y5HA 4XCUA 3MJ1A 4ZSAA 3KMUA 4KIQA 4N6ZA 4YZDA 3IG7A 1PY5A 2AC5A 4QMSA 3WZUA 4BYIA 3DV3A 4TYIA 5E8ZA 5LVOA 2UZVA 3PLSA 3TWJA 3MGYA 4D9TA 5J1WA 3OWLA 4QQ5A 1H0VA 3GNIB 3DPKA 2XZSA 3CIKA 3FLQA 4RFMA 4AN2A 2Z7QA 3JVRA 1FINA 2O3PA 5M07A 2C47A 3LFFA 4MD8E 3MS9A 4O7ZA 2FSOX 3O8PA 3QTRA 2WHBA 3BI6A 2O63A 4I3ZA 3R7YA 3EMGA 5HO6A 4F64A 4BDGA 3ITZA 3IW5A 4KIKB 5CF6A 4O1PA 4FSNA 4EK8A 3VF8A 4IX4A 3D7ZA 3DQWA 4RRVA 4MF0A 4TRLA 3HV5A 4FIIA 5FUTA 4NEUA 4BDCA 3CJFA 1XJDA 3HKOA 4Z3VA 4OAUC 4G34A 5K4JA 5JEBA 4E6DA 2NNWB 1V0PA 3LJ2A 3EFWA 4CTCA 4Z7GA 4LOOA 2GCDA 3IW8A 1OB3A 1CTPE 4GFGA 3QTXA 4FNYA 3AMAA 3IDCA 4K6ZA 1UU9A 3QKMA 5HHWA 2J2IB 4PUZA 5F95A 4EHGA 4Y95A 2Z02A 3ALNA 3CC6A 3Q9YA 3OT3A 3BYVA 4NCTC 2W9ZB 4WRSA 4X6RA 5D10A 2YIQA 4YJOA 3F7ZA 4MBJA 2QOQA 3CLYA 1YQJA 2JKQA 3MA6A 4E93A 5IH6A 2J0IA 2JBOA 4ZOGA 4RVMA 1BMKA 1FOTA 3NUAA 3BBWA 2BKKA 3VUGA 3VUMA 4IFGA 4IM3A 4QNAA 2XKCA 4DBNA 3S4QA 1LEWA 5CU3A 4IX6A 5IEXA 2XBAA 2Y6OA 2CPKE 3E8CA 3R8UA 3BRBA 2C5OA 4JQ7A 4XG2A 4IEBA 3RCJA 4OTFA 2R3PA 4B9DA 1BI8A 2A4LA 2I0YA 4L68A 4RFZA 1ZZLA 4AXAA 2JC6A 1XHAA 3FMJA 5L3AA 4L3PA 5L2WA 5DT3A 3TJDA 3R7OA 4F9YA 3NVMB 4ASZA 4F70A 3QD2B 4BTJA 3KULA 2XIRA 4YSJA 4GW8A 5CXHA 4FTJA 4BCHA 4C36A 2JIIA 2VGPA 5I9YA 4BDIA 4RZVA 3S1HA 4G6NA 3QBNA 3UVQA 4LQMA 3I60A 2B9HA 4BF2A 4AW1A 1OKYA 2C3JA 3EL7A 3OG7A 3UZPA 5CAUA 4O6LA 2RFSA 3B8RA 2BRNA 3DJ6A 1WMKA 5I0BA 4R7BA 4CYIA 4DFBA 3UPXA 1PXNA 3NUUA 2HK5A 4PP7A 4YJUA 3ZO1A 3KN6A 2VWUA 3ZHPC 4F7LA 1HOWA 4WSQA 5HCXA 4FIHA 4WO5A 2R3KA 1Z9XA 4GL9A 4IVAA 5C4KA 2Y7JA 4G31A 5J5SA 2QD9A 4IHPA 4FKVA 4L45A 4A9RA 5IUIA 3K3JA 3MIAA 4M69A 5KNJA 3M42A 4JRNA 4QMTA 5M55A 3Q4UA 4BDKA 1Q41A 3W2CA 4RMZA 3A99A 3F61A 4JG8A 2B55A 3C0IA 5JZJA 3H9FA 1KOBA 2AUHA 5DN3A 4D28A 5JN2A 3FLSA 4B8LA 4GYIA 2OIBA 3VHKA 2JKOA 4Y46A 4TYHA 4BTKA 4HNIA 1YWVA 4O21A 4YC8A 4BDDA 4FEUA 4D0WA 3EJ1A 3SXFA 5HTIA 4Q5EA 3QUEA 1K9AA 2OJGA 4OBOA 2XCHA 4R77A 2XIZA 3G6GA 2I7QA 3OUKA 5CI6A 1OECA 1OVEA 3AGLA 3UVRA 4ITHA 4E3CA 4HVGA 2R0IA 4UX9A 5J7HA 3SVVA 5E9EA 2I0VA 4ZEGA 5CAQA 2EU9A 4EZ7A 2UW4A 3H10A 4BWKA 2H8HA 4D2SA 4J52A 4QTAA 1UA2A 1ZOHA 5L6PA 3ZEWA 5AV1A 1YXUA 1XH5A 4IC8A 1OPJA 3BHVA 4N57A 4FV7A 2IVSA 4IM2A 3PSCA 4O7LA 5CSHA 3RAIA 5DRDA 3ZEPA 3LCOA 4AT5A 3UQFA 4AZWA 4IVDA 2ZV7A 4CLIA 2BR1A 3RMFA 4A4OA 4IFCA 4UN0C 4ANLA 3CTQA 2XM8A 4ZY6A 3DKCA 1T45A 5GHVA 5AAEA 5IQFA 1M52A 3QWKA 1CKPA 4D55A 4W8DA 3MN3A 5E8TA 4FZ6A 4GUBA 1BLXA 4IAKA 5TF9A 5IA5A 4NSTA 4F7NA 4JDJA 1FVTA 4BHNA 2UVXA 1KSWA 2R3FA 4G16A 2C3LA 2CCIA 3EQIA 2C3IB 3AC1A 1GAGA 4BKJA 1Q4LA 5CT0A 2B7AA 4ARKA 4QMVA 2XYUA 3P7BA 1MRYA 2C6EA 3R22A 4ZZNA 5CEMA 3QD4A 5K0XA 4F65A 2OJFE 1B6CB 2BHHA 2PVFA 2XK9A 3OD6X 3PUPA 4KS8A 5HBHA 4BCMA 3DK6A 3MH1A 4CKRA 4EOMA 2XVDA 3QRUA 2PULA 5CAVA 1IRKA 4ZTNA 2PK9A 1SVEA 2C30A 5EW9A 4CFNA 1GY3A 3CTJA 2WZJA 4ZY4A 5HX6A 2HELA 5HOAA 4G3GA 4USFA 4NUSA 3O8TA 3NGAA 1Q3DA 4L3JA 5EDPA 3VUTA 4EZ3A 1WBTA 4KWPA 5L8JA 4D4YA 2UZUE 4BBFA 4KSQA 5IA3A 3V8WA 4FV8A 4AE6A 3LZBA 3WZEA 4W4XA 1LPUA 3R8PA 3ZS5A 3PP0A 3NNUA 4UMRA 3EOCA 2HOGA 3W33A 5JFSA 5IUHA 4IIRA 2Z7RA 4YJTA 4YLLA 4C4IA 4RZWA 3DNEA 3RTPA 2QHMA 1YW2A 3A61A 3FSKA 4NL0A 5IQCA 2VGOA 4NJDA 4FVRA 4FTIA 2X6EA 2VO3A 4IDVA 4UWYA 3GEQA 5DI1A 5KHXA 4FV6A 3BEGA 3C5UA 4FT3A 4KD1A 4WRGA 2C5XA 3GC9A 4QMUA 4WG3A 4X2NA 4I20A 1JKTA 2ITXA 1ZOEA 3WARA 5JMSA 3ZM9A 4ZMEA 5HO7A 4GK2A 4J96A 4DBXA 1UNLA 3AC2A 2UZNA 2WU6A 4LL0A 1AQ1A 4I92A 5CZHA 1OKWA 5DNRA 4ZZMA 3I81A 3FZOA 3L9PA 3QF9A 2YA9A 3ZLXA 3RAWA 5KMKA 2Y6MA 2CJMA 4XNEA 2W1FA 5HEZA 4ZTRA 4O91A 1WBWA 2PZIA 4UB7A 4KKHA 3ROYA 3T9IA 1YXSA 2C4GA 3EQBA 3NUNA 4FV3A 2UW5A 4U41A 1NY3A 3PG1A 4FL3A 3LFAA 3R8ZA 4AE9A 4C2VA 3LLTA 3DTWA 2JDOA 1PXIA 1W98A 3BGPA 4S30A 4QPMA 3DGKA 1U46A 4YP8A 5DEYA 3HGKA 2ETMA 4H3BA 3R9HA 4XRJA 5AA8A 3KFAA 1UNGA 2OIQA 4YBKA 3F69A 2YCFA 4L8MA 3KY2A 2W5AA 2IWIA 2QOKA 2EXEA 3QCQA 3LOKA 1OL6A 1PMUA 4OTQA 2PUUA 4PP9A 5EM5A 4HPTE 5B7VA 1K3AA 2CNVA 1OL7A 2CSNA 4RG0A 4KIKA 5ANIA 5H9BA 4ZMFA 3NSZA 4FOCA 1JOWB 4FV0A 4ANQA 2W4OA 5IMEA 5M4UA 2B53A 2ITNA 4ZTQA 3F2NA 2XKEA 3I6WA 3VBVA 2XP2A 4CMUA 3P9JA 5DYJA 2W1CA 4DEHA 1H28A 2RL5A 4I5HA 4RC4A 5DGZA 5CSPA 3V6SA 1FMKA 1HCKA 3FMNA 3A60A 1QPJA 3O71A 3QC9A 5L2SA 4U97A 4RWIA 2YM3A 4KRCA 3GGFA 1CM8A 4MXZA 1H01A 2IO6A 3TZ8A 2G15A 4WD5A 4BGGA 3VBQA 3EB0A 1H1RA 4IWOA 4C4FA 5CQUA 1IA9A 4X2JA 4G6OA 2PMLX 4JAJA 5HNBA 4UWBA 1KE5A 5EOLA 4IJPA 2BZIB 3P7AA 5FXQA 4EOJA 3BX5A 4NFNA 4HYHA 1G8SA 1PXKA 2FB8A 4JVGA 3MFSA 4I0TA 3IK3A 4U81A 4X3FB 2PUIA 1F3MC 3FV8A 3O51A 4AW2A 1ZYSA 2GNLA 4F0IA 1W7HA 4ANBA 1H0WA 4YPDA 2VTLA 5K4IA 5CVHA 5AP7A 1XH6A 4IBMA 2HXQA 4U42A 1IAHA 4S31A 3KC3A 3ZU7A 3TKIA 3M1SA 1ZMUA 1Y6BA 4MH7A 4GH2A 4O27B 4W8EA 2YISA 2PE0A 3SXRA 2A1AB 5BVWA 2UW9A 2R3GA 5LMBA 4F1TA 3MSSA 5ACKA 4C4HA 3V04A 4F99A 4XG3A 1TQMA 3GU8A 4YUQA 4RIOA 2QLQA 3RWPA 4IZ7A 4MX9A 3MESA 4K18A 4CFUA 4DEBA 4E5BA 2XKDA 4OT5A 5LMKC 1EH4A 2RFDA 4A4XA 5FLFA 3QTSA 2B0QA 3EQFA 3HLLA 4RC2A 5HIBA 5DMZA 3SW4A 4N6YA 4J8MA 2HWPA 3VUIA 2VO7A 2ZDUA 3TNIA 3SV0A 4IQ6A 3ZBXA 1Y6AA 3BHHA 3U6HA 2X81A 3Q6UA 4G9RA 4V01A 5AV0A 5AAGA 4CFMA 3DDPA 4A9YA 4Y72A 3MFRA 5AUTA 3TKUA 3LXPA 4MXCA 1PMVA 3NAYA 5E7RA 2PZ5A 4D2RA 2WMBA 1DAWA 4JS8A 5A4QA 3NYXA 2VTIA 4KSPA 1J7IA 3GBZA 3O8UA 4WKQA 5KMJA 4KS7A 4PNIA 2YEXA 4U9AA 4NJ3A 4XV2A 3GP0A 4IH8A 5K3YA 5HBJA 4EH6A 3R71A 5CALA 3TXOA 4AT4A 1QPCA 4ZS4A 1XO2B 4JI9A 2XKFA 4W4VA 5HNGA 1XKKA 4UMUA 5CVGA 4AOTA 4DLIA 2B1PA 3QRKA 5D7AA 5FXSA 3LQ3A 2WNTA 4YZ9A 2J7TA 4E4MA 3R9DA 2PVJA 3HEGA 2YABA 3DK7A 2YWVA 4ZTMA 4FKIA 3R6XA 3NDMA 4YLJA 3E8DA 4O0WA 5D12A 4XG9A 5I4NA 4QP8A 3UTOA 4JT3A 3BYUA 4XG6A 4AG8A 4IWPA 4BIEA 4F9CA 2YITA 1O6KA 2X8EA 2XNEA 5BVDA 4LG4A 1LR4A 4YZCA 3G9NA 2HIWA 4RSSA 4D58A 5A14A 3P08A 4HGSA 2PUPA 4A06A 5K5NA 1WCCA 3B8QA 1Y57A 3NUXA 4GV1A 5C03A 4QMXA 3QUPA 4IVCA 4JQEA 2ITWA 4FTOA 1Q8ZA 2QO9A 2V7OA 3QZHA 1BX6A 2QKRA 2YZAA 4BBMA 4DFLA 3I5NA 3PSDA 4NK9A 5AMNA 2IPXA 3G5DA 2RG6A 4QTEA 2WTKC 3UIUA 3KU2A 3OFMA 4C61A 3L1SA 3LFCA 4O7NA 1S9JA 1STCE 3DAKA 2OZAA 3QQGA 3TKHA 4PNKA 3G2FA 1RQQA 3NZ0A 4XV3A 4EJNA 2HY0A 2WU7A 3EYHA 3O96A 4FV9A 2VUWA 4I41A 5EM8A 3TG1A 4X2FA 4UWCA 3D7TB 2QC6A 5AR8A 4FNXA 2QHNA 2W06A 3BE2A 4D1SA 4JDKA 4PV0A 1TQIA 3PJ2A 3WILA 4E8AA 4D9UA 1YHWA 3EFKA 3R1YA 3ANQA 1XWSA 3DBEA 3FKOA 4GG7A 1M2QA 4X0MA 1GZ8A 2OBJA 2BTRA 3EQHA 4C7TA 5AV2A 4LL5A 4NH1A 3Q3BA 3VW8A 4IX3A 5CI7A 3EKNA 3EQPA 1H1PA 5I3RA 5GZ9A 5CNNA 2B9IA 2XIKA 5BUJA 3OCTA 4JQ8A 5CF5A 4OUCA 1WBNA 5J7BA 3F5PA 4CCUA 2PUNA 1OUKA 4FSYA 4NKAA 4K9YA 5FM3A 4EK4A 2BAQA 2P3GX 1FVVA 3KMWA 1VYWA 4XG8A 2XIYA 3C4XA 3GCQA 4FKLA 5HD4A 2FH9A 2VWIA 4K2RA 2VD5A 3HV6A 2VO0A 4QP7A 3AMYA 5LCJA 4XHKB 4A4LA 2OH0E 4QMNA 5FEDA 1OL2A 4O7YA 5AUYA 4FBXA 1OI9A 4FTCA 3IW7A 5FBOA 4FVPA 5B2KA 4ZIMA 4MQ2A 3ZH8A 2C6LA 4BCFA 4ZZOA 5DOSA 4V0GB 2LGCA 4AS0A 4G9CA 4TN6A 3N51A 4WA9A 2QKWB 5M08A 1TKIA 2XCKA 4RBLA 3QL8A 2ITVA 2IZUA 4B99A 2OXXA 1G5SA 2XNBA 5HG9A 2CHLA 3UYSA 3TNWA 1SVHA 3FMEA 3CKXA 3SW7A 3ACJA 4DF3A 2QOFA 4BZNA 1H8FA 1MUOA 1Q62A 4RA5A 3BHYA 4QP3A 4U3ZA 3UIBA 4I24A 2BRGA 3CTHA 3D4QA 3R8LA 4EYJA 1JLUE 3RHKA 5CEQA 5M06A 5E8VA 4AA4A 5KCVA 4WNKA 4I6BA 4FSTA 3GI3A 2F2UA 4WHZA 1RDQE 2JD5A 5BQ0A 4FZDB 5LARA 4OTHA 4J99A 4GJ3A 5HD7A 3OEZA 2YJSA 3OXZA 3U51A 2C5YA 1ZOGA 2ITQA 2VZ6A 3NYNA 4RLLA 5AIKA 2XMYA 2BDWA 1M7QA 3PIYA 4EONA 4WBBB 4PMSA 3TTJA 4OTIA 3Q6WA 4BCQA 3ERKA 4KIOA 3HUCA 4YC6A 4AGDA 4D2WA 3HMIA 4FR4A 4Y8DA 1Y8YA 5JRSA 3AD6A 3FMLA 3SKCA 3PTGA 2B54A 2JFMA 2YIXA 4JR7A 3K2LA 3LMHA 4ITIA 5GIOE 1L3RE 2I0HA 3LQ8A 2J6MA 4BWPA 4DH5A 4HYIA 4IAYA 4W9XA 5AX9A 5IEYA 3DBFA 3JPVA 4EZ5A 2VAGA 4HJOA 4ZLZA 4GYGA 4D2PA 4HZSA 4AF3A 4J53A 5CLPA 2CKOA 4E6CA 1GZKA 1Y91A 4RLKA 3VNTA 3CSVA 3CY2A 4AZVA 3LPBA 5JFXA 2PTKA 5CF8A 5BUIA 4H58A 4OBPA 4FEWA 4O0RA 4AZFA 3P79A 3AC3A 3D2IA 3AD4A 4WT6A 3BELA 5EI6A 3AD5A 3FPQA 3OF0A 4LRKA 5LVLA 2XBJA 3ORLA 2JFLA 3PXQA 3Q52A 4FV1A 1PXLA 1VYZA 2QU5A 4NM7A 4GT3A 4X3FA 5LQFA 3UZTA 3OCGA 2X8IA 1XH4A 3AT3A 1Q8YA 2JDSA 2YM5A 5KZIA 4ACGA 4BZDA 2QR8A 3RK7A 5E92A 2YDIA 3RCDA 5EQPA 3TI1A 4F9WA 4O22A 4CFVA 3N4TA 3LKMA 2JDVA 3QGYA 1XH8A 2HWOA 4EOLA 4YHJA 3BWFA 4FKOA 3RBWA 1DI9A 3M11A 4AA0A 4HVHA 4FG7A 3FHRA 5I9ZA 3ZFYA 4IZAA 3PIZA 2BDFA 5LVPA 1PJKA 3SXSA 3V8TA 4MQ1A 3IS5A 2VRXA 3DZOA 2OU7A 5BYLA 5L2QA 4C3RA 2CGXA 4UYAA 5LCKA 3PDTA 3OY3A 1OPLA 3TV6A 4BBEA 3TTIA 5HX8A 5J79A 2QR7A 3LMGA 4QTBA 4PPCA 4YJPA 5JK3A 3HRCA 2EUFB 1FVRA 5KZ0A 4EOKA 1IG1A 2CGWA 5A4TA 5AM7A 1RW8A 3R21A 4YJVA 4BB4A 1WVXA 2C69A 5C01A 2G9XA 1IASA 3WF6A 4HGEA 4JR3A 3TNPC 2I40A 3WIKA 5M53A 4RJ4A 4F7SA 1SNXA 4F7JA 2HW6A 3F3UA 5HLNA 2H34A 1P2AA 2FVDA 2JGZA 2W9FB 3KCFA 3QTWA 1OKVA 2WTCA 4GMYA 4TPTA 3T3UA 3F9NA 2V62A 3KK9A 3QWJA 4AT3A 4GT4A 5L2IA 3S0OA 4RIYB 1O6LA 1O6YA 5L8KA 2YCSA 3ZLWA 3VS4A 1URCA 4BDEA 3ORNA 3DBQA 3DCVA 3PRIA 4EOSA 2DWBA 2VTJA 3QKKA 2WOTA 2CCHA 5TKDA 4L44A 4MXYA 4WSYA 2IN6A 2W4KA 4DFXE 4YSMA 3D15A 5CT7A 2PMIA 2NRUA 4FSQA 4BWXA 4C0TA 3EIDA 4FZFB 1DS5A 4GJ2A 4EK5A 4R3CA 2WFYA 3HA8A 3VRYA 4DGNA 1YXVA 4NM0A 2VX0A 2F9GA 1AD5A 4I6HA 3CP9A 3QHWA 2QOIA 2R3LA 4AZEA 2Y8OA 3LXNA 2VTQA 5J9YA 4BDAA 3GB2A 1HCLA 2Y9QA 3OXTA 3AC5A 5KX8A 5CU4A 3FI3A 1VEBA 3MFTA 3VQHA 4E1ZA 3HV3A 2O64A 4FKWA 1I09A 4RX9A 5AV4A 1P5EA 4PL3A 3P86A 3UVPA 2R3NA 3Q2JA 5DLSA 2H96A 3MB6A 3UDBA 2XS0A 5EHYA 2WMQA 3G90X 4NW6A 3TDWA 3DDQA 2OJJA 3A62A 2G2IA 4TTHB 3PE1A 3EQGA 3QZIA 4FMQA 1H1WA 2CGVA 1GZNA 3F6XA 4ALWA 4UY9A 5DT0A 4FSUA 3QQJA 4XYFA 2EVAA 3R8VA 5T68A 4M13A 4RIWB 3D7TA 5DG5A 5AA9A 1WBVA 3P4KA 4C3PA 2FSLX 3Q32A 3QCYA 3DS6A 4MKCA 3DFAA 2J0KA 3ULIA 3IOKA 5M51A 4YTCA 3ZUUA 3QLGA 2UZBA 2HYYA 2QLUA 2EWAA 3IPHA 4GG5A 4TW9A 3HNGA 5D7VA 2C1AA 3I79A 4YTIA 4QMMA 4HYSA 4IWQA 4NFMA 1PMEA 5BVNA 2XIXA 4JBPA 4FF8A 2HY81 4YTHA 5HVJA 4HNFA 3ZZEA 3PJ3A 5DFPA 3JR1A 2VX3A 5AP5A 3POOA 4ANMA 3KVWA 4GT5A 3C13A 3I5ZA 5KMMA 2X7FA 4L01A 3ATSA 4RT7A 3BU5A 4AZSA 3OS3A 4U7ZA 5FTQA 4NWMA 3LQ5A 2PVKA 4U5JA 5AR5A 4ZLYA 1IAJA 4U45A 5E8YA 3FQHA 1UU3A 3F88A 4JNWA 4QYYA 3TZMA 2OJIA 5AV3A 4JOAA 1JSTA 2WPAA 3P5KA 3BKBA 4FTUA 5DT4A 1YVJA 4ZS0A 4C2WA 5GZAA 3IW6A 4V0GA 3LLAA 5BNJA 5I9VA 3QTQA 3POZA 4GUEA 3V5QA 5LOHA 5EM6A 3FMHA 3PJ1A 5A54A 2B9JA 2WO6A 2I0EA 3NNVA 3COIA 3U4WA 4AU8A 3OT8A 3QAME 2C6MA 2BRHA 2VV9A 4PWNA 4Q9ZA 4MF1A 3R63A 5IG1A 3VAPA 4M97A 4XH6A 5H8GA 4APCA 3IECA 4JBVA 4QMZA 4YJNA 3ORPA 2JDTA 5DE2A 5EDRA 1PXOA 3R83A 4EBVA 3QXPA 3RJCA 2XNGA 3T8OA 2ZM3A 3GU5A 2WGJA 3DA6A 4I23A 3SOCA 2UVYA 4JIKA 3BU3A 3PVUA 3P23A 4UZDA 5E90A 2W1EA 3Q2MA 4WNOA 2GNGA 4DH8A 4AGUA 5ANOA 5FP6A 4EH5A 1ZYJA 2W1ZA 1QMZA 4CFWA 4PPBA 4OGRA 4DN5A 3EQRA 2PY3A 2QG5A 2ESMA 4C57A 1WFCA 4HGTA 3FKNA 2Q83A 3OY1A 3B2WA 1IEPA 1ZAOA 3LAUA 3MH2A 2Y4IB 4DG2E 4JRVA 3VVHA 2FSTX 3GC0A 4EQUA 4KNBA 4FKSA 4AW0A 3V3VA 3R1NA 5EQYA 2C5VA 5EH0A 4PDPA 5KBQA 4U80A 1NVRA 2Q0BA 4M3QA 3FI2A 3WF7A 4GS6A 2YAAA 1Q97A 2FGIA 3RPYA 1ZZ2A 3JXWA 4FEQA 3GUBA 5HE2A 3FMMA 1LP4A 3FY2A 4MBIA 4L00A 4TYJA 2C3KA 5D1JA 4YO4A 1SMHA 2OK1A 2QU6A 2CMWA 3AT4A 2XRWA 3UNZA 2VWBA 3W2PA 4TL0A 5F4NA 3TACA 3QQFA 2V0DA 3C50A 3OP5A 4CXAA 5EI8A 4QYGA 4CT2A 3DU8A 3DOGA 4FEVA 3CKWA 3MIYA 5ANDA 2QOOA 4FZ7A 4FT9A 4F9BA 4ZTSA 4E4NA 3MY0A 3ZYAA 4O86A 4ZJVA 1V0BA 2G2FA 3DQXA 3H0ZA 2X39A 3R00A 2WQNA 3B2TA 4EQMA 3MFUA 3L9LA 5M4IA 2YDJA 1PRYA 3H9OA 3LCSA 2E2BA 3UG2A 3PZHA 3SGCA 4MBLA 5CEIA 2EB3A 1X8BA 3KRWA 2CN5A 3QKLA 4DEDA 3W55A 4D5KA 3W32A 4B7TA 2P4IA 3T9TA 4QRCA 4OTPA 4YO6A 5LVNA 3FYJX 4MD9E 3R7GA 5HG8A 3RPOA 4HYUA 4ITJA 1P4FA 2OH4A 2ITYA 4EC8A 5IH4A 3U6JA 1G3NA 2IZTA 5IDPA 3SC1A 4UMPA 4JX7A 2J5FA 3F3VA 3BV2A 3KXHA 3OBGA 4FSRA 3DKOA 4D1ZA 1Q8UA 2GNFA 5AUXA 5AWMA 3MPMA 3CS9A 3QTZA 4V04A 1CDKA 5DIAA 3UOLA 3VUKA 2VTRA 3KL8A 3LFSA 3LHJA 4BGQA 4D1XA 1SNUA 4MAOA 4RFYA 4CFFA 5IQHA 1M7NA 4D4RA 5KE0A 3FZPA 3DJ7A 4PX6A 3MTLA 3GCPA 3E92A 5E8WA 4U40A 5CTPA 3V5PA 4BCNA 5ANJA 2JAVA 4YLKA 1SYKA 4UV0A 5EHLA 5F20A 2GQSA 2F4JA 5AP4A 5BMSA 4GIIA 2YFXA 3PZEA 4Q2AA 3OOGA 4UMTA 4ZXTA 3MY1A 3K54A 4H3QA 4TWCA 1MRUA 3AQVA 4OTRA 2G1TA 4RX8A 3V5WA 3WBLA 5C1QB 3WE4A 3UBDA 1H08A 3VWAA 3R2BA 3TUCA 1RJBA 4P7EA 3BZ3A 3R0TA 3ZONA 5IH5A 5EW3A 4P90A 3OXIA 4I5CA 1KE8A 3R7IA 3SDJA 4C33A 4QQJA 4RIYA 5BUEA 4M67A 5GZ8A 2G01A 2JIVA 4GK3A 3V51A 2X4ZA 3TNHA 3UIXA 3JUHA 4BCKA 4O6EA 2WMVA 3RGFA 3NX8A 1NT2A 3I1AA 5KMIA 4TWOA 4BI0A 4LFIA 4XS2A 2C0TA 4FKGA 5EYDA 4E7WA 1GZOA 4FE2A 1BL7A 1OMWA 3BU6A 2J0MB 4S34A 3ZDIA 1TQPA 3COKA 3REPA 3THBA 1R78A 1H07A 3R28A 4FK3A 2ZV8A 2WQMA 5A4LA 4AACA 4I4FA 4KBKA 4RQKA 1O9UA 3FLZA 1WVWA 2XH5A 3PFQA 2DYLA 1OM1A 3FYKX 4UEUA 4C35A 2BVAA 4F4PA 3GFWA 1R0EA 4LI5A 3OHTA 3RAKA 5CENA 4FUXA 5CF4A 3QGWA 4YNOA 3S00A 4A9UA 3ODZX 3DB8A 5C8NA 5D41A 2UW6A 3TZ7A 4P5QA 4CYJA 4RGJA 4XLVA 3I7BA 3VHEA 3KXNA 1YHSA 2GNIA 3P7CA 4ZSGA 3BV3A 3HRFA 3C4WA 4LOPA 3UO4A 3ORTA 3W16A 4IAFA 3OBJA 5L6WL 2GMXA 2VN9A 2QVSE 3N4UA 4EH3A 2SRCA 1FMOE 4EL9A 3DT1A 2GFSA 5TT7A 3HMNA 4RVTA 5CY3A 1OL1A 4QTDA 4XBUA 2OSCA 2BAJA 4RIWA 3DNDA 2YCQA 3HL7A 3TV7A 2YM8A 4DGOA 5DEWA 4FT0A 5LJJA 3NUYA 2YACA 3PJCA 5H8EA 3CXWA 3GOPA 3NW7A 4HGLA 3WYYA 4DT9A 3VN9A 2RFNA 4RWLA 3BLQA 3LM5A 3ZRKA 3CY3A 4GVAA 5E1SA 1OIYA 1UU7A 5AR4A 4KA3A 4U3YA 5GJFA 3R9NA 3AT2A 3C4CA 3H0YA 3COMA 3OOMA 3FZRA 4FL2A 4K1BA 4ZSEA 3UP7A 5BX0A 1G8AA 1A06A 1JAMA 2WOUA 2XYNA 3R1SA 5FXRA 4FC0A 3AXWA 1UWJA 3CQEA 2GHMA 4H05A 1E1VA 4MNEB 2HZ4A 1B39A 4JG7A 4ASEA 2W1GA 3E87A 4GU6A 5BYZA 3OEFX 1WZYA 1M2PA 1W82A 2IVTA 1YOMA 3DLZA 3EHAA 1YDTE 2VTNA 4LRJA 1BUHA 4BHZA 3TUBA 2H6DA 3LJ0A 3BE9A 1YRPA 3MTFA 4N4SA 4PRJA 4WIHA 4DFZE 3UO6A 5J9ZA 1GJOA 1T46A 3BYOA 4FUYA 5CVFA 3U87A 1M2RA 3GXLA 4O2PA 2CN8A 4WG4A 5FM2A 3WF9A 2W5HA 4E20A 4K77A 3SOAA 2BHEA 1K2PA 2IJMA 3TCPA 3Q4CA 3AC8A 4F1OA 4BI2A 4KABA 4IZ5A 1H4LA 1PXJA 3QLFA 1OPKA 3ZBFA 5K9IA 2OICA 3E8EA 1U54B 2WMWA 4QMYA 2IVVA 2PZPA 4IZYA 3KRLA 4LGGA 3FDNA 4FTQA 5IDNA 3KCKA 1CKJA 5CSWA 5CU2A 1APME 4ID7A 4EUTA 2ZDTA 3LIJA 4F0GA 5KKRC 4RC3A 5GJGA 5IA1A 3NS9A 3UOKA 1F5QA 2PVNA 5GNKA 1XBBA 3D14A 4QMPA 2XNMA 3N9XA 3QHRA 4RIXB 3UMXA 3ZSIA 2W0JA 3DZQA 4QQTA 3CD3A 2HENA 2GTNA 3NW5A 4I5MA 5D9HA 5IA2A 2P2IA 4R1VA 3ID6C 1KOAA 4I1ZA 1PKDA 5JQ5A 2X1NA 2Q0NA 4NIFB 4O96A 2PPQA 4HVIA 4JLCA 3NNXA 4XP0A 1YHVA 4I5PA 4B4LA 1CKIA 4FG9A 4QMQA 3A7GA 3NYOA 5ETIA 3C0GA 5BVFA 3FQEA 5CEOA 3VBYA 3SG9A 5DR9A 3DB6A 2CNQA 2WTDA 2IW9A 4JG6A 3DK3A 1XH9A 3Q4TA 4EKKA 4Q9SA 3R7VA 3NIEA 4C59A 3NUPA 3C4FA 2V5QA 4DEIA 4G5JA 2WQEA 4QT1A 2CKQA 1KV2A 2PVRA 1J7LA 3CQWA 3FXXA 4OLIA 4QP2A 4O0SA 2HZ0A 2Z7LA 3W2QA 4AGCA 3DKGA 4OBQA 1PYXA 1XBCA 3W8LA 3D9VA 4G3EA 3E63A 4LGDA 5CASA 4CGAA 2WD1A 3ZMMA 5F1ZA 3MJ2A 3WZJA 3BCEA 2EXMA 4PQNA 4BDFA 2UZTA 5EI2A 4QYEA 3UGCA 4CCBA 5GIPE 2YERA 3D5WA 4CRLA 3IGOA 3FLYA 1W84A 5A6OA 3RNYA 3VIDA 4DFUA 3DBDA 3C9WA 4JXFA 2W99B 2WIHA 3A7JA 5B2MA 1PW2A 2UW3A 1UKIA 4XLIA 3ZO3A 5FQDC 3SLSA 2GNHA 2A2AA 4N0SA 1ZYDA 4RPVA 5HU9A 3E88A 4ZLOA 2XEZA 5ICPA 1NW1A 4DT8A 2KULA 4YZMA 3BGZA 3E8NA 3FBVA 4R1YA 4ANNA 3I0QA 2OI4X 2B9FA 3RNIA 2HCKA 4F9AA 4PMTA 5HVKA 1DM2A 3ETAA 4FSZA 4I6QA 4FZAB 4C34A 3ZOSA 2FYSA 5I9WA 5KO1A 1GIJA 2O65A 3QRTA 3QCXA 4AW5A 5FBNC 5HBEA 3D5XA 2C5NA 3Q9ZA 4P4CA 1H27A 4M66A 4EK6A 2PYWA 3PJ8A 3V5JA 3A7IA 4L7SA 4AZTA 4CV9A 4D2TA 3PWDA 1Q8WA 3MVJA 3PLAE 3SA0A 4R5SA 3SHEA 2UZEA 1LEZA 2PZRA 4ZSLA 4A7CA 2OJ9A 5KMOA 4E6QA 5EQEA 2BTSA 3KXMA 3FAAA 3PPJA 5F9EA 3PY1A 4TY1A 4DHFA 1M14A 3OTVA 4CQGA 3WYXA 3T3VA 3H9RA 4AFEA 3EWHA 4MVFA 4RVKA 3QYZA 3EL8A 4FIJA 4YZBA 2R7BA 3GT8A 4YJRA 2ZM4A 4LV8A 5H3QA 3MW1A 5HCYA 4CMTA 5LWMA 2V55A 5J9LA 4JJRA 2C6TA 3R1QA 3MA3A 4GK4A 4QO9A 4DH7A 3ZFXA 4G5PA 3EQDA 4AA5A 5HGIA 1ATPE 5H2UA 3FEGA 5EOBA 3PE2A 1JNKA 4AQCA 5C26A 1Q3WA 4IVBA 3WZKA 4L42A 5DR6A 5HKMA 3ORIA 1H1QA 1IA8A 2Z2WA 2ZOQA 4MTAA 4AAAA 5LWNA 4DC2A 3HUBA 4Y85A 3MY5A 3ORXA 5ETCA 3KRJA 3VRZA 4BRXA 4XG4A 3KN5A 2UW7A 4MNFA 3OCBA 4YJQA 3RP9A 3LMIA 2R3IA 4PF4A 3FKLA 3QZGA 4FTKA 3OVVA 3FE3A 3VS6A 2R4BA 2XEYA 2ZYBA 4M0ZA 3FXZA 2AC3A 4ONAA 2GHGA 5IF1A 3FMDA 2VTPA 4KAOA 4Z9LA 5EKNA 3CE3A 3JYAA 2BCJA 3RKBA 4WBOA 4TYHB 2ONLA 3PY0A 1F0QA 2C1BA 2RKUA 5DH3A 4FVQA 4FX3A 4X7QA 2RGPA 1QPEA 5AP6A 1BKXA 3UODA 4O0YA 2GTMA 4G17A 5ANGA 3A8WA 1CMKE 4DE4A 5AM6A 4BI1A 1YKRA 3MVMA 5HO8A 4QNYA 3R9OA 5IQIA 4ACCA 4LRMA 1MQBA 4WUNA 5A3XA 4FT5A 5JFVA 3EN5A 4BR3A 4CV8A 2Z8CA 5FG8A 4DTKA 5ETFA 5M09A 2W7XA 2XB7A 4L52A 1GIHA 3QX2A 4XMOA 4MYGA 3ZLSA 4O81A 1PMNA 3RPVA 3NMUF 3IQ7A 2JIUA 4NKSA 4RJ7A 2CNUA 2O8YA 4UXLA 1E1XA 3FZ1A 2NPQA 3LCTA 3LJ1A 4X3JA 3WF5A 4EHVA 3C4ZA 3LM0A 2YIWA 4UALA 4JDIA 3VJOA 3TEIA 4DGLC 4GKIA 1UV5A 3VC4A 5AFVA 5EKOA 5L2TA 1KE6A 4UZHA 2ITPA 3BLRA 1FPUA 3CJGA 1RE8A 3VF9A 4USDA 4USEA 4ASDA 2ITTA 2C6KA 4FNWA 2QOLA 4CVAA 3D0EA 4BIDA 4NCTA 3F5XA 4U44A 3O2MA 4DFNA 1Z5MA 2J5EA 3F5UA 5M56A 3SRVB 4BCGA 3C1XA 3EN6A 2P0CA 3RM7A 4F6SA 4MNEA 1JVPP 4R8QA 4DTAA 2X6DA 5TO8A 2PE1A 4MD7E 2GNJA 4FTMA 5BMMA 3DXPA 3RK9A 1TVOA 4G3DA 4KB8A 1ZY5A 4YR8A 2ITUA 1A9UA 4ZTHA 4TNBA 2XNNA 4EOIA 4QOXA 2OWBA 3MV5A 4CKIA 4BCPA 4RX5A 2PMNX 2VNWA 4GVJA 3ENHA 3HV4A 4YURA 4JBOA 2PWLA 4ENYA 2ZB0A 3PXRA 2PE2A 5FEEA 4AGWA 3K3IA 3KF7A 3UC4A 2H9VA 3WE8A 3VS3A 1JKKA 4RVLA 1KUTA 3AG9A 1ERKA 1NVSA 2DS1A 5I9XA 1U54A 4IM0A 3E64A 5C27A 2WTWA 5GJDA 2WTVA 3O7LD 3EQCA 4I6FA 3S3IA 3KXXA 3VS2A 4AOJA 3EFLA 4H39A 2C6DA 2A19B 3VBTA 4HCTA 3VS7A 4FTTA 1MQ4A 5A6NA 3P78A 3ET7A 4FL1A 4LMNA 2VTMA 4IMYA 4PDOA 3A2CA 4RIXA 3CBLA 2BMCA 2UW0A 3IONA 1J3HA 3LFEA 2FUMA 4ANSA 5E8SA 3C0HA 3VUHA 4BDJA 4E4XA 5AR2A 4ZP5A 4F0FA 1XR1A 3D2KA 3MWUA 2R3JA 5HCZA 3W1FA 4DG3E 2WMXA 4NIFA 4TYEA 4FG8A 4MCVA 3LW0A 2R3RA 3Q5ZA 4FV2A 3R7UA 4CG8A 4OTDA 3FL4A 3QQKA 4QP1A 1REKA 3LXLA 3PP1A 4C37A 5HIEA 3FMKA 1UNHA 2OFUA 2VTAA 3UYTA 5DR2A 5DWRA 3HAMA 4EH8A 2BZHB 4TXCA 3LXKA 3OUNB 2ONLC 2X2MA 5EHOA 2CGUA 3Q9WA 5HE3A 3VS5A 3II5A 2WMTA 2GFCA 1YXXA 4M8TA 5ACBC 3TL8A 3QD0A 5CX9A 4XX9A 3GU4A 4OAVB 3DAEA 1YDSE 4H36A 4DITA 4DH1A 4E5WA 3OC1A 3EH9A 2ZM1A 3UOJA 1R1WA 2X0GA 3E7OA 4FYOA 3BHTA 3MPTA 3I6UA 4G6LA 3Q04A 3L8XA 5IQGA 3WOWA 4HPUE 4XG7A 3LVPA 3RVGA 4KUJA 3CCNA 4YU2A 5HG7A 3GU6A 3GVUA 5L4QA 3W2RA 3G6HA 2HZIA 2JAMA 3FSFA 2VTOA 3ROCA 1JKSA 4TKSA 4D4VA 5K5XA 2WB8A 2QQ7A 4FV5A 4BIBA 3VW6A 2WTKB 2W5BA 1W8CA 2O0UA 4CZYB 1YDRE 5E8XA 3PY3A 4EKLA 3DKFA 4E6AA 4X3FC 4V05A 2VTHA 3BBTB 3QZFA 4CNHA 4MK0A 1YXTA 4EOOA 5CAOA 4YTFA 4JL9A 3F2RA 2CLXA 4FKJA 3UIMA 5A4EA 5JGBA 2R3OA 4XV1A 2VTTA 5E1EA 2J9MA 3ZFMA 4NTTA 5IQAA 2WQOA 4MEDA 3BHUA 4Y83A 1KWPA 1U59A 2CLQA 4EHEA 5IZFA 3AOXA 4O82A 3P0MA 5J8IA 5CYIA 4BGHA 1KE9A 1S9IA 4QPSA 2RIOA 1OIUA 5CU6A 2JKKA 4XJ0A 4CFXA 4APPA 4GU9A 4TT7A 2YJRA 4KRDA 5HE0A 3NNWA 2GU8A 2X4FA 2YLEA 5AR7A 4YHFA 3FHIA 2PVHA 3ENMA 4NTSA 2IG7A 2HXLA 2GQGA 3ZZWA 3GCSA 4L43A 2JLDA 2WMAA 2C68A 4I94A 4DA5A 1Q5KA 1W83A 1ZYLA 3QRJA 4RJ6A 4QQCA 4M0YA 4K8AA 5HZNA 4TWNA 4R7IA 3TZ9A 2CKEA 4EWHA 3H30A 5CEKA 3Q96A 3QX4A 4HOKA 3MI9A 2AYPA 4IW0A 4PMMA 3LFBA 3WZDA 4BDBA 3JVSA 1WBOA 2JITA 3QCSA 3RHXA 3TJCA 4C4EA 3OWKA 5CANA 4FV4A 1JQHA 4YPSA 2R3QA 1R0PA 3VULA 2PVMA 4XEYA 3W8QA 3IKAA 3HVCA 3U6IA 2VWVA 3S95A 2BRBA 3U9CA 4EH2A 5HQ0A 1OIRA 1QCFA 5CEPA 4CG9A 2GS2A 2DUVA 3EZRA 3ODYX 4IJ9A 2GS6A 3R8MA 4FTRA 4YMJA 3OWJA 3QUDA 3KEXA 4L6QA 2WKMA 4EC9A 3E62A 5I3OA 5FWKK 3V5TA 3A8XA 3KXGA 4F1MA 4IB5A 1VR2A 3MB7A 2WAJA 4EHZA 2YZLA 4BCOA 4HVSA 2WMRA 3VQUA 4EQCA 4YJSA 4NYEA 3BYMA 5AP2A 4C8BA 5IMXA 4GFMA 1SVGA 1DI8A 1UU8A 2O5KA 3FL5A 5A9UA 1FGIA 4MXAA 4UBAA 1OZ1A 2OO8X 4H1MA 2VTSA 3NCGA 4W9WA 3NAXA 5FGKA 4DFYA 2XA4A 1U5RA 5KBRA 5E91A 5HVYA 3H4JA 4L53A 4BY9E 3D5VA 4GSBA 5EYMA 2RSVA 3F3WA 3F7WA 3O23A 2ZVAA 4GIHA 3HMMA 4B0GA 4Z16A 5JGDA 1ZYCA 2V7AA 3GQLA 2UV2A 2YM7A 2P55A 3ORMA 3L8SA 4DG0E 5GINE 2R5TA 3ZO4A 1NA7A 4FIFA 3QU0A 5DRBA 5JSMA 4DAWA 3DAJA 4FEXA 2UUEA 2BFXA 2R0UA 4PDSA 4Y5QA 5AP0A 3EFJA 5AR3A 5B0XA 4NZWB 4G3FA 3L9MA 4AN3A 5DPVA 3HMPA 1V1KA 2YCRA 4M68A 2WMUA 3OCSA 3VBWA 4AUAA 2E9PA 5LVMA 2YWPA 3C7QA 1YI4A 3ZUTA 2VO6A 3KA0A 3BGQA 2A27A 3MYGA 2GDOA 3L8PA 3PYYA 5M4FA 3LFNA 3E3PA 4IADA 1Q8TA 2ZV9A 2XUUA 4P5ZA 4O7WA 2UZDA 3HX4A 2GS7A 4PL5A 3L9NA 5CS6A 4LMUA 3HDMA 4QMLA 2OZAB 4CQEA 3G0EA 2RF9A 2ZJWA 5EYKA 4G1WA 2BUJA 4I0SA 4J71A 4WG5A 1JWHA 4FT7A 5EW8A 1JPAA 2BILB 5C8KA 4CZUA 3RAHA 3UJGA 4WNPA 3CR0A 3SRVA 1W0XC 3FZSA 3QALE 4DGMA 4A9TA 1DAYA 1CSNA 4QMOA 4O7SA 5BVEA 4O2ZA 3LFQA 1WBSA 5JKGA 3C4EA 1GIIA 5IU2A 2YM6A 2XNOA 3K5VA 2RFEA 3PA4A 3KQ7A 4BVUA 4PY1A 4H1JA 4IWDA 5K0KA 4AN9A 5HTCA 4OTGA 2J90A 4BTFA 2REIA 5M44A 4CSVA 1ZWSA 5J87A 2R3MA 3GU7A 5CXZA 4J98A 2VWZA 2DQ7X 2PVYA 5J95A 2NO3A 4YC3A 4C4JA 4X2GA 2ZAZA 3TNQB 4F08A 3IOPA 3EN9A 4GKHA 3LFDA 3UNJA 4RJ5A 3TIYA 3NVKI 2ETRA 1QPDA 4JDHA 2XK3A 5T3QA 1GOLA 3QQHA 5DVRA 2X2KA 5G6VA 3TIZA 3ZDUA 1YOLA 5HICA 5JQ8A 4RJ3A 2QOHA 4EORA 5JFWA 4NM5A 4MHAA 5LMKA 4D5HA 3TV4A 2ITZA 2XRUA 3FUPA 3OMVA 3ACKA 4H3PA 5JH6A 2NP8A 4FODA 2XNPA 4O7TA 2R7IA 2R3HA 3ZLYA 2OF4A 3HZTA 4PTCA 5G1XA 5I5ZA 3ULZA 4DEAA 4ERWA 4YBJA 2Z7SA 3UC3A 3R9RA 3F82A 2PVLA 1PYEA 4QYFA 4FOBA 5DHJA 5EFQA 4C62A 2WIPA 2J4ZA 4CZTA 3QXOA 3V8SA 3MH3A 4XV9A 5HE1A 1P14A 4CLJA 3HP2A 4EK3A 4L3LA 3PSBA 4ZJIA 1V0OA 2QI8A 2EB2A 4L67A 5DA3A 4DH3A 2XK7A 3G51A 3HRBA 3AMBA 3BLHA 2X8DA 4M12A 4DYMA 2GSFA 3QQUA 4FNZA 4IB3A 3NUSA 5LXMA 1SM2A 3IW4A 1PF8A 4K0YA 3UPZA 5KMNA 3A7FA 3MVHA 5HLPA 3O7LB 5AADA 3O50A 2UZWE 5CU0A 3G15A 4O7VA 2BROA 2QONA 5IA4A 3UNKA 2JEDA 4PTGA 4RX7A 3BYSA 3FQSA 4ZTLA 4BCJA 2YAKA 4ENXA 5L6OA 1MP8A 3OW3A 4PMPA 2FSMX 4Q5HA 3ZO2A 1B38A 2PMOX 2NRYA 3PVWA 4MWIA 4BL1A 3MDYA 2QURA 1J1BA 2VWXA 1PHKA 4XUFA 5HI2A 1SZMA 3PVBA 2Y4PA 2E9OA 3HV7A 2J0JA 4XRLA 4A9SA 3A4OX 2UZOA 3FLNC 3QTIA 5JRQA 4IC7A 3NW6A 4M7IA 4QP9A 2W96B 3E5AA 3Q9XA 3IDBA 4R3RA 3VBXA 3PA3A 4CRSA 1WBPA 2C0OA 3DJ5A 4GCJA 4M14A 2XK8A 4KINA 3RPRA 5IA0A 2ERKA 3DFCB 2BDJA 2PHKA 2YLFA 2VNYA 3KKVA 3P1AA 4CD0A 5AUUA 5FP5A 1ZXEA 5HLWA 3TN8A 3SQQA 3VS0A 3ZRLA 1KE7A 4IDTA 4KBAA 4HVDA 5HNIX 1A48A 1OL5A 5DBXA 3U55A 3FC2A 2QODA 2PU8A 3OWPA 3UE4A 5HTBA 1BL6A 3W2OA 2W1IA 4DEGA 4FGRA 4FKUA 1Q61A 1H25A 3QTUA 4W4YA 5D11A 5BVOA 4N70A 3KB7A 3ZM4A 4RQVA 2XJ0A 4FIGA 3EKKA 3ZRMA 3ZCLA 4EEVA 2WQBA 4RWKA 5EM7A 2QOCA 2PSQA 2QOBA 3FC1X 3LCDA 2BZKB 1URWA 3QA8A 1OKZA 3GENA 4DGGA 4I22A 4O83A 1WVYA 1YOJA 3DXNA 4FSWA 4EUUA 4IB0A 4O84A 3FPMA 4IANA 3UQGA 3U9NA 4EI4A 1R3CA 3EYGA 5B2LA 5BPYA 4TNDA 5CWZA 4F63A 2XF0A 2WELA 4GFOA 5A4CA 2PL0A 3UG1A 4ZJJA 1OGUA 4QTCA 4PPAA 3VO3A 5IQDA 2F57A 2VU3A 3GCVA 3L8VA 4QD6A 2Y0AA 3IGGA 5EK7A 5AAFA 4G2FA 2QG7A 4EOQA 2OW3A 4IX5A 1H26A 3PG3A 2OXYA 2B4SB 4J97A 4MXOA 5AX3A 4C3FA 3ANRA 4FKRA 4BICA 4RA4A 2F7XE 1Q24A 4M84A 4WNMA 5ANKA 3ZSGA 4QP4A 2GPHA 4NM3A 5E8UA 5AIRA 4I21A 4O0TA 1PKGA 3I0OA 3OTUA 5FRIA 4R6VA 1QL6A 3N4VA 3FWQA 3PPZA 2HW7A 1I44A 2BIKB 4YZNA 3WF8A 2BRMA 2OKRA 4D4SA 3A7HA 1M17A 4FIEA 4HCVA 4C02A 2VX1A 4DINA 2F7ZE 3GCUA 4J95A 1YWNA 2XK4A 1NVQA 2XJ1A 3CGFA 4XP2A 3UQCA 4ALUA 1OUYA 3QC4A 4LUDA 4Y73A 4S33A 5FTGA 4TWPA 5CNOA 2X7OA 4E4LA 3FLWA 3OW4A 4LUEA 4U6RA 2LAVA 4IE9A 4BYJA 3ZXTA 2YM4A 3PVGA 4WUAA 3RI1A 4EH4A 1VJYA 2FO0A 3K5UA 4O7RA 3W10A 2PZYA 2BFYA 2XJ2A 4C38A 3NYVA 5TR6A 3RWQA 4S2ZA 4L9IA 3NEWA 3ZC6A 4L46A 3PWYA 1U5QA 1Y8GA 3I4BA 2QNJA 5BYYA 3HYHA 1FGKA 3O17A 3TT0A 2WEVA 1ZARA 4AP7A 2WTIA 3I7CA 3LE6A 2IZRA 3UO5A 3V01A 4IAAA 3HP5A 2IVUA 1Z57A 2RG5A 3V5LA 2E9NA 3Q5IA 4YGAA 5E4HA 1KV1A 3F2AA 5ANEA 4Z55A 3DY7A 4O0UA 3HDNA 1ZMWA 4LGHA 4Z7HA 4D2VA 3ORZA 4DCEA 3FXWA 3RZFA 1BYGA 3EN4A 1YI6A 3CPCA 5L8LA 3TDVA 3NR9A 3JS2A 2YIYA 2I1MA 4IXPA 4U79A 5TE0A 2W1DA 2CKPA 3ELJA 4QYHA 1OITA 3ORKA 4XOYA 4FKTA 4F09A 4OTWA 4XBRA 4KBCA 2UW8A 4FGBA 2IZSA 2J51A 4MXXA 4UXQA 3BIZA 3ATTA 3QRIA 5I9UA 3NLBA 1J1CA 4DEEA 3E93A 4QPAA 4HZRA 3ZSHA 4J1RA 3PXFA 4FK6A 4HCUA 3S2PA 3DLSA 4CEGA 4IAIA 5AP3A 1JSUA 3QA0A 3RPSA 1YI3A 3R01A 1MRVA 2J0LA 5EDQA 4EWQA 4OT6A 5HU3A 3DXQA 5CAPA 5IQEA 4A07A 4TYGA 5IUGA 5C8MA 1P4OA 5EG3A 3BQRA 4R5YA 3JY9A 4FKPA 3RINA 4FICA 3FI4A 4MWHA 4FA2A 2C6OA 5M57A 4ACDA 4ZSJA 4UMQA 3W18A 3D94A 5H8BA 1REJA 2YDKA 2O2UA 3KULB 2W17A 3NWWA 4KIPA 4X2KA 4FKQA 4ZK5A 3QD3A 3HMOA 4PDYA 3OZ6A 2E9UA 4WOVA 3FI8A 4J8NA 3ZXZA 3C5IA 3DBCA 4PTEA 3FJQE 3RM6A 4GEOA 3CPBA 5C4LA 2X2LA 4FTLA 1GNGA 4LM5A 5CSXA 4NT4A 4YHTA 3D5UA 1AGWA 1J7UA 2QO2A 2YN8A 3ALOA 1PXMA 2BAKA 4EH7A 2XK6A 2BKZA 4FTNA 3AC4A 3Q53A 3HA6A 3PPKA 1NXKA 3SAYA 2WTJA 2E9VA 3CEKA 4G3CA 3U4UA 3Q4ZA 2OIDA 3IO7A 2G2HA 4JIAA 3KMMA 1ZLTA 2I6LA 1ZMVA 3UOHA 4BC6A 4M69B 5ITAA 2WXVA 4BKYA 4UYNA 5J1VA 2UVZA 2FA2A 1JSVA 3GC8A 3COHA 2ETKA 2X9FA 2BALA 3NCZA 5KMLA 4R78A 2BZJA 2J50A 5HESA 4EBWA 1JKLA 2Y4IC 5AEPA 2ZMCA 3UMWA 2OFVA 3MVLA 5A46A 1WAKA 3TUDA 3R30A 4BFMA 2OG8A 3OROA 3F3TA 4O38A 5FDXA 3LCKA 4FTAA 3MBLA 2BPMA 2C0IA 1JBPE 4NW5A 3R2YA 3RK5A 1U4DA 3TM0A 1VZOA 2ERZE 2W4JA 3R73A 4O0VA 4M15A 1YWRA 4OW8A 2GQRA 3MH0A 2Z60A 1ZY4A 4ZY5A 2VWYA 4U0IA 2CDZA 4II5A 4K33A 1OBDA 4W4WA 4LV5A 2QCSA 3BEAA 4NU1A 2P2HA 1UVRA 3RALA 4CTBA 2R64A 5JGAA 4DCAA 3PIXA 4P2KA 4I93A 3NRMA 4AX8A 4OR5A 4B6LA 3F5GA 3WI6A 3O0GA 3QFVA 4XOZA 2B52A 3F66A 3PA5A 5JZNA 4ACMA 4BZOA 5AUZA 3VUDA 1H00A 3E3BX 3PXKA 4JAIA 4QP6A 4QMWA 3SX9A 2WEIA 5AJQA 3SG8A 3KVXA 4PL4A 4TZRA 3GOKA 5IQBA 4U8ZA 4ZAUA 3KRXA 4CKJA 5EYCA 3F3ZA 2OLCA 5HORA 4GRBA 2ITOA 5FEQA 2HAKA 5IKWA 3IDPA 2JKMA 4J7BA 4BDHA 4C58A 2F2CB 2ZV2A 1ND4A 3R02A 3MPAA 3VJNA 2W1HA 4R7HA 5ETAA 4D0XA 3EZVA 5KHWA 1UKHA 1L8TA 5CZIA 5BVKA 2W05A 3CGOA 1J91A 2F49A 2OF2A 3QYWA 3KGAA 3ZTXA 4O1OA 2ZMDA 3U54A 5LMAA 2OGVA 3BQCA 4O0XA 1LUFA 2IW8A 4LYNA 3BPRA 3D83A 1UWHA 5FD2A 4B8MA 4E5AX 5CSVA 4F6UA 2C6IA 1XH7A 4U43A 2ZB1A 1OIQA 5JT2A 2WMSA 4X6QC 4BCIA 4BKZA 5M4CA 2F7EE 3CD8A 4IACA 4F6WA 5IEVA 4DLJA 1H1SA 5IPJA 4BN1A 3BWJA 2UZLA 2ACXA 2R2PA 4EOPA 2A0CX 3KREA 4FYNA 4KKEA 3EN7A 5AUWA 3GFEA 4ASXA 3JY0A 3G33A 4C4GA 4CMOA 4DTBA 3KRRA 4KKGA 3FY0A 3H3CA 3HECA 4ACHA 5IISA 3AGMA 4S32A 5F94A 4FI1A 2YIRA 3R7EA 5J5TA 3PRFA 1BI7A 4IAZA 5AUVA 5C9CA 4CT1A 2OZOA 5T6KA 3ZC5A 2GHLA 5CQWA 4E73A 4EJ7A 3R04A 4EYMA 2X7GA 3SD0A 4I4EA 4RJ8A 5FDPA 4AFJA 3KK8A 3GC7A 3NIZA 4YNEA 3VS1A 3RZBA 1PXPA 2X9EA 3QQLA 4E26A 4EH9A 4ORKA 3ZUVA 2EXCX 2V22A 1XBAA 4FSMA 4L7FA 3V6RA 4BTMA 3GQIA 3E7VA 4XP3A 4K11A 3HAVA 1XQZA 2KTYA 3G9LX 5KUPA 2IW6A 3UP2A 4I0RA 3KF4A 3UZRA 3CQUA 2VWWA 1ZRZA 1IR3A 2BIYA 3FZTA 1R39A 2YHVA 3C51A 3PXYA 3W2SA 4ALVA 2OXDA 4IB1A 3PXZA 4ANOA 2JBPA 3NPCA 3KXZA 1H24A 4ERKA 3M2WA 2QO7A 5AP1A 4R3PA
chains in the Genus database with same CATH superfamily
1E9HA 2R9SA 1FQ1B 5HG5A 3U8WA 5HIDA 2HZNA 2JDRA 4AWIA 5FTOA 4AOIA 4HW7A 5TOZA 5KKRB 1OBGA 3DTCA 3WIGA 1FBNA 4JBQA 2XM9A 4RWJA 3G0FA 3A4PA 4JX3A 4LOQA 4X21A 3Q60A 1Q99A 1ST4A 2P33A 4Y5HA 4XCUA 3MJ1A 4ZSAA 3KMUA 4KIQA 4N6ZA 4YZDA 3IG7A 1PY5A 2AC5A 4QMSA 3WZUA 4BYIA 3DV3A 4TYIA 5E8ZA 5LVOA 2UZVA 4DHZA 3PLSA 3TWJA 3MGYA 4D9TA 5J1WA 3OWLA 4QQ5A 1H0VA 3GNIB 3DPKA 2XZSA 3CIKA 3FLQA 4RFMA 4AN2A 2Z7QA 3JVRA 1FINA 2O3PA 5M07A 2C47A 3LFFA 4MD8E 3MS9A 4O7ZA 2FSOX 3O8PA 3QTRA 2WHBA 3BI6A 2O63A 4I3ZA 3R7YA 3EMGA 5HO6A 4F64A 4BDGA 3ITZA 3IW5A 4KIKB 5CF6A 4O1PA 4FSNA 4EK8A 3VF8A 4IX4A 3D7ZA 3DQWA 4RRVA 4MF0A 4TRLA 3HV5A 4FIIA 5FUTA 4NEUA 2IEWA 4BDCA 3CJFA 1XJDA 3HKOA 4Z3VA 4OAUC 4G34A 5K4JA 5JEBA 4E6DA 2NNWB 1V0PA 3LJ2A 3EFWA 4CTCA 4Z7GA 4LOOA 2GCDA 3IW8A 1OB3A 1CTPE 2XARA 4GFGA 3QTXA 4FNYA 3AMAA 3IDCA 4K6ZA 1UU9A 3QKMA 5HHWA 2J2IB 4PUZA 5F95A 4EHGA 4Y95A 2Z02A 3ALNA 3CC6A 3Q9YA 3OT3A 3BYVA 4NCTC 2W9ZB 4WRSA 4X6RA 5D10A 2YIQA 4YJOA 3F7ZA 4MBJA 2QOQA 3CLYA 1YQJA 2JKQA 3MA6A 4E93A 5IH6A 2J0IA 2JBOA 4ZOGA 4RVMA 1BMKA 1FOTA 3NUAA 3BBWA 2BKKA 3VUGA 3VUMA 4IFGA 4IM3A 4QNAA 2XKCA 4DBNA 3S4QA 1LEWA 5CU3A 4IX6A 5IEXA 2XBAA 2Y6OA 2CPKE 3E8CA 3R8UA 3BRBA 2C5OA 4JQ7A 4XG2A 4IEBA 3RCJA 4OTFA 2R3PA 4B9DA 1BI8A 2A4LA 2I0YA 4L68A 4RFZA 1ZZLA 4AXAA 2JC6A 1XHAA 3FMJA 5L3AA 4L3PA 5L2WA 5DT3A 3TJDA 3R7OA 4F9YA 3NVMB 4ASZA 4F70A 3QD2B 4BTJA 3KULA 2XIRA 4YSJA 4GW8A 5CXHA 4FTJA 4BCHA 4C36A 2JIIA 2VGPA 5I9YA 4BDIA 4RZVA 3S1HA 4G6NA 3QBNA 3UVQA 4LQMA 3I60A 2B9HA 4BF2A 4AW1A 1OKYA 2C3JA 3EL7A 3OG7A 3UZPA 5CAUA 4O6LA 2RFSA 3B8RA 2BRNA 3DJ6A 1WMKA 5I0BA 4R7BA 4CYIA 4DFBA 3UPXA 1PXNA 3NUUA 2HK5A 3TMOA 4PP7A 4YJUA 3ZO1A 3KN6A 3P5JC 2VWUA 3ZHPC 4F7LA 1HOWA 4WSQA 5HCXA 4FIHA 4WO5A 2R3KA 1Z9XA 4GL9A 4IVAA 5C4KA 2Y7JA 4G31A 5J5SA 2QD9A 4IHPA 4FKVA 4L45A 4A9RA 5IUIA 3K3JA 3MIAA 4M69A 5KNJA 3M42A 4JRNA 4QMTA 5M55A 3Q4UA 4BDKA 1Q41A 3W2CA 4RMZA 3A99A 3F61A 4JG8A 2B55A 3C0IA 5JZJA 3H9FA 1KOBA 2AUHA 5DN3A 4D28A 5JN2A 3FLSA 4B8LA 4GYIA 2OIBA 3VHKA 2JKOA 4Y46A 4TYHA 4BTKA 4HNIA 1YWVA 4O21A 4YC8A 4BDDA 4FEUA 3PFYA 4D0WA 3EJ1A 3SXFA 5HTIA 4Q5EA 3QUEA 1K9AA 2OJGA 4OBOA 2XCHA 4R77A 2XIZA 3G6GA 2I7QA 3OUKA 5CI6A 1OECA 1OVEA 3AGLA 3UVRA 4ITHA 4E3CA 4HVGA 2R0IA 4I6LA 4UX9A 5J7HA 3SVVA 5E9EA 2I0VA 4ZEGA 5CAQA 2EU9A 4EZ7A 2UW4A 3H10A 4BWKA 2H8HA 4D2SA 4J52A 4QTAA 1UA2A 1ZOHA 5L6PA 3ZEWA 5AV1A 1YXUA 1XH5A 4IC8A 1OPJA 3BHVA 4N57A 4FV7A 2IVSA 4IM2A 3PSCA 4O7LA 5CSHA 3RAIA 5DRDA 3ZEPA 3LCOA 4AT5A 3UQFA 4AZWA 4IVDA 2ZV7A 4CLIA 2BR1A 3RMFA 4A4OA 4IFCA 4UN0C 4ANLA 3CTQA 2XM8A 4ZY6A 3DKCA 1T45A 5GHVA 5AAEA 5IQFA 1M52A 3QWKA 1CKPA 4D55A 4W8DA 3MN3A 5E8TA 4FZ6A 4GUBA 1BLXA 4IAKA 5TF9A 5IA5A 4NSTA 4F7NA 4JDJA 1FVTA 4BHNA 2UVXA 1KSWA 2R3FA 4G16A 2C3LA 2CCIA 3EQIA 2C3IB 3AC1A 1GAGA 4BKJA 1Q4LA 5CT0A 2B7AA 4ARKA 4QMVA 2XYUA 3P7BA 1MRYA 2C6EA 3R22A 4ZZNA 5CEMA 3QD4A 5K0XA 4F65A 2OJFE 1B6CB 2BHHA 2PVFA 2XK9A 3OD6X 3PUPA 4KS8A 5HBHA 4BCMA 3DK6A 3MH1A 4CKRA 4EOMA 2XVDA 3QRUA 2PULA 5CAVA 1IRKA 4ZTNA 2PK9A 1SVEA 2C30A 5EW9A 4CFNA 1GY3A 3CTJA 2WZJA 4ZY4A 5HX6A 2HELA 5HOAA 4G3GA 4USFA 4NUSA 3O8TA 3NGAA 1Q3DA 4L3JA 5EDPA 3VUTA 4EZ3A 4FJVA 1WBTA 4KWPA 5L8JA 4D4YA 2UZUE 4BBFA 4KSQA 5IA3A 3V8WA 4FV8A 4AE6A 3LZBA 3WZEA 4W4XA 1LPUA 3R8PA 3ZS5A 3PP0A 3NNUA 4UMRA 3EOCA 2HOGA 3W33A 5JFSA 5IUHA 4IIRA 2Z7RA 4YJTA 4YLLA 4C4IA 4RZWA 3DNEA 3RTPA 2QHMA 1YW2A 3A61A 3FSKA 4NL0A 5IQCA 2VGOA 4NJDA 4FVRA 4FTIA 2X6EA 2VO3A 4IDVA 4UWYA 3GEQA 5DI1A 5KHXA 4FV6A 3BEGA 3C5UA 4FT3A 4KD1A 4WRGA 2C5XA 3GC9A 4QMUA 4WG3A 4X2NA 4I20A 1JKTA 2ITXA 1ZOEA 3WARA 5JMSA 2XAOA 3ZM9A 4ZMEA 5HO7A 4GK2A 4J96A 4DBXA 1UNLA 3AC2A 2UZNA 2WU6A 4LL0A 1AQ1A 4I92A 5CZHA 1OKWA 5DNRA 4ZZMA 3I81A 3FZOA 3L9PA 3QF9A 2YA9A 3ZLXA 3RAWA 5KMKA 2Y6MA 2CJMA 4XNEA 2W1FA 5HEZA 4ZTRA 4O91A 1WBWA 2PZIA 4UB7A 4KKHA 3ROYA 3T9IA 1YXSA 2C4GA 3EQBA 3NUNA 4FV3A 2UW5A 4U41A 1NY3A 3PG1A 4FL3A 3LFAA 3R8ZA 4AE9A 4C2VA 3LLTA 3DTWA 2JDOA 1PXIA 1W98A 3BGPA 4S30A 4QPMA 3DGKA 1U46A 4YP8A 5DEYA 3HGKA 2ETMA 4H3BA 3R9HA 4XRJA 5AA8A 3KFAA 1UNGA 2OIQA 4YBKA 3F69A 2YCFA 4L8MA 3KY2A 2W5AA 2IWIA 2QOKA 2EXEA 3QCQA 3LOKA 1OL6A 1PMUA 4OTQA 2PUUA 4PP9A 5EM5A 4HPTE 5B7VA 1K3AA 2CNVA 1OL7A 2CSNA 4RG0A 4KIKA 5ANIA 5H9BA 4ZMFA 3NSZA 4FOCA 1JOWB 4FV0A 4ANQA 2W4OA 5IMEA 5M4UA 2B53A 2ITNA 4ZTQA 3NFFB 3F2NA 2XKEA 3I6WA 3VBVA 2XP2A 4CMUA 3P9JA 5DYJA 2W1CA 4DEHA 1H28A 2RL5A 4I5HA 4RC4A 5DGZA 5CSPA 3V6SA 1FMKA 1HCKA 3FMNA 3A60A 1QPJA 3O71A 3QC9A 5L2SA 4U97A 4RWIA 2YM3A 4KRCA 3GGFA 1CM8A 4MXZA 1H01A 2IO6A 3TZ8A 2G15A 4QEBA 4WD5A 4BGGA 3VBQA 3EB0A 1H1RA 4IWOA 4C4FA 5CQUA 1IA9A 4X2JA 4G6OA 2PMLX 4JAJA 5HNBA 4UWBA 1KE5A 5EOLA 4IJPA 2BZIB 3P7AA 5FXQA 4EOJA 3BX5A 4NFNA 4HYHA 1G8SA 1PXKA 2FB8A 4JVGA 3MFSA 4I0TA 3IK3A 4U81A 4X3FB 2PUIA 1F3MC 3FV8A 3O51A 4AW2A 1ZYSA 2GNLA 4F0IA 1W7HA 4ANBA 1H0WA 4YPDA 2VTLA 5K4IA 5CVHA 5AP7A 1XH6A 4IBMA 2HXQA 3W0RA 4U42A 1IAHA 4S31A 3KC3A 3ZU7A 3TKIA 3M1SA 1ZMUA 1Y6BA 4MH7A 4GH2A 4O27B 4FRFA 2YISA 2PE0A 4W8EA 3SXRA 2A1AB 5BVWA 2UW9A 2R3GA 5LMBA 4F1TA 3MSSA 5ACKA 4C4HA 3V04A 4F99A 4XG3A 3W0OA 1TQMA 3GU8A 4YUQA 4RIOA 2QLQA 3RWPA 4IZ7A 4MX9A 3MESA 4K18A 4CFUA 4DEBA 4E5BA 2XKDA 4OT5A 5LMKC 1EH4A 2RFDA 4A4XA 5FLFA 3QTSA 2B0QA 3EQFA 3HLLA 4RC2A 5HIBA 5DMZA 3SW4A 4N6YA 4J8MA 2HWPA 3VUIA 2VO7A 2ZDUA 3TNIA 3SV0A 4IQ6A 3ZBXA 1Y6AA 3BHHA 3U6HA 2X81A 3Q6UA 4G9RA 4V01A 5AV0A 5AAGA 4CFMA 3DDPA 4A9YA 4Y72A 3MFRA 5AUTA 3TKUA 3LXPA 4MXCA 1PMVA 3NAYA 5E7RA 2PZ5A 4D2RA 2WMBA 1DAWA 4JS8A 5A4QA 3NYXA 2VTIA 4KSPA 1J7IA 3GBZA 3O8UA 4WKQA 5KMJA 4KS7A 4PNIA 2YEXA 4U9AA 4NJ3A 4XV2A 3GP0A 4IH8A 5K3YA 5HBJA 4EH6A 3R71A 5CALA 3TXOA 4AT4A 1QPCA 4ZS4A 1XO2B 4JI9A 2XKFA 4W4VA 5HNGA 1XKKA 4UMUA 3UDSA 5CVGA 4AOTA 4DLIA 2B1PA 3QRKA 5D7AA 5FXSA 3LQ3A 2WNTA 4YZ9A 2J7TA 4E4MA 3R9DA 2PVJA 3HEGA 2YABA 3DK7A 2YWVA 4ZTMA 4FKIA 3R6XA 3NDMA 4YLJA 3E8DA 4O0WA 5D12A 4XG9A 5I4NA 4QP8A 3UTOA 4JT3A 3BYUA 4XG6A 4AG8A 4IWPA 4BIEA 4F9CA 2YITA 1O6KA 2X8EA 2XNEA 5BVDA 4LG4A 5BV3A 1LR4A 4YZCA 3G9NA 2HIWA 4RSSA 4D58A 5A14A 3P08A 4HGSA 2PUPA 4A06A 5K5NA 1WCCA 3B8QA 1Y57A 3NUXA 4GV1A 5C03A 4QMXA 3QUPA 4IVCA 4JQEA 2ITWA 4FTOA 1Q8ZA 2QO9A 2V7OA 3QZHA 1BX6A 2QKRA 2YZAA 4BBMA 4DFLA 3I5NA 3PSDA 4NK9A 5AMNA 2IPXA 3G5DA 2RG6A 4QTEA 2WTKC 3UIUA 3KU2A 3OFMA 4C61A 3L1SA 3LFCA 4O7NA 1S9JA 1STCE 3DAKA 2OZAA 3QQGA 3TKHA 4PNKA 3G2FA 1RQQA 3NZ0A 4XV3A 4EJNA 2HY0A 2WU7A 3EYHA 3O96A 4FV9A 2VUWA 4I41A 5EM8A 3TG1A 4X2FA 4UWCA 3D7TB 2QC6A 5AR8A 4FNXA 2QHNA 2W06A 3BE2A 4D1SA 4JDKA 4PV0A 1TQIA 3PJ2A 3WILA 4E8AA 4D9UA 1YHWA 3EFKA 3R1YA 3ANQA 1XWSA 3DBEA 3FKOA 4GG7A 1M2QA 4X0MA 1GZ8A 2OBJA 2BTRA 3EQHA 4C7TA 5AV2A 4LL5A 4NH1A 3Q3BA 3VW8A 4IX3A 5CI7A 3EKNA 3EQPA 1H1PA 5I3RA 5GZ9A 5CNNA 2B9IA 2XIKA 5BUJA 3OCTA 4JQ8A 5CF5A 4OUCA 1WBNA 5J7BA 3F5PA 4CCUA 2PUNA 1OUKA 4FSYA 4NKAA 4K9YA 5FM3A 4EK4A 2BAQA 2P3GX 1FVVA 3KMWA 1VYWA 4XG8A 2XIYA 3C4XA 3GCQA 4FKLA 5HD4A 2FH9A 2VWIA 4K2RA 2VD5A 3HV6A 2VO0A 4QP7A 3AMYA 5LCJA 4XHKB 4A4LA 2OH0E 4QMNA 5FEDA 1OL2A 4O7YA 5AUYA 4FBXA 1OI9A 4FTCA 3IW7A 5FBOA 4FVPA 5B2KA 4ZIMA 4MQ2A 3ZH8A 2C6LA 4BCFA 4ZZOA 5DOSA 4V0GB 2LGCA 4AS0A 4G9CA 4TN6A 3N51A 4WA9A 2QKWB 5M08A 1TKIA 2XCKA 3W0MA 4RBLA 3QL8A 2ITVA 2IZUA 4B99A 2OXXA 1G5SA 2XNBA 5HG9A 2CHLA 3UYSA 3TNWA 1SVHA 3FMEA 3CKXA 3SW7A 3ACJA 4DF3A 2QOFA 4BZNA 1H8FA 1MUOA 1Q62A 4RA5A 3BHYA 4QP3A 4U3ZA 2X0QA 3UIBA 4I24A 2BRGA 3CTHA 3D4QA 3R8LA 4EYJA 1JLUE 3RHKA 5CEQA 5M06A 5E8VA 4AA4A 5KCVA 4WNKA 4I6BA 4FSTA 3GI3A 2F2UA 4WHZA 1RDQE 2JD5A 5BQ0A 4FZDB 5LARA 4OTHA 4J99A 4GJ3A 3AKLA 5HD7A 3OEZA 2YJSA 3OXZA 3U51A 2C5YA 1ZOGA 2ITQA 2VZ6A 3NYNA 4RLLA 3NFGB 5AIKA 2XMYA 2BDWA 1M7QA 3PIYA 4EONA 1TZDA 4WBBB 4PMSA 3TTJA 4OTIA 3Q6WA 4BCQA 3ERKA 4KIOA 3HUCA 4YC6A 4AGDA 4D2WA 3HMIA 4FR4A 4Y8DA 1Y8YA 5JRSA 3AD6A 3FMLA 3SKCA 3PTGA 2B54A 2JFMA 2YIXA 4JR7A 3K2LA 3LMHA 4ITIA 5GIOE 1L3RE 2I0HA 3LQ8A 2J6MA 4BWPA 4DH5A 4HYIA 4IAYA 4W9XA 5AX9A 5IEYA 3DBFA 3JPVA 4EZ5A 2VAGA 4HJOA 4ZLZA 4GYGA 4D2PA 4HZSA 4AF3A 4J53A 5CLPA 2CKOA 4E6CA 1GZKA 1Y91A 4RLKA 3VNTA 3CSVA 3CY2A 4AZVA 3LPBA 5JFXA 2PTKA 5CF8A 5BUIA 4H58A 4OBPA 4FEWA 4O0RA 4AZFA 3P79A 3AC3A 3D2IA 3AD4A 4WT6A 3BELA 5EI6A 3AD5A 3FPQA 3OF0A 4LRKA 5LVLA 2XBJA 3ORLA 2JFLA 3PXQA 3Q52A 4FV1A 1PXLA 1VYZA 2QU5A 4NM7A 4GT3A 4X3FA 5LQFA 3UZTA 3OCGA 2X8IA 1XH4A 1VLRA 3AT3A 1Q8YA 2JDSA 2YM5A 5KZIA 4ACGA 4BZDA 2QR8A 3RK7A 5E92A 2YDIA 3RCDA 5EQPA 3TI1A 4F9WA 4O22A 4CFVA 3N4TA 3LKMA 2JDVA 3QGYA 1XH8A 2HWOA 4EOLA 4YHJA 3BWFA 4FKOA 3RBWA 1DI9A 3M11A 4AA0A 4HVHA 4FG7A 3FHRA 5I9ZA 3ZFYA 4IZAA 3PIZA 2BDFA 5LVPA 1PJKA 3SXSA 1W2FA 3V8TA 4MQ1A 3IS5A 2VRXA 3DZOA 2OU7A 5BYLA 5L2QA 4C3RA 2CGXA 4UYAA 5LCKA 3PDTA 3OY3A 1OPLA 3TV6A 4BBEA 3TTIA 5HX8A 5J79A 2QR7A 3LMGA 4QTBA 4PPCA 4YJPA 5JK3A 3HRCA 2EUFB 1FVRA 5KZ0A 4EOKA 1IG1A 2CGWA 5A4TA 5AM7A 1RW8A 3R21A 4YJVA 4BB4A 1WVXA 2C69A 5C01A 2G9XA 1IASA 3WF6A 4HGEA 4JR3A 3TNPC 2I40A 3WIKA 5M53A 4RJ4A 4F7SA 1SNXA 4F7JA 2HW6A 3F3UA 5HLNA 2H34A 1P2AA 2FVDA 2JGZA 2W9FB 3KCFA 2X0PA 1OKVA 2WTCA 3QTWA 4GMYA 4TPTA 3F9NA 2V62A 3KK9A 3QWJA 3T3UA 4GT4A 4AT3A 5L2IA 4RIYB 1O6LA 1O6YA 5L8KA 2YCSA 3ZLWA 3VS4A 1URCA 4BDEA 3ORNA 3DBQA 3DCVA 3PRIA 4EOSA 2DWBA 2VTJA 3QKKA 2WOTA 2CCHA 5TKDA 4L44A 4MXYA 4WSYA 2IN6A 2W4KA 4DFXE 4YSMA 3D15A 5CT7A 4BJJA 2PMIA 2NRUA 4FSQA 4BWXA 4C0TA 3EIDA 4FZFB 1DS5A 4GJ2A 4EK5A 4R3CA 2WFYA 3HA8A 3VRYA 4DGNA 1YXVA 4NM0A 2VX0A 2F9GA 1AD5A 4I6HA 4AXDA 3CP9A 3QHWA 2QOIA 2R3LA 4AZEA 2Y8OA 3LXNA 2VTQA 5J9YA 4F78A 4BDAA 3GB2A 1HCLA 2Y9QA 3OXTA 3AC5A 5KX8A 5CU4A 3FI3A 1VEBA 3MFTA 3VQHA 4E1ZA 3HV3A 2O64A 4FKWA 1I09A 4RX9A 5AV4A 1P5EA 4PL3A 3P86A 3UVPA 2R3NA 3Q2JA 5DLSA 2H96A 3MB6A 3UDBA 2XS0A 5EHYA 2WMQA 3G90X 4NW6A 3TDWA 3DDQA 3AKJA 2OJJA 3A62A 2G2IA 4TTHB 3PE1A 3EQGA 3QZIA 4FMQA 1H1WA 2CGVA 1GZNA 3F6XA 4ALWA 4UY9A 5DT0A 4FSUA 3QQJA 4XYFA 2EVAA 3R8VA 5T68A 4M13A 4RIWB 3D7TA 5DG5A 5AA9A 1WBVA 3P4KA 4C3PA 2FSLX 3Q32A 3QCYA 3DS6A 4MKCA 3DFAA 2J0KA 3ULIA 3IOKA 5M51A 4YTCA 3ZUUA 3QLGA 2UZBA 2HYYA 2QLUA 2EWAA 3IPHA 4GG5A 4TW9A 3HNGA 5D7VA 2C1AA 3I79A 4YTIA 4QMMA 4HYSA 4IWQA 4NFMA 1PMEA 5BVNA 2XIXA 4JBPA 4FF8A 2HY81 4YTHA 5HVJA 4HNFA 3ZZEA 3PJ3A 5DFPA 3JR1A 2VX3A 5AP5A 3POOA 4ANMA 3KVWA 4GT5A 3C13A 3I5ZA 5KMMA 2X7FA 4L01A 3ATSA 4RT7A 3BU5A 4AZSA 3OS3A 4U7ZA 5FTQA 4NWMA 3LQ5A 2PVKA 4U5JA 5AR5A 4ZLYA 1IAJA 4U45A 5E8YA 3FQHA 1UU3A 3F88A 4JNWA 4QYYA 3TZMA 2OJIA 5AV3A 4JOAA 1JSTA 2WPAA 3P5KA 3BKBA 4FTUA 5DT4A 1YVJA 4ZS0A 4C2WA 5GZAA 3IW6A 4V0GA 3LLAA 5BNJA 5I9VA 3QTQA 3POZA 4GUEA 3V5QA 5LOHA 5EM6A 3FMHA 3PJ1A 5A54A 2B9JA 2WO6A 2I0EA 3NNVA 3COIA 3U4WA 4AU8A 3OT8A 3QAME 2C6MA 2BRHA 2VV9A 4PWNA 4Q9ZA 4MF1A 3R63A 5IG1A 3VAPA 4M97A 4XH6A 5H8GA 4APCA 3IECA 4JBVA 4QMZA 4YJNA 3ORPA 2JDTA 5DE2A 5EDRA 1PXOA 3R83A 4EBVA 3QXPA 3RJCA 4DHJA 2XNGA 3T8OA 2ZM3A 3GU5A 2WGJA 3DA6A 4I23A 3SOCA 2UVYA 4JIKA 3BU3A 3PVUA 3P23A 4UZDA 5E90A 2W1EA 3Q2MA 4WNOA 2GNGA 4DH8A 4AGUA 5ANOA 5FP6A 4EH5A 1ZYJA 2W1ZA 2ZFYA 1QMZA 4CFWA 4PPBA 4OGRA 4DN5A 3EQRA 2PY3A 2QG5A 2ESMA 4C57A 1WFCA 4HGTA 3FKNA 2Q83A 3OY1A 3B2WA 1IEPA 1ZAOA 3LAUA 3MH2A 2Y4IB 4DG2E 4JRVA 3VVHA 2FSTX 3GC0A 4EQUA 4KNBA 4FKSA 4AW0A 3V3VA 3R1NA 5EQYA 2C5VA 5EH0A 4PDPA 5KBQA 4U80A 1NVRA 2XAMA 2Q0BA 4M3QA 3FI2A 3WF7A 4GS6A 2YAAA 1Q97A 2FGIA 3RPYA 1ZZ2A 3JXWA 4FEQA 3GUBA 5HE2A 3FMMA 1LP4A 3FY2A 4MBIA 4L00A 4TYJA 2C3KA 5D1JA 4YO4A 1SMHA 2OK1A 2QU6A 2CMWA 3AT4A 2XRWA 3UNZA 2VWBA 3W2PA 4TL0A 5F4NA 3TACA 3QQFA 2V0DA 3C50A 3OP5A 4CXAA 5EI8A 4QYGA 4CT2A 3DU8A 3DOGA 4FEVA 3CKWA 3MIYA 5ANDA 2QOOA 4FZ7A 4FT9A 4F9BA 4ZTSA 4E4NA 3MY0A 3ZYAA 4O86A 4ZJVA 1V0BA 2G2FA 3DQXA 3H0ZA 2X39A 3R00A 2WQNA 3B2TA 4EQMA 3MFUA 3L9LA 5M4IA 2YDJA 1PRYA 3H9OA 3LCSA 2E2BA 3UG2A 3PZHA 3SGCA 4MBLA 5CEIA 2EB3A 1X8BA 3KRWA 2CN5A 3QKLA 4DEDA 3W55A 4D5KA 3W32A 4B7TA 2P4IA 3T9TA 4QRCA 4OTPA 4YO6A 5LVNA 3FYJX 4MD9E 3TYKA 3R7GA 5HG8A 3RPOA 4HYUA 4ITJA 1P4FA 2OH4A 2ITYA 4EC8A 5IH4A 3U6JA 1G3NA 2IZTA 3W0PA 5IDPA 3SC1A 4UMPA 4JX7A 2J5FA 3F3VA 3BV2A 3KXHA 3OBGA 4FSRA 3DKOA 4D1ZA 1Q8UA 2GNFA 5AUXA 5AWMA 3MPMA 3CS9A 3QTZA 4V04A 1CDKA 5DIAA 3UOLA 3VUKA 2VTRA 3KL8A 3LFSA 3LHJA 4BGQA 4D1XA 1SNUA 4MAOA 4RFYA 4CFFA 5IQHA 1M7NA 4D4RA 5KE0A 3FZPA 3DJ7A 4PX6A 3MTLA 3GCPA 3E92A 5E8WA 4U40A 5CTPA 3V5PA 4BCNA 5ANJA 2JAVA 4YLKA 1SYKA 4UV0A 5EHLA 5F20A 2GQSA 2F4JA 5AP4A 5BMSA 4GIIA 2YFXA 3PZEA 4Q2AA 3OOGA 4UMTA 4ZXTA 3MY1A 3K54A 4H3QA 4TWCA 1MRUA 3AQVA 4OTRA 2G1TA 4RX8A 3V5WA 3WBLA 5C1QB 3WE4A 3UBDA 1H08A 3VWAA 3R2BA 3TUCA 1RJBA 4P7EA 3BZ3A 3R0TA 3ZONA 5IH5A 5EW3A 4P90A 3OXIA 4I5CA 1KE8A 3R7IA 3SDJA 2A98A 4C33A 4QQJA 4RIYA 5BUEA 4M67A 5GZ8A 2G01A 2JIVA 4GK3A 3V51A 2X4ZA 3TNHA 3UIXA 3JUHA 4BCKA 4O6EA 2WMVA 3RGFA 3NX8A 1NT2A 3I1AA 5KMIA 4TWOA 4BI0A 4LFIA 4XS2A 2C0TA 4FKGA 5EYDA 4E7WA 1GZOA 4FE2A 1BL7A 1OMWA 3BU6A 2J0MB 4S34A 3ZDIA 1TQPA 3COKA 3REPA 3THBA 1R78A 1H07A 3R28A 4FK3A 2ZV8A 2WQMA 5A4LA 4AACA 4I4FA 4KBKA 4RQKA 1O9UA 3FLZA 1WVWA 2XH5A 3PFQA 2DYLA 1OM1A 3FYKX 4UEUA 4C35A 2BVAA 4F4PA 3GFWA 3BL7A 1R0EA 4LI5A 3OHTA 3RAKA 5CENA 4FUXA 5CF4A 3QGWA 4YNOA 3S00A 4A9UA 3ODZX 3DB8A 5C8NA 5D41A 2UW6A 3TZ7A 4P5QA 4CYJA 4RGJA 4XLVA 3I7BA 3VHEA 3KXNA 1YHSA 2GNIA 3P7CA 4ZSGA 3BV3A 3HRFA 3C4WA 4LOPA 3UO4A 3ORTA 3W16A 4IAFA 3OBJA 5L6WL 2GMXA 2VN9A 2QVSE 3N4UA 4EH3A 2SRCA 1FMOE 4EL9A 3DT1A 2GFSA 5TT7A 3HMNA 4RVTA 5CY3A 1OL1A 4QTDA 4XBUA 2OSCA 2BAJA 4RIWA 3DNDA 2YCQA 3HL7A 3TV7A 2YM8A 3W0NA 4DGOA 5DEWA 4FT0A 5LJJA 3NUYA 2YACA 3PJCA 5H8EA 3CXWA 3GOPA 3NW7A 4HGLA 3WYYA 4DT9A 3VN9A 2RFNA 4RWLA 3BLQA 3LM5A 3ZRKA 3CY3A 4GVAA 5E1SA 1OIYA 1UU7A 5AR4A 4KA3A 4U3YA 5GJFA 3R9NA 3AT2A 3C4CA 3H0YA 3COMA 3OOMA 3FZRA 4FL2A 4K1BA 4ZSEA 3UP7A 5BX0A 1G8AA 1A06A 1JAMA 2WOUA 2XYNA 3R1SA 5FXRA 4FC0A<