4PTGA

Structure of a carboxamine compound (26) (2-{2-[(cyclopropylcarbonyl)amino]pyridin-4-yl}-4-methoxypyrimidine-5-carboxamide) to gsk3b
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
347
structure length
333
Chain Sequence
KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogen synthase kinase-3 beta
publication title Discovery of new acylaminopyridines as GSK-3 inhibitors by a structure guided in-depth exploration of chemical space around a pyrrolopyridinone core.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 99
structure length 333
sequence length 347
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ptgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ptgA01
5ANJA 3SW4A 4RA4A 5E8XA 2WTWA 3GC8A 4AZTA 2XBJA 4FK6A 2ITNA 3QD4A 4YJVA 1JPAA 4FL2A 4KRCA 4LUEA 4KWPA 5BVWA 3RKBA 2XK9A 4AN9A 4D9UA 5CAOA 1BYGA 1DAWA 2HZ0A 2Z60A 2WMXA 5A4CA 3Q4UA 3H10A 3NCZA 1QPCA 3F82A 3GCUA 1H01A 5EM8A 3UC4A 3KB7A 3EYGA 4WG5A 4C3FA 4E4MA 1OL2A 1AD5A 3FL4A 5I3OA 2PHKA 3MPAA 3OFMA 3R00A 4M3QA 3WZKA 1ZMWA 2W1FA 4BICA 3KF7A 4BRXA 5JSMA 2QR8A 2ITYA 3DZQA 2RG6A 4AT4A 2UZTA 4JDHA 4YZCA 2R7BA 1J1CA 4MXAA 2BZJA 1H00A 4I22A 4TTHB 3QYZA 3A60A 3LCSA 5LMBA 4NJ3A 2J0KA 2O8YA 3FI3A 2IZSA 3R7YA 1XR1A 4MNEB 1PHKA 3CD8A 4X0MA 3TNWA 4YZ9A 5FDPA 4EH8A 3I81A 1ZARA 5A9UA 5JGDA 2WU7A 4ZXTA 2XEYA 3I6UA 4IBMA 3VF9A 2GNIA 2BROA 4U80A 4U3ZA 4FMQA 5IDPA 2QC6A 4W8DA 5BMSA 3R8ZA 4D4YA 4FI1A 3PPKA 3OBGA 2BDJA 5K4IA 5LMKA 1IA9A 3QTZA 4GFOA 1LUFA 1ZYLA 2XNGA 2YIXA 4MD8E 5DRDA 5DT4A 3R63A 4EL9A 3ULIA 4C61A 2C3LA 2VNWA 5FM3A 2JDTA 3V5QA 1U5RA 1GIIA 2QOHA 2GQRA 3N9XA 3EN4A 2XIRA 3NS9A 3R8LA 4EC8A 3E3BX 2DS1A 4ZSJA 5FTOA 4F6WA 2X39A 3KULB 3TDVA 4H1JA 3OBJA 3PWYA 2ITOA 4PPBA 4ZTSA 2OXXA 4DGNA 2A4LA 2B0QA 4FTLA 4RWIA 2WTJA 4FSRA 3DV3A 3QTRA 4YPSA 3DJ5A 2JBOA 3A62A 3ENHA 2W1IA 2XRWA 4NW5A 4WSQA 4WG4A 1A06A 3DCVA 4J1RA 5HG8A 3RI1A 3OCSA 1GZNA 3BHHA 3PJ8A 4QQCA 3HYHA 4XP3A 3IW6A 4RVMA 4XG2A 4L44A 3BYSA 5ANDA 4G3CA 1APME 3PA5A 1TQPA 2PWLA 4IJPA 5IQBA 4L8MA 3T9IA 3KFAA 3UDBA 5JEBA 1QPJA 3EN6A 4MF0A 3F3WA 3LIJA 3H3CA 5IH6A 3Q53A 4YJRA 4FTRA 3QGYA 5E4HA 2C5VA 1WBNA 3FLQA 2QI8A 4W9XA 5HG5A 3VF8A 1ZYJA 2X6EA 4AN2A 4ZLOA 2OG8A 3PE2A 3F3UA 5FD2A 4L43A 4YC8A 2XNEA 4A4LA 4MTAA 4DFXE 2ITVA 2A27A 4IFCA 3CJFA 5J79A 4JX7A 3SG9A 4TYIA 4A4OA 3CPBA 2QVSE 2XKCA 4QYFA 1TQMA 3RMFA 3RZBA 5LVOA 2I40A 3GOPA 4G5PA 2ZOQA 1XBCA 2YA9A 3WF7A 1Q24A 3L8SA 4NK9A 5F1ZA 4NM3A 4UZHA 3DT1A 3KKVA 5AP6A 4BDKA 1Z9XA 2UVXA 5K5XA 3OW3A 3NRMA 1SZMA 4OTFA 3LM0A 5G6VA 3R02A 3LFBA 2R3RA 3DNDA 4FV9A 3NZ0A 3BEAA 1DI8A 4O21A 4ALVA 4BKZA 4RIXA 4G9RA 4C8BA 1H08A 5C8NA 4HGEA 4CFNA 5LVPA 3DNEA 4LRKA 3W8LA 5J8IA 2QOKA 5IA4A 4D55A 3N4UA 3KCFA 4MAOA 3E62A 2OICA 2YCSA 4IB5A 4N6ZA 2YDIA 4BHZA 2C6OA 2H96A 4U7ZA 4G9CA 3MYGA 4H3BA 4Q2AA 5J7BA 4J8MA 3C0IA 3T9TA 1REJA 3NUPA 2GHLA 4KIQA 4RJ8A 3ZRMA 2HENA 2W5BA 3RINA 2FH9A 2PSQA 3CJGA 4TNBA 3QTQA 3WF9A 5JFSA 1GIHA 5BUIA 3C4WA 4YO4A 3DLZA 1OL6A 2YJRA 5EDPA 4ASXA 4YU2A 3C4FA 5JFXA 1M17A 2OXDA 2VTIA 2ESMA 5JRSA 4YUQA 1FVVA 4FNXA 4LV5A 4LYNA 4X7QA 1DI9A 3TNQB 2W4JA 3TZ8A 4DGOA 4RJ4A 1ZWSA 3PJ1A 3EB0A 1Q8UA 4GT3A 4BDBA 2PK9A 3DPKA 3QALE 4AF3A 1IAJA 2WTDA 2VGPA 2X9FA 1OL7A 4MBIA 2R3OA 4FIEA 4BCNA 3M2WA 4MBLA 4QMXA 3P08A 4XLVA 2ZMCA 1UV5A 2PE1A 3PVWA 2PMOX 5GZ8A 2R2PA 4ZK5A 3G90X 5E9EA 4BCPA 4F6SA 4RGJA 3RNYA 3HMIA 1XHAA 4JIAA 2JAMA 3LFAA 5EQYA 3U55A 2X1NA 4E1ZA 1J91A 1R0EA 3MBLA 5H2UA 3NUNA 5DR6A 1VJYA 4NH1A 4RIWA 4MNFA 1IG1A 4V0GB 3BX5A 4WT6A 4K33A 3RAKA 4FZAB 1U54B 1LEZA 2ZV8A 5CSWA 3AC3A 3PXYA 3U87A 3F5GA 4IACA 2VWIA 2JGZA 4QTDA 4YJSA 4F08A 4GK3A 3LZBA 3UQFA 4MXCA 4O0UA 3RK7A 3O96A 4PF4A 4B9DA 3LLAA 4U97A 1AQ1A 3I0QA 4BWXA 3R2BA 3NPCA 2YCQA 1Q8ZA 5KMOA 2F49A 3Q32A 2C6DA 5CI7A 5I3RA 2P2HA 3FI2A 3KRWA 1OB3A 2PL0A 4JR7A 5DEYA 3ZO3A 1MRVA 4D2WA 1VYWA 4PP7A 3FL5A 3GB2A 4RC3A 4WIHA 5HBHA 5EI2A 4WA9A 4I0TA 4GSBA 3MY5A 2C6LA 1URCA 2J90A 4KKEA 5HU3A 3LQ8A 4OTHA 4BFMA 4I6QA 5L4QA 3PPZA 3CTJA 3Q5ZA 4FKJA 2F9GA 3NVKI 3MIYA 3LE6A 4AN3A 1Q4LA 2WZJA 4HCVA 4C34A 3UTOA 4Y5QA 2Z7SA 2XJ1A 2H34A 5ANGA 4DE4A 4IB3A 2IW8A 4GIHA 4FNYA 2OW3A 4RWLA 2JIUA 3GU5A 3RP9A 3QYWA 4DFUA 4E73A 4F63A 2W1GA 2GQSA 2CPKE 2WAJA 1W0XC 4L7FA 4EUTA 3QTUA 3VS3A 4ACCA 4S2ZA 5FP5A 4EJNA 2Y9QA 5TR6A 2X8DA 2C5YA 5I9UA 1UNLA 4HZRA 4GW8A 5L6OA 4QMLA 5BYZA 5CEKA 4X3FA 4FEQA 5M09A 4QP8A 5E8YA 2QKWB 3P7CA 2J7TA 2JKQA 2YJSA 3LM5A 5CNNA 4BCJA 4BCFA 4P5QA 4O84A 3ZDUA 3ZHPC 4I5CA 4I94A 5J1VA 1XJDA 3V5TA 2BIKB 3FJQE 4A9RA 3PSBA 3SC1A 5AP3A 5BYYA 2X2LA 2F7XE 2HY81 4BBEA 3HV4A 3HVCA 2XKDA 3KQ7A 3MN3A 4AOJA 4K8AA 4FIJA 1TQIA 4ALWA 4C59A 4BL1A 2C5NA 4HVHA 1Q41A 5T6KA 1Q97A 4FIGA 5D1JA 4F1TA 2ITUA 2XMYA 3E3PA 3AQVA 2HZ4A 2OZAA 3M1SA 4BI0A 2P3GX 3DKGA 4R7BA 3T3VA 5J9YA 4I4EA 3RAHA 2OBJA 5IQHA 4FEVA 3PIZA 2WQNA 4HVIA 4GT4A 2IVSA 4IVDA 3DQXA 4OTQA 3SV0A 3NR9A 4XV3A 5D10A 1YHWA 3CTQA 2FSOX 4JI9A 3E92A 1CM8A 2V22A 2ZB1A 3CY3A 4RPVA 4MBJA 4AZFA 2W7XA 4QMNA 3NNWA 3S00A 2PVRA 4USDA 4ZS0A 2BALA 4OT6A 5CF5A 2WTVA 4YLJA 3A8XA 3U9NA 5LCJA 4WUNA 5F94A 1KE6A 5KZ0A 3WZEA 4CFUA 4XYFA 1PXNA 4A9SA 4ANSA 2BVAA 3VS7A 3F2NA 2ITWA 3VULA 4CV9A 4XOYA 2WMBA 3UPXA 4XP0A 2C3JA 3W2CA 4QQTA 4FL3A 3GXLA 4DGGA 1HCLA 3R7EA 3W32A 3FC1X 4IZ7A 1QL6A 2P2IA 5E1SA 3R28A 5HNGA 3SOCA 4EH5A 2UW9A 3TT0A 4BI2A 3FKNA 4R5YA 4ANBA 4D58A 3ZLWA 2YZLA 4TWPA 4EYJA 2WNTA 1PW2A 3NLBA 3WF5A 5C8KA 3F3ZA 5DHJA 5CVGA 3SQQA 4KSPA 4OGRA 3HV7A 2W1CA 1FOTA 1FQ1B 5ETAA 1FGIA 4H1MA 3OWPA 1OZ1A 4I0SA 4L53A 5TE0A 4D4RA 2CN5A 1NW1A 4CGAA 2GCDA 5D12A 3ZYAA 3QZGA 4NKSA 4MX9A 1Q3WA 2Q0NA 4K77A 3PIXA 4FTJA 2W1ZA 3KEXA 1LP4A 2XEZA 4B99A 4KBAA 2F2UA 2BRNA 2J0MB 3VHKA 1SNUA 4UN0C 5IF1A 2ZM4A 3A7JA 3OEZA 3FSFA 5CQUA 3VBVA 2FSTX 1OPJA 3VJOA 3QWKA 5B2LA 1SNXA 2GNGA 2UZWE 3ELJA 2CGVA 3LFQA 5IUIA 4I5HA 3FY0A 2ERKA 3R7IA 5ITAA 2OF4A 3EHAA 4KIKA 4YSMA 5EW8A 5BMMA 1ZMUA 3DQWA 2GS7A 4FF8A 3CP9A 1KE8A 4B7TA 3HDMA 5JFWA 1WZYA 3VVHA 5KHXA 4OBQA 3ROCA 3TM0A 3DGKA 3PJ2A 5HE3A 2V7OA 3NNXA 2IJMA 4RX8A 4DTKA 4CLJA 5M57A 1YXXA 4IVCA 4QQ5A 2ITTA 2BMCA 2DYLA 3VNTA 3RBWA 4EOSA 4FR4A 2VUWA 4R7IA 3JXWA 4Y72A 5KE0A 4BI1A 4L3JA 5I0BA 3NYVA 1BL7A 1YRPA 3DAEA 3OT8A 1A48A 3HKOA 4FBXA 4PTCA 3ENMA 4HYUA 3TZ9A 4ACDA 4B8LA 3KXHA 4FTMA 4J95A 2GHGA 2VTLA 3FZTA 4FVPA 4GJ2A 5E8ZA 2BAKA 4D1ZA 2XKEA 3VUIA 4XG4A 1Y57A 4L01A 2LGCA 4PQNA 2VTTA 5EHYA 3DKCA 2R3JA 4FTNA 5EW3A 5FBNC 2J5EA 4AE6A 4BDCA 4UV0A 4LRJA 3O2MA 3BBWA 3NX8A 4FL1A 3BU3A 5DEWA 4TL0A 2XA4A 2FSMX 2PZ5A 5EDQA 3VW8A 2BIYA 2XJ0A 4L68A 2X7OA 4O81A 2NO3A 3ATSA 5IQDA 4K18A 3DKFA 3KY2A 3G0FA 4A4XA 3EFLA 4HYIA 5AR3A 1CKPA 1OL5A 4HW7A 5FTGA 4EOJA 1PXMA 1UNGA 2BZHB 4FK3A 3G9LX 2IVTA 4RIYA 4XH6A 3TXOA 2EB3A 5LVNA 4BIDA 2ETRA 3DBEA 3T8OA 3V5PA 4JRVA 2ZM3A 3HA6A 3QUEA 4JNWA 3ZBXA 1PYEA 3LXPA 3G5DA 2WKMA 5HORA 1UU3A 2XM8A 3UVPA 3B2WA 4Q9SA 4E20A 1E1XA 4EH2A 4AT5A 3RPVA 4J71A 2UW6A 4M97A 3SXRA 4Q5HA 3TZ7A 2JKKA 3QRKA 1ZOHA 3WF8A 5EG3A 3H9FA 1SYKA 4JS8A 2ZV7A 5L8JA 3LXNA 4NYEA 4U8ZA 4X21A 2X4FA 3QLGA 1SM2A 5EQPA 2Y4IC 2R3QA 4JT3A 3UIBA 3QTXA 4BDAA 4G17A 3PJ3A 5IEXA 2ZVAA 3R8PA 3HMNA 3EIDA 4UYAA 3B8QA 4NM7A 3UOKA 3WYYA 5IA3A 5H8BA 1S9IA 4HYHA 4S33A 3W2PA 3SRVA 4G5JA 2RIOA 2WPAA 3QXOA 5CEMA 1W84A 2WTKB 3BHYA 3EZRA 4AP7A 3V6SA 3AMAA 2CGUA 3THBA 1CSNA 1H07A 3K5VA 4BF2A 2HZIA 4EI4A 2O0UA 4B6LA 3HNGA 1JSUA 4BTJA 5HNBA 3W18A 5GINE 2QOLA 2YIQA 1BLXA 4E3CA 3DTWA 3RAWA 3TG1A 5EM7A 1FINA 2UVZA 3UZRA 1MQ4A 4EKLA 5HIBA 4YHFA 4G6NA 3HX4A 4NW6A 5HOAA 2WU6A 4ZZOA 4FGRA 1UKHA 1Y8YA 4E8AA 1ZZ2A 1YXVA 3QGWA 1T46A 5TO8A 3EQBA 4EOKA 2VN9A 3GU4A 4XG3A 4MD9E 5FEDA 4ZY6A 2JD5A 4Z55A 1LR4A 4D1SA 5KMNA 3F2RA 1XKKA 5GNKA 1T45A 3E8CA 4K2RA 2PVNA 1REKA 3ZXZA 2W05A 3KRRA 2HOGA 4C3PA 4XRLA 4RJ7A 2F4JA 2FGIA 3QC9A 3SGCA 5DN3A 3LCDA 3U54A 3ZO4A 5K5NA 1YDSE 2E9NA 5CASA 4X3JA 2HWPA 4FKLA 2VWVA 4ZSLA 4UB7A 1Y91A 3Q96A 3FMMA 2QHNA 2OF2A 2W17A 2QLQA 3B8RA 4XG8A 4ERWA 2AC5A 3C4XA 3ORNA 3PXQA 3F66A 5EW9A 4IW0A 2WMSA 4Y95A 4YZMA 1UU9A 2R4BA 3BE2A 3F69A 5E7RA 5GJGA 2XVDA 3O50A 2OXYA 3R7VA 2O3PA 3JYAA 3FLNC 3RAIA 2QOOA 3NUSA 3U9CA 3JS2A 4S34A 3IPHA 3D5UA 2JFLA 2G15A 4UWCA 4C37A 3AC2A 1AGWA 1R78A 3NW7A 4QMSA 3UO6A 3HUCA 5HVKA 4L9IA 2FUMA 2PE0A 3Q2MA 1P4FA 1Y6AA 3E7VA 4BDFA 3R9RA 1ZOGA 3CCNA 3I5ZA 1YI4A 4N6YA 3DK3A 3FXWA 2PMIA 3BI6A 3FQEA 3DY7A 4OTRA 4QOXA 3OWLA 3SXSA 4EK6A 4O7WA 4YSJA 4I4FA 4UALA 4XUFA 3FMEA 1V0PA 4I6BA 4IIRA 2ITPA 3Q60A 3ZLYA 5EOLA 4GH2A 3JR1A 3GOKA 3P5KA 4M7IA 3R1SA 3ANRA 4DC2A 3U6HA 2AUHA 4P4CA 3ZTXA 5L2WA 5J95A 4EHVA 5FXRA 3O17A 2WO6A 2C1BA 3HRBA 4APPA 3MFTA 3UP2A 1WFCA 1O9UA 5DNRA 1B6CB 3OUNB 3PXKA 4UWBA 1XO2B 4X2NA 3N4VA 4O2PA 4AW5A 4HPUE 3DFCB 4B8MA 2G1TA 4F7SA 4KUJA 2CN8A 4A7CA 4D2RA 3RTPA 4I21A 2YM6A 4U0IA 1YHSA 1F5QA 2W5AA 4YZNA 4GL9A 4C57A 5AAGA 2XK7A 3H4JA 4F9WA 4CNHA 4PWNA 2OJJA 4FOBA 4AQCA 4X2KA 4AA0A 4J97A 3CXWA 4LGGA 4NFNA 4PP9A 4BGQA 4ANMA 3PG3A 2CLQA 1H1QA 3DZOA 3CR0A 3QTWA 4JBVA 2J9MA 4L3LA 3RHXA 3LMGA 2BDFA 4QMWA 3VIDA 5IQGA 4JG6A 3FV8A 3MY0A 4ZJIA 5IISA 4P7EA 4FKTA 4GJ3A 4GK4A 4P2KA 2Z2WA 5C01A 4DYMA 4UBAA 2V7AA 4LFIA 2IN6A 3AG9A 4DAWA 3C5UA 4A9UA 4EZ3A 3AXWA 4AACA 4LI5A 3R22A 5M4UA 4LL5A 4S32A 3WOWA 3R9OA 5IDNA 3MVMA 5DVRA 4DN5A 4FEWA 3KMUA 4ZJJA 2GMXA 1IEPA 3BU5A 4FYOA 4A06A 3WYXA 3KA0A 2X8IA 3LCKA 2UZEA 3GQIA 3VUDA 3EKNA 4MKCA 4BWPA 5FTQA 4DCEA 2YM7A 4FIIA 4U41A 4FZFB 3K5UA 5A6OA 3ATTA 4NL0A 3UPZA 3MPMA 2OKRA 2SRCA 3FQHA 3MFSA 4QT1A 4RG0A 1OMWA 3D83A 1UNHA 3PFQA 3R01A 5BVKA 2BKKA 4RC2A 3TJDA 4APCA 4HVSA 3RCJA 5M4FA 4CSVA 5HBEA 3O23A 5AP4A 4D2VA 5JH6A 4DFZE 3C9WA 1KSWA 5CSXA 2XNNA 1QPDA 4CV8A 4DEGA 2UUEA 1YOMA 2VO7A 4CZYB 2W0JA 4EOLA 3NYXA 4AW0A 5M51A 2VO3A 1XH7A 1JLUE 1W8CA 2XUUA 3OCGA 3OZ6A 4IWPA 4XHKB 3BWFA 4FZ6A 4NKAA 5CAPA 3G15A 2J0LA 3PTGA 2ACXA 2RGPA 3O8TA 4R6VA 4QP3A 4RSSA 3CQWA 4FV8A 2YM5A 3BHVA 5JFVA 3CTHA 5JZJA 4ACGA 2H8HA 2OSCA 3NUXA 4IFGA 4FGBA 3WIGA 5HE2A 4TT7A 4R78A 2ZV9A 3U51A 3P78A 2VX3A 3OOGA 2C6EA 2CNQA 4KIPA 5AX9A 3LPBA 3AT2A 5KMLA 4O7VA 4BGGA 2J50A 3EYHA 3HAMA 1OPKA 3CKWA 5DFPA 2XH5A 3WILA 4M0YA 2GFSA 4IVAA 3WZUA 3CBLA 1BI7A 2IZUA 1H28A 3OCTA 4DG2E 2WMTA 4GG7A 5A4EA 4EBWA 3QHWA 3LCTA 3VS5A 2XK3A 3S1HA 3SG8A 4FZ7A 2WQOA 3GCQA 4KBCA 3AMYA 3UVRA 4F70A 4I41A 4W4VA 3FLYA 4G3EA 4IAAA 4AU8A 4W8EA 3V5WA 5EKNA 3ZBFA 4I3ZA 5M07A 4N4SA 4ZIMA 2R3NA 3UIUA 5EKOA 3DOGA 3P86A 4O38A 4D0XA 4EK5A 3D15A 4OTIA 2QG7A 4ERKA 3UE4A 4EZ5A 4ASZA 4JL9A 3NYOA 4G6OA 4TYJA 2O65A 4RJ6A 2YFXA 3GCPA 5A4QA 4FG7A 4B0GA 1KE9A 5IA0A 3VUTA 3RALA 1ERKA 4CLIA 4U6RA 2YCFA 2WMUA 3A7IA 4HOKA 2C0IA 2WTKC 4RIOA 3UG1A 4O0SA 4V04A 3EQFA 3OCBA 1X8BA 4PTGA 4CMOA 2W9FB 3QCQA 5BVFA 3HRFA 5CVHA 5KNJA 3LXKA 1YW2A 4FKWA 3FLSA 3T3UA 4BKJA 1FVRA 4UYNA 5DH3A 4L00A 4F65A 2PULA 4Z9LA 1PKDA 2HIWA 1J7LA 2W96B 1OKZA 3V04A 2WTCA 5J5SA 2VO0A 3UMXA 3ITZA 5A14A 3LFSA 4AFJA 3F5XA 3BRBA 3AT4A 3D2IA 5DPVA 3NIZA 4PMPA 3PIYA 4MEDA 5JQ8A 4M84A 4BTKA 3C0GA 3F6XA 4E6AA 1WMKA 3TUBA 2OU7A 1H1PA 1NA7A 2VO6A 2RF9A 2R3MA 5CALA 3L8XA 2OZOA 5IQCA 3OXTA 5LXMA 4DA5A 1NVQA 2W4OA 2VRXA 3PRFA 2XJ2A 4FKPA 2HAKA 4A07A 4DT8A 1ZMVA 4JDKA 2OWBA 4F64A 5CI6A 3BPRA 4TW9A 4IX4A 3UIMA 4N57A 3PSDA 2BRBA 3ZSGA 5AP1A 3FZ1A 2E9OA 3HLLA 2QCSA 3FQSA 4A9TA 4IVBA 4QP4A 5KHWA 4C4EA 3UOJA 4I5MA 3HRCA 2QOIA 1R3CA 1OIUA 2E9PA 3R1YA 2VWBA 3H0YA 4BTMA 4X2FA 2FSLX 5EDRA 1BL6A 5CT7A 3E8DA 3C50A 2B53A 3G9NA 4RMZA 1ZAOA 3IG7A 1YHVA 3ZDIA 3EQHA 1GY3A 2JEDA 2GDOA 5E92A 3R0TA 3UYSA 4YZBA 2ETMA 5L8KA 1MRYA 2BHHA 4YC3A 3ZO1A 5HE0A 5FP6A 1H27A 5CF6A 1CTPE 3F9NA 4XV9A 4KD1A 3QWJA 4OTPA 3LQ3A 4O1OA 4UMUA 3NAYA 4YBKA 3R9DA 5KCVA 2IW9A 3SW7A 4EQUA 4CZUA 5CAVA 5H9BA 5ANEA 2GNJA 2J4ZA 3ZUVA 4TYHA 3RPSA 5AV3A 3TI1A 5HZNA 4E6DA 2XNOA 3DB8A 4DGMA 1UU8A 5DYJA 2PVMA 2WELA 3L9NA 1JSVA 3WE4A 3ZLXA 3KXZA 2YIYA 2BRGA 2C6MA 4BIEA 2XNBA 3ORKA 1JQHA 3KMMA 3VBYA 2PZYA 4Z3VA 3P9JA 4QMTA 4JG7A 4IZYA 5M08A 3FE3A 1FPUA 3OC1A 4JR3A 1YDRE 3LHJA 5BVNA 1XH8A 4WRGA 3DAKA 4BCHA 4TPTA 2JKMA 3MV5A 4QO9A 4ZP5A 4KAOA 4M66A 2JLDA 2BRHA 5ETIA 5LVLA 3W2QA 3ZMMA 4KINA 4AWIA 2IVVA 1UWHA 5CZHA 2QU5A 4NU1A 4G2FA 4Y8DA 5D7AA 1IR3A 3BGZA 5ETFA 2VWYA 1WVYA 1K2PA 1YXTA 4E26A 2WQEA 3GU7A 2CDZA 2WQMA 4H3QA 5FGKA 1YI3A 2C0OA 3S4QA 1ZY5A 3Q04A 4GEOA 4ANNA 1H24A 4JXFA 4FKRA 2ZDUA 3VJNA 3BU6A 4BCGA 4IM0A 1W83A 4WSYA 4X6RA 5EM6A 4FSWA 4DH7A 2VTQA 3NEWA 4AA4A 4EOPA 1YXUA 5CU2A 1WBPA 2HXLA 1I09A 4M68A 5EYDA 4DEBA 5ICPA 5L6PA 1XH9A 3LCOA 4IHPA 4ZSEA 3IQ7A 3Q6UA 5ANIA 5EQEA 3PDTA 4FNZA 4NEUA 3ZSHA 3R1NA 3BBTB 4BHNA 4GVAA 3SLSA 3TV6A 3UO5A 3NAXA 5EH0A 1VR2A 4PNKA 2A2AA 4FKVA 2P55A 3C5IA 2HELA 1XBAA 1WVWA 3LFDA 3RWQA 4JDJA 4H05A 4D2SA 4XV1A 3VS4A 4HGLA 3RM7A 2YAKA 1GNGA 2HK5A 3LAUA 1JSTA 3D7ZA 3F7WA 2UZOA 2KTYA 3KXXA 1IASA 2LAVA 4CXAA 4FKSA 4G16A 2A1AB 4G1WA 4ZLZA 2C69A 2XNPA 2QNJA 4ASEA 4DEAA 3M42A 3F5UA 4GYGA 2Z7QA 2GS6A 3BHTA 3GVUA 3OS3A 4EOOA 5AM7A 5H8GA 3DDPA 5EFQA 3AC5A 4YJNA 4EHZA 5L2IA 3EJ1A 2AYPA 3QRIA 5J9LA 2Y0AA 2YM8A 3IDBA 3MSSA 4IZ5A 2BTRA 4AXAA 4CYJA 4RIXB 4GU6A 5KUPA 4GKHA 2C5OA 1S9JA 2VX1A 2E9UA 3EQIA 3E8NA 3GFWA 4CYIA 2CKQA 4YNOA 4W4XA 5T3QA 3A7HA 2YISA 3RM6A 2C1AA 4GFMA 2RFDA 2H6DA 2HXQA 4KABA 4AAAA 4U44A 3OOMA 4NT4A 3QQKA 4O0XA 5EI6A 1OM1A 4FKUA 2BZIB 3EL8A 4CCUA 2B54A 4IX3A 4Y83A 4YJQA 4BWKA 4DGLC 4IM2A 4JJRA 4JAIA 4I0RA 3R71A 2PY3A 1XQZA 3QKLA 5AR4A 3DB6A 4ALUA 5A54A 3BCEA 3D7TA 4FT7A 4AOTA 4RWKA 1UA2A 5JGBA 3LJ1A 3RNIA 2GQGA 2R3IA 4FODA 2OFUA 2BUJA 5AP2A 1RQQA 4FV6A 5HD7A 3UYTA 3NDMA 4CFFA 4BCIA 3MESA 3CS9A 2BCJA 5AV4A 3UQCA 5C4LA 3V8SA 3GU6A 1QPEA 4MQ1A 3ZFMA 4HGTA 2CKEA 3Q4TA 5CEOA 4UZDA 2UZDA 3O71A 4RC4A 4C58A 3HL7A 4IWQA 4FTUA 4RQKA 5AUVA 3O0GA 2ZAZA 3CPCA 3VS1A 2WFYA 3C0HA 4U42A 4RBLA 3QQGA 4KS7A 3U4UA 4U43A 3Q9WA 4GG5A 4YBJA 1V0OA 3HP2A 4IB0A 1GAGA 3EZVA 3VUGA 3GCVA 4FV5A 3R9NA 1JNKA 5HE1A 3AC1A 5D11A 3VWAA 3N51A 4NSTA 4MQ2A 2VTJA 2XIKA 5IQEA 1PY5A 4O7NA 4AW2A 4RIWB 4WUAA 4RX5A 4W9WA 4USEA 4IEBA 4PDOA 1FGKA 4RFMA 4C7TA 4FSZA 4L42A 4NCTC 5AIRA 3BYVA 2FYSA 3LFCA 3RK9A 5JK3A 3GC0A 4BYIA 5HU9A 3PUPA 1JBPE 4MWHA 4IWOA 1DM2A 2YM4A 5E8VA 4YGAA 3BV3A 4FTTA 4QTBA 2PYWA 2B7AA 3MWUA 3MH2A 5HEZA 2C6TA 3PZEA 5HO6A 3V5LA 4DEIA 3Q2JA 3JPVA 5AR2A 5CY3A 4IMYA 4FV7A 5AUWA 1JAMA 4CTBA 5IMEA 3ZOSA 2DQ7X 3AC4A 1XWSA 3UG2A 3NWWA 5LMAA 1GZOA 1K3AA 4R3RA 4D0WA 3SOAA 2J0JA 1Q62A 3MA3A 1KV2A 3FHRA 4O1PA 4QP9A 2V62A 3A4OX 4XP2A 3U8WA 2XCKA 4JX3A 5CSHA 4MXZA 5EM5A 4X2JA 2P0CA 4WD5A 4BKYA 4ZTLA 4IQ6A 4ENYA 4JQEA 4K1BA 5HTCA 4NIFA 2HY0A 2WB8A 3II5A 4JBPA 4EBVA 4FIFA 2UVYA 4QTAA 5IQIA 3OT3A 2F2CB 4PPCA 4ZTQA 4UMPA 5DR9A 3POOA 3CGFA 5FDXA 4X3FB 4IAKA 4BB4A 5GIOE 2IG7A 2XYUA 2GPHA 4M15A 2I6LA 4ZTMA 5FEEA 5AA9A 3RK5A 4ACMA 1GJOA 3VS2A 4JRNA 4QTEA 5HTBA 4DT9A 3QUPA 3LFNA 3EH9A 2CCIA 3FC2A 4PL5A 1U5QA 5HLPA 3QD2B 3PWDA 4M67A 5CVFA 4E5WA 4JOAA 3LMHA 2XIYA 4QMOA 3GNIB 1RJBA 3IK3A 4ANQA 4W4YA 2GS2A 2VGOA 4IAYA 4NUSA 4EH9A 4L6QA 4ZLYA 1WBWA 1Q8TA 4FG9A 4XNEA 3V5JA 1OKVA 4RFZA 5GHVA 3UZPA 3UMWA 2BZKB 4D28A 3LLTA 4NM0A 3ZONA 3P4KA 4FSUA 3RJCA 4D4SA 3IW5A 3L8PA 2XS0A 1M2RA 2W06A 3TCPA 2OZAB 3FZRA 5CF8A 2AC3A 3I60A 2CGXA 2PZRA 3E87A 1Q5KA 4M13A 5BPYA 4HNIA 3HP5A 3JY0A 3MS9A 2QODA 4XMOA 1UWJA 4CG9A 2G2IA 4XS2A 3D5WA 4DHFA 1KUTA 3F3VA 3ZZWA 2FB8A 2OGVA 4R8QA 3LFFA 3DDQA 4M69A 3FKLA 4TZRA 4K11A 4FKGA 5ANKA 1EH4A 2CSNA 4PNIA 5GJFA 3RVGA 2VWXA 4O0RA 4QP2A 2OO8X 4PUZA 2CNVA 2B4SB 5FLFA 3F88A 4UWYA 5LJJA 4F4PA 4QP1A 1OGUA 5AMNA 2QKRA 4QTCA 4ASDA 4EHGA 2A19B 5BVEA 5A46A 3BLHA 3G0EA 4ITHA 4GS6A 3TN8A 3UVQA 3UJGA 4GK2A 4GV1A 2B9JA 3CIKA 5IZFA 2QOCA 4BCQA 2F57A 3A99A 4ZSGA 3CGOA 2ITXA 3G6HA 3CSVA 5A4LA 5HCYA 4FVRA 1JWHA 5JRQA 1H4LA 4CKRA 3QUDA 1STCE 2WEIA 1V1KA 5DMZA 3W10A 1O6LA 4FE2A 3PE1A 1A9UA 3SVVA 5IQFA 2W99B 5HESA 3TTIA 4GKIA 2X2MA 3F5PA 2ITQA 4DFBA 2CNUA 5TF9A 5KO1A 4QP7A 5F20A 5DT0A 3ORXA 4IC7A 3VQUA 2YN8A 3GI3A 3TJCA 4FC0A 5DLSA 5EOBA 2FA2A 2PTKA 4KIOA 2BFYA 2Y7JA 3GGFA 4KIKB 5DOSA 2RFEA 4EUUA 3EFJA 2O5KA 3R73A 1M2PA 3JUHA 3W8QA 2XNMA 4QP6A 5CEIA 3HDNA 4DFYA 2JDSA 3D14A 4U3YA 3KCKA 4KKGA 5E90A 3NNUA 4GT5A 2IZRA 3FBVA 4FTIA 4TWNA 3A2CA 2XB7A 3MDYA 2QO7A 4ITIA 4BDDA 3P0MA 2ZDTA 2XF0A 3NUAA 3QRUA 5AM6A 4ZY5A 4ZY4A 3ACKA 1VZOA 4AZEA 4TY1A 4UMQA 4ANOA 4DEHA 3OUKA 4V05A 4D4VA 4OTGA 4LGDA 4G31A 4KB8A 4BZDA 3FMDA 5C9CA 4IAZA 5AAEA 3R2YA 1SVEA 5HQ0A 2PPQA 1MQBA 1YWNA 4UY9A 2R0IA 4F0IA 3P7AA 3NIEA 4JAJA 5DIAA 3IS5A 3ALNA 3ET7A 3QQJA 3S0OA 3MPTA 4DBNA 3ZM9A 1IRKA 4QQJA 3TDWA 5D9HA 1NXKA 2YZAA 3KC3A 5CXHA 1RW8A 2B1PA 4KS8A 5L2TA 2QOQA 1ZYSA 4FSQA 1PRYA 4Z16A 3EQCA 3C51A 1OVEA 1VYZA 2I0HA 3JVRA 3OVVA 4RIYB 3R7UA 2YACA 2V55A 4FV1A 3ORTA 4ZZNA 3DU8A 3PVUA 4CT2A 4IE9A 5BUJA 1O6KA 4WNMA 3WE8A 4IJ9A 3DBDA 4GRBA 4ZTRA 4EJ7A 2X7GA 4XLIA 5EYMA 5HBJA 1JKSA 3ZZEA 4YTHA 5I9XA 2XYNA 3IW7A 4NTSA 4TKSA 4CMTA 4E93A 4AA5A 5K0XA 5AJQA 2CKPA 1OIRA 4MYGA 2C3KA 2JKOA 3KL8A 4EH3A 4FA2A 3FY2A 3RHKA 4EZ7A 4FEXA 2XBAA 4C4FA 4RJ3A 2XIXA 4AGDA 4YMJA 3VBQA 1MRUA 4D5KA 3VAPA 4D2PA 2H9VA 2PVHA 4XOZA 2R0UA 2VTPA 4ITJA 3MFUA 4ARKA 3IDCA 1OECA 1PMVA 1Z5MA 3HMMA 3PVBA 4FIHA 3SRVB 2NP8A 4KA3A 3V3VA 3EQRA 3HV5A 4G3DA 4EONA 5L2SA 2BPMA 3PP0A 5IQAA 5AR7A 2EU9A 2XZSA 5F4NA 4C33A 3JVSA 4UXQA 1H1WA 1CKIA 5DG5A 5LARA 3R8UA 4V01A 4FVQA 1WBOA 5IA5A 3BELA 3CQUA 3BEGA 4YJOA 4OBPA 4XBRA 4U9AA 5GZ9A 3UODA 3KXGA 3W16A 4OLIA 3S3IA 5FXSA 3D9VA 3PLAE 2OIBA 1JOWB 4XRJA 4HJOA 4FOCA 2YLEA 3L9LA 4YP8A 3R83A 3O8UA 4QYEA 5E8TA 3MGYA 1R0PA 4LG4A 3UNJA 1CKJA 3ACJA 3PLSA 5B0XA 3IW8A 3KMWA 4YHTA 1MP8A 3F7ZA 1FVTA 3O8PA 3ZUTA 3SKCA 5IA1A 5IH4A 1UVRA 5M44A 2R3HA 3MA6A 3DLSA 2C4GA 2PVYA 4H3PA 4MH7A 5L2QA 4AGUA 4RRVA 4FG8A 5L6WL 3LJ0A 2E2BA 2VZ6A 4CEGA 5DGZA 2BDWA 5I9ZA 4WO5A 4FICA 5EHOA 4EHEA 2CJMA 4QRCA 2PU8A 3QF9A 4X3FC 4R1YA 3AGMA 3OY3A 3DJ6A 4JQ8A 3W33A 2X6DA 4Q9ZA 3AC8A 4M8TA 3HMPA 4BN1A 3ID6C 2DUVA 3FYJX 3QD0A 3OTVA 4MCVA 2UW3A 4MHAA 4DH3A 3MJ1A 4DTAA 3EQPA 2HW6A 2OH4A 3G51A 3K3IA 4HNFA 2WMQA 4RZWA 4XBUA 3TNIA 4FUYA 4ID7A 3KXMA 3H9RA 3TNPC 4BDJA 5HX6A 4I6FA 2XP2A 2RFNA 4S31A 4MNEA 3MJ2A 4FKIA 2WMWA 2PUNA 4F99A 1YQJA 3PVGA 1JKLA 4I92A 5FXQA 2JDVA 2F7EE 3UP7A 4EEVA 4J53A 1BUHA 2UW8A 2YIRA 5DRBA 5IKWA 1V0BA 5E8SA 4HVGA 5L8LA 1E1VA 3BQCA 3VUMA 1O6YA 3UBDA 4C62A 3IGOA 2C68A 5LWNA 3NMUF 1NT2A 3V8WA 1JVPP 5HCXA 4E7WA 4LGHA 4YTIA 3SXFA 5CXZA 1GIJA 3UQGA 4D5HA 3PYYA 4YO6A 5ETCA 4L45A 3K54A 4H36A 5I9YA 2C5XA 1KWPA 2GFCA 4FX3A 3IW4A 4QNAA 1LPUA 5BX0A 3OEFX 4O96A 1UKIA 2XM9A 3Q9YA 3KULA 5KMIA 1FBNA 4O6EA 2EUFB 1ZYCA 4RVKA 1RDQE 4AG8A 4BYJA 5GZAA 4FV0A 1LEWA 2V5QA 3QCSA 1L8TA 2Z7RA 2WMAA 4GUEA 5HLWA 4BTFA 4PMMA 4YJTA 3VC4A 3MY1A 4EC9A 4JIKA 5HGIA 1MUOA 1Q8YA 2QONA 5HG7A 5A4TA 4XV2A 2NPQA 3O7LB 5JZNA 4UX9A 3Q3BA 4PV0A 5AAFA 4F1OA 4QMPA 5IUGA 2C6IA 4H39A 2OLCA 3KREA 3VW6A 4O7ZA 5T68A 4FSNA 2VTRA 4EORA 1U59A 2R3FA 2HCKA 3EFKA 3TIZA 2B9HA 4D1XA 2PMNX 4F9AA 2CHLA 4FV3A 2IPXA 5B2KA 3MH1A 3B2TA 2IO6A 2W1EA 4BDGA 4I24A 1SMHA 1PXPA 3AD5A 4S30A 3PY1A 3R21A 5J1WA 3FEGA 1CDKA 5CTPA 2ZJWA 3V01A 4C2WA 4IZAA 5C26A 3KK9A 3ORZA 1KOBA 5E8UA 2GNHA 3V51A 2CGWA 3ZRLA 1G3NA 3UNKA 3UZTA 5TT7A 2PMLX 3D5VA 5C03A 3VUKA 2WGJA 2UZVA 3FSKA 4ACHA 3D0EA 3W2RA 4JDIA 4UEUA 4DH5A 4CFWA 1YKRA 4HYSA 2A0CX 3LOKA 1PXJA 2RL5A 2VV9A 4FT9A 3EN7A 2GNFA 4RA5A 4AE9A 3OG7A 2Y6OA 5ANOA 2YITA 2X81A 3COHA 5H8EA 5A6NA 5HLNA 4O2ZA 4RVLA 4B4LA 4BBMA 1BMKA 3CD3A 3CLYA 4PPAA 2UV2A 2VAGA 2Q0BA 3D2KA 4M0ZA 3R8MA 3WF6A 3OP5A 4C36A 4F7LA 1I44A 2BTSA 2UW7A 3QU0A 4MXYA 1PMEA 4DG0E 3VBTA 5K4JA 3UOLA 3DXQA 3FHIA 5D7VA 3C13A 4Y73A 4ZTNA 4YURA 4HPTE 1PXOA 2IVUA 4LMUA 5DWRA 3TKIA 1XH5A 4IX6A 2WD1A 4MXOA 4R3PA 2WOTA 4O0WA 4J52A 5GIPE 2JDRA 2ETKA 4LV8A 3G6GA 5KBRA 3SA0A 2GU8A 1M7NA 4FSMA 3L1SA 5GJDA 5CEQA 3KRLA 3ZFXA 5I5ZA 2HYYA 5HKMA 3VQHA 1OL1A 2X8EA 3MVLA 2GTNA 2FO0A 3KU2A 4FUXA 3MTLA 3ZLSA 4ANLA 5E8WA 3OXIA 4QMQA 4BC6A 2REIA 3TZMA 1TVOA 4KSQA 1KE5A 2IZTA 4QPMA 2EWAA 5BVOA 4O7RA 5KZIA 1JKTA 3REPA 3ZXTA 1KV1A 3ZEPA 4PL3A 2HZNA 3RCDA 2PZIA 5HIEA 4N70A 3FDNA 2Y8OA 3BLQA 4E6QA 1YOJA 3E7OA 4DEDA 4GMYA 5HO8A 4NWMA 2F7ZE 3VBXA 5F9EA 3QQUA 4G3FA 4A9YA 2QURA 3EOCA 3VRYA 1Q3DA 5AIKA 3OY1A 2WIHA 2GSFA 4IXPA 4FEUA 3UOHA 4LOPA 4U40A 2YAAA 2PE2A 3OW4A 2R3PA 4IC8A 1ZZLA 4LOQA 2V0DA 4V0GA 5AV2A 5AUTA 3BV2A 4AW1A 3EL7A 1PF8A 4NJDA 2JFMA 4U79A 1U54A 2HW7A 4BDEA 4DEEA 4IDVA 3HA8A 3GENA 3SX9A 3R04A 4YZDA 2OK1A 5IMXA 1YVJA 2VWWA 3I7CA 1OBGA 2BFXA 2VWZA 5JT2A 4ORKA 4RLKA 2RSVA 1H1SA 4IDTA 2WQBA 3L8VA 4DLIA 3I4BA 5AEPA 3NNVA 3QTSA 4HCTA 5LOHA 3KRXA 5KX8A 3KVWA 4F7NA 4FYNA 4Y85A 1M7QA 3PRIA 3AOXA 4I93A 2R3GA 3G33A 3DBFA 3Q4ZA 1PKGA 3I5NA 3QRTA 4PY1A 5FWKK 3W55A 2R3KA 3E88A 3A4PA 4AGWA 3KF4A 4F6UA 4HVDA 5IEVA 5CANA 4BDIA 3R9HA 3DTCA 1G5SA 4H58A 3WZJA 2B9FA 4PDSA 2B9IA 3VHEA 3QTIA 4FT5A 4ZSAA 4FTAA 4XCUA 3VUHA 4ZEGA 1H0WA 2CLXA 3AD6A 5BQ0A 1NVSA 3NUYA 1IA8A 5AFVA 4BVUA 2ZM1A 2C30A 2PVFA 3SAYA 4PDPA 1DAYA 4L46A 4D9TA 4CFXA 5TKDA 2QOBA 2RKUA 3F61A 2EVAA 2QOFA 3TKHA 4DITA 3DS6A 1GOLA 2YDJA 3ORPA 2Z02A 2R7IA 3KN5A 4FTQA 5EK7A 1J3HA 5L3AA 4HZSA 5CU3A 4Z7HA 5HTIA 1F3MC 4MXXA 5JGAA 2NRYA 4JVGA 3K3JA 2PVKA 4RLLA 1PXLA 2JC6A 4P5ZA 3AGLA 5HNIX 3FMLA 4O0TA 5K0KA 5JQ5A 4OTWA 3ODZX 5M55A 2YERA 5CT0A 3A7FA 3IONA 5JN2A 3PA4A 1OIQA 1ZYDA 3QC4A 3NCGA 3P7BA 4FV2A 5F95A 5LWMA 4DINA 5KMMA 1OKWA 3GP0A 3SHEA 4BCOA 2BAJA 3CE3A 4TYHB 3Q9XA 1CMKE 4TNDA 4TYGA 2Y4IB 3PXZA 3TL8A 4C35A 1F0QA 4DG3E 4E5BA 5IEYA 4J98A 1XBBA 4O7YA 5AR8A 2YM3A 2YWPA 3POZA 4GCJA 2R5TA 4E5AX 4JBQA 4TRLA 1OPLA 3QQFA 4MVFA 3W2SA 4XG6A 5C4KA 2J6MA 4DBXA 4QMVA 3FZOA 3R7OA 4FZDB 4R5SA 5DBXA 4PDYA 2VNYA 5BUEA 2B55A 3KGAA 5CU6A 3WZDA 2QO2A 3ZRKA 2JBPA 4IX5A 1OBDA 3ZC6A 2JDOA 5DA3A 3C4EA 3HAVA 2IWIA 2CKOA 2VWUA 2XK4A 1TKIA 4M12A 3E93A 5CLPA 4FTOA 4QYGA 3ROYA 3DA6A 3ORIA 3DXPA 3PSCA 3DK7A 5KMKA 4EK4A 4AZVA 4E4NA 4I6HA 3COIA 2GNLA 3TTJA 3QL8A 4IANA 1H26A 3FZSA 4ZOGA 5KKRB 4AUAA 2ONLC 4O27B 1H0VA 1DS5A 3GC9A 5C1QB 3FPQA 4ZS4A 2WMVA 3OXZA 3E8EA 4E4LA 5FUTA 3I1AA 3ZCLA 3ZO2A 2J0IA 4O22A 4F09A 5C8MA 2EXMA 3NYNA 4KBKA 3RPRA 5HI2A 5CAUA 4O7SA 4WNOA 5CU4A 2QD9A 3R7GA 4MWIA 4JLCA 4O0YA 3BGPA 3TIYA 3DBCA 4R1VA 4L7SA 4ZTHA 4TN6A 3QKKA 3RZFA 3HECA 3WBLA 4WKQA 4Y5HA 3EN9A 3U4WA 2PVJA 4NZWB 4HCUA 4PMTA 4KKHA 3U6JA 3DJ7A 3PP1A 3OROA 4NFMA 4OW8A 3SDJA 2R9SA 1YWVA 5CU0A 4F7JA 5E91A 4EH6A 4EK8A 4FNWA 2I0VA 5CWZA 2I0EA 4QNYA 1J7IA 4BCMA 2E9VA 2WHBA 1KOAA 2VTAA 2XRUA 1WVXA 3AMBA 3I0OA 4AT3A 4LOOA 5CENA 3H30A 4NTTA 5AA8A 4FSTA 4DFNA 4Q5EA 4TWCA 3KRJA 1OIYA 4XEYA 1ZXEA 1FMKA 4P90A 3A61A 1WAKA 4BGHA 2Z7LA 4F0FA 1R1WA 3A7GA 2OI4X 3F3TA 2BILB 3LFEA 3ERKA 3TACA 3VBWA 3Q5IA 5CYIA 4USFA 5M06A 3EKKA 4QYHA 1NVRA 3QQHA 5TOZA 3BYMA 3GUBA 3RWPA 4EWHA 3BQRA 2W9ZB 4IH8A 5HD4A 3ALOA 4BR3A 4XG7A 4QMZA 1XH4A 2GHMA 1YXSA 4JBOA 1SVHA 3IECA 1P2AA 1PXKA 3UNZA 3IOKA 5IU2A 3BE9A 2UW0A 3QLFA 3GU8A 2O63A 3TUCA 2O2UA 3TWJA 5C27A 3Q4CA 5M4IA 1J1BA 5I9WA 2NRUA 4O86A 1OI9A 4JG8A 4ZZMA 3BZ3A 5J7HA 1Z57A 5HO7A 5I4NA 2CMWA 4FKOA 4RZVA 3D7TB 2VTNA 4AOIA 4ENXA 4U5JA 3U6IA 5AP7A 1L3RE 3DBQA 3F2AA 3FXXA 2VX0A 4G3GA 4CQGA 2JIVA 3I79A 4RWJA 4DTBA 3WIKA 4Y46A 5J87A 4EH7A 1ZY4A 4GFGA 5LQFA 1M2QA 3FI4A 2WOUA 2X4ZA 4K9YA 4C02A 1YOLA 4D2TA 4O83A 4ZJVA 1NY3A 1G8SA 3ZH8A 1QMZA 1OUYA 2Q83A 4BY9E 4EKKA 4FKQA 2J2IB 4N0SA 2R3LA 4RT7A 4QMMA 3LQ5A 4RVTA 4DF3A 3L9MA 3R6XA 5DT3A 3FXZA 1PYXA 3BYOA 1BI8A 2QU6A 3GBZA 3GFEA 5AR5A 1P14A 2ZMDA 5ACBC 3LMIA 3PJCA 3QKMA 4R7HA 2G01A 1GZKA 1OKYA 3IDPA 3FI8A 4I1ZA 3PPJA 5B2MA 5LMKC 5DI1A 3OMVA 3FLWA 3EFWA 3PY3A 4LUDA 4U45A 4UMTA 4EQCA 1U4DA 4OAUC 1ZRZA 3LXLA 3GC7A 3Q6WA 3IOPA 3FLZA 3ORMA 1QCFA 5M56A 5K9IA 3IGGA 3ETAA 4MF1A 3ZSIA 2YIWA 4IB1A 3MIAA 3QBNA 3ZFYA 2IW6A 2RG5A 1BX6A 4R3CA 3E63A 3CQEA 4F0GA 4CQEA 4EOQA 3VRZA 3EMGA 2QLUA 3HEGA 2UZNA 5BVDA 2YLFA 3PZHA 1P4OA 3EQDA 3LJ2A 4K0YA 4KRDA 4L52A 2C3IB 2UW4A 3IKAA 3MVJA 4YC6A 5EHLA 3W2OA 1SVGA 1XH6A 4O0VA 1PJKA 4LL0A 4YNEA 3MH3A 5AUUA 1KE7A 3ZU7A 4CMUA 4WHZA 3QHRA 2YDKA 1URWA 5AUXA 5HCZA 4KNBA 2P33A 4HGSA 3TV7A 2VTSA 2XK6A 1YWRA 3GQLA 3ORLA 3DXNA 3VN9A 3MB6A 3PG1A 3CC6A 3COKA 4IAIA 3FMJA 5HG9A 5D41A 4F9CA 4RJ5A 3TKUA 3FYKX 3LW0A 4I20A 3OWJA 4FTKA 4PRJA 3SD0A 4JQ7A 4YJPA 3QAME 3OHTA 4DCAA 3KXNA 4O82A 5EYKA 2Y6MA 3COMA 4NIFB 3RGFA 1Y6BA 3FAAA 4OT5A 2OFVA 3VS0A 5FRIA 2ZB0A 4J96A 4GIIA 2YCRA 3FKOA 3VS6A 4F1MA 3FUPA 3PXRA 4O6LA 2ZV2A 4C4HA 5CSVA 5CNOA 3QFVA 2EB2A 5CX9A 5AP5A 2BKZA 3ZM4A 4AZWA 1R39A 3PY0A 4C3RA 4WOVA 2VTHA 4K6ZA 2FVDA 1PXIA 2RFSA 2ZYBA 1OITA 4J7BA 2I1MA 5DE2A 3AD4A 3QXPA 2O64A 5A3XA 3MVHA 2PUPA 4EOIA 4CFVA 4UMRA 3FPMA 1ZOEA 4CZTA 4BIBA 3PXFA 1E9HA 2OIQA 2XKFA 2ITZA 3G2FA 4RFYA 5FBOA 5CF4A 3O7LD 4YLLA 4FSYA 5LVMA 4EWQA 3BGQA 4WBOA 4CKJA 5JKGA 2R64A 4R77A 1Q61A 5AADA 3R8VA 2WMRA 3E64A 1H8FA 3TNHA 2BR1A 2C47A 2C0TA 4E6CA 3LKMA 3D5XA 4O7TA 5M4CA 2G2FA 2PUIA 2OJGA 4IWDA 1JKKA 5EI8A 3MW1A 4BZOA 1G8AA 3C4ZA 3I6WA 4CTCA 4CG8A 3TEIA 2Y4PA 4RQVA 4TYEA 5EYCA 5IA2A 4ZMFA 3BLRA 4MK0A 4G34A 1W82A 5FG8A 4E4XA 3BIZA 1ZLTA 3ZS5A 2G9XA 5G1XA 1PMUA 4M69B 4WNPA 5J9ZA 4FT0A 3GCSA 2UZBA 3MFRA 3MTFA 1H1RA 4BZNA 4EOMA 5BYLA 5BNJA 5KKRC 3D94A 5HHWA 3OTUA 2OJIA 4OUCA 4CD0A 3QQLA 5I9VA 2B52A 4EH4A 1UU7A 2QO9A 1ATPE 5AUZA 4PL4A 5AP0A 4CKIA 4IAFA 3NSZA 3IO7A 3O51A 3UIXA 5IH5A 5J5TA 1H25A 2JIIA 4C2VA 2G2HA 4X6QC 2W4KA 4FV4A 4L3PA 4WNKA 5E1EA 2P4IA 2QR7A 4DLJA 1WBTA 5CEPA 5FM2A 2PVLA 4BBFA 3BKBA 3ODYX 4L67A 3RPOA 4J8NA 4LM5A 4O7LA 4EK3A 4C4IA 3HV3A 2X7FA 4YPDA 5FEQA 2VU3A 1ND4A 1HOWA 3NUUA 2OJ9A 4QMYA 1WBVA 4CVAA 5JMSA 3MH0A 2GTMA 3CEKA 3OWKA 4GYIA 1W98A 3DK6A 4EYMA 4YR8A 3FMKA 2XK8A 5ACKA 2VTMA 4F9BA 4G6LA 4LMNA 3OD6X 4GVJA 4PX6A 1U46A 3QD3A 3L9PA 3QX4A 3QA8A 4DFLA 4FTCA 3LVPA 4DH1A 2DWBA 1P5EA 2BHEA 4W4WA 3QCYA 4X2GA 2YABA 2UZLA 3QX2A 4C4GA 3C7QA 3FWQA 3JY9A 1RE8A 1Q99A 5HVJA 2PUUA 4AX8A 3RPYA 5HVYA 3M11A 3HGKA 3QZFA 2QQ7A 3UGCA 4YTFA 1Y8GA 3OF0A 5CZIA 4J99A 4WBBB 3C1XA 5AV1A 3HMOA 2QHMA 4IM3A 4CRLA 2J5FA 5B7VA 3PA3A 4BCKA 2JAVA 3DKOA 3BYUA 3V8TA 4EQMA 3E5AA 3ZC5A 3DAJA 3K2LA 4WG3A 5IUHA 2WXVA 3QZHA 5DR2A 5AX3A 3UO4A 1FMOE 3DFAA 4TXCA 2NNWB 2JITA 2WTIA 4AGCA 2KULA 1PMNA 4AS0A 1WBSA 3MB7A 3S2PA 4YTCA 3EN5A 1WCCA 5CS6A 1VEBA 4C0TA 5KMJA 4II5A 4ONAA 4I23A 3V6RA 3P79A 4LRMA 5CSPA 1W7HA 2OJFE 3A8WA 3R30A 4QPAA 4QYYA 4FT3A 1YDTE 4O91A 5HX8A 2I0YA 3CY2A 4YLKA 3QCXA 2W1HA 4OBOA 4XG9A 4F9YA 1OUKA 2W5HA 2UW5A 5IG1A 3P23A 4XJ0A 2EXEA 4QPSA 2BAQA 4Z7GA 4OAVB 4I5PA 4QMUA 3QZIA 4ZAUA 2ONLA 5CAQA 2X0GA 3R1QA 3P1AA 2PZPA 3C4CA 3WI6A 3ANQA 1M14A 3KN6A 4OR5A 1B39A 4QD6A 1IAHA 3I7BA 4IADA 3NW6A 4C4JA 5CQWA 2VD5A 2X9EA 2WEVA 3EWHA 4RX9A 5H3QA 2XCHA 4XX9A 3QRJA 4GU9A 3NVMB 1GZ8A 3FMHA 5AWMA 3KVXA 4GUBA 3ZEWA 2I7QA 2YEXA 3Q52A 4CRSA 5AUYA 2XIZA 3FMNA 4ZMEA 3ZUUA 1YI6A 4UXLA 5HIDA 4YHJA 2ERZE 3FZPA 3TUDA 2VTOA 3W1FA 2WIPA 3UC3A 3QA0A 2HWOA 4MD7E 4AFEA 3AT3A 1BKXA 4DH8A 4PMSA 1Q8WA 3NGAA 4C38A 5K3YA 2Z8CA 3EQGA 4NCTA 2YHVA 2OH0E 5KBQA 2YWVA 4LQMA 2C6KA 4PTEA 4BDHA 3Q9ZA 3GT8A 2X2KA 3CKXA 2OIDA 1M52A 3HUBA 3MI9A 1HCKA 4CCBA 3WARA 4M14A 3S95A 4RX7A 3HZTA 3ULZA 3N4TA 3TV4A 3H0ZA 2QG5A 5IPJA 5LCKA 1J7UA 5AV0A 1K9AA 4NM5A 4CT1A 5M53A 3BHUA 4U81A 4TWOA 2J51A 4AZSA 3D4QA 4YJUA 1B38A 3VO3A 3GEQA 3HV6A 4CFMA 5HICA 2W1DA 2CCHA 2BRMA 2EXCX 5FQDC 2UZUE 3H9OA 4WRSA 3NW5A 3KK8A 4OTDA 3BWJA
chains in the Genus database with same CATH superfamily
5ANJA 3SW4A 4RA4A 5E8XA 2WTWA 3GC8A 4AZTA 2XBJA 4FK6A 3AKKA 2ITNA 3QD4A 4YJVA 1JPAA 4FL2A 4KRCA 4LUEA 4KWPA 5BVWA 3RKBA 2XK9A 4AN9A 4D9UA 5CAOA 1BYGA 1DAWA 2HZ0A 2Z60A 2WMXA 5A4CA 3Q4UA 3H10A 3NCZA 1QPCA 3F82A 3GCUA 1H01A 5EM8A 3UC4A 3KB7A 3EYGA 4WG5A 4C3FA 4E4MA 1OL2A 1AD5A 3FL4A 5I3OA 2PHKA 3MPAA 3OFMA 3R00A 4M3QA 3WZKA 1ZMWA 2W1FA 4BICA 3KF7A 4BRXA 5JSMA 2QR8A 2ITYA 3DZQA 2RG6A 4AT4A 2UZTA 4JDHA 4YZCA 2R7BA 1J1CA 4MXAA 2BZJA 1H00A 4I22A 4TTHB 3QYZA 3A60A 3LCSA 5LMBA 4NJ3A 2J0KA 2O8YA 3FI3A 2IZSA 3R7YA 1XR1A 4MNEB 1PHKA 3CD8A 4X0MA 3TNWA 4YZ9A 5FDPA 4EH8A 3I81A 1ZARA 5A9UA 5JGDA 2WU7A 4ZXTA 2XEYA 3I6UA 4IBMA 3VF9A 2GNIA 2BROA 4U80A 4U3ZA 4FMQA 5IDPA 2QC6A 4W8DA 5BMSA 3R8ZA 4D4YA 4FI1A 3PPKA 3OBGA 2BDJA 5K4IA 5LMKA 1IA9A 3QTZA 4GFOA 1LUFA 1ZYLA 2XNGA 2YIXA 4MD8E 5DRDA 5DT4A 3R63A 4EL9A 3ULIA 4C61A 2C3LA 2VNWA 5FM3A 2JDTA 4AXEA 3V5QA 1U5RA 1GIIA 2QOHA 2GQRA 3N9XA 3EN4A 2XIRA 3NS9A 3R8LA 3W0PA 4EC8A 3E3BX 2DS1A 4ZSJA 5FTOA 4F6WA 4O4DA 2X39A 3KULB 3TDVA 4H1JA 3OBJA 3PWYA 2ITOA 4PPBA 4ZTSA 2OXXA 4DGNA 2A4LA 2B0QA 4FTLA 4RWIA 2WTJA 4FSRA 3DV3A 3QTRA 4YPSA 3DJ5A 2JBOA 3A62A 3ENHA 2W1IA 2XRWA 4NW5A 4WSQA 4WG4A 1A06A 3DCVA 4J1RA 5HG8A 3RI1A 3OCSA 1GZNA 3BHHA 3PJ8A 4QQCA 3HYHA 4XP3A 3IW6A 4RVMA 4XG2A 4L44A 3BYSA 5ANDA 4G3CA 1APME 3PA5A 1TQPA 2PWLA 4IJPA 5IQBA 4L8MA 3T9IA 3KFAA 3UDBA 5JEBA 1QPJA 3EN6A 4MF0A 3F3WA 3LIJA 3H3CA 5IH6A 3Q53A 4YJRA 4FTRA 3QGYA 5E4HA 2C5VA 1WBNA 3FLQA 2QI8A 4W9XA 5HG5A 3VF8A 1ZYJA 2X6EA 4AN2A 4ZLOA 2OG8A 3PE2A 3F3UA 5FD2A 4L43A 4YC8A 4AXDA 2XNEA 4A4LA 4MTAA 4DFXE 2ITVA 2A27A 4IFCA 3CJFA 5J79A 4JX7A 3SG9A 4TYIA 4I6LA 4A4OA 3CPBA 2QVSE 2XKCA 4QYFA 1TQMA 3RMFA 3RZBA 5LVOA 2I40A 3GOPA 4G5PA 2ZOQA 1XBCA 2YA9A 3WF7A 1Q24A 3L8SA 4NK9A 5F1ZA 4NM3A 4UZHA 3DT1A 3KKVA 5AP6A 4BDKA 1Z9XA 2UVXA 5K5XA 3OW3A 3NRMA 1SZMA 4OTFA 3LM0A 5G6VA 3R02A 3LFBA 2R3RA 3DNDA 4FV9A 3NZ0A 3BEAA 1DI8A 4O21A 4ALVA 4BKZA 4RIXA 4G9RA 4C8BA 1H08A 5C8NA 4HGEA 4CFNA 4O4FA 5LVPA 3BLAA 3DNEA 4LRKA 3W8LA 5J8IA 2QOKA 5IA4A 4D55A 3N4UA 3KCFA 4MAOA 3E62A 2OICA 2YCSA 4IB5A 4N6ZA 2YDIA 4BHZA 2C6OA 2H96A 4U7ZA 4G9CA 3MYGA 4H3BA 4Q2AA 5J7BA 4J8MA 2X0OA 3C0IA 1REJA 3NUPA 3T9TA 2GHLA 4KIQA 4RJ8A 3ZRMA 2HENA 2W5BA 3RINA 2FH9A 2PSQA 3CJGA 4TNBA 3QTQA 3WF9A 5JFSA 1GIHA 5BUIA 3C4WA 4YO4A 3DLZA 1OL6A 2YJRA 5EDPA 4ASXA 4YU2A 3C4FA 5JFXA 1M17A 2OXDA 2VTIA 2ESMA 5JRSA 4YUQA 1FVVA 4FNXA 4LV5A 4LYNA 4X7QA 1DI9A 3TNQB 2W4JA 3TZ8A 4DGOA 4RJ4A 1ZWSA 3PJ1A 3EB0A 1Q8UA 4GT3A 4BDBA 2PK9A 3DPKA 3QALE 4AF3A 1IAJA 2WTDA 2VGPA 2X9FA 1OL7A 4MBIA 2R3OA 4FIEA 4BCNA 3M2WA 4MBLA 4QMXA 3P08A 4AXFA 4XLVA 2ZMCA 1UV5A 2PE1A 3PVWA 2PMOX 5GZ8A 2R2PA 4ZK5A 3G90X 5E9EA 4BCPA 4F6SA 4RGJA 3RNYA 3HMIA 1XHAA 4JIAA 2JAMA 3LFAA 5EQYA 3U55A 2X1NA 4E1ZA 1J91A 1R0EA 3MBLA 5H2UA 3NUNA 5DR6A 1VJYA 4NH1A 4RIWA 4MNFA 1IG1A 4V0GB 3BX5A 4WT6A 4K33A 3RAKA 2XAMA 4FZAB 1U54B 1LEZA 2ZV8A 5CSWA 3AC3A 3PXYA 3U87A 3F5GA 4IACA 2VWIA 2JGZA 4QTDA 4YJSA 4F08A 4GK3A 3LZBA 3UQFA 4MXCA 4O0UA 3RK7A 3O96A 4PF4A 4B9DA 3LLAA 1W2CA 4U97A 1AQ1A 3I0QA 4BWXA 3R2BA 3NPCA 2YCQA 1Q8ZA 5KMOA 2F49A 3Q32A 2C6DA 5CI7A 5I3RA 2P2HA 3FI2A 3KRWA 1OB3A 2PL0A 4JR7A 5DEYA 3ZO3A 1MRVA 4D2WA 1VYWA 4PP7A 3FL5A 3GB2A 4RC3A 4WIHA 5HBHA 5EI2A 4WA9A 4I0TA 4GSBA 3MY5A 2C6LA 1URCA 2J90A 4KKEA 5HU3A 3LQ8A 4OTHA 4BFMA 4I6QA 5L4QA 3PPZA 3CTJA 3Q5ZA 4FKJA 2F9GA 3NVKI 3MIYA 3LE6A 4AN3A 1Q4LA 2WZJA 4HCVA 4C34A 3UTOA 4Y5QA 2Z7SA 2XJ1A 2H34A 5ANGA 4DE4A 4IB3A 2IW8A 4GIHA 4FNYA 2OW3A 4RWLA 2JIUA 3GU5A 3RP9A 3QYWA 4DFUA 4E73A 4F63A 2W1GA 2GQSA 2CPKE 2WAJA 1W0XC 4L7FA 4EUTA 3QTUA 2X0QA 3VS3A 4S2ZA 5FP5A 4ACCA 2Y9QA 5TR6A 4EJNA 2X8DA 2C5YA 5I9UA 1UNLA 4HZRA 4GW8A 5L6OA 4QMLA 4DHZA 5BYZA 5CEKA 4X3FA 4FEQA 5M09A 4QP8A 5E8YA 2QKWB 3P7CA 2J7TA 2JKQA 2YJSA 3LM5A 5CNNA 4BCJA 4BCFA 4P5QA 4O84A 3ZDUA 3ZHPC 4I5CA 4I94A 5J1VA 1XJDA 3V5TA 2BIKB 3FJQE 4A9RA 3PSBA 3SC1A 5AP3A 5BYYA 2X2LA 2F7XE 2HY81 4BBEA 3HV4A 3HVCA 2XKDA 3KQ7A 3MN3A 4AOJA 4K8AA 4FIJA 1TQIA 4ALWA 4C59A 4BL1A 1XMLA 2C5NA 4HVHA 1Q41A 5T6KA 1Q97A 4FIGA 4LV7A 5D1JA 4F1TA 2ITUA 2XMYA 3E3PA 3AQVA 2HZ4A 2OZAA 3M1SA 4BI0A 2P3GX 3DKGA 4R7BA 3T3VA 5J9YA 4I4EA 3RAHA 2OBJA 5IQHA 4FEVA 3PIZA 2WQNA 4HVIA 4GT4A 2IVSA 4IVDA 3DQXA 4OTQA 3SV0A 3NR9A 4XV3A 5D10A 1YHWA 3CTQA 2FSOX 4JI9A 3E92A 1CM8A 1ST4A 2V22A 2ZB1A 3CY3A 4RPVA 4MBJA 4AZFA 2W7XA 4QMNA 3NNWA 3S00A 2PVRA 4USDA 4ZS0A 2BALA 4OT6A 5CF5A 2WTVA 4YLJA 3A8XA 3U9NA 5LCJA 4WUNA 5F94A 1KE6A 5KZ0A 4O4BB 3WZEA 4XYFA 1PXNA 4A9SA 4CFUA 4ANSA 2BVAA 3VS7A 3F2NA 2ITWA 3VULA 4CV9A 4XOYA 2WMBA 3UPXA 4XP0A 2C3JA 3W2CA 4QQTA 4FL3A 3GXLA 4DGGA 1HCLA 3R7EA 3W32A 3FC1X 4IZ7A 1QL6A 2P2IA 5E1SA 3R28A 5HNGA 3SOCA 4EH5A 2UW9A 3TT0A 4BI2A 3FKNA 4R5YA 4ANBA 4D58A 3ZLWA 2YZLA 4TWPA 4EYJA 2WNTA 1PW2A 3NLBA 3WF5A 5C8KA 3F3ZA 5DHJA 5CVGA 3SQQA 4KSPA 4OGRA 3HV7A 2W1CA 1FOTA 1FQ1B 5ETAA 1FGIA 4H1MA 3OWPA 1OZ1A 4I0SA 4L53A 5TE0A 4D4RA 2CN5A 1NW1A 4CGAA 2GCDA 5D12A 3ZYAA 3QZGA 4NKSA 4MX9A 1Q3WA 2Q0NA 4K77A 1W2FA 3PIXA 4FTJA 2W1ZA 3KEXA 1LP4A 2XEZA 4B99A 4KBAA 2F2UA 2BRNA 2J0MB 3VHKA 1SNUA 4UN0C 5IF1A 2ZM4A 3A7JA 3OEZA 3FSFA 5CQUA 3VBVA 2FSTX 1OPJA 3VJOA 3QWKA 5B2LA 1SNXA 2GNGA 2UZWE 3ELJA 2CGVA 3LFQA 5IUIA 4I5HA 3FY0A 2ERKA 3R7IA 5ITAA 2OF4A 3EHAA 4KIKA 4YSMA 5EW8A 5BMMA 1ZMUA 3DQWA 2GS7A 4FF8A 3CP9A 1KE8A 4B7TA 3HDMA 5JFWA 1WZYA 3VVHA 5KHXA 4OBQA 3ROCA 3TM0A 3DGKA 3PJ2A 5HE3A 2V7OA 3NNXA 2IJMA 4RX8A 4DTKA 4CLJA 5M57A 1YXXA 4IVCA 4QQ5A 2ITTA 2BMCA 2DYLA 3VNTA 3RBWA 4EOSA 4FR4A 2VUWA 4R7IA 3JXWA 4Y72A 5KE0A 4BI1A 4L3JA 5I0BA 3NYVA 1BL7A 1YRPA 3DAEA 3OT8A 1A48A 3HKOA 4FBXA 4PTCA 2XAOA 3ENMA 4HYUA 3TZ9A 4ACDA 4B8LA 3KXHA 4FTMA 4J95A 2GHGA 2VTLA 3FZTA 4FVPA 4GJ2A 5E8ZA 2BAKA 4D1ZA 2XKEA 3VUIA 4XG4A 1Y57A 4L01A 2LGCA 4PQNA 2VTTA 5EHYA 3DKCA 2R3JA 4FTNA 5EW3A 5FBNC 2J5EA 4AE6A 4BDCA 4UV0A 4LRJA 3O2MA 3BBWA 3NX8A 4FL1A 3BU3A 5DEWA 4TL0A 2XA4A 2FSMX 2PZ5A 5EDQA 3VW8A 2BIYA 2XJ0A 4L68A 2X7OA 4O81A 2NO3A 3ATSA 5IQDA 4K18A 3DKFA 3KY2A 3G0FA 4A4XA 3EFLA 4HYIA 5AR3A 1CKPA 1OL5A 4HW7A 5FTGA 4EOJA 1PXMA 1UNGA 2BZHB 4FK3A 3G9LX 2IVTA 4RIYA 4XH6A 3TXOA 2EB3A 5LVNA 4BIDA 2ETRA 3DBEA 3T8OA 2AEGA 3V5PA 4JRVA 2ZM3A 3HA6A 3QUEA 4JNWA 3ZBXA 1PYEA 3LXPA 3G5DA 2WKMA 5HORA 1UU3A 2XM8A 3UVPA 3B2WA 4Q9SA 4E20A 1E1XA 4EH2A 4AT5A 3RPVA 4J71A 2UW6A 4M97A 3SXRA 4Q5HA 3TZ7A 2JKKA 3QRKA 1ZOHA 3WF8A 5EG3A 3H9FA 1SYKA 4JS8A 2ZV7A 5L8JA 3LXNA 4NYEA 4U8ZA 4X21A 2X4FA 3QLGA 1SM2A 5EQPA 2Y4IC 2R3QA 4JT3A 3UIBA 3QTXA 4BDAA 4G17A 3PJ3A 5IEXA 2ZVAA 3R8PA 3HMNA 3EIDA 4UYAA 3B8QA 4NM7A 3UOKA 3WYYA 5IA3A 5H8BA 1S9IA 4HYHA 4S33A 3W2PA 3SRVA 4G5JA 2RIOA 2WPAA 3QXOA 5CEMA 1W84A 2WTKB 3BHYA 3EZRA 4AP7A 3V6SA 3AMAA 2CGUA 3THBA 1CSNA 1H07A 3K5VA 4BF2A 2HZIA 4EI4A 2O0UA 4B6LA 3HNGA 1JSUA 4BTJA 5HNBA 3W18A 5GINE 5BV3A 2QOLA 2YIQA 1BLXA 4E3CA 3DTWA 3RAWA 3TG1A 5EM7A 1FINA 2UVZA 3UZRA 1MQ4A 4EKLA 5HIBA 4YHFA 4G6NA 3HX4A 4NW6A 5HOAA 2WU6A 4ZZOA 4FGRA 1UKHA 1Y8YA 4E8AA 1ZZ2A 1YXVA 3QGWA 1T46A 5TO8A 3EQBA 4EOKA 2VN9A 3GU4A 4XG3A 4MD9E 5FEDA 4ZY6A 2JD5A 4Z55A 1LR4A 4D1SA 5KMNA 3F2RA 1XKKA 5GNKA 1T45A 3E8CA 4K2RA 2PVNA 1REKA 3ZXZA 2W05A 3KRRA 2HOGA 4C3PA 4XRLA 3W0OA 4RJ7A 2F4JA 2FGIA 3QC9A 3SGCA 5DN3A 3LCDA 3U54A 3ZO4A 5K5NA 1YDSE 2E9NA 5CASA 4X3JA 2HWPA 4FKLA 2VWVA 4ZSLA 4UB7A 1Y91A 3Q96A 3FMMA 2QHNA 2OF2A 2W17A 2QLQA 3B8RA 4XG8A 4ERWA 2AC5A 3C4XA 3ORNA 3PXQA 3F66A 5EW9A 4IW0A 2WMSA 4Y95A 4YZMA 1UU9A 2R4BA 3BE2A 3F69A 5E7RA 5GJGA 2XVDA 3O50A 2OXYA 3R7VA 2O3PA 3JYAA 3FLNC 3RAIA 2QOOA 3NUSA 3U9CA 3JS2A 4S34A 3IPHA 3D5UA 2JFLA 2G15A 4UWCA 4C37A 3AC2A 1AGWA 1R78A 3NW7A 4QMSA 3UO6A 3HUCA 5HVKA 4L9IA 2FUMA 2PE0A 3Q2MA 1P4FA 1Y6AA 3E7VA 4BDFA 3R9RA 1ZOGA 3CCNA 3I5ZA 1YI4A 4N6YA 3DK3A 3FXWA 2PMIA 3BI6A 3FQEA 3DY7A 4OTRA 4QOXA 3OWLA 3SXSA 4EK6A 4O7WA 4YSJA 4I4FA 4UALA 4XUFA 3FMEA 1V0PA 4I6BA 4IIRA 2ITPA 3Q60A 3ZLYA 5EOLA 4GH2A 3JR1A 3GOKA 3P5KA 4M7IA 3R1SA 3ANRA 4DC2A 3U6HA 2AUHA 4P4CA 3ZTXA 5L2WA 5J95A 4EHVA 5FXRA 3O17A 2WO6A 2C1BA 3HRBA 4APPA 3MFTA 3UP2A 1WFCA 1O9UA 5DNRA 1B6CB 3OUNB 3PXKA 4UWBA 1XO2B 4X2NA 3N4VA 4O2PA 4AW5A 4HPUE 3DFCB 4B8MA 2G1TA 4F7SA 4KUJA 2CN8A 4A7CA 4D2RA 3RTPA 4I21A 2YM6A 4U0IA 1YHSA 1F5QA 2W5AA 4YZNA 4GL9A 4C57A 5AAGA 2XK7A 3H4JA 4F9WA 4CNHA 4PWNA 2OJJA 4FOBA 4AQCA 4X2KA 4AA0A 4J97A 3CXWA 4LGGA 4NFNA 4PP9A 4BGQA 4ANMA 3PG3A 2CLQA 1H1QA 3DZOA 4JMQA 4QEBA 3CR0A 3QTWA 4JBVA 2J9MA 4L3LA 3RHXA 3LMGA 2BDFA 4QMWA 3VIDA 5IQGA 4JG6A 3FV8A 3MY0A 4ZJIA 5IISA 4P7EA 4FKTA 4GJ3A 4GK4A 4P2KA 2Z2WA 5C01A 4DYMA 4UBAA 2V7AA 4LFIA 2IN6A 3AG9A 4DAWA 3C5UA 4A9UA 4EZ3A 3AXWA 4AACA 4LI5A 3R22A 5M4UA 4LL5A 4S32A 3WOWA 3R9OA 5IDNA 3MVMA 5DVRA 4DN5A 4FEWA 3KMUA 4ZJJA 2GMXA 1IEPA 3BU5A 4FYOA 4A06A 3WYXA 3KA0A 2X8IA 3LCKA 2UZEA 3GQIA 3VUDA 3EKNA 4MKCA 4BWPA 5FTQA 4DCEA 2YM7A 4FIIA 4U41A 4FZFB 3K5UA 5A6OA 3ATTA 4NL0A 3UPZA 3MPMA 2OKRA 2SRCA 3FQHA 3MFSA 4QT1A 4RG0A 1OMWA 3D83A 1UNHA 3PFQA 3R01A 5BVKA 2BKKA 4RC2A 3TJDA 4APCA 4HVSA 3RCJA 5M4FA 4CSVA 5HBEA 3O23A 5AP4A 4D2VA 5JH6A 4DFZE 3C9WA 1KSWA 5CSXA 2XNNA 1QPDA 4CV8A 4DEGA 2UUEA 1YOMA 2VO7A 4CZYB 2W0JA 4EOLA 3NYXA 4AW0A 5M51A 2VO3A 1XH7A 1JLUE 1W8CA 2XUUA 3OCGA 3OZ6A 4IWPA 4XHKB 3BWFA 4FZ6A 4NKAA 5CAPA 3G15A 2J0LA 3PTGA 2ACXA 2RGPA 3O8TA 4R6VA 4QP3A 4RSSA 3CQWA 4FV8A 2YM5A 3BHVA 5JFVA 3BL9A 3CTHA 5JZJA 4ACGA 2H8HA 2OSCA 3NUXA 4IFGA 4FGBA 3WIGA 5HE2A 4TT7A 4R78A 2ZV9A 3U51A 3P78A 2VX3A 3OOGA 2C6EA 2CNQA 4KIPA 4BJJB 5AX9A 3LPBA 3AT2A 5KMLA 1ST0A 4O7VA 4BGGA 2J50A 3EYHA 3HAMA 1OPKA 3CKWA 5DFPA 2XH5A 3WILA 4M0YA 2GFSA 3NFFB 4IVAA 3WZUA 3CBLA 2AQXA 1BI7A 2IZUA 1H28A 3OCTA 4DG2E 2WMTA 4GG7A 5A4EA 4EBWA 3QHWA 3LCTA 3VS5A 2XK3A 3S1HA 3SG8A 4FZ7A 2WQOA 3GCQA 4KBCA 3AMYA 3UVRA 4F70A 4I41A 4W4VA 3FLYA 4G3EA 4IAAA 4AU8A 4W8EA 3V5WA 5EKNA 3ZBFA 4I3ZA 5M07A 4N4SA 4ZIMA 2R3NA 3UIUA 5EKOA 3DOGA 3P86A 4O38A 4D0XA 4EK5A 3D15A 4OTIA 2QG7A 4ERKA 3UE4A 4EZ5A 4ASZA 4JL9A 3NYOA 4G6OA 4TYJA 2O65A 4RJ6A 2YFXA 3GCPA 5A4QA 4FG7A 4B0GA 1KE9A 5IA0A 3VUTA 3RALA 1ERKA 4CLIA 4U6RA 2YCFA 2WMUA 3A7IA 4HOKA 2C0IA 2WTKC 4RIOA 3UG1A 4O0SA 4V04A 3EQFA 3OCBA 1X8BA 4PTGA 4CMOA 2W9FB 3QCQA 5BVFA 3HRFA 5CVHA 5KNJA 3LXKA 1YW2A 4FKWA 3FLSA 3T3UA 4BKJA 1FVRA 4UYNA 5DH3A 4L00A 4F65A 2PULA 4Z9LA 1PKDA 2HIWA 1J7LA 2W96B 1OKZA 3AKJA 3V04A 2WTCA 5J5SA 2VO0A 3UMXA 3ITZA 5A14A 3LFSA 4AFJA 3F5XA 3BRBA 3AT4A 3D2IA 5DPVA 3NIZA 4PMPA 3PIYA 4MEDA 5JQ8A 4M84A 4BTKA 3C0GA 3F6XA 4E6AA 1WMKA 3TUBA 2OU7A 1H1PA 1NA7A 2VO6A 4AXCA 2RF9A 2R3MA 5CALA 3L8XA 2OZOA 5IQCA 3OXTA 5LXMA 4DA5A 1NVQA 2W4OA 2VRXA 3PRFA 2XJ2A 4FKPA 2HAKA 4A07A 4DT8A 1ZMVA 4JDKA 2OWBA 4F64A 5CI6A 3BPRA 4TW9A 4IX4A 3UIMA 4N57A 3PSDA 2BRBA 3ZSGA 5AP1A 3FZ1A 2E9OA 3HLLA 2QCSA 3FQSA 4A9TA 4IVBA 4QP4A 5KHWA 4C4EA 3UOJA 4I5MA 3HRCA 2QOIA 1R3CA 1OIUA 2E9PA 3R1YA 2VWBA 3H0YA 4BTMA 4X2FA 2FSLX 5EDRA 1BL6A 5CT7A 3E8DA 3C50A 2B53A 3G9NA 4RMZA 1ZAOA 3IG7A 1YHVA 3ZDIA 3EQHA 1GY3A 2JEDA 2GDOA 5E92A 3R0TA 3UYSA 4YZBA 2ETMA 5L8KA 1MRYA 2BHHA 4YC3A 3ZO1A 5HE0A 5FP6A 1TZDA 1H27A 5CF6A 1CTPE 3F9NA 4XV9A 4KD1A 3QWJA 4OTPA 3LQ3A 4O1OA 4UMUA 3NAYA 4YBKA 3R9DA 5KCVA 2IW9A 3SW7A 4EQUA 4CZUA 5CAVA 5H9BA 5ANEA 2GNJA 2J4ZA 3ZUVA 4TYHA 3RPSA 5AV3A 3TI1A 5HZNA 4E6DA 2XNOA 3DB8A 4DGMA 1UU8A 5DYJA 2PVMA 2WELA 3L9NA 1JSVA 3WE4A 3ZLXA 3KXZA 2YIYA 2BRGA 2C6MA 4BIEA 2XNBA 3ORKA 1JQHA 3KMMA 3VBYA 2PZYA 4Z3VA 3P9JA 4QMTA 4JG7A 3O5AA 4IZYA 5M08A 3FE3A 1FPUA 3OC1A 4JR3A 1YDRE 3LHJA 5BVNA 1XH8A 4WRGA 3W0MA 3DAKA 4BCHA 4TPTA 2JKMA 3MV5A 4QO9A 4ZP5A 4KAOA 4M66A 2JLDA 2BRHA 5ETIA 5LVLA 3W2QA 3ZMMA 4KINA 4AWIA 2IVVA 1TFFA 1UWHA 5CZHA 2QU5A 4NU1A 4G2FA 4Y8DA 5D7AA 1IR3A 3BGZA 5ETFA 2VWYA 1WVYA 1K2PA 1YXTA 4E26A 2WQEA 3GU7A 2CDZA 2WQMA 4H3QA 5FGKA 1YI3A 2C0OA 3S4QA 1ZY5A 3Q04A 4GEOA 4ANNA 1H24A 4JXFA 4FKRA 2ZDUA 3VJNA 3BU6A 4BCGA 4IM0A 1W83A 4WSYA 4X6RA 5EM6A 4FSWA 4DH7A 2VTQA 3NEWA 4AA4A 4EOPA 1YXUA 5CU2A 1WBPA 2HXLA 1I09A 4M68A 5EYDA 4DEBA 5ICPA 5L6PA 1XH9A 3LCOA 4IHPA 4ZSEA 3IQ7A 3Q6UA 5ANIA 5EQEA 3PDTA 4FNZA 4NEUA 3ZSHA 3R1NA 3BBTB 4BHNA 4GVAA 3SLSA 3TV6A 3UO5A 3NAXA 5EH0A 1VR2A 4PNKA 2A2AA 4FKVA 2P55A 3C5IA 2HELA 1XBAA 1WVWA 3LFDA 3RWQA 4JDJA 4H05A 4D2SA 4XV1A 3VS4A 4HGLA 3RM7A 2YAKA 1GNGA 2HK5A 3LAUA 1JSTA 3D7ZA 3F7WA 2UZOA 2KTYA 3KXXA 1IASA 2LAVA 4CXAA 4FKSA 4G16A 2A1AB 4G1WA 4ZLZA 2C69A 2XNPA 2QNJA 4ASEA 4DEAA 3M42A 3F5UA 4GYGA 2Z7QA 2GS6A 3BHTA 3GVUA 3OS3A 4EOOA 5AM7A 5H8GA 3DDPA 5EFQA 3AC5A 4YJNA 4EHZA 5L2IA 3EJ1A 2AYPA 3QRIA 5J9LA 2Y0AA 2YM8A 3IDBA 3MSSA 4IZ5A 2BTRA 4AXAA 4CYJA 4DHIB 4RIXB 4GU6A 5KUPA 4GKHA 2C5OA 1S9JA 2VX1A 2E9UA 3EQIA 3E8NA 3GFWA 4CYIA 2CKQA 4YNOA 4W4XA 5T3QA 3A7HA 2YISA 3RM6A 2A98A 2C1AA 4GFMA 2RFDA 2H6DA 2HXQA 4KABA 4AAAA 4U44A 3OOMA 4NT4A 3QQKA 4O0XA 5EI6A 1OM1A 4FKUA 2BZIB 3EL8A 4CCUA 2B54A 4IX3A 4Y83A 4YJQA 4BWKA 4DGLC 4IM2A 4JJRA 4JAIA 4I0RA 3R71A 2PY3A 1XQZA 3QKLA 5AR4A 3DB6A 4ALUA 5A54A 3BCEA 3D7TA 4FT7A 4AOTA 4RWKA 1UA2A 5JGBA 1G8JA 3LJ1A 3RNIA 2GQGA 2R3IA 4FODA 2OFUA 2BUJA 5AP2A 1RQQA 4FV6A 5HD7A 3UYTA 3NDMA 4CFFA 4BCIA 3MESA 3CS9A 2BCJA 5AV4A 3UQCA 5C4LA 3V8SA 3GU6A 1QPEA 4MQ1A 3ZFMA 4HGTA 2CKEA 3Q4TA 5CEOA 4UZDA 2UZDA 3O71A 3ML1A 4RC4A 4C58A 3HL7A 4IWQA 4FTUA 4RQKA 5AUVA 3O0GA 4O4CA 2ZAZA 3CPCA 3VS1A 2WFYA 3C0HA 4U42A 4RBLA 3QQGA 4KS7A 3U4UA 4U43A 3Q9WA 4GG5A 4YBJA 1V0OA 3HP2A 4IB0A 1GAGA 3EZVA 3VUGA 3GCVA 4FV5A 3R9NA 1JNKA 5HE1A 3AC1A 5D11A 1OGYA 3VWAA 3N51A 4NSTA 4MQ2A 2VTJA 2XIKA 5IQEA 1PY5A 4O7NA 4AW2A 4RIWB 4WUAA 4RX5A 4W9WA 4USEA 4IEBA 4PDOA 1FGKA 4RFMA 4C7TA 4FSZA 4L42A 4NCTC 5AIRA 3BYVA 2FYSA 3LFCA 3RK9A 5JK3A 3GC0A 4BYIA 5HU9A 3PUPA 1JBPE 4MWHA 4IWOA 1DM2A 2YM4A 5E8VA 4YGAA 3BV3A 4FTTA 4QTBA 2PYWA 2B7AA 3MWUA 3MH2A 5HEZA 2C6TA 3PZEA 5HO6A 3V5LA 4DEIA 3Q2JA 3JPVA 5AR2A<