4PTGA

Structure of a carboxamine compound (26) (2-{2-[(cyclopropylcarbonyl)amino]pyridin-4-yl}-4-methoxypyrimidine-5-carboxamide) to gsk3b
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
347
structure length
333
Chain Sequence
KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Glycogen synthase kinase-3 beta
publication title Discovery of new acylaminopyridines as GSK-3 inhibitors by a structure guided in-depth exploration of chemical space around a pyrrolopyridinone core.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 333
sequence length 347
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ptgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ptgA01
4AGUA 4ZZOA 2BRGA 2Z8CA 1I44A 3UQFA 4BKYA 3OP5A 3DQWA 3NYVA 2XNPA 3BKBA 2W06A 3PPJA 1V1KA 4IVCA 4HPTE 1GIJA 3EQRA 3L9MA 2YCSA 3D9VA 4AZSA 5LXMA 1Y8YA 4WG4A 2V5QA 4BCJA 4F64A 2B55A 4I0SA 2R3LA 3O8TA 3QGYA 5DHJA 3Q4ZA 4IACA 1ZYJA 3HEGA 3MIAA 3OZ6A 4QP7A 3V5JA 4OT5A 3LXNA 4DA5A 5AAFA 3GCPA 3RGFA 3LMIA 4AE6A 2YM6A 4I24A 4X0MA 4DFZE 3RINA 4JIAA 3HECA 4CKRA 3ZM9A 3TN8A 1YKRA 2XCHA 4XH6A 3PRFA 3MVJA 3FMLA 3LFEA 1J1BA 3BCEA 2Z7LA 3PG1A 5DBXA 2OKRA 3DQXA 4JQ8A 1IRKA 3DZQA 2ZV2A 3IOPA 3R73A 2ACXA 3R9RA 3GNIB 2R7BA 1HCLA 2ITPA 2J0IA 3DB8A 3Q96A 4XOYA 3OY3A 4ACCA 3UPZA 2JDRA 4PDSA 4PDPA 4CVAA 4RFMA 5G6VA 4K2RA 5AA8A 1MRYA 4O7VA 1XH7A 4FIJA 4ZMFA 4YU2A 4FT7A 3MVHA 5ANGA 2QOQA 4PPAA 4IAZA 3KCKA 2QKWB 3M2WA 2HAKA 2FYSA 1BUHA 3ZTXA 4OTHA 3R7IA 3KXNA 4A9SA 5E8WA 3QTSA 5ANOA 5DR9A 4Z55A 4KABA 1NVRA 3FSKA 4L3JA 4F65A 4ZS0A 3ATSA 4X6QC 3OXTA 4W4YA 2CDZA 2HENA 3DJ6A 3F6XA 4XV2A 4B8LA 5HU9A 4DH5A 3QD0A 4PMSA 2I0HA 3KEXA 4ALVA 3HYHA 1G8AA 1Q8YA 4GVAA 3ZS5A 4AZVA 1KE5A 2PMLX 3NAYA 4J99A 5EFQA 3R83A 3P1AA 3WIKA 4Z3VA 2C6KA 3EYGA 3FQSA 4B4LA 4HVHA 4RJ5A 3AGMA 1WMKA 4NJDA 1J7UA 2RG6A 3Q60A 4F09A 3AMAA 3S3IA 4MKCA 4PDYA 2W1IA 3A7FA 4LV5A 3BGPA 4X3FB 3GI3A 1YHVA 1J7IA 3EN5A 3I6UA 1M2RA 3BLRA 3N9XA 5L2QA 4ARKA 2UZEA 3VUHA 4TXCA 2Y4PA 2BRMA 2YLFA 3COKA 2RKUA 3C4ZA 3EN4A 3PY1A 3BU6A 2JD5A 4ANMA 4U45A 4C59A 1SVGA 2W9ZB 2OH0E 1DAWA 4J8NA 4OTQA 5GZ9A 3CPBA 4EH3A 3OD6X 4DBXA 4FBXA 4M69B 2O2UA 2XH5A 3BZ3A 4BCFA 5CU0A 2PPQA 1H07A 2PE0A 4QNYA 1OIYA 3TUBA 4PL5A 4DGNA 1XQZA 2QHNA 4HZSA 4IAAA 4JIKA 4CTBA 4EONA 4C35A 4F08A 2YM4A 4YJQA 2GS2A 3MY0A 2QQ7A 4NU1A 5IF1A 4I6QA 4ZSGA 3TM0A 3FY0A 3ANQA 2W1ZA 2YFXA 3UZPA 4FGBA 4QMUA 4C4IA 2W9FB 4BWKA 2ZMCA 2PUNA 2RIOA 3N4TA 3FJQE 4LYNA 4S31A 4XOZA 3WF8A 3PE2A 4FSMA 4KUJA 4UBAA 1RJBA 3ORKA 4OTPA 1QCFA 3IONA 4LRKA 4GK2A 2Z2WA 5CNOA 3ANRA 5IEVA 4YHFA 2OW3A 4GV1A 1LR4A 4DT8A 4FYNA 1U4DA 4J98A 3F2RA 4I92A 1GNGA 2FO0A 3P79A 4YR8A 1YXXA 3GVUA 2W05A 3QHRA 2ZB1A 4RBLA 4EH5A 3EZRA 3RNYA 4AUAA 2XRUA 3LIJA 4NWMA 4ZLZA 3LJ1A 2P33A 3HUCA 1IG1A 2VWYA 4EK8A 1FBNA 3WYYA 3BHVA 3EMGA 4MYGA 2X0GA 4MX9A 5CT7A 4ZEGA 4O7SA 5EG3A 3GGFA 3GC7A 4JI9A 2IZRA 3SQQA 5GINE 2C6LA 1VJYA 4XS2A 4F9WA 3ZZWA 3R21A 4MF0A 2GU8A 3LFQA 1ZMWA 3SC1A 3C4EA 2HY81 3E63A 4YNOA 3UQCA 4RX8A 3R00A 4R1YA 5C9CA 3VUTA 3EQFA 2FVDA 4IX5A 5KZ0A 3LQ5A 3ZFYA 4AU8A 5D12A 1PJKA 3KXMA 2QR7A 1A48A 3BYSA 3ZDIA 4E3CA 3QUDA 4MXYA 3V5PA 4L53A 3ZHPC 3QD4A 3U6IA 4JR3A 2XNMA 3UP7A 1YW2A 3UDBA 3G51A 4MXAA 2XNBA 5GHVA 3UO5A 2GFSA 4YJSA 2BFXA 1GAGA 4XV9A 4DEGA 4EJ7A 3HMIA 3P7AA 4D9UA 2QOIA 2W1DA 4C61A 1STCE 4Y95A 4IAYA 4R7IA 3G90X 2ZM1A 4O22A 4NUSA 2X7OA 4IDVA 3EQPA 5LQFA 1Y91A 3C7QA 3TWJA 3QRJA 2JC6A 5CF4A 5IEYA 5IG1A 3SX9A 5AADA 5C4KA 5AAGA 4FZDB 1CMKE 2Q83A 2OXDA 3R1SA 4IC8A 3R04A 4BI1A 2YWPA 3B8RA 1REKA 1GZKA 2LGCA 3NYNA 4HJOA 3DBQA 3F7WA 4FC0A 4ZK5A 2VWUA 1VYWA 4C2WA 4I93A 4C3PA 2HXLA 3UPXA 4FEXA 4WG3A 5DG5A 5J9YA 1HCKA 4N6YA 4NSTA 3Q9WA 2VTRA 4E4LA 2ZMDA 2HY0A 3C9WA 4DEDA 5HBEA 5DYJA 1J7LA 3F69A 2R3MA 5M4UA 3FHRA 2QNJA 2NO3A 3HA8A 3P5KA 4GU6A 4JQEA 5TR6A 4WG5A 2VO3A 2R0IA 3NCZA 4V05A 1UVRA 2CN8A 5BQ0A 3ORTA 4RQKA 2Z02A 2BAKA 1H1SA 2PMOX 4QMSA 2LAVA 1OL2A 4FL1A 3T8OA 4L8MA 4UEUA 1JBPE 3I79A 5JFVA 5EDRA 2R3OA 4MXCA 3I81A 5HG7A 3DK3A 5BUIA 5CF8A 5EI2A 2C0TA 2IW6A 1ZZLA 4QD6A 5BVEA 5JQ5A 5HVJA 4LUEA 1JSTA 2F57A 4QYHA 5IDNA 4UMQA 3V3VA 3BPRA 5M4IA 3MA3A 5KCVA 4FVRA 1PXNA 3HDMA 3U9CA 4ZY5A 5CQWA 4BI2A 3FLWA 3FLNC 4E4MA 1ZLTA 5CVGA 5GIPE 3AC5A 4BCHA 4JXFA 3W33A 3U54A 3QZIA 4KS8A 2BHHA 4FTKA 5CALA 2CKEA 2XBJA 3NR9A 3R9DA 4KBKA 3VS2A 4DG2E 2VTAA 3BYMA 2A0CX 4RLKA 4RMZA 2XRWA 3FY2A 4WKQA 3TJCA 1YI3A 2GS7A 4BCIA 4D0WA 4M69A 5ETFA 5CEQA 5HESA 3BU3A 4JJRA 5DRBA 3U55A 4ZJIA 4AXAA 1OECA 4ZTRA 3KRXA 4ANOA 4GVJA 3EB0A 3S2PA 3IDPA 4PQNA 5KMJA 4C36A 3Q6UA 5J1VA 3CGOA 3E8DA 1Q3DA 1NY3A 3D5VA 1KE7A 3K3IA 4ZTMA 4FIFA 4DC2A 4FSTA 5CVHA 3ZRMA 2J5FA 3PFQA 2YA9A 4QTAA 1ZMVA 1YXVA 2YM3A 4IH8A 4O91A 3PJ3A 3CCNA 4CRLA 2EXMA 4HGLA 2UZNA 4FKPA 4PPBA 5M55A 5CVFA 5T6KA 4GKIA 4JG7A 3VW8A 3LFBA 3OUKA 4YJRA 2OWBA 2HXQA 3CTJA 4EQUA 4PTEA 1VZOA 3ORMA 1Q99A 2UW7A 5FEQA 1PXPA 3QXOA 4ACHA 4YJOA 5EW8A 3UIXA 2I6LA 3JY9A 2ITVA 3FI4A 2QOFA 3O71A 2RFNA 3I6WA 3VWAA 4WD5A 4F1TA 3EQBA 3EWHA 4EC8A 2PZYA 5AFVA 1UWJA 4II5A 2PZPA 3Q5ZA 5DVRA 5E8UA 3EOCA 4FNXA 4C37A 3D94A 3R02A 4ASDA 5BUEA 1R3CA 3P78A 3EZVA 3JR1A 2E9OA 3OT8A 4GK3A 2Q0NA 2VV9A 1LPUA 2X2LA 3QCXA 1H1PA 5BVFA 4NTSA 5LMKA 4DN5A 4CYIA 4C4EA 2ITXA 2W96B 4Q5EA 4IMYA 2ZM4A 2WO6A 4EK5A 3P0MA 5C26A 5F1ZA 1F3MC 1UKIA 3LFDA 3Q4TA 3EQIA 4IEBA 5DWRA 5CAQA 5EYDA 3TZ7A 5HG8A 2GNJA 3C4WA 3QKMA 3W10A 1SM2A 2EUFB 3ZONA 4E5BA 4YMJA 4O84A 4Z9LA 3QD2B 4PY1A 4XLIA 4CFWA 2H9VA 3EFWA 5I9ZA 4WT6A 3C5IA 3OT3A 3E8NA 4R7HA 4BCMA 4DFXE 5LJJA 1PRYA 2CSNA 1ZXEA 5GJGA 1U46A 3QLGA 4WA9A 5AM7A 4TTHB 3TJDA 3ULIA 5HO7A 4P2KA 5IUIA 5AR4A 2F9GA 4FTOA 4D4YA 2FA2A 1JQHA 1W82A 3DDPA 4I4FA 2JLDA 3HUBA 2QOBA 4YZBA 4F63A 4FKRA 4ITJA 4NM7A 4AE9A 4Q2AA 4EOIA 4E93A 3Q4UA 2JKMA 4WNMA 5FRIA 3PRIA 4XYFA 2ERKA 4QMPA 4CT2A 5AP3A 1OKWA 1APME 3EYHA 4EBWA 5I9YA 2EB3A 3PXKA 2C5XA 3MW1A 5CF6A 1XH6A 5CASA 3DFCB 3OROA 5JKGA 5JMSA 3S95A 4BTFA 1G3NA 2BFYA 2C68A 4FSQA 4O2PA 5D7AA 4DGGA 2ZAZA 4X2NA 3TV7A 2Y9QA 4FTUA 4YZ9A 4EOPA 2PUIA 3FLQA 5D11A 4RT7A 4E5WA 2BROA 2WAJA 2B53A 3RPYA 3V51A 2BALA 4TWCA 5EHLA 3RJCA 5EQPA 4LI5A 4PNKA 4YTFA 2WTCA 2IJMA 4BN1A 4FK6A 4M14A 2Y8OA 4EOQA 4XG2A 2ZV9A 2YJRA 3MJ2A 2IPXA 4U79A 4D4RA 1JKKA 4IX4A 1YDRE 2ZVAA 3BE2A 3HL7A 5DPVA 4D2WA 2J0KA 2QO7A 4WUAA 5EM5A 1MP8A 3VS3A 4DG3E 5L6PA 4O27B 1YOMA 4X2JA 2JIIA 3TV6A 3VRZA 4AGWA 2X6EA 3L9LA 1GZ8A 1XHAA 4LOPA 2HZ4A 1PKDA 3NNUA 4IANA 4UXQA 3F82A 3PJCA 3R7GA 2OLCA 4F9BA 3E87A 4U6RA 4QYYA 3L1SA 5LMKC 3F5GA 1PMUA 4M12A 5AUXA 4RJ4A 3R1YA 3I7CA 3ORNA 2C1AA 2VTTA 4IW0A 5DMZA 5LVOA 2C4GA 1XH9A 2VN9A 3DXNA 3QRUA 4G16A 4CZUA 1JOWB 4ZTQA 2BZKB 4HNIA 4IAIA 4U41A 4BCOA 2PZRA 4UWYA 4RC4A 5HOAA 3PXRA 1K2PA 2XIKA 4TYHB 1WBSA 3OFMA 3A99A 5DNRA 4AA5A 3GOKA 1VR2A 2GNHA 4LOOA 5EI8A 1UKHA 3OBJA 1JKSA 4RQVA 2UW3A 2UVYA 4JX3A 4Q9SA 4NL0A 3QC4A 4W9WA 2VU3A 1L8TA 4M66A 4D0XA 5M4FA 5A6NA 4ERKA 3QKLA 4I41A 4E8AA 2J9MA 3ZBXA 3EQCA 3W8LA 5HLNA 3OTUA 4PUZA 4D1XA 3QRKA 4J53A 3DNDA 4GJ2A 5E8ZA 4YBJA 4G31A 4CKJA 3AD5A 4UWCA 5M56A 4DEIA 5J79A 3NMUF 5L8JA 3TTIA 1PYXA 1Y6AA 1ZOGA 4OTGA 2YCQA 3A2CA 2XBAA 4L44A 4EH4A 4NFMA 1YXTA 3UVQA 1Q62A 3R6XA 3RAHA 4DHFA 3PVUA 4L43A 5J95A 4HOKA 5CEKA 3FL4A 4P5QA 4ZIMA 4BZDA 2YDIA 1H8FA 1QPEA 4F9AA 4Q5HA 3DTCA 5GJFA 4EWHA 4PV0A 4QRCA 3NUXA 3PXQA 2OH4A 1P14A 2QD9A 3UG2A 3RHXA 5H9BA 4F0IA 4RVTA 2X2KA 4YNEA 3BRBA 4HPUE 3OF0A 2V22A 5AR8A 4EK6A 5A3XA 2PUPA 3TZMA 1CKPA 4E5AX 2C6IA 4RJ7A 4EH2A 3PXYA 4D4VA 4RFZA 4XG7A 3KKVA 1LP4A 1UU3A 5HVKA 1Q8ZA 3TZ8A 1NW1A 1OBGA 3BELA 4WHZA 2WMVA 4NTTA 2RL5A 3QZFA 3WZUA 3DXPA 2PTKA 4YC3A 1M17A 2XM9A 4AFEA 2YM7A 4C7TA 3NYOA 1OL1A 3F3TA 3F7ZA 5CXZA 5CF5A 4BIBA 2B4SB 4IX3A 2B54A 4C62A 3Q04A 3PDTA 2UVXA 4G3DA 2GFCA 2WMTA 3QTUA 4KNBA 1Q8TA 1UA2A 2EXCX 3R2BA 3TNPC 4FTCA 3DKOA 3LCTA 4G17A 3TL8A 3UIMA 5A9UA 3JXWA 3LFSA 4MHAA 4E73A 3KY2A 4OTFA 2B7AA 4IVAA 4LG4A 4BCGA 2BZJA 2HZ0A 3MH2A 3IO7A 3K5UA 1ERKA 3VBWA 4Y46A 3KK9A 3NNVA 4FKGA 4G1WA 4GFOA 3BX5A 4BFMA 5C8KA 2DQ7X 1ZOEA 3L8XA 4UYNA 4MXOA 3UVPA 3UYSA 3IECA 4GL9A 3SW7A 3DT1A 2WMXA 3RM7A 3OCGA 1F0QA 5HIEA 2BRHA 5L6OA 5FM2A 4XRLA 3HA6A 4TRLA 2WMRA 4JBVA 5IH5A 3IQ7A 5HCZA 2WD1A 2YM8A 3VBTA 2VTPA 4ONAA 4W8DA 4CG9A 2WU7A 2NP8A 2G2HA 5ETAA 2YZAA 4F7JA 3LW0A 5DT3A 5AUUA 3QGWA 4K18A 3RAIA 1W0XC 4OBPA 5M4CA 1OVEA 5HKMA 4ZAUA 3E62A 4J52A 4IM2A 2G1TA 3IGOA 4S32A 2F7ZE 1JNKA 4JL9A 4W4VA 4IVBA 5AIKA 2X39A 4ZY4A 3PZEA 5LWMA 3TDVA 3LCKA 3IW4A 3NAXA 2WTKC 4LUDA 3SW4A 4EBVA 1UWHA 2JEDA 4O0YA 2UW9A 3DXQA 4NYEA 2HWOA 5FTQA 2JBOA 3W2CA 4EH8A 2Y4IB 4I6HA 2XCKA 3TNHA 1QMZA 2OXXA 3FKLA 3OW4A 4G3CA 5JN2A 3KREA 2WELA 3D5XA 3DCVA 4JDHA 4RIYB 2X4ZA 1GIIA 3MN3A 2BAQA 5HQ0A 2W5AA 4USDA 2PK9A 5EYCA 4IWPA 3TT0A 4LV8A 5AUWA 1PXMA 2OJGA 1RDQE 4FG7A 3OOMA 3V5QA 4CT1A 1FVVA 4W4WA 5E91A 1XH5A 3DKGA 5AR3A 3RNIA 3R63A 4QP6A 5AA9A 1JSUA 3QTRA 2HELA 1U54A 4GKHA 2GTMA 3QQKA 4E6CA 4TYHA 4QPSA 3WF9A 4GG5A 1XJDA 3F2NA 4MNEA 1FVRA 4DAWA 4X2GA 1MUOA 5BMSA 5IH6A 4N57A 4TYJA 3CIKA 4KS7A 3O8PA 4A7CA 3QQJA 4KRCA 3LZBA 3U6HA 5J87A 2JDTA 5K4IA 4XG3A 4R78A 3R9OA 4CCUA 3QL8A 4GK4A 5H8BA 3PJ2A 3E5AA 4FV4A 5HEZA 3RWQA 4IM0A 3ZXTA 3AC1A 1M52A 4E4XA 4CV8A 2BUJA 4FE2A 3ZBFA 4FKVA 3HV5A 4UMRA 2PWLA 2Z7RA 1W7HA 2XJ2A 2UZTA 4PDOA 4FOCA 4A07A 4QP9A 4AW2A 5AUYA 5JRQA 4A9YA 4ACMA 4FV9A 3ZUUA 3SG9A 2PZ5A 3VJNA 3ZSGA 1R0EA 2GTNA 4TPTA 4CRSA 2ZJWA 3LHJA 3LOKA 5FXRA 4AG8A 5JH6A 3A61A 4U3YA 3TDWA 2VX0A 1R39A 2QG5A 3R8PA 3VS6A 3ZYAA 5AR5A 2W1CA 4QP4A 4QMLA 3NLBA 2X1NA 4FEUA 3ZU7A 3BGZA 4U97A 3RCDA 2VWBA 3H3CA 1WFCA 3IW7A 5AJQA 5C01A 1L3RE 3DS6A 2QI8A 3CBLA 4XRJA 3WYXA 3LKMA 5M51A 4GH2A 3RMFA 3EFJA 3GQIA 3QXPA 3V6RA 4ANBA 3U4UA 4C2VA 2OZAB 1KOAA 2PHKA 4N0SA 2NRUA 4J7BA 4MD8E 4OR5A 3TI1A 4NKSA 5KX8A 4BVUA 2J6MA 5AX9A 2UW6A 3W2OA 3IW8A 1CM8A 4YLLA 1BLXA 3ACKA 3AT2A 3NIEA 3DY7A 2P3GX 3OXIA 4GYIA 4NJ3A 2WKMA 2WZJA 4HCTA 4AGCA 4FIGA 3NX8A 1OIRA 4AX8A 2GHMA 1ZMUA 4H05A 3FI8A 4CFXA 3C4XA 4IZYA 1TQIA 1BL6A 4APCA 4ZLYA 2XS0A 2BDJA 3OWJA 2C3KA 3DAKA 4O1OA 4NEUA 2HOGA 3KF4A 3W18A 5DT4A 1H0VA 2GNFA 4IHPA 1WBTA 3QX2A 3P7BA 4NM3A 4R1VA 2JITA 3V5WA 3ZO1A 3C4FA 4D9TA 1PXLA 1H28A 4YJTA 4FIIA 5J5SA 2O65A 4RA4A 2PL0A 4J1RA 4LRJA 4Y5HA 4AACA 4O81A 3VQUA 4ZZMA 3I5ZA 3N4UA 3H10A 3RHKA 3S1HA 3B2WA 2XEZA 4EH7A 2IG7A 4K1BA 2YWVA 3NW7A 3FLYA 2QR8A 4BDDA 4JVGA 4L7SA 3P23A 2Y6MA 4FG9A 4MVFA 3G6GA 5BVKA 3ZMMA 2REIA 5KO1A 5BYLA 4L3PA 3PLSA 4QP1A 5AP2A 3RKBA 3KRRA 3ZCLA 3G6HA 2JIVA 4BIEA 5AUVA 2WQMA 5CX9A 2HW6A 3AT3A 5EDQA 4HVDA 2ITWA 4CZYB 5DEYA 4PL3A 4YJUA 4DCAA 1TVOA 5HIBA 5DE2A 4UMTA 4U7ZA 5DGZA 3N4VA 4M0ZA 3ZO2A 5AX3A 2BTSA 5HG9A 4OLIA 4FKIA 3PVBA 4QQ5A 4RSSA 5HZNA 4M97A 4ZTSA 2ZM3A 1W98A 4P7EA 5E1EA 3ZRKA 1OKVA 2HYYA 3LJ2A 4H58A 1Q8WA 3WZEA 1SYKA 3KXHA 4EI4A 4L52A 4RIOA 3RPSA 2ONLA 2XIRA 3QA8A 4CG8A 3ZC5A 4ASZA 3D4QA 3TEIA 1ZAOA 4S33A 2RF9A 4XG4A 3KF7A 3MDYA 1YHWA 5CU4A 4HYUA 5H3QA 3SOAA 5LVNA 3IOKA 3UGCA 4RIYA 2WMBA 3KMMA 4UWBA 4DEEA 4WO5A 4BYIA 4O7WA 2UZLA 4GUBA 4I5MA 4FA2A 3G15A 3MESA 4RJ3A 4CFMA 1TQMA 3EFKA 3QTZA 5KNJA 4BDCA 4KINA 4IFCA 1SNXA 4HGTA 2W1FA 4N70A 4NT4A 5CAUA 1NT2A 4KBAA 2F4JA 3HP5A 4KAOA 3V8SA 2ZV8A 2JIUA 3GFEA 3IW5A 4AF3A 4FNZA 2F2CB 4LMUA 3FZRA 4MWIA 2J4ZA 3R7EA 2VTJA 4GG7A 4PPCA 2O5KA 4AFJA 2OF4A 4MEDA 1WBNA 4BKJA 3QF9A 2J5EA 2B9JA 4GT4A 3TUDA 3K3JA 4TKSA 3UOJA 5AIRA 4DH3A 5A4QA 2V62A 4RVMA 2ESMA 5LMBA 4RWLA 4FKSA 4WOVA 4XUFA 1W83A 4EOKA 1OGUA 3VBXA 4KKEA 4IVDA 4BF2A 4TYEA 2VNWA 3ZDUA 2QC6A 4YJPA 5G1XA 2YHVA 3TACA 2AC5A 1ND4A 1IR3A 2VWWA 3FKNA 3PXZA 5EOBA 3NIZA 3VUDA 4LGGA 2JKKA 4G5JA 3GT8A 2VTOA 4FTJA 3AMBA 4ITIA 1KOBA 4IWOA 3NUSA 4LMNA 4DH1A 3OWPA 1NVQA 2BZIB 4GFGA 4QMOA 5FG8A 2UV2A 3JYAA 4UX9A 3ID6C 3SAYA 3WF6A 4BCPA 4A9RA 4ZY6A 3G33A 5AAEA 1WZYA 5DOSA 4UMPA 4QMTA 3D2KA 2X8EA 4M7IA 2OSCA 3NSZA 3DK6A 4I6FA 5IA2A 4I94A 3V5TA 4USFA 5CYIA 3R0TA 2PY3A 4ZP5A 4IAFA 3QA0A 5A54A 2UZVA 1R78A 3DKFA 3AD6A 4O2ZA 4BGGA 5JGDA 4OW8A 5KKRB 4BDJA 2W7XA 2ONLC 5BUJA 3FE3A 4BCNA 4FIHA 1NVSA 2Y4IC 3ALNA 3Q53A 3M1SA 3W2SA 3VS1A 3MPMA 4FZAB 4QMYA 5K5NA 4W9XA 2CKOA 5DRDA 3EQGA 5CTPA 5AP4A 2YM5A 4DH8A 3D7TB 3UBDA 2ZOQA 4YZMA 2IVUA 5AWMA 2E9NA 5BVDA 5AP1A 3IW6A 3ZM4A 4B8MA 2X9FA 5EYKA 2BR1A 1FOTA 4DEAA 2VZ6A 3MB6A 4MCVA 2FSLX 3HP2A 3ZXZA 4BHZA 2PMNX 4XG8A 4FKJA 5FGKA 4BYJA 3CTHA 4CMTA 1WVYA 2QU6A 3C51A 4MTAA 2A2AA 3OOGA 1VYZA 3F61A 2B0QA 3R8LA 3HRFA 2VGOA 4OAUC 2HCKA 3KGAA 5E8YA 4Q9ZA 5B2KA 2R3GA 3Q9XA 1J91A 4FTQA 4OT6A 3FXXA 2UW8A 3UOKA 4A4LA 4PX6A 4FKTA 2OJFE 4RLLA 1E1XA 4E4NA 4F1MA 4FVPA 1H1WA 3H9OA 4UYAA 2YIRA 3JS2A 3ELJA 3IPHA 2GNIA 4UALA 3R71A 3BEAA 4IBMA 4JDKA 3U51A 5HTCA 2ITYA 5K5XA 3HV7A 5C27A 2DS1A 2XKFA 4AWIA 3QWKA 3PJ8A 4TY1A 2C0IA 4ASEA 4K77A 4QP8A 2GS6A 2HWPA 4Y5QA 4XP3A 3ZO4A 4FNWA 4X3FA 2RFEA 3BWJA 5E92A 5E4HA 4NM0A 2BDFA 5FTGA 4I5PA 4RZVA 3A4PA 2ITOA 2X6DA 4W8EA 3U9NA 5IA4A 2YLEA 2P55A 3QWJA 1OL6A 4IZ7A 1BMKA 4DTAA 3HMNA 3R8ZA 4RX9A 5FLFA 3ODYX 5C8NA 4O7YA 4EKKA 1ZZ2A 1DI9A 2WOTA 3C13A 3HV6A 3IKAA 5CNNA 4R3CA 2XK8A 4DFUA 2VTLA 4O1PA 2EB2A 2I0EA 3MH1A 3OHTA 4U8ZA 3DPKA 2B9IA 2YN8A 4M8TA 3KMUA 4KIKB 3KXZA 5FWKK 5IQBA 4DG0E 3MFUA 5EKNA 2PVMA 4DTBA 4EHGA 4I0RA 2I0YA 3K5VA 1CKJA 4R8QA 3ULZA 3RPVA 3MY5A 3FHIA 2GCDA 3HV4A 4AN9A 1YI4A 3O0GA 2YZLA 4K11A 5BVNA 4F7NA 3B2TA 5CU6A 3PZHA 3MPAA 4WUNA 4XV3A 4I3ZA 3BYVA 1ZARA 4FEWA 3QYWA 2XK4A 3F3VA 4XBRA 4YPDA 3HZTA 4C33A 2GDOA 3VBVA 4FF8A 2UZDA 3SXSA 4RC3A 5TT7A 4X6RA 5ANIA 4AT3A 3DBFA 2R3PA 4EOJA 1OUYA 2H8HA 3EQHA 4TT7A 3QRIA 5FEDA 4ANNA 2XB7A 4UV0A 1H27A 3QYZA 1U5QA 4U5JA 4ALWA 1Q41A 1KE8A 3VHKA 3LPBA 4KKGA 3LCDA 3KL8A 4TYIA 4HVGA 1JPAA 5H8EA 4LFIA 3FAAA 3PA3A 4PWNA 3UO6A 4LM5A 4CYJA 4FX3A 3KN5A 5CSWA 4IADA 4EOOA 3KK8A 2ZDTA 3MGYA 3NS9A 3DZOA 2QO2A 1A06A 1Q97A 1TKIA 4O6EA 2VRXA 3DDQA 4QP2A 5CU3A 3RAWA 4ASXA 4FTAA 4YO4A 2C3LA 2X9EA 2CGWA 3HMOA 5HTIA 3H30A 3AC2A 5IUGA 3C0HA 2XNOA 3F3WA 3KXXA 3NDMA 4C3RA 2OK1A 3QLFA 4FSWA 5ICPA 2O8YA 2OIQA 4M13A 2R3RA 5HI2A 5E8VA 1FMKA 3C0GA 4WNKA 5CEIA 5EYMA 3ORPA 3FEGA 4Y85A 2VTNA 2W4JA 4IJ9A 5AP7A 4NIFB 4YTHA 2EU9A 1T46A 1B38A 2W5BA 4BY9E 3KQ7A 2XK7A 5CEOA 3BYUA 3NPCA 5IMEA 3VW6A 3NW5A 5GZAA 3NVMB 5AUTA 4X3FC 3SDJA 3PWYA 5C03A 4FV3A 2PSQA 1YXSA 3FLZA 4RPVA 4Y83A 3VUGA 5JGAA 3LMHA 3C5UA 2RG5A 3KN6A 3RI1A 3VS5A 3ZC6A 5L8LA 2R5TA 2PVYA 4IIRA 4U40A 4CZTA 3I1AA 5LVLA 1JSVA 1Z5MA 3U87A 3DAEA 3KVXA 1SZMA 4EJNA 1QPJA 4IXPA 3KULB 1WCCA 2H6DA 4BDKA 3E92A 3RTPA 3F5PA 2R3FA 4YLJA 4XHKB 3VAPA 3KFAA 3ODZX 4PF4A 4BICA 3D7TA 5HHWA 2QOLA 3ENMA 2JFMA 4FEQA 3O50A 5TF9A 3DKCA 4FZFB 3HGKA 3EH9A 4HYIA 3B8QA 5D41A 4FTIA 1PXJA 4N4SA 5BVWA 4R5SA 4AT4A 3W8QA 2C0OA 2V7OA 5CSPA 4AT5A 4DLJA 2VTQA 3D15A 3L9NA 4QMXA 4JG6A 4E26A 3MB7A 3QQUA 4AN3A 1IA8A 1QPCA 3ORIA 1Z9XA 2RGPA 3WIGA 3H9RA 1OKYA 4TNBA 5AV3A 2HZIA 4V0GB 3DBDA 3NYXA 3KRLA 2VGPA 4AAAA 3Q2JA 4KRDA 2Z60A 3QQLA 4V01A 4IWDA 3MH3A 3E93A 4QNAA 2PMIA 1E9HA 4G9CA 4UB7A 3HAVA 3CJFA 5HU3A 3CQUA 2C6DA 3O7LB 4PL4A 1JWHA 1RQQA 5IA5A 5M09A 3UOHA 4K6ZA 3R1QA 3CGFA 4FSYA 2CKQA 5M08A 2XK3A 2ITZA 2P4IA 5FEEA 3UNZA 1OI9A 1H24A 4NKAA 4YSMA 4XG9A 4DFLA 5KMNA 2G15A 3I4BA 4DINA 3A7HA 3AT4A 1EH4A 5HNGA 2ETRA 3CE3A 4QTBA 3FPQA 5FUTA 3CC6A 3A7JA 3FMKA 4QMZA 3EN7A 3FL5A 4EZ3A 2A19B 4ZXTA 5IH4A 2YISA 4EOSA 2R3NA 1GJOA 5T68A 2C69A 4L68A 4Y73A 3SLSA 1P2AA 3T9TA 4AZEA 4L01A 4GFMA 4L45A 3ZLXA 3SKCA 4B7TA 3R7VA 4JAIA 1E1VA 3A7IA 1ZRZA 3EL8A 3ZUVA 3NNWA 3QU0A 2VO0A 3O51A 4H3BA 4W4XA 4AGDA 4CLIA 1IASA 3UIBA 1M2QA 3WZDA 4G6NA 4KBCA 3HMMA 3COMA 4FV0A 5DFPA 3NUYA 5FBOA 2X2MA 3FKOA 4CTCA 1FINA 3MIYA 4KIQA 5JFWA 1P4FA 3UTOA 5LCJA 4EK4A 2WGJA 2IZTA 4C57A 2CNQA 4YPSA 3G0FA 3HVCA 5KKRC 4JBOA 1PXIA 4ZJJA 4TL0A 2FUMA 4OGRA 4FOBA 4R7BA 2GNGA 4QTCA 4AZWA 4FEVA 3H4JA 2UVZA 5EW3A 2YEXA 3FZSA 3U8WA 1PYEA 2OG8A 3LFNA 3BBTB 3FPMA 3FXWA 4L7FA 1DAYA 5CLPA 3QC9A 4AA4A 4BDHA 5L2SA 4DEHA 2CKPA 5EQEA 5IQHA 3C50A 3W1FA 3OWKA 3AC4A 4G3GA 3TG1A 3LM5A 5FD2A 2R0UA 5L6WL 4AN2A 2HIWA 2YDJA 2BDWA 4QP3A 5HX6A 5IZFA 3UMXA 3GU6A 2PVLA 1B39A 4FMQA 1AD5A 5CY3A 4MNFA 2XKEA 3JY0A 5CAVA 3P7CA 4H3PA 4F99A 2GQSA 3NUUA 3KC3A 4XX9A 4U3ZA 1KWPA 3QCQA 1CDKA 4QTDA 4R77A 4F0FA 4L3LA 2JKOA 5HVYA 1MQ4A 2VWXA 3AD4A 3DNEA 2BKKA 2WU6A 5IQFA 4JRNA 5E7RA 1OB3A 5M06A 3CY2A 1SVHA 2OFVA 4TWOA 4PMTA 4Z7HA 5KHXA 4FR4A 2QU5A 3K54A 2W99B 1RE8A 2V55A 2XK6A 4Y8DA 2R3HA 3F66A 1BI7A 3ZSHA 2CCHA 3DLSA 4JG8A 4PTCA 4ERWA 2RFSA 4I0TA 2IZSA 3OBGA 4K33A 4QMNA 2C3IB 4GUEA 2OIBA 4DFNA 4U80A 3ORXA 5FP5A 5K3YA 1UV5A 3CD3A 3D83A 1M7QA 5HBHA 2WB8A 3FMNA 2F2UA 4O21A 5ANJA 5L4QA 4O7ZA 4M3QA 4MXZA 4QTEA 3ZRLA 5K4JA 2R3QA 4AP7A 5FTOA 4U44A 3FQHA 5AM6A 3QRTA 3T9IA 2J50A 4FV2A 1CTPE 2GPHA 3GU5A 1OZ1A 3KULA 4TWPA 4BZNA 3HMPA 4ZSLA 3F9NA 5IDPA 5LMAA 3BYOA 1WBVA 3MFSA 5EM6A 3VHEA 3ATTA 2FSOX 2VTHA 3QD3A 5D10A 3DLZA 2CCIA 2CHLA 2WIPA 4LL0A 3CP9A 2F7XE 4F0GA 4IFGA 3FLSA 4ENXA 4HCUA 1GZNA 1UU8A 2QOKA 3CR0A 2XM8A 3ACJA 4FT9A 5IMXA 4GYGA 3CXWA 1GIHA 2R64A 5FBNC 3H0ZA 3VS7A 1QL6A 4YC8A 3NGAA 5HE2A 4AOJA 2I40A 4D58A 2RSVA 4FZ7A 4H1MA 3DB6A 1KV2A 3GQLA 4V0GA 5J8IA 3GU8A 3QUEA 2X4FA 5DT0A 3OW3A 3CD8A 3PE1A 4D2SA 1XKKA 3UE4A 3SOCA 2PVNA 4EC9A 4BKZA 2QLUA 5AUZA 4D2RA 3D14A 2IN6A 4A4OA 4JS8A 4DTKA 4E7WA 3BIZA 3NVKI 5ETCA 1A9UA 5CQUA 2GNLA 3UC4A 2BIKB 4UN0C 1BKXA 4DYMA 4EH9A 1OL5A 4EHZA 4MH7A 4GW8A 3C0IA 3Q9ZA 5JFSA 3HAMA 2CN5A 3D0EA 1YDTE 3R2YA 4QPMA 5CU2A 5K9IA 3A8XA 3E64A 3VBQA 4QMQA 5E90A 3CQWA 4CEGA 5AP5A 2UW0A 3ZO3A 3P86A 1PW2A 4CSVA 1ZYCA 1QPDA 4D28A 5HG5A 3DBEA 2OXYA 2W1HA 2F49A 5JT2A 4GCJA 4RX7A 3NW6A 4RFYA 4UY9A 3PSDA 4QT1A 5E8TA 2UW5A 3ETAA 4R6VA 3QALE 3V6SA 4F9YA 5L2TA 1P4OA 3BQCA 4CXAA 3ET7A 4BI0A 4O83A 5DLSA 1ZWSA 2OJJA 2QLQA 3AG9A 4EL9A 5DA3A 4M68A 4BBEA 3RZBA 2YIYA 1H25A 2PVKA 1XH4A 2BIYA 4JAJA 4CFUA 4F6UA 5LWNA 2OJ9A 4EWQA 3A4OX 4RVKA 2VTSA 3COHA 3OEFX 4YHTA 4D5KA 1YDSE 4FT3A 5B2MA 3VBYA 5CENA 3GCSA 3LFFA 4MAOA 2GQGA 4R3RA 5B0XA 5L2IA 4YTIA 3D5WA 4X7QA 3TNQB 4MK0A 5KBQA 3MFRA 3RZFA 4G6LA 5IISA 1XBAA 2YJSA 3ORLA 4XEYA 3ZOSA 2W1EA 2Y0AA 4D55A 2E9UA 4MBJA 3AOXA 4AW0A 4WRSA 3BQRA 4YZNA 3BGQA 4M0YA 2PE1A 3LE6A 2NNWB 1H1RA 4FV7A 4BRXA 4Z16A 1H01A 2CGXA 3DJ5A 3FI3A 2GSFA 2XIYA 1YWVA 3UJGA 3VULA 5HLPA 1PXOA 2P2HA 3LXPA 4KD1A 4C58A 4I21A 4FICA 4QQTA 4K0YA 4ANQA 5EW9A 3PJ1A 4BC6A 3QFVA 1HOWA 3E8CA 5CSHA 5K0KA 5IA3A 4S30A 4YBKA 3R9HA 2R3KA 2ZDUA 3GCUA 4MBLA 4AZFA 1OBDA 2PZIA 4O96A 2G01A 3RBWA 2QODA 3HRCA 5HO8A 5TO8A 3A8WA 5CI6A 2VNYA 1AGWA 4RG0A 4D4SA 1IAJA 5EHYA 5CZHA 4RZWA 2VO7A 5CSXA 2BMCA 1URWA 1XWSA 1J3HA 5IQDA 3GENA 3DJ7A 1ZY5A 1OUKA 4FT0A 3VN9A 1WBOA 5ANEA 4FT5A 3UQGA 3P4KA 4HVIA 1OIUA 3PY3A 3EN6A 3MA6A 2WEVA 3ZFMA 2EXEA 5I9WA 4OTWA 3DAJA 5KMLA 2YERA 2VO6A 5HX8A 5E8SA 4IQ6A 5AR7A 3ROYA 4BGHA 3WZJA 2JGZA 5J7HA 3LLTA 3K2LA 2UZWE 4PNIA 3IS5A 3HKOA 4IWQA 3SGCA 3NUNA 2WMAA 3FYKX 5H2UA 3QHWA 3TCPA 1WAKA 3V8WA 4EKLA 3PIXA 3POOA 1OPLA 3L8VA 2PE2A 3R7OA 4QPAA 4I22A 1BYGA 5IQGA 2XZSA 2I0VA 1PKGA 1FGIA 5GIOE 4HCVA 4WIHA 4ZTLA 1V0OA 2JKQA 4IDTA 3T3VA 5HTBA 2XIZA 3ENHA 3FBVA 3FZ1A 4JBQA 4IM3A 5EH0A 4FSZA 4CD0A 3FDNA 3SRVB 4J8MA 3RK9A 3VUKA 1XO2B 3BV2A 5JSMA 2VWZA 4N6ZA 4ZTNA 1YOLA 3FSFA 4PRJA 2H34A 5GJDA 5BMMA 5KMOA 1DI8A 1YHSA 2X7GA 3BI6A 4J97A 4TNDA 4ACDA 2F7EE 4UZHA 4HGSA 2FSTX 2W4KA 2X7FA 3O23A 1M14A 2J0MB 4CMUA 1KUTA 4C4GA 5DR2A 4WSQA 4XLVA 4NFNA 3HRBA 2A4LA 2BTRA 5HD4A 3TTJA 2C6OA 3SV0A 3A62A 1MRUA 2VWVA 3PSCA 3O96A 2CNUA 1Q3WA 3W16A 4FG8A 4MWHA 5LCKA 3QCYA 4QQCA 4MQ1A 5KHWA 1H00A 4B6LA 3LCOA 2JDSA 3NUAA 3R8VA 4QYEA 4BIDA 3UZRA 3MFTA 3T3UA 3OVVA 3HDNA 4HZRA 3G2FA 5M07A 4X21A 3PYYA 2OO8X 3R7YA 4EUUA 3CQEA 2ZB0A 4F1OA 4FKLA 4NH1A 1UU7A 5AP6A 3PLAE 4FSUA 4GS6A 4JR7A 3VS0A 5HORA 3L8PA 4QMMA 1H08A 1H26A 3E3BX 3VC4A 4FNYA 5J7BA 3O2MA 5CEMA 2KULA 4GT3A 5CANA 1K9AA 3UOLA 3F5XA 5D9HA 2FGIA 5ANKA 5HE3A 3TIYA 3RWPA 1OMWA 4O7NA 1YWNA 5DEWA 4I5HA 3W32A 3FWQA 4BDAA 3OCSA 2QOCA 4FSRA 2O3PA 3FC2A 4WRGA 2VX1A 4F6SA 5KMMA 3ALOA 4JDJA 5D7VA 4ACGA 5CI7A 3VS4A 2C6MA 1NXKA 5IUHA 2HZNA 4LOQA 3FZPA 4O7LA 3Q9YA 5LVPA 2C3JA 1XBCA 3DOGA 4IZ5A 3RK5A 3LLAA 5KMKA 2C6TA 3EKKA 3FXZA 4K8AA 3GFWA 4U81A 5EM7A 2YDKA 4BDIA 5A4CA 3KMWA 3RPOA 5CAOA 4JBPA 3EHAA 3II5A 4L46A 5IQAA 4L67A 3FV8A 4IB5A 4MF1A 4WNPA 4YLKA 5LOHA 1V0BA 3DGKA 1PY5A 3Q4CA 4FK3A 3C4CA 4G34A 1UNGA 3AC8A 4MD9E 4UMUA 2VWIA 3TV4A 4XP0A 4BTMA 4C34A 2ZV7A 3IK3A 4KSPA 4QO9A 2J7TA 1XH8A 5AMNA 2GHLA 4FKOA 4YC6A 3R1NA 1OM1A 4U43A 2XVDA 2OFUA 1O6KA 2HW7A 3O17A 3FZTA 2W0JA 2XNNA 1CKIA 4KWPA 5HGIA 2OZAA 2W5HA 2ERZE 2Q0BA 4HNFA 3BHHA 4IZAA 5EHOA 3OCTA 3R22A 3IGGA 4E6QA 4NZWB 5JZJA 5CXHA 2O63A 1JKTA 2V0DA 3BLHA 4FKQA 4FVQA 2XK9A 5EOLA 3TNWA 3VNTA 4KSQA 2IZUA 1ZOHA 4J95A 3OY1A 4EHEA 2C5YA 3COIA 4XV1A 4CCBA 4U42A 2OU7A 5DI1A 3MY1A 4QMWA 1WVXA 3EQDA 5AV4A 5JQ8A 4ENYA 1U5RA 2I1MA 3F88A 5M44A 1ZYLA 2C1BA 2W1GA 4I20A 2BILB 4OTIA 1Q4LA 4EOLA 3QZGA 3VF9A 2WTWA 5FP6A 5HO6A 2Z7SA 2W4OA 2OGVA 3QKKA 3L8SA 2X81A 3LCSA 5CEPA 1PXKA 4IE9A 5A14A 2C5VA 4L00A 3DA6A 4O0UA 4TYGA 4O0SA 2WMWA 5C8MA 3W2QA 5KUPA 3KCFA 3KVWA 4KA3A 4C38A 4CFVA 4JT3A 5I5ZA 2A1AB 4USEA 5IKWA 3UP2A 4ZSAA 2B1PA 2C5OA 4NK9A 3IG7A 3UYTA 1YI6A 1OPKA 3WF7A 3W2PA 2ITTA 2WMSA 1Q61A 5HNBA 4A9TA 1VEBA 2XNEA 1J1CA 5EQYA 4AS0A 3D7ZA 3GP0A 3RVGA 3SRVA 5I0BA 2NRYA 2QONA 1JAMA 2VUWA 4QQJA 4F70A 2R9SA 1OKZA 1PMEA 2WHBA 3QQFA 4G3EA 3QBNA 4YGAA 2ITNA 4FIEA 4XNEA 3WZKA 3DFAA 4RWKA 3WILA 3LVPA 5I3RA 3VF8A 4YUQA 5F4NA 1KSWA 4DT9A 2XYNA 2WIHA 3P08A 3TKUA 4MQ2A 5ITAA 3NUPA 5JGBA 4IB3A 1GY3A 3FUPA 5AV2A 2ITUA 4RWIA 3IDCA 3A60A 1FQ1B 4JDIA 4QYFA 4IC7A 5ACKA 5IA1A 4RJ6A 2WPAA 5L2WA 2XA4A 4DLIA 2VTMA 2WMUA 3JPVA 1RW8A 4KIPA 2QKRA 5M57A 2R7IA 3KB7A 3OUNB 3ZLSA 4EZ7A 1F5QA 3LXLA 1KE9A 3ERKA 5J9LA 3GCVA 3WI6A 1OPJA 2OZOA 2H96A 1FGKA 2PVJA 3MSSA 5CAPA 4C4FA 4GEOA 1BL7A 2BRBA 4DCEA 2IVSA 1ATPE 2R3JA 3QTWA 1SNUA 4ZSEA 3EN9A 2JBPA 3I60A 4NW6A 3U4WA 3DU8A 5IU2A 3FMEA 4I5CA 3TUCA 2QCSA 3FMJA 3L9PA 4FODA 3LQ3A 4PP7A 3E7OA 4S34A 3QX4A 4KKHA 4BWPA 4ANSA 1W8CA 3RAKA 1GZOA 1V0PA 3FMHA 1Q24A 4UXLA 3LAUA 4ID7A 3UMWA 5IA0A 5IQCA 1BX6A 2BCJA 3RPRA 3V01A 3PVGA 5C4LA 3DBCA 1WBPA 2JDVA 2IW8A 5BPYA 3JVSA 2UZUE 3MV5A 4KIOA 4LL5A 3R9NA 3ORZA 4BBFA 2QG7A 3GCQA 2J90A 3R28A 3Q3BA 4YJNA 3KRJA 3MYGA 5A4LA 5KMIA 4RWJA 1H0WA 3MTFA 4FL3A 3OEZA 4O38A 4F7SA 2UZBA 4U9AA 5DIAA 5JZNA 3POZA 5EM8A 4D1SA 4AA0A 3W55A 5CT0A 5JK3A 4YTCA 4DITA 4BCKA 4BHNA 2WNTA 5I9XA 4BCQA 2CGVA 3MBLA 3P9JA 2FH9A 4G3FA 5HE0A 2WTKB 4MBIA 3LXKA 4EQMA 3C1XA 3G0EA 2NPQA 5CWZA 3SXRA 3BHUA 3ZLYA 3PXFA 4XMOA 5JEBA 2W17A 3OS3A 3NCGA 3SD0A 4IB0A 2HK5A 3QQHA 2BRNA 5FXQA 3R8UA 3ROCA 3VQHA 2I7QA 3QTIA 5HNIX 5JRSA 4AZTA 3I0QA 4GIIA 4TZRA 1ZYDA 4GT5A 4H39A 2AYPA 5J9ZA 5T3QA 5J1WA 1M7NA 2PUUA 4A9UA 4FUYA 5HIDA 3QTQA 4IX6A 5D1JA 1YWRA 2CGUA 2BVAA 3ITZA 3V04A 3WF5A 5K0XA 3GBZA 4JNWA 4M67A 5JFXA 4UZDA 3UIUA 5L8KA 1YRPA 4XJ0A 5FM3A 4DGLC 1Y6BA 3EL7A 3F3ZA 5E8XA 5DN3A 3BLQA 3GUBA 3FI2A 4FKUA 4BDBA 4R3PA 4AW1A 4ZMEA 1MRVA 4O82A 3Q5IA 3EJ1A 4YURA 5IPJA 5CZIA 1WVWA 4QOXA 5TOZA 3WARA 5I4NA 2WXVA 4I23A 4FSNA 2QHMA 2WOUA 4L42A 3REPA 3Q32A 4CV9A 4KB8A 5F9EA 2QOHA 4EYJA 1R0PA 2XP2A 4JLCA 4HW7A 2QOOA 4IJPA 2YAKA 3TNIA 3AC3A 5DR6A 1Y8GA 2SRCA 2B52A 2UW4A 3FYJX 4M15A 3BE9A 4P4CA 3QZHA 1YOJA 3BV3A 2RFDA 3QCSA 2J0LA 3MWUA 1Y57A 5TKDA 1LEZA 2JAMA 3UZTA 3UNKA 4QMVA 5IQEA 4G2FA 5B7VA 2DWBA 5L3AA 2CPKE 4RRVA 2WTIA 2XYUA 5H8GA 3MTLA 3PIYA 3UVRA 1G5SA 3H9FA 5AR2A 2YIXA 3VRYA 2CLXA 3MJ1A 1S9IA 3VO3A 3CSVA 4H1JA 3TXOA 1O9UA 3KXGA 2DYLA 2PVFA 3GB2A 2V7AA 4GJ3A 1KE6A 2O64A 4O6LA 4HYSA 4A06A 1NA7A 3SG8A 3MPTA 4RIXB 3O8UA 2XUUA 1BI8A 4HGEA 5AV1A 2PULA 1KV1A 1FPUA 3DV3A 3LMGA 3E7VA 4H36A 4X3JA 5A4EA 5FDXA 3WE8A 2YCFA 1X8BA 4C8BA 4BL1A 2XJ1A 3BHTA 2DUVA 4LGHA 4RC2A 5ACBC 4C4JA 5E9EA 2X8DA 4C3FA 2J0JA 3D2IA 3QQGA 5BX0A 4E6AA 3OMVA 5FXSA 4E6DA 4O0XA 3GXLA 4DF3A 2JAVA 1OIQA 3F2AA 4DBNA 4WSYA 3CPCA 3HV3A 4FZ6A 4FV1A 3WOWA 1PHKA 4WBBB 5EKOA 3S00A 4F9CA 1PMVA 4O0WA 4KIKA 2FSMX 2YCRA 5CS6A 2C30A 3CKWA 2OF2A 2OICA 4E20A 2WQNA 4BZOA 3R30A 2J51A 1PF8A 3SXFA 4P90A 5B2LA 3PUPA 3UO4A 3UODA 4CMOA 5TE0A 1W84A 1WBWA 4WNOA 5AP0A 2WQBA 4RX5A 1O6YA 5LVMA 1K3AA 4ALUA 3QAME 4XCUA 4O7RA 2QURA 1Q8UA 4ZTHA 3BWFA 3CS9A 4JQ7A 4QYGA 2FB8A 4CNHA 4DFYA 4YZDA 4EQCA 1PMNA 5A6OA 2R2PA 1U54B 4FTMA 3UC3A 2VAGA 3ZUTA 2QO9A 4B0GA 1IEPA 4TW9A 4D1ZA 5IEXA 2Y6OA 3I7BA 4NW5A 3O7LD 2ITQA 3M42A 4MNEB 4BDEA 4BTKA 3AGLA 5KZIA 2PU8A 3TZ9A 2P0CA 3SVVA 2XJ0A 4FKWA 4DGMA 1LEWA 4K9YA 1FVTA 3OG7A 5A4TA 4FGRA 2WFYA 5J5TA 3PVWA 4PMPA 3PP1A 2OI4X 4AOTA 1JLUE 3S4QA 1XR1A 3GC0A 4YO6A 2BZHB 4Z7GA 4OUCA 3V8TA 3PG3A 1OITA 4DGOA 5HE1A 3LJ0A 3U6JA 3NRMA 2OIDA 4CFFA 5DH3A 4FYOA 4RIWB 3FQEA 3OXZA 5AV0A 2BPMA 5HCXA 2IVTA 4BR3A 3CTQA 4BGQA 3Q52A 2PYWA 3FZOA 3ZEWA 3JVRA 1U59A 4F4PA 3CJGA 2R4BA 3DK7A 4LGDA 3FMMA 2G2IA 3MS9A 4XP2A 4YHJA 5GNKA 3PY0A 2UUEA 3QTXA 3V5LA 4OTRA 3ZEPA 2AUHA 4O86A 1LUFA 5F20A 4D2PA 4I1ZA 4YSJA 2OJIA 2XKCA 4NIFA 4XG6A 2G9XA 2WTJA 3AMYA 3F3UA 4GIHA 3NEWA 4YZCA 4D2TA 2IVVA 2EWAA 2YAAA 4FTTA 4RA5A 4DH7A 3BEGA 4FV8A 3R01A 4X2KA 4EZ5A 4U0IA 1ZYSA 4GU9A 3LFAA 3G9NA 3PIZA 2GHGA 4FV6A 4V04A 1YXUA 4ZOGA 4YJVA 3RP9A 3BU5A 1SMHA 4I4EA 3RCJA 3TIZA 4DEBA 4CKIA 5KE0A 3EKNA 4AQCA 2ETMA 4FTLA 3UNJA 3HNGA 2C6EA 4IAKA 4S2ZA 3ZSIA 4BTJA 4EHVA 3VUIA 3VUMA 2B9FA 1P5EA 2YIQA 3N51A 3PWDA 3S0OA 1REJA 2R3IA 4JOAA 1G8SA 4CQEA 3RALA 4F6WA 2C47A 3OCBA 3FC1X 4FTNA 3E8EA 4RJ8A 5F94A 4LRMA 2VD5A 4F7LA 4ORKA 2O0UA 3MI9A 2UZOA 2WMQA 3G5DA 3GU7A 1I09A 5C1QB 4NCTA 2VX3A 3ZZEA 3AQVA 4J96A 4JRVA 4PMMA 4YP8A 4BDGA 4EUTA 3E88A 4L9IA 3PSBA 4C0TA 3CLYA 1M2PA 3PTGA 4E1ZA 1JKLA 1R1WA 1OL7A 3HLLA 5ETIA 3OTVA 4RVLA 1T45A 3OC1A 3RM6A 4FL2A 4IB1A 4APPA 4BDFA 4CFNA 1FMOE 2IW9A 3I0OA 2B9HA 2BKZA 3VVHA 4AOIA 1IAHA 2IWIA 4OTDA 4BBMA 4EEVA 1GOLA 4B99A 1B6CB 2XF0A 2E9PA 3DTWA 3WE4A 3SHEA 2J2IB 5A46A 3KA0A 4LQMA 1UU9A 5I9UA 4I6BA 4O0RA 4OBOA 4BWXA 5BYYA 3OWLA 3WBLA 1Q5KA 4AW5A 3PP0A 2C5NA 2XKDA 4M84A 3IDBA 4PTGA 4RIXA 4XBUA 4EOMA 4EYMA 5LARA 3PA5A 3LM0A 4Y72A 4WBOA 5HICA 2OBJA 1DM2A 3GC8A 4FI1A 4H3QA 4OBQA 5M53A 5HLWA 4ZJVA 3R7UA 4RGJA 5E1SA 5HCYA 1YQJA 2CJMA 4FUXA 5EDPA 2WTVA 4HYHA 3R8MA 2GMXA 5F95A 4HVSA 2E9VA 3GEQA 4X2FA 4P5ZA 1XBBA 1AQ1A 3MH0A 3HX4A 4ZZNA 4ZLOA 4CGAA 3G9LX 3I5NA 3PPZA 1O6LA 4G9RA 4GMYA 2ETKA 1DS5A 4DE4A 3A7GA 3LFCA 5HBJA 1SVEA 3GU4A 5FQDC 5BVOA 4O0VA 4O0TA 2WEIA 3TKIA 2YITA 2ZYBA 1URCA 2CLQA 3EFLA 4MD7E 2JFLA 3E3PA 5GZ8A 2E2BA 4PP9A 4G6OA 4ZS4A 4NM5A 3D5UA 4TWNA 2JDOA 1H1QA 2WTDA 3W2RA 4C4HA 4OAVB 5FDPA 4ITHA 4FV5A 2X8IA 4R5YA 2QVSE 3CEKA 3Q6WA 3ZFXA 4GRBA 5EK7A 5EI6A 4G5PA 2YACA 5CSVA 1Z57A 4L6QA 4A4XA 3UG1A 4MXXA 2CNVA 2PVHA 2VTIA 5AEPA 1UNHA 3CKXA 3GC9A 4DFBA 3KRWA 3NWWA 3RK7A 3VJOA 1ZY4A 3BHYA 2WQEA 3PA4A 5I3OA 1UNLA 2GQRA 3LQ8A 2Y7JA 3AXWA 5ANDA 3ZH8A 3ZLWA 4CQGA 4TN6A 4BB4A 3JUHA 1JVPP 3EIDA 3FMDA 4EH6A 3KU2A 3Q2MA 4FTRA 4ZSJA 3GOPA 5HD7A 4GSBA 1H4LA 3CY3A 4NCTC 5BYZA 2XNGA 5I9VA 3PPKA 2Z7QA 5BNJA 2P2IA 2EVAA 3TKHA 3MVMA 4B9DA 2CMWA 2XMYA 4O7TA 3MVLA 3VIDA 2YABA 3SA0A 3M11A 4C02A 1YVJA 3F5UA 2XIXA 2YIWA 2AC3A 3QUPA 3THBA 2BAJA 1S9JA 3H0YA 4RIWA 4D5HA 1IA9A 2WQOA 2KTYA 4ANLA 1MQBA 2XEYA 5KBRA 4CLJA 2BHEA 2PVRA 3NZ0A 2IO6A 3BBWA 1TQPA 4EORA 4EK3A 3NNXA 1CSNA 4JX7A 2A27A 4J71A 5IQIA 4D2VA 2G2FA
chains in the Genus database with same CATH superfamily
4AGUA 4ZZOA 2BRGA 2Z8CA 1I44A 3UQFA 4BKYA 1ST0A 3OP5A 4QDEA 3DQWA 3NYVA 2XNPA 3BKBA 2W06A 3PPJA 1V1KA 4IVCA 4HPTE 1GIJA 3EQRA 3L9MA 2YCSA 3D9VA 4AZSA 5LXMA 1Y8YA 4WG4A 2V5QA 4BCJA 4F64A 2B55A 4I0SA 2R3LA 3O8TA 3QGYA 5DHJA 3Q4ZA 4IACA 1ZYJA 3HEGA 3MIAA 3OZ6A 4QP7A 3V5JA 4OT5A 3LXNA 4DA5A 5AAFA 3GCPA 3RGFA 3LMIA 4AE6A 2YM6A 4I24A 4X0MA 4DFZE 3RINA 4DHZA 4JIAA 3HECA 4CKRA 3ZM9A 3TN8A 1YKRA 2XCHA 4XH6A 3UDZA 3PRFA 3MVJA 4MUQA 3FMLA 3LFEA 1J1BA 3BCEA 2Z7LA 3PG1A 5DBXA 2OKRA 3DQXA 4JQ8A 1IRKA 3DZQA 2ZV2A 3IOPA 3R73A 2ACXA 3R9RA 3GNIB 2R7BA 1HCLA 2ITPA 2J0IA 3DB8A 3Q96A 4XOYA 3OY3A 4ACCA 3UPZA 2JDRA 4PDSA 4PDPA 4CVAA 4RFMA 5G6VA 4K2RA 5AA8A 1MRYA 4O7VA 1XH7A 4FIJA 4ZMFA 4YU2A 4FT7A 3MVHA 5ANGA 2QOQA 4PPAA 4IAZA 3KCKA 2QKWB 3M2WA 2HAKA 2FYSA 1BUHA 3ZTXA 4OTHA 3R7IA 3KXNA 4A9SA 5E8WA 3QTSA 5ANOA 5DR9A 4Z55A 4KABA 1NVRA 3FSKA 4L3JA 4F65A 4ZS0A 3ATSA 4X6QC 3OXTA 4W4YA 2CDZA 2HENA 3DJ6A 3F6XA 4XV2A 4B8LA 5HU9A 4DH5A 3QD0A 4PMSA 2I0HA 3KEXA 4ALVA 3HYHA 1G8AA 1Q8YA 4GVAA 3ZS5A 4AZVA 1KE5A 2PMLX 3NAYA 4J99A 5EFQA 3R83A 3P1AA 3WIKA 4Z3VA 2C6KA 3EYGA 3FQSA 4B4LA 4HVHA 4RJ5A 3AGMA 1WMKA 4NJDA 1J7UA 2RG6A 3Q60A 4F09A 3AMAA 3S3IA 4MKCA 4PDYA 2W1IA 3A7FA 4LV5A 3BGPA 4X3FB 3GI3A 1YHVA 1J7IA 3EN5A 3I6UA 1M2RA 3BLRA 3N9XA 5L2QA 4ARKA 2UZEA 3VUHA 4TXCA 2Y4PA 2BRMA 2YLFA 3COKA 2RKUA 3C4ZA 3EN4A 3W0NA 3PY1A 3BU6A 2JD5A 4ANMA 4U45A 4C59A 1SVGA 2W9ZB 2OH0E 1DAWA 4J8NA 4OTQA 5GZ9A 3CPBA 4EH3A 3OD6X 4DBXA 4FBXA 4M69B 2O2UA 2XH5A 3BZ3A 4BCFA 5CU0A 2PPQA 1H07A 2PE0A 4QNYA 1OIYA 3TUBA 4PL5A 4DGNA 1XQZA 2QHNA 4HZSA 4IAAA 4JIKA 4CTBA 4EONA 4C35A 4F08A 2YM4A 4YJQA 2GS2A 3MY0A 2QQ7A 4NU1A 5IF1A 4I6QA 4ZSGA 3TM0A 3FY0A 3ANQA 2W1ZA 2YFXA 3UZPA 4FGBA 4QMUA 4C4IA 2W9FB 4BWKA 2ZMCA 2PUNA 2RIOA 3N4TA 3FJQE 4LYNA 4S31A 4XOZA 3WF8A 3PE2A 4FSMA 4KUJA 4UBAA 1RJBA 3ORKA 4OTPA 1QCFA 3IONA 4LRKA 4GK2A 2Z2WA 5CNOA 3ANRA 5IEVA 4YHFA 2OW3A 4GV1A 1LR4A 4DT8A 4FYNA 1U4DA 4J98A 3F2RA 4I92A 1GNGA 2FO0A 3P79A 4YR8A 1YXXA 3GVUA 2W05A 3QHRA 2ZB1A 4RBLA 4EH5A 3EZRA 3RNYA 4AUAA 2XRUA 3LIJA 4NWMA 4ZLZA 3LJ1A 2P33A 4AXDA 3HUCA 1IG1A 2VWYA 4EK8A 1FBNA 3WYYA 3BHVA 3EMGA 4MYGA 2X0GA 4MX9A 5CT7A 4ZEGA 4O7SA 5EG3A 3GGFA 3GC7A 4JI9A 2IZRA 3SQQA 5GINE 2C6LA 1VJYA 4XS2A 4F9WA 3ZZWA 3R21A 4MF0A 2GU8A 3LFQA 1ZMWA 3SC1A 3C4EA 2HY81 3E63A 4YNOA 3UQCA 4RX8A 3R00A 4R1YA 5C9CA 3VUTA 3EQFA 2FVDA 4IX5A 5KZ0A 3LQ5A 3ZFYA 4AU8A 5D12A 1PJKA 3KXMA 2QR7A 1A48A 3BYSA 3ZDIA 4E3CA 3QUDA 4MXYA 3V5PA 4L53A 3ZHPC 3QD4A 3U6IA 4JR3A 2XNMA 3UP7A 1YW2A 3UDBA 3G51A 4MXAA 2XNBA 5GHVA 3UO5A 2GFSA 4YJSA 2BFXA 1GAGA 4XV9A 4DEGA 4EJ7A 3HMIA 3P7AA 4D9UA 2QOIA 2W1DA 4C61A 1STCE 4Y95A 4IAYA 4R7IA 3G90X 2ZM1A 4O22A 4NUSA 2X7OA 4IDVA 3EQPA 2X0PA 1Y91A 5LQFA 3C7QA 3TWJA 3QRJA 2JC6A 5CF4A 5IEYA 5IG1A 3SX9A 5AADA 3W0PA 5C4KA 5AAGA 4FZDB 1CMKE 2Q83A 2OXDA 3R1SA 4IC8A 3R04A 4BI1A 2YWPA 3B8RA 1REKA 1GZKA 2LGCA 3NYNA 4HJOA 3DBQA 3F7WA 4FC0A 4ZK5A 2VWUA 1VYWA 4C2WA 4I93A 4C3PA 2HXLA 3UPXA 4FEXA 4WG3A 5DG5A 5J9YA 1HCKA 4N6YA 4NSTA 3Q9WA 2VTRA 4E4LA 2ZMDA 2HY0A 3C9WA 4DEDA 5HBEA 5DYJA 1J7LA 3W0SA 3F69A 2R3MA 5M4UA 3FHRA 2QNJA 2NO3A 3HA8A 3P5KA 4GU6A 4JQEA 5TR6A 4WG5A 2VO3A 2R0IA 3NCZA 4V05A 1UVRA 2CN8A 5BQ0A 3ORTA 4RQKA 2Z02A 2BAKA 4AAYA 1H1SA 2PMOX 4QMSA 2LAVA 1OL2A 4FL1A 3T8OA 4L8MA 4UEUA 1JBPE 3I79A 5JFVA 5EDRA 2R3OA 4MXCA 3I81A 5HG7A 3DK3A 5BUIA 5CF8A 5EI2A 2C0TA 2IW6A 1ZZLA 4QD6A 5BVEA 5JQ5A 5HVJA 4LUEA 1JSTA 2F57A 4QYHA 5IDNA 4UMQA 3V3VA 3BPRA 5M4IA 3MA3A 5KCVA 4FVRA 1PXNA 3HDMA 3U9CA 4ZY5A 5CQWA 4BI2A 3FLWA 3FLNC 4E4MA 1ZLTA 5CVGA 5GIPE 3AC5A 4BCHA 4JXFA 3W33A 3U54A 3QZIA 4KS8A 2BHHA 4FTKA 5CALA 2CKEA 2XBJA 3NR9A 3R9DA 4KBKA 3VS2A 4DG2E 2VTAA 3BYMA 2A0CX 4RLKA 4RMZA 2XRWA 3FY2A 4WKQA 3TJCA 1YI3A 2GS7A 4BCIA 4D0WA 4M69A 5ETFA 5CEQA 5HESA 3BU3A 4JJRA 5DRBA 3U55A 4ZJIA 4AXAA 1OECA 4ZTRA 3KRXA 4ANOA 4GVJA 3EB0A 3S2PA 3IDPA 4PQNA 5KMJA 4C36A 3Q6UA 5J1VA 3CGOA 3E8DA 1Q3DA 1NY3A 3D5VA 1KE7A 3K3IA 4ZTMA 4FIFA 4DC2A 4FSTA 5CVHA 3ZRMA 2J5FA 3PFQA 2YA9A 4QTAA 1ZMVA 1YXVA 2YM3A 4IH8A 4O91A 3PJ3A 3CCNA 4CRLA 2EXMA 4HGLA 2UZNA 4FKPA 4PPBA 5M55A 5CVFA 5T6KA 4GKIA 4JG7A 3VW8A 3LFBA 3OUKA 2AQXA 2OWBA 4YJRA 2HXQA 3CTJA 3W0OA 4EQUA 4PTEA 1VZOA 3ORMA 1Q99A 2UW7A 5FEQA 1PXPA 3QXOA 4ACHA 4YJOA 5EW8A 3UIXA 2I6LA 3JY9A 2ITVA 3FI4A 2QOFA 3O71A 2RFNA 3I6WA 3VWAA 4WD5A 4F1TA 3EQBA 3EWHA 4EC8A 2PZYA 5AFVA 1UWJA 3NFGB 4II5A 2PZPA 3Q5ZA 5DVRA 5E8UA 3EOCA 4FNXA 4C37A 3D94A 3R02A 4ASDA 5BUEA 1R3CA 3P78A 3EZVA 3JR1A 2E9OA 3OT8A 4GK3A 2Q0NA 4DHJA 4LDTA 2VV9A 1LPUA 2X2LA 3QCXA 1H1PA 5BVFA 4NTSA 5LMKA 4DN5A 4CYIA 4C4EA 2ITXA 2W96B 4Q5EA 4IMYA 2ZM4A 2WO6A 4EK5A 3P0MA 5C26A 5F1ZA 1F3MC 1UKIA 3LFDA 3Q4TA 3EQIA 4IEBA 5DWRA 5CAQA 5EYDA 3TZ7A 5HG8A 1G8JA 2GNJA 3C4WA 3QKMA 3W10A 1SM2A 2EUFB 3ZONA 4E5BA 4YMJA 4O84A 4Z9LA 3QD2B 4PY1A 4XLIA 4CFWA 2H9VA 3EFWA 5I9ZA 4WT6A 3C5IA 3OT3A 3E8NA 4R7HA 4BCMA 4DFXE 5LJJA 1PRYA 2CSNA 1ZXEA 5GJGA 1U46A 3QLGA 4WA9A 5AM7A 4TTHB 3TJDA 3ULIA 5HO7A 4P2KA 5IUIA 5AR4A 2F9GA 4O4EA 4FTOA 4D4YA 2FA2A 1JQHA 1W82A 3DDPA 4I4FA 2JLDA 3HUBA 2QOBA 4YZBA 4F63A 4FKRA 4ITJA 4NM7A 4AE9A 4Q2AA 4EOIA 4E93A 3Q4UA 2JKMA 4WNMA 5FRIA 3PRIA 4XYFA 2ERKA 4QMPA 4CT2A 5AP3A 1OKWA 1APME 3EYHA 4EBWA 5I9YA 2EB3A 3PXKA 2C5XA 3MW1A 5CF6A 1XH6A 5CASA 3DFCB 3OROA 5JKGA 5JMSA 3S95A 4BTFA 1G3NA 2BFYA 2C68A 4FSQA 4O2PA 5D7AA 4DGGA 2ZAZA 4X2NA 3TV7A 2Y9QA 4FTUA 4YZ9A 4EOPA 2PUIA 3FLQA 5D11A 4RT7A 4E5WA 2BROA 2WAJA 4AXFA 2B53A 3RPYA 3V51A 2BALA 4TWCA 5EHLA 3RJCA 5EQPA 4LI5A 4PNKA 4YTFA 2WTCA 2IJMA 4BN1A 4FK6A 4M14A 2Y8OA 4EOQA 4XG2A 2ZV9A 2YJRA 3MJ2A 2IPXA 4U79A 4D4RA 1JKKA 4IX4A 1YDRE 2ZVAA 3BE2A 3HL7A 5DPVA 4D2WA 2J0KA 2QO7A 4WUAA 5EM5A 1MP8A 3VS3A 4DG3E 5L6PA 4O27B 1YOMA 4X2JA 2JIIA 3TV6A 3VRZA 4AGWA 2X6EA 3L9LA 1GZ8A 1XHAA 4LOPA 2HZ4A 1PKDA 3NNUA 4IANA 4UXQA 3F82A 3PJCA 3R7GA 2OLCA 4F9BA 3E87A 4U6RA 4QYYA 3L1SA 5LMKC 3F5GA 1PMUA 4M12A 5AUXA 4RJ4A 3R1YA 3I7CA 3ORNA 2C1AA 2VTTA 4IW0A 5DMZA 5LVOA 2C4GA 1XH9A 2VN9A 3DXNA 3QRUA 4G16A 4CZUA 1JOWB 4ZTQA 2BZKB 4HNIA 4IAIA 4U41A 4BCOA 2PZRA 4UWYA 4RC4A 5HOAA 3PXRA 1K2PA 2XIKA 4TYHB 1WBSA 3OFMA 3A99A 5DNRA 4AA5A 3GOKA 1VR2A 2GNHA 4LOOA 5EI8A 1UKHA 3OBJA 1JKSA 4RQVA 2UW3A 2UVYA 4JX3A 4Q9SA 4NL0A 3QC4A 4W9WA 2VU3A 1L8TA 4M66A 4D0XA 5M4FA 5A6NA 4ERKA 3QKLA 4I41A 4E8AA 2J9MA 3ZBXA 3EQCA 3W8LA 5HLNA 3OTUA 4PUZA 4D1XA 3QRKA 4J53A 3DNDA 4GJ2A 5E8ZA 4YBJA 4G31A 4CKJA 3AD5A 4UWCA 5M56A 4DEIA 5J79A 3NMUF 5L8JA 3TTIA 1PYXA 1Y6AA 1ZOGA 4OTGA 2YCQA 3A2CA 2XBAA 4L44A 4EH4A 4NFMA 1YXTA 3UVQA 1Q62A 3R6XA 3RAHA 4DHFA 3PVUA 4L43A 5J95A 4HOKA 5CEKA 3FL4A 4P5QA 4ZIMA 4BZDA 2YDIA 1H8FA 1QPEA 4F9AA 4Q5HA 3DTCA 5GJFA 4EWHA 4PV0A 4QRCA 1XMLA 3NUXA 3PXQA 2OH4A 1P14A 2QD9A 3UG2A 3RHXA 5H9BA 4F0IA 4RVTA 2X2KA 4YNEA 3BRBA 4HPUE 3OF0A 2V22A 5AR8A 4EK6A 5A3XA 2PUPA 3TZMA 1CKPA 4E5AX 2C6IA 4RJ7A 4EH2A 5BV3A 3PXYA 4D4VA 4RFZA 4XG7A 3KKVA 1LP4A 1UU3A 5HVKA 1Q8ZA 3TZ8A 1NW1A 1OBGA 3BELA 4WHZA 2WMVA 4NTTA 2RL5A 3QZFA 3WZUA 3DXPA 2PTKA 4YC3A 1M17A 2XM9A 4AFEA 2YM7A 4C7TA 3NYOA 1OL1A 3F3TA 3F7ZA 5CXZA 5CF5A 4BIBA 2B4SB 4IX3A 2B54A 4C62A 3Q04A 3PDTA 2UVXA 4G3DA 2GFCA 2WMTA 3QTUA 4KNBA 1Q8TA 1UA2A 2EXCX 3R2BA 3TNPC 4FTCA 3DKOA 3LCTA 4G17A 3TL8A 3UIMA 5A9UA 3JXWA 3LFSA 4MHAA 4E73A 3KY2A 4OTFA 2B7AA 4IVAA 4LG4A 4BCGA 2BZJA 2HZ0A 3MH2A 3IO7A 3K5UA 1ERKA 3VBWA 4Y46A 3KK9A 3NNVA 4FKGA 4G1WA 4GFOA 3BX5A 4BFMA 5C8KA 2DQ7X 1ZOEA 3L8XA 4UYNA 4MXOA 3UVPA 3UYSA 3IECA 4GL9A 3SW7A 3DT1A 2WMXA 3RM7A 3OCGA 1F0QA 5HIEA 2BRHA 5L6OA 5FM2A 4XRLA 3HA6A 4TRLA 2WMRA 4JBVA 5IH5A 3IQ7A 5HCZA 2WD1A 2YM8A 3VBTA 2VTPA 4ONAA 4W8DA 4CG9A 2WU7A 2NP8A 2G2HA 5ETAA 2YZAA 4F7JA 3LW0A 5DT3A 5AUUA 3QGWA 4K18A 3RAIA 1W0XC 4OBPA 5M4CA 4I6LA 1OVEA 5HKMA 4ZAUA 3E62A 4J52A 4IM2A 2G1TA 4AXEA 3IGOA 4S32A 2F7ZE 1JNKA 4JL9A 4W4VA 4IVBA 5AIKA 2X39A 4ZY4A 3PZEA 5LWMA 3TDVA 3LCKA 3IW4A 3NAXA 2WTKC 4LUDA 3SW4A 4EBVA 1UWHA 2JEDA 4O0YA 2UW9A 3DXQA 3NFFB 2HWOA 4NYEA 5FTQA 2JBOA 3W2CA 4EH8A 2Y4IB 4I6HA 2XCKA 3TNHA 1QMZA 2OXXA 3FKLA 3OW4A 4G3CA 5JN2A 3KREA 2WELA 3D5XA 3DCVA 4JDHA 4RIYB 2X4ZA 1GIIA 3MN3A 2BAQA 5HQ0A 2W5AA 4USDA 2PK9A 5EYCA 4IWPA 3TT0A 4LV8A 5AUWA 1PXMA 2OJGA 1RDQE 4FG7A 3OOMA 3V5QA 4CT1A 1FVVA 4W4WA 5E91A 1XH5A 3DKGA 5AR3A 3RNIA 3R63A 4QP6A 5AA9A 1JSUA 3QTRA 2HELA 1U54A 4GKHA 2GTMA 3QQKA 4E6CA 4TYHA 4QPSA 3WF9A 4GG5A 1XJDA 3F2NA 4MNEA 1FVRA 4DAWA 4X2GA 1MUOA 5BMSA 5IH6A 4N57A 4TYJA 3CIKA 4KS7A 3O8PA 4A7CA 3QQJA 4KRCA 3LZBA 3U6HA 5J87A 2JDTA 5K4IA 4XG3A 4R78A 3R9OA 4CCUA 3QL8A 4GK4A 4O4BB 5H8BA 3PJ2A 3E5AA 4FV4A 5HEZA 3RWQA 4IM0A 3ZXTA 3AC1A 1M52A 4E4XA 4CV8A 2BUJA 4FE2A 3ZBFA 4FKVA 3HV5A 4UMRA 2AEGA 2PWLA 2Z7RA 1W7HA 2XJ2A 2UZTA 4PDOA 4FOCA 4A07A 4QP9A 4AW2A 5AUYA 5JRQA 4A9YA 4ACMA 4FV9A 3ZUUA 3SG9A 2PZ5A 3VJNA 3ZSGA 1R0EA 2GTNA 4TPTA 4CRSA 2ZJWA 3LHJA 3LOKA 5FXRA 4AG8A 5JH6A 3A61A 4U3YA 4LV7A 2XAOA 3TDWA 2VX0A 1R39A 2QG5A 2X0QA 3R8PA 3VS6A 3ZYAA 5AR5A 2W1CA 4QP4A 4QMLA 3NLBA 2X1NA 4FEUA 3ZU7A 3BGZA 4U97A 3RCDA 2VWBA 3H3CA 1WFCA 3IW7A 5AJQA 5C01A 1L3RE 3DS6A 2QI8A 3CBLA 4XRJA 3WYXA 3LKMA 5M51A 4GH2A 3RMFA 3EFJA 3GQIA 3QXPA 3V6RA 4ANBA 3U4UA 4C2VA 2OZAB 1KOAA 2PHKA 4N0SA 2NRUA 4J7BA 4MD8E 4OR5A 3TI1A 4NKSA 5KX8A 4BVUA 2J6MA 5AX9A 2UW6A 3W2OA 3IW8A 1CM8A 4YLLA 1BLXA 3ACKA 3AT2A 3NIEA 3DY7A 2P3GX 3OXIA 4GYIA 4NJ3A 2WKMA 2WZJA 4HCTA 4AGCA 4FIGA 3NX8A 1OIRA 4AX8A 2GHMA 1ZMUA 4H05A 3FI8A 4CFXA 3C4XA 4IZYA 1TQIA 1BL6A 4APCA 4ZLYA 2XS0A 2BDJA 3OWJA 2C3KA 3DAKA 3BL9A 4O1OA 4NEUA 2HOGA 3KF4A 3W18A 5DT4A 1H0VA 2GNFA 4IHPA 1WBTA 3QX2A 3P7BA 4NM3A 4R1VA 2JITA 4DHIB 1OGYA 3V5WA 3ZO1A 3C4FA 4D9TA 1PXLA 1H28A 4YJTA 4FIIA 5J5SA 2O65A 4RA4A 2PL0A 4J1RA 4LRJA 4Y5HA 4AACA 4O81A 3VQUA 4ZZMA 3I5ZA 3N4UA 3H10A 3RHKA 3S1HA 3B2WA 2XEZA 4EH7A 2IG7A 4K1BA 2YWVA 3NW7A 3FLYA 2QR8A 4BDDA 4JVGA 4L7SA 3P23A 2Y6MA 4FG9A 4MVFA 3G6GA 5BVKA 3ZMMA 2REIA 5KO1A 5BYLA 4L3PA 3PLSA 4QP1A 5AP2A 3RKBA 3KRRA 3ZCLA 3G6HA 2JIVA 4BIEA 5AUVA 2WQMA 5CX9A 2HW6A 3AT3A 5EDQA 4HVDA 2ITWA 4CZYB 5DEYA 4PL3A 4YJUA 4DCAA 1TVOA 5HIBA 5DE2A 4UMTA 4U7ZA 5DGZA 3N4VA 4M0ZA 3ZO2A 5AX3A 2BTSA 5HG9A 4OLIA 4FKIA 3PVBA 4QQ5A 4RSSA 5HZNA 4M97A 4ZTSA 2ZM3A 1W98A 4P7EA 5E1EA 3ZRKA 1OKVA 2HYYA 3LJ2A 4H58A 1Q8WA 3WZEA 1SYKA 3KXHA 4EI4A 4L52A 4RIOA 3RPSA 2ONLA 2XIRA 3QA8A 4CG8A 3ZC5A 4ASZA 3D4QA 3TEIA 1ZAOA 4S33A 2RF9A 4XG4A 3KF7A 3MDYA 1YHWA 5CU4A 4HYUA 5H3QA 3SOAA 5LVNA 3IOKA 3UGCA 4RIYA 2WMBA 3KMMA 4UWBA 4DEEA 4WO5A 4BYIA 4O7WA 2UZLA 4GUBA 4I5MA 4FA2A 3G15A 3MESA 4RJ3A 4CFMA 1TQMA 3EFKA 3QTZA 5KNJA 4F78A 4BDCA 4KINA 4IFCA 1SNXA 4HGTA 2W1FA 4N70A 4NT4A 5CAUA 1NT2A 4KBAA 2F4JA 3HP5A 4KAOA 3V8SA 2ZV8A 2JIUA 3GFEA 3IW5A 4AF3A 4FNZA 2F2CB 4LMUA 3FZRA 4MWIA 2J4ZA 3R7EA 2VTJA 4GG7A 4PPCA 2O5KA 4AFJA 2OF4A 4MEDA 1WBNA 4BKJA 3QF9A 2J5EA 2B9JA 4GT4A 3TUDA 3K3JA 4TKSA 3UOJA 5AIRA 4DH3A 5A4QA 2V62A 4RVMA 4FRFA 2ESMA 5LMBA 4RWLA 4FKSA 4WOVA 4XUFA 1W83A 4EOKA 1OGUA 3VBXA 4KKEA 4IVDA 4BF2A 4TYEA 2VNWA 3ZDUA 2QC6A 4YJPA 5G1XA 2YHVA 3TACA 2AC5A 1ND4A 1IR3A 2VWWA 3FKNA 3PXZA 5EOBA 3NIZA 3VUDA 4LGGA 2JKKA 4G5JA 3GT8A 2VTOA 4FTJA 3AMBA 4ITIA 1KOBA 4IWOA 3NUSA 4LMNA 4DH1A 3OWPA 1NVQA 2BZIB 4GFGA 4QMOA 5FG8A 2UV2A 3JYAA 4UX9A 3ID6C 3SAYA 3KIOC 3WF6A 4BCPA 4A9RA 4ZY6A 3G33A 5AAEA 1WZYA 5DOSA 4UMPA 4QMTA 3D2KA 2X8EA 4M7IA 2OSCA 3NSZA 3DK6A 4I6FA 5IA2A 4I94A 3V5TA 4USFA 5CYIA 3R0TA 2PY3A 4ZP5A 4IAFA 3QA0A 5A54A 2UZVA 1R78A 3DKFA 3AD6A 4O2ZA 4BGGA 5JGDA 4OW8A 5KKRB 4BDJA 2W7XA 2ONLC 5BUJA 3FE3A 4BCNA 4FIHA 1NVSA 2Y4IC 3ALNA 3Q53A 3M1SA 3W2SA 3VS1A 3MPMA 4FZAB 4QMYA 5K5NA 4W9XA 2CKOA 5DRDA 3EQGA 5CTPA 5AP4A 2YM5A 4DH8A 3D7TB 3UBDA 2ZOQA 4YZMA 2IVUA 5AWMA 2E9NA 5BVDA 5AP1A 3IW6A 3ZM4A 4B8MA 2X9FA 5EYKA 3PFYA 2BR1A 1FOTA 4DEAA 2VZ6A 3MB6A 4MCVA 2FSLX 3HP2A 3ZXZA 4BHZA 3VONA 2PMNX 4XG8A 4FKJA 5FGKA 4BYJA 3CTHA 4CMTA 1WVYA 2QU6A 3C51A 4MTAA 2A2AA 3OOGA 1VYZA 3F61A 2B0QA 3R8LA 3HRFA 2VGOA 4OAUC 2HCKA 3KGAA 5E8YA 4Q9ZA 5B2KA 2R3GA 3Q9XA 1J91A 4FTQA 4OT6A 3FXXA 2UW8A 3UOKA 4A4LA 4PX6A 4FKTA 2OJFE 4RLLA 1E1XA 3TYKA 4E4NA 4F1MA 4FVPA 1H1WA 3H9OA 4UYAA 2YIRA 3JS2A 3ELJA 3IPHA 2GNIA 4UALA 3R71A 3BEAA 4IBMA 4JDKA 3U51A 5HTCA 2ITYA 5K5XA 3HV7A 5C27A 2DS1A 2XKFA 4AWIA 3QWKA 3PJ8A 4TY1A 2C0IA 4ASEA 4K77A 4QP8A 2GS6A 1TZDA 2HWPA 4Y5QA 4XP3A 3ZO4A 4FNWA 4X3FA 2RFEA 3BWJA 5E92A 5E4HA 4NM0A 2BDFA 5FTGA 4I5PA 4RZVA 3A4PA 2ITOA 2X6DA 4W8EA 3U9NA 5IA4A 2YLEA 2P55A 3QWJA 1OL6A 4IZ7A 1BMKA 4DTAA 3HMNA 3R8ZA 4RX9A 5FLFA 3ODYX 5C8NA 4O7YA 4EKKA 1ZZ2A 1DI9A 2WOTA 3C13A 3HV6A 3IKAA 5CNNA 4R3CA 2XK8A 4DFUA 2VTLA 4O1PA 2EB2A 2I0EA 3MH1A 3OHTA 4U8ZA 3DPKA 2B9IA 2YN8A 4M8TA 3KMUA 4KIKB 3KXZA 5FWKK 5IQBA 4DG0E 3MFUA 5EKNA 2PVMA 4DTBA 4EHGA 4I0RA 2I0YA 3K5VA 1CKJA 4R8QA 3ULZA 3RPVA 3MY5A 3FHIA 2GCDA 3HV4A 4AN9A 1YI4A 3O0GA 2YZLA 4K11A 5BVNA 4F7NA 3B2TA 5CU6A 3PZHA 2NYAA 3MPAA 4WUNA 4XV3A 4I3ZA 3BYVA 1ZARA 4FEWA 3QYWA 2XK4A 3F3VA 4XBRA 4YPDA 3HZTA 4C33A 2GDOA 3VBVA 4FF8A 2UZDA 3SXSA 4RC3A 5TT7A 4X6RA 5ANIA 4AT3A 3DBFA 2R3PA 4EOJA 1OUYA 2H8HA 3EQHA 4TT7A 3QRIA 5FEDA 4ANNA 2XB7A 4UV0A 1H27A 3QYZA 1U5QA 4U5JA 4ALWA 1Q41A 1KE8A 3VHKA 3LPBA 4KKGA 3LCDA 3KL8A 4TYIA 4HVGA 1JPAA 5H8EA 4LFIA 3FAAA 3PA3A 4PWNA 3UO6A 4LM5A 4CYJA 4FX3A 3KN5A 5CSWA 4IADA 4EOOA 3KK8A 2ZDTA 3MGYA 3NS9A 3DZOA 2QO2A 1A06A 1Q97A 1TKIA 4O6EA 2VRXA 3DDQA 4QP2A 5CU3A 3RAWA 4ASXA 4FTAA 4YO4A 2C3LA 2X9EA 2CGWA 3HMOA 5HTIA 3H30A 3AC2A 5IUGA 3C0HA 2XNOA 3F3WA 3KXXA 3NDMA 4C3RA 2OK1A 3QLFA 4FSWA 5ICPA 3AKKA 2O8YA 2OIQA 4M13A 2R3RA 5HI2A 5E8VA 1FMKA 3C0GA 4WNKA 5CEIA 5EYMA 3ORPA 3FEGA 4Y85A 2VTNA 2W4JA 4O4CA 4IJ9A 5AP7A 4NIFB 4YTHA 2EU9A 1T46A 1B38A 2W5BA 4BY9E 3KQ7A 2XK7A 5CEOA 3BYUA 3NPCA 5IMEA 3VW6A 3NW5A 5GZAA 3NVMB 5AUTA 4X3FC 3SDJA 3PWYA <