5EK7A

Structure of the autoinhibited epha2 jms-kd
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
290
structure length
286
Chain Sequence
KTYVDPHTYEDPNQAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin type-A receptor 2
publication title structure of the autoinhibited Epha2 JMS-KD
rcsb
source organism Homo sapiens
total genus 94
structure length 286
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ek7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ek7A01
1W98A 5KO1A 4V0GB 2XMYA 4XX9A 3NYOA 1I09A 3RPVA 5EW3A 3DOGA 4L45A 2OSCA 3WZKA 4F9AA 3E62A 4BDKA 1OIUA 4IB3A 2R3LA 4Q9ZA 4ITIA 3C4WA 3R2BA 4F09A 4GUBA 1YXTA 3A7GA 3QA8A 4GT4A 2OFVA 5FP6A 4E3CA 4C34A 2YDJA 2ETKA 3HVCA 4X3FB 5FUTA 4S31A 2P55A 4XLIA 1WVXA 5ICPA 3VWAA 4AZFA 3U6IA 4NEUA 3RZBA 3NUPA 3EN7A 2P2HA 4BHNA 1REJA 3E7VA 5BVWA 4O2ZA 3IQ7A 5BVDA 3TUDA 2JBPA 2BIYA 3PXQA 4WG4A 5CU2A 5IQHA 3KU2A 5M06A 1PXNA 4A7CA 4R3RA 4BDEA 2VTNA 4I41A 4BIDA 3VBWA 4O7WA 1FOTA 3EQGA 1KE8A 2VO7A 2VWZA 3AT3A 4UX9A 3BWJA 2VTSA 3QZHA 4I6HA 2X7GA 4QQTA 2RGPA 3P08A 2CCIA 5ANIA 4CV8A 3U87A 3R7UA 4H1JA 3RNIA 2H8HA 4YNEA 4BDHA 5KHXA 1GNGA 1JSUA 5EI2A 5EK7A 3LCTA 3S0OA 2WPAA 4MXOA 4JQ8A 4CKJA 4OLIA 5AUTA 4D1XA 1WFCA 2JDSA 4FIGA 3E8CA 3RCDA 3HV7A 1YHVA 2BVAA 2JITA 3O8TA 5HG7A 4BICA 4U45A 1SVGA 5BNJA 5DG5A 2YERA 4IAZA 3EQIA 4TWOA 3UYTA 4DGLC 4M84A 4WNPA 2VWBA 3SQQA 1OI9A 3PA5A 2EU9A 2ONLC 4I20A 1VEBA 4Y83A 4PDPA 4A9TA 3O51A 3VQHA 4BN1A 4MBIA 3DDPA 5HESA 3A2CA 3BX5A 5EKOA 1ATPE 1OITA 2A27A 3OVVA 3L9LA 3PY0A 3JVRA 4BWKA 3MH1A 3MY0A 4JG7A 5F95A 3LVPA 3GENA 5FDPA 4FEWA 3QLGA 5J7BA 2ZM1A 3FMEA 5L6WL 4AZEA 4CYIA 3NUYA 4P7EA 5BUJA 2Z7QA 3OZ6A 4ONAA 5LMKA 2XZSA 3BHUA 2XUUA 5HBHA 5M07A 5CYIA 1NVRA 3FXXA 3LXLA 3UP2A 1PXJA 3VULA 5IA0A 5IQDA 5GIPE 2R64A 5AP7A 1STCE 4DFLA 3EQRA 4EH3A 4QOXA 2VTAA 3R9OA 2OFUA 2R3HA 4IHPA 5AJQA 1J3HA 5DNRA 4B8MA 3P7CA 3HRCA 4BBFA 3DBDA 3GUBA 3ZS5A 5H2UA 4AW5A 4NU1A 2ZDUA 5E92A 4ZTRA 4J96A 1XQZA 1CTPE 3ANQA 3FLZA 1TVOA 2R3FA 3VS4A 1ZYCA 3A7IA 1DI9A 2PZ5A 4IE9A 4IWQA 1UNLA 2B55A 1OL6A 4FT7A 3W33A 4RX7A 1W83A 2GU8A 3PWDA 4C57A 3ELJA 4EZ5A 3PSCA 2X39A 2CKPA 3JPVA 3F5GA 3QTWA 4K9YA 2BAKA 4C4GA 5I9ZA 2C5OA 1CDKA 4WBBB 2QO9A 3QU0A 3T9TA 1XKKA 1H4LA 3UE4A 4DGMA 3WZDA 4GU6A 4D5KA 2FB8A 4FTKA 3F3UA 5M51A 4FKLA 4B99A 4AUAA 3R6XA 5DFPA 2X7OA 3ACJA 4F64A 4DCEA 2UW9A 3IDPA 2F57A 3U51A 1H01A 2WXVA 3UQGA 4FBXA 3Q96A 4ZJIA 3QRIA 1KWPA 2WZJA 3F69A 4FKIA 5LOHA 5IPJA 5K0KA 2O0UA 3G0FA 5ETIA 3RBWA 3F3WA 5LXMA 4ZMEA 4CLIA 4JBOA 2YWPA 5CT7A 3FLNC 3Q9XA 3MTFA 3ZH8A 2XNNA 3PVBA 1A48A 3ORLA 4ANBA 2VO6A 5IQAA 3D2KA 3PDTA 5JFXA 5LJJA 4ZSLA 4R7BA 4YO4A 1NXKA 3V8WA 2PMNX 3P7AA 4HYUA 4K6ZA 3ROCA 2CPKE 3Q9YA 4C4FA 4JS8A 4O7VA 4D1ZA 4BCJA 2W1EA 2WMTA 3PJ3A 3AQVA 4UZDA 3WZJA 5HKMA 3OWJA 4PRJA 4JRVA 5BMSA 5FG8A 4C37A 3MY1A 4UXQA 2ESMA 4QP1A 3W2RA 5FP5A 3VC4A 3ZFMA 2WQMA 4PL3A 1H1QA 3BU6A 5AV4A 1OL7A 3LM0A 3EQHA 2XNMA 2R3JA 4M69A 4O7TA 4QMPA 5JEBA 5T6KA 3UJGA 1FBNA 3QRKA 5L8JA 1MP8A 2YZLA 4AN9A 3CGFA 4AZTA 2XBJA 4DEHA 4G31A 4JQ7A 5M53A 5AUWA 4D2TA 4V0GA 4NKAA 3DJ7A 4XBRA 2J0MB 5DH3A 4G16A 4AQCA 4AU8A 1OBGA 3G0EA 4YZCA 4G5JA 4JG6A 3D14A 4IX4A 1RE8A 1KE9A 2YZAA 4WNKA 1ZYLA 2ITWA 3G6GA 3QXPA 4DFZE 2XEYA 1H08A 2H34A 2WMWA 3F6XA 3EN6A 4FSQA 1PJKA 4RSSA 3QALE 4AOIA 4KD1A 2HCKA 2VTLA 4IWPA 4PUZA 3GFEA 1Z9XA 2Q83A 3ACKA 3Q4TA 4UYNA 4X3FA 4BHZA 4JQEA 4E6QA 4EK5A 3A61A 5D7AA 3BBTB 3PIYA 2PSQA 2HOGA 4GSBA 3AC4A 2IVTA 2B53A 3QTZA 3ERKA 5TF9A 3OCBA 4MXAA 3SG9A 4D2VA 3ORNA 3HA8A 3QXOA 4IH8A 4LUEA 2DS1A 4ZAUA 1PF8A 3EL8A 1VYZA 3FL4A 3WF8A 4WD5A 5L6OA 5I4NA 3R30A 2AYPA 3MVJA 3UZPA 4AS0A 3RJCA 2H96A 2VTMA 2PZPA 2VWYA 4FMQA 2BTSA 5C4KA 2YACA 3CQWA 5HU3A 5FRIA 3LMIA 1JVPP 2XBAA 4XJ0A 3TKIA 3W2SA 3R7YA 3R1YA 1NVSA 4N6ZA 2QO7A 4MKCA 5CS6A 5A4TA 5D1JA 4F1OA 2B7AA 4I1ZA 5IG1A 4EL9A 5CEMA 5LVNA 1CKPA 2GS6A 3F82A 2W1HA 4U40A 1H8FA 3CY2A 3DT1A 5AUXA 4O22A 4OTPA 3PPKA 2CJMA 4NW6A 2X1NA 5EDQA 4ACDA 1HCLA 2A1AB 2PL0A 1XH7A 3FZSA 4FVPA 3D5UA 4FSTA 4L3LA 4QTAA 5HE1A 5T68A 3CEKA 3SLSA 3VF9A 2NPQA 4ZLZA 1TKIA 3GCUA 4MF1A 5C8KA 2C6OA 4AW2A 2HXQA 4D2RA 2C1BA 4JOAA 4EH2A 4KB8A 2OGVA 4TWCA 4PP9A 3UQFA 3D5XA 3PIZA 4X0MA 3PA3A 4IACA 1GIIA 2XIZA 3GC7A 2WU6A 3LJ2A 3PJ1A 4E93A 1YHSA 3CJGA 3Q3BA 2F9GA 3D7TB 3Q6WA 4BKZA 4AXAA 3I81A 3EL7A 4FX3A 3SAYA 3E64A 4FKGA 4BKYA 3GNIB 4NZWB 2HZIA 4R78A 4BIEA 5M57A 1M52A 2R3QA 2QHNA 2QU5A 4BR3A 5LARA 2GQSA 3UPXA 4C38A 4MYGA 3ZBFA 3TI1A 5EI8A 2WTKC 2BMCA 1QPEA 4YO6A 4BGGA 4KRCA 3PY3A 1G5SA 3VBTA 5A4LA 3TEIA 5DOSA 4KSQA 4U3ZA 3W10A 4C02A 4F1TA 1ND4A 4YP8A 4EI4A 2HZNA 3U8WA 3F2RA 2XCKA 4YC3A 2GHLA 3NW7A 4OW8A 3C0HA 4ZZMA 2X6EA 3CR0A 2OKRA 4IZAA 4XRJA 3BIZA 4RJ8A 2W7XA 3FLSA 3EIDA 2J90A 3QA0A 5I3RA 4C4HA 4O7LA 4NT4A 4IFCA 5AUYA 3RGFA 3LPBA 4FKQA 3U4UA 4G3FA 3VUHA 4F0FA 5AUZA 2PUIA 4BY9E 3ORKA 4GK2A 4H3BA 3QX2A 2WTWA 3OEZA 3CLYA 3KQ7A 4PPBA 2UZTA 2UUEA 1JWHA 4HNFA 4MH7A 3FYKX 2KULA 4R3PA 4DGGA 2WMUA 3I60A 2HXLA 2BRHA 2E9PA 2YCFA 5FM2A 4WO5A 2XS0A 5IUIA 3C5UA 3GOPA 5B2LA 3FWQA 4AE6A 1XH8A 2GFSA 3BE9A 4M3QA 1GZKA 4FKJA 3WE4A 2C3JA 4FIIA 4AA5A 3DJ6A 2R3OA 3MW1A 3TKUA 4FL2A 4IWDA 5BYLA 4YTHA 3S1HA 4J95A 4TYJA 5EDPA 3KRRA 4FSMA 2GNLA 2HWOA 2OZAB 5H8BA 4NSTA 4G3EA 3V8TA 2X8IA 2YEXA 4HGTA 3TZ8A 3KL8A 2SRCA 4GIHA 3NNVA 3AT2A 1REKA 2WMAA 1XH6A 4UMQA 3N9XA 3QCXA 5AEPA 2PE0A 2X2LA 4TL0A 3KCFA 3DPKA 4MD8E 2PULA 2QG7A 2QI8A 3QHWA 2W1ZA 3POZA 4AE9A 5LQFA 5HE3A 1GJOA 2FSLX 3G9NA 3R71A 4FL1A 4M0YA 4U41A 3R8UA 1OL1A 4DFNA 4GW8A 3AXWA 4KKGA 4BTFA 3E93A 3MWUA 3DLSA 4CVAA 3V04A 4NM7A 5IA2A 1IA9A 4IX5A 5CNNA 5D11A 4RIOA 3G6HA 4U7ZA 5HORA 3BGQA 3ZLXA 2WQBA 3BYSA 2P2IA 2B9FA 4WUNA 4CQEA 3HP5A 4L3PA 5JK3A 4XUFA 1PXKA 4F1MA 4HNIA 4B9DA 3Q60A 3NUXA 4RG0A 2IPXA 1F0QA 2YHVA 1UU9A 4DA5A 3IDCA 1UNHA 2OH4A 2PPQA 3QD4A 5E1SA 1TQIA 2G9XA 4CZTA 5JGAA 3KRXA 4G3DA 4XG6A 2Q0NA 4FSNA 4FZDB 5HX8A 2F2CB 2BHEA 5CSHA 2IW8A 3E92A 3NVKI 1ZYSA 3WIGA 5CVHA 2DYLA 1JKKA 3AMAA 3CTJA 3OMVA 3R8VA 2J2IB 4U44A 3RAWA 4CLJA 3QZIA 3H3CA 3DXPA 4ENYA 4S33A 2WMVA 2F7ZE 3U9NA 4CTCA 2AC5A 3PE1A 3OP5A 4FTCA 5F94A 4V01A 1YHWA 4QD6A 4TYEA 5HBJA 4GH2A 3VUKA 4MVFA 3ZFXA 2ZB0A 3QLFA 2YABA 2W06A 3WYXA 4LOOA 4F6UA 2PHKA 4OTRA 1OKWA 4RVKA 1WVYA 1T45A 2C0OA 4NM5A 2XEZA 4O0XA 4AA0A 4FIJA 4ZMFA 4BYJA 5DT3A 3BZ3A 3R04A 5E8TA 3V5LA 3VRZA 3ZRLA 4AGUA 5AR4A 2GMXA 2JC6A 3GCPA 4GL9A 2IJMA 4K18A 5BVEA 4RA5A 1YI4A 3ORIA 2XYUA 2BRMA 4NCTC 2CN8A 3DAEA 4FYNA 5EHOA 3IW7A 4QNAA 1S9JA 2Y4PA 3PZEA 4CFFA 5CF6A 4NFMA 5J9ZA 4ZTQA 2VUWA 2J50A 3O7LD 5LVMA 4NM0A 5B2KA 4TNBA 3F3TA 1H28A 4Y5HA 4IIRA 3BLHA 4GFGA 2BFXA 2ONLA 3RK9A 4APCA 4JT3A 4L46A 4ZXTA 3RVGA 5AADA 5KUPA 4FTQA 3GCVA 3BRBA 4E6CA 2VV9A 2OJFE 3SW4A 4ZY4A 3PLSA 1FVRA 5EOBA 1WBPA 3LZBA 5JH6A 2JDVA 4QP9A 1JKTA 5IDPA 1LP4A 3GQLA 1BX6A 3Q9WA 2IW9A 4HW7A 4FIFA 5FEQA 4E5WA 3TV7A 5J5TA 4DTBA 5T3QA 2QO2A 3IOKA 4D0XA 4R7HA 1Q97A 3U6JA 3VBVA 4K2RA 5KMJA 3O2MA 3QFVA 3KVXA 2HW6A 5CWZA 2OJGA 3OCGA 4XG2A 3I7BA 2C0IA 4IADA 3D7TA 4FTLA 1PY5A 4FGRA 1NA7A 2UVZA 2VWIA 4CEGA 4FVRA 2C5VA 5JQ8A 3A7FA 2ZDTA 3TWJA 4YJQA 3TNPC 1MUOA 4BZNA 2OICA 2BRNA 3FUPA 4JBVA 2UVYA 4BI2A 2XA4A 4L53A 3ZZWA 2Z02A 3QBNA 3FMHA 4KIKB 5DYJA 2HIWA 4QP3A 4YJPA 1XH9A 4JR7A 4I6QA 3VUDA 4AZWA 2XNBA 3I0QA 4E26A 3NVMB 5TR6A 3GC9A 3PG1A 3DZQA 4FC0A 3NNWA 3OUKA 3U6HA 3HUCA 3QTIA 2JBOA 3HP2A 4IM0A 2YISA 3KRJA 3LCOA 2R0UA 4HGEA 3TM0A 2HY81 3IW8A 4L01A 3SD0A 2OF2A 4D2WA 1UVRA 3C51A 3VS6A 2BKKA 2BKZA 3KMWA 3TNWA 3ZZEA 2JDTA 3TKHA 5LMBA 3M1SA 1V0OA 2ITOA 2R3KA 3VAPA 1KV2A 2XIKA 4F08A 4C2WA 4YJOA 3LXNA 4FTUA 4HZRA 4BWXA 3ATTA 2EXMA 3ZEWA 2B9HA 4F9YA 1E1VA 1YXXA 2OZOA 4FV0A 3VJNA 4X3JA 3W2QA 3R9RA 5KKRC 1Q3DA 2R0IA 1BMKA 4FIEA 4FZFB 4M7IA 3MTLA 1AQ1A 2WEVA 4H58A 5CSXA 4CD0A 1PHKA 2JIVA 3IGGA 2Y4IC 4W4YA 2RFDA 4LG4A 1P4OA 2FUMA 4V04A 4AACA 5BX0A 2YIWA 3F7ZA 4ZEGA 3B8RA 3RWQA 4E8AA 4GJ2A 2JKKA 4PL5A 4EKKA 2QC6A 4ALVA 4FTRA 4EOMA 4QP4A 3NS9A 2CGWA 2J0JA 3V5TA 2XK7A 4EQUA 4I0RA 4RWLA 3MV5A 5DLSA 4CGAA 5E8SA 4YJRA 4RX8A 4TYIA 5HVYA 3RPOA 3V5WA 3ZYAA 3U54A 4OUCA 2YDKA 3DBFA 4CFUA 5GZAA 5L8KA 5EH0A 2OU7A 4ACGA 1P2AA 4PDOA 4BBMA 4BRXA 2B52A 4FK3A 4J1RA 4LMUA 4I6FA 3KEXA 4FL3A 1Q24A 5A4CA 4OAVB 3DU8A 4QTDA 3U4WA 4F9CA 2UW3A 4JAIA 4S32A 4XV2A 1KOBA 5AM6A 5DE2A 5KMIA 2WMBA 3VHEA 3UTOA 1BKXA 4BCKA 4QMQA 1L8TA 4MNEB 4ZTSA 2EB3A 5A9UA 2PUNA 4PNKA 3FMNA 1YKRA 3R1SA 4ZZOA 3KMMA 4F7SA 3VUGA 3AC3A 3MIAA 2WEIA 3LAUA 4R5SA 2GTNA 4DH1A 3A99A 3M11A 2G2HA 4KBCA 4RJ3A 4HCUA 4EOJA 3FZOA 3PE2A 2CNVA 2RSVA 4GU9A 5IA5A 1NY3A 3FSKA 4PMMA 4IEBA 4ASDA 4C61A 4OT6A 3BGPA 4GYIA 4KIQA 5ANKA 5KBQA 4ALUA 5CVFA 3BELA 2E9NA 1IR3A 3ZXZA 2W0JA 1TQMA 5EM8A 3FE3A 4D4RA 5K0XA 5C01A 2YM5A 3B2WA 4AF3A 3F9NA 4Z7HA 3QQGA 1PXLA 5HG8A 4U97A 4WA9A 1NW1A 3HNGA 4IANA 5CF5A 4DBXA 4YR8A 1UU8A 3BYUA 3OCTA 2IW6A 4CMOA 2W1FA 2E2BA 3T9IA 1Y8GA 5BQ0A 4W4WA 2ITYA 2VNWA 5M56A 3FV8A 4WRSA 4DT8A 4AFEA 3FMKA 3CQEA 3I6UA 4XOZA 4YTFA 2IG7A 2VN9A 4HVSA 5IEVA 4MD7E 3F2AA 5JQ5A 2W05A 2PVMA 4B8LA 3AOXA 4IWOA 2IVUA 3QQJA 4Y72A 3TUCA 2IO6A 4IB1A 5I3OA 2XNOA 2WMRA 2PVJA 2ERZE 4O27B 1Q8TA 2REIA 2X0GA 5HCXA 5TE0A 3CCNA 4D28A 2C6KA 5EI6A 3ZM9A 2VO0A 5FEEA 3CD3A 3NR9A 2BZKB 4HVHA 4D1SA 4N0SA 4GCJA 1DI8A 3EWHA 3DKOA 3ODYX 3DQWA 1URCA 2P0CA 5M4FA 3TJDA 5E8XA 3UZTA 5AFVA 5IEXA 4MWHA 3A8XA 4L6QA 2WIPA 4ACMA 3FKOA 4FT0A 4PP7A 3F7WA 4HJOA 4IJ9A 3G90X 5HBEA 3KVWA 4J7BA 5HX6A 1KSWA 4IAYA 1MRUA 3OROA 4F6SA 3R2YA 2XJ2A 2NP8A 4IAIA 4MXZA 5HCZA 3QUDA 4R6VA 5TKDA 3C4XA 3MDYA 4NK9A 4JG8A 4FICA 3FLQA 3Q32A 4D4VA 2PYWA 5IH6A 2XRUA 4X2JA 5JGBA 2VX3A 4BGHA 4EYMA 3QQHA 2XVDA 4PX6A 2WMQA 4XG7A 3FKNA 2XB7A 3E63A 3UIMA 4AN2A 5M44A 4HCTA 2PE2A 4L3JA 1PYEA 4CCUA 3R7EA 3WF9A 4DGOA 2WGJA 2PUPA 2C5NA 4KIKA 4E5BA 4A06A 2FGIA 4A9UA 4CMUA 3A60A 4XG8A 5CT0A 4FGBA 2OW3A 4HYIA 1FVTA 3OXTA 2B9IA 1UV5A 4RVTA 3TXOA 3FAAA 3R0TA 2QODA 4FV2A 3MIYA 4FNWA 4GV1A 3UGCA 2B0QA 4H05A 4FKWA 2I0VA 2HENA 5CU6A 2ZMDA 2XKDA 1ZOGA 3RAHA 4M0ZA 1OKYA 1UKIA 5FQDC 5C8NA 2W17A 3OWPA 3FMMA 4RC3A 3R7OA 1JQHA 4J97A 3VBQA 3ZDIA 4QMXA 1X8BA 1CMKE 4RJ5A 5BVOA 2W4KA 3COIA 4BCMA 4DG3E 3KXXA 2V7OA 4ZLYA 1PMEA 1WBWA 4DFUA 3P9JA 2R3RA 3MFUA 4PPCA 5AR8A 4YHJA 4Q5EA 2Z7SA 4OTHA 5IQFA 5DR2A 4BYIA 2ZJWA 4BDIA 4YHFA 3CJFA 2JKOA 4QT1A 4XG3A 3CPBA 4HPUE 5E91A 4JBPA 2B9JA 2WU7A 5KZ0A 2YJRA 4M12A 3ATSA 2ZM4A 3C0IA 3VJOA 3C0GA 2O5KA 3EZRA 4EBWA 1CSNA 5JRSA 5CSWA 5L2IA 1YDSE 4YTCA 3CKXA 3HMMA 2UW7A 5L2WA 3FQSA 3PXYA 1R78A 1U54B 3GCSA 4FT5A 4OBPA 3EFWA 3MVHA 4O1PA 3ZRKA 2OWBA 4YMJA 3FKLA 1ZAOA 4P4CA 5CI6A 5GHVA 3HA6A 3TJCA 4MXCA 4BVUA 5F4NA 4C4IA 5CXZA 2IVSA 4XP0A 2JEDA 5AP5A 2EWAA 3UIBA 4H3QA 3ZEPA 3EJ1A 2WMXA 4OBOA 3R8PA 4L7SA 4EOQA 3FI2A 3KXNA 4IDTA 1LUFA 1OIQA 3JS2A 4X2KA 4QMNA 2C6MA 3FXWA 3TZMA 2XP2A 4UV0A 4F99A 4U6RA 4ZTHA 2XKCA 4X2GA 3RI1A 4PV0A 1G3NA 3C4CA 2VGOA 4OTQA 3GFWA 5I9VA 4J53A 3AMYA 4CYJA 4F7JA 3F3VA 4ZS4A 2J51A 2PU8A 3QTXA 3R83A 1IRKA 2F7EE 4UMTA 2UZUE 4WNMA 4G1WA 4MNEA 4BI0A 4U43A 4EONA 4EQMA 5IQEA 3ZRMA 4FSRA 2J6MA 4G5PA 5AAFA 4EHEA 3EYGA 4Q5HA 3W32A 2PTKA 2JKMA 3MFRA 2DWBA 2E9OA 4BCHA 2XM9A 4JX3A 2JAVA 2EXCX 1Q8ZA 4PPAA 3TUBA 4DF3A 2UW4A 4FVQA 4MD9E 4Y8DA 4O82A 3KFAA 3VVHA 5CU3A 4RC2A 3TV6A 3KY2A 3UPZA 2O63A 3ZUUA 5E7RA 4RGJA 4TTHB 3KGAA 4PL4A 2XIYA 2QVSE 3FC1X 5JFWA 5L6PA 5IQCA 2XKFA 3ROYA 1BI8A 5AWMA 3UODA 4CTBA 4CFVA 5HD7A 3SG8A 4XV3A 2J5FA 4EEVA 1B6CB 2G2IA 2WTIA 3M2WA 3NSZA 4CFWA 2IZTA 2UVXA 2GSFA 1FMOE 1F3MC 3LFFA 4FV4A 4QP2A 2PK9A 2PVRA 3H4JA 3PJCA 4PTGA 1OUYA 3EFJA 3L8VA 4OTGA 5DBXA 3UC4A 4P2KA 2I1MA 4I0SA 4QMVA 3ID6C 4I3ZA 1M2PA 4FTJA 4JDIA 5C9CA 1H1SA 1O9UA 1FGIA 3MPAA 4QMOA 3FY2A 3PY1A 3NX8A 5CEOA 5CALA 2VTRA 4QTBA 4M14A 4Y5QA 3VS2A 2UZEA 4EOKA 2I40A 4QP7A 1J91A 3VW8A 2X8DA 4EOOA 3FMJA 5HO8A 2C69A 1J7IA 4RIYB 3IPHA 4DEBA 4RPVA 3EMGA 3R01A 2XNPA 3PTGA 4JBQA 5ITAA 1JNKA 3I0OA 4J99A 2OJ9A 4XH6A 3COHA 3OOGA 5KNJA 2XJ1A 1K2PA 2UZWE 5J8IA 2XIXA 1BLXA 2OF4A 4K77A 5J87A 1YOMA 3I6WA 1WAKA 5H8EA 2IZRA 3A4PA 3AC5A 4ZSEA 2IN6A 5AP4A 3PWYA 5D7VA 3UO4A 4CRLA 5BUIA 2QOFA 1QPCA 4F0IA 2ZB1A 4O0SA 4RFYA 2QURA 1IEPA 4U42A 5I5ZA 3H9RA 5ANJA 1VJYA 4L43A 2B54A 3OWKA 2GNIA 4UY9A 3R9DA 3RK7A 3LFBA 3HDMA 5K4IA 1WVWA 3FI4A 5HHWA 3F88A 3DAKA 3HMNA 3CTHA 3UNZA 4EOPA 3TIZA 4XLVA 5GJGA 4LRMA 2IZUA 3KB7A 5BVFA 2VWWA 4USFA 1MRVA 4JIKA 4DITA 3HYHA 3QYWA 4FOCA 4OTFA 3SXSA 1Q62A 4JXFA 3LLAA 4G9CA 2CHLA 3ZLWA 4LUDA 1KE5A 2UZBA 4OT5A 3G5DA 3DK3A 2YN8A 2ITZA 3RHXA 4EJNA 4LI5A 4IAKA 1WZYA 2W4JA 4QQCA 2FSTX 4GJ3A 4KABA 3ZSHA 5CASA 4IC7A 2VNYA 4RLKA 3QHRA 4D4SA 3DBEA 2Y8OA 3RPRA 3EQFA 4LOPA 4A9YA 1UNGA 5EDRA 5EG3A 3BV3A 5AR5A 4F65A 2ACXA 2BTRA 5AX3A 5HLNA 4NKSA 4Z7GA 1Q99A 1OL2A 3PVWA 4RFMA 4WT6A 2A2AA 1WBVA 4TY1A 2QKWB 4G9RA 4PQNA 4QMWA 2A4LA 4HGSA 3GOKA 5HVKA 3OS3A 2WQOA 4Q9SA 1OGUA 3E88A 3ZMMA 3D15A 4ZJVA 2WMSA 3QRUA 5LVLA 3NCGA 3D5VA 3S3IA 2PWLA 3WZEA 4E20A 4CFMA 4Y85A 4AGCA 4BDJA 4EKLA 1BUHA 1M2RA 5E8ZA 5CEPA 1UU7A 5M08A 3LXPA 4IFGA 3AT4A 1W82A 1ZLTA 4YC8A 1Y6BA 5KX8A 4FODA 1VR2A 4CKRA 4M13A 3VBXA 4F7NA 3MJ2A 1Z5MA 1GAGA 3ZM4A 4GYGA 2X4FA 5DIAA 5A4QA 4AX8A 3LMHA 1WMKA 4RZVA 3IKAA 3BV2A 4EHZA 3N4TA 2ZV8A 2CGXA 3ZFYA 4R1YA 5EW8A 2C47A 4YSMA 1R3CA 3ZU7A 5C1QB 2VTPA 3HEGA 1OL5A 2XK9A 2PVHA 5IQBA 1H00A 3H0YA 3DFAA 3LE6A 1U54A 3P23A 1WBOA 5AR3A 4AZVA 4ENXA 2OXDA 4TKSA 4TYHA 1QL6A 5E1EA 1UU3A 2AUHA 2PVYA 5AA8A 3SXFA 2OG8A 5KE0A 1OECA 3RPYA 4L52A 3KC3A 4XEYA 4BFMA 4I4FA 4ID7A 4DEGA 4ZJJA 1P4FA 4X21A 5EW9A 5GZ8A 4FKPA 4IJPA 4QP8A 4YZNA 3NLBA 4YTIA 2P33A 3O8UA 2W1CA 3DJ5A 2J0IA 4NM3A 5EOLA 4IW0A 1UA2A 4O7SA 3CP9A 2H6DA 2J7TA 2Y0AA 1SM2A 3PSBA 3QRJA 3DKFA 4I4EA 4I24A 3QCSA 4QMTA 2HAKA 3W18A 4ERKA 3QGWA 5TO8A 3TL8A 4U0IA 1YXUA 1B38A 4FA2A 4NJ3A 4ZY6A 2V0DA 5D9HA 3ZSIA 5A54A 2I0HA 2YIYA 4ZLOA 2GCDA 4I6BA 5AP2A 4BF2A 1Q61A 3I79A 1OB3A 2YCQA 5D41A 3HAMA 2PMOX 2VWXA 3DA6A 1QPDA 3P1AA 4ITJA 2QOOA 1E9HA 5EHLA 2F2UA 3C4EA 4E4XA 3COKA 3P4KA 3VS1A 2OI4X 4EWQA 5CSPA 4EH5A 3E3BX 3QC4A 1KE6A 4FKUA 5LCKA 3FPQA 3RAKA 4BB4A 4FSUA 2PUUA 4YJTA 2FA2A 2GFCA 3GQIA 3GEQA 5HZNA 3PJ8A 1YW2A 3FEGA 3K54A 4AOJA 4O7RA 3Q9ZA 3LKMA 2C5XA 3C1XA 3LCDA 4MK0A 3GU6A 3ORZA 3BGZA 3GBZA 3UNKA 4GT3A 5FBNC 4WUAA 4YJSA 2FO0A 3TACA 3KRLA 3WF6A 5CSVA 3OT8A 2PVKA 4FTOA 4O0RA 3EHAA 3HUBA 1K3AA 3D94A 4IAFA 1GIHA 4YLLA 3CGOA 3LIJA 4U79A 5J79A 4D5HA 4DLJA 2YWVA 2QR8A 3HECA 2ZV2A 5ETFA 4BCOA 2ZYBA 5LCJA 3JYAA 4NW5A 4WNOA 5BYZA 3NWWA 4FT9A 4IX6A 5ACKA 1PMVA 5JMSA 3VN9A 3NDMA 1KE7A 2GNJA 4Y73A 4BDFA 4EC8A 2QD9A 4EWHA 5LWNA 2OIBA 2Z60A 4IM3A 4AGWA 3WF7A 3O71A 4RIYA 5IA4A 2XNGA 4C7TA 3FXZA 4DEEA 5J9YA 5L3AA 5J1VA 2BROA 2ETRA 3V5PA 1Y6AA 4ANOA 4DYMA 2RG6A 4RZWA 4PDSA 5LMKC 4ANSA 2Y7JA 5BUEA 2FSMX 2WQEA 4KKHA 2CKEA 3NNUA 3FZ1A 4MX9A 4CV9A 2WHBA 2IVVA 3TIYA 3QD3A 3IW5A 3AD6A 3EH9A 3CE3A 3R1QA 3V01A 3GGFA 4ASXA 5M4IA 3IS5A 1XBBA 2V5QA 1ZXEA 2CMWA 2YA9A 3W2CA 3R00A 4M68A 4WSYA 2YM7A 4FI1A 4Z9LA 5J5SA 2CN5A 1W84A 5EYDA 2R2PA 4FK6A 3W1FA 4LV8A 5HVJA 1H25A 1WBNA 5CY3A 1XHAA 5DN3A 3JXWA 4K8AA 1XO2B 2ITUA 2OJJA 3LOKA 2GHGA 3LJ1A 3OW3A 5HNBA 5LWMA 2CLQA 4FKOA 1SZMA 3OD6X 3RALA 4F6WA 3N4VA 3DDQA 4FEXA 4XV1A 5JFSA 3KA0A 4EH7A 5EQYA 2X7FA 3EOCA 5JZJA 3ULZA 5HG9A 3JY0A 3MH3A 4IZ7A 1U46A 4RVMA 4BZDA 3QAME 3OXIA 4QRCA 2PE1A 4L44A 1OPJA 2YDIA 3LHJA 2UW0A 5KMLA 3MH0A 4QMSA 4C33A 4FEQA 3EQBA 4O7ZA 3POOA 3KMUA 3FBVA 3C4ZA 2RFSA 3L8SA 3C9WA 3FC2A 2Z7RA 3FYJX 3LFNA 3PXFA 4G34A 4JIAA 1U5QA 4DHFA 5CF8A 4RQVA 5HICA 5IZFA 3E3PA 3WILA 4J8MA 5DHJA 2J0KA 5BMMA 4RX5A 5BPYA 4NTTA 4M15A 5HI2A 3R1NA 5DR9A 4EHVA 3L9NA 4MNFA 2WTCA 2GNHA 3BKBA 4L67A 4XS2A 2C5YA 5FM3A 4APPA 2YFXA 3TNHA 4QPMA 4TN6A 4O0YA 3PZHA 5IA1A 2YIQA 3ZLSA 4EZ3A 5AAGA 2GPHA 3D0EA 3FZPA 4Y46A 3MESA 4AWIA 1PW2A 4QYYA 3K5UA 2OIQA 1H0VA 3WZUA 3KF7A 5C4LA 3KRWA 4LL5A 5B0XA 2UW6A 3PG3A 4XYFA 3GP0A 3LCSA 4TW9A 2YLEA 1J7UA 4IAAA 2WTKB 1R1WA 3UVRA 3SW7A 5EYMA 4GVAA 4UYAA 5J1WA 1CKIA 3SA0A 2XYNA 3PVGA 3VS7A 4YU2A 1HCKA 3VS5A 2YAKA 1YQJA 2BIKB 4GS6A 3SOCA 5DWRA 3DK7A 2BR1A 3TV4A 5AV2A 3QCYA 3KN5A 4R77A 3GVUA 3DCVA 5TT7A 4KUJA 3U9CA 2QQ7A 1V0PA 1PMNA 4IQ6A 4W8DA 2HZ0A 3EYHA 5B2MA 2OLCA 2G15A 4D2PA 5A46A 3RWPA 2QLUA 2GS7A 4C3FA 4FZ7A 5L4QA 1OIRA 4ASZA 3D83A 4K1BA 4PMSA 3GCQA 5E8YA 4ACHA 4FF8A 4CQGA 3F5UA 4TWNA 1BL7A 4X3FC 4BDGA 5CAOA 3RTPA 5AMNA 3M42A 2WO6A 2C68A 2C3LA 4PMTA 4G6NA 4RC4A 3DKGA 4FKVA 1QMZA 4II5A 5AA9A 3GU5A 4PNIA 4QTEA 1H24A 4YJVA 3Q4ZA 4S30A 3MPTA 3ETAA 2WFYA 1MQBA 2X9EA 1YXSA 4FUXA 4GT5A 4I23A 5G6VA 3UYSA 4F9BA 2BRGA 3I5NA 3ITZA 3I7CA 2VO3A 3QF9A 4FSYA 4H1MA 3BYVA 3QKMA 4FZAB 4XBUA 5FD2A 3R8ZA 3RKBA 4NYEA 3E8NA 1LEWA 4DTKA 2BUJA 4HGLA 4QMYA 4QPAA 1JLUE 1SNUA 2C6DA 2O3PA 2BZHB 2ZVAA 3QC9A 4OTDA 1O6LA 4D9TA 1T46A 2XK4A 1YRPA 4MTAA 1PXIA 4UB7A 1P14A 3O8PA 2OXYA 5E9EA 3NAXA 1AD5A 3BHHA 3BLQA 1IA8A 1ZY5A 2OXXA 3KF4A 3OHTA 4RRVA 3FZTA 3DK6A 4L9IA 3O96A 3PFQA 4B6LA 2E9VA 2W1DA 5AV3A 4BCGA 3NAYA 5CLPA 3RINA 3V5QA 4QPSA 4W4XA 2HYYA 1FGKA 4RMZA 4CG9A 3EFLA 3PYYA 2Z8CA 4FE2A 3VUMA 1Q41A 4DE4A 4FZ6A 3FLWA 4TNDA 1OKVA 2ZAZA 4DH5A 4YUQA 3VW6A 2P3GX 3PUPA 3EN5A 5HNGA 4U9AA 2PVLA 1FQ1B 3OG7A 1LPUA 2WAJA 5JN2A 4TZRA 4FSWA 3RHKA 3WBLA 4RJ4A 3R9NA 3N4UA 3UOHA 3BHTA 4DEAA 4NWMA 4EOSA 5EQEA 3OXZA 5KMNA 4EH8A 5EM5A 4UWBA 1SYKA 3ZO4A 1LR4A 2P4IA 3ZXTA 3KXMA 4XCUA 2W1GA 3Q52A 4R3CA 5AM7A 3F3ZA 4OR5A 4X2NA 4DFXE 4EUUA 5IMXA 4LV5A 2G01A 2C6LA 3NYVA 3MH2A 4P90A 4E1ZA 5IUGA 3ZHPC 5L8LA 4ZZNA 1XH5A 3L8XA 1YVJA 3VF8A 3IW6A 4CFXA 2C6TA 4UMRA 1BI7A 3GU4A 4DTAA 5CXHA 2X8EA 3CBLA 4PF4A 2Y6OA 5AUVA 3QKLA 4ZTNA 4PMPA 4FUYA 4ACCA 3VS3A 5I0BA 4QYEA 5L2TA 3BQRA 4LQMA 1ZYJA 2CNQA 1ZMVA 4FV9A 3C13A 5K5NA 3RM6A 3UG1A 4FEVA 5HD4A 3A4OX 1WBTA 1CM8A 1YDTE 2UZVA 3A62A 4PY1A 4RX9A 3OF0A 4BCIA 2BDJA 5K3YA 4BI1A 4DEDA 4HYSA 3BYOA 3NW5A 4G17A 4FTIA 3EB0A 5CQWA 4R8QA 5I9XA 2YM8A 4PTEA 3HV5A 3BPRA 2XK6A 1RDQE 4UMPA 4J98A 4M97A 4O6EA 3WF5A 4AT3A 5H3QA 3OWLA 4FSZA 4RJ7A 3L9MA 4MEDA 5CENA 4E6AA 5CAUA 4YLJA 3HRBA 3TZ9A 3W16A 2NNWB 1YDRE 2I7QA 3R7VA 3Q53A 3HGKA 3KN6A 3GXLA 4QNYA 2CGUA 3UC3A 4G2FA 4DGNA 3BEGA 2JIIA 4BCFA 1FVVA 3AD5A 1QCFA 4RIXA 4B4LA 3D9VA 4L68A 3IK3A 3W8QA 2GS2A 4HVGA 4IVDA 3NIEA 5BYYA 3K5VA 5M09A 5IEYA 2QONA 3B8QA 4E5AX 3ODZX 1AGWA 5FWKK 5JFVA 2R5TA 2A0CX 4FKTA 4YC6A 4ZSGA 3QTUA 4FNXA 4LRKA 3MSSA 3UIUA 4EJ7A 4BDCA 4EHGA 4H3PA 3UVQA 1SVHA 4RWKA 3KXZA 1QPJA 4Y95A 4AZSA 4EBVA 3QWKA 2QNJA 3TCPA 4I22A 3CY3A 5CANA 4FEUA 3PPZA 2VU3A 4JRNA 1A9UA 4DINA 3ZSGA 5A4EA 1I44A 4TT7A 4ANQA 4GG7A 2BDFA 3LQ5A 4IZYA 4KBKA 4QTCA 3KXHA 5DRDA 4FG7A 4FNYA 4A4OA 4EH9A 4ZSAA 4N57A 4C58A 5GJFA 3DLZA 4I94A 4O81A 1YI6A 5M55A 3P86A 4USEA 3D4QA 3HDNA 4QMZA 3S4QA 1OVEA 1M14A 3AC8A 2QOQA 3KKVA 4FV6A 5DPVA 3SRVB 3FQHA 5HG5A 3R73A 5I9YA 3Q2MA 2XH5A 4YPDA 4IMYA 4MBLA 3P79A 3EFKA 3ZTXA 2R7BA 1YOLA 2RFNA 4FT3A 2C1AA 2HY0A 2WKMA 4G3GA 4JDJA 4NFNA 3BBWA 4NTSA 5KBRA 4QYHA 4M67A 3FY0A 5IQGA 5EQPA 3MFSA 2JFLA 3R02A 3G51A 4GG5A 4M66A 4ZOGA 3VIDA 3QTRA 2OH0E 3D7ZA 3PA4A 1OPLA 4GK3A 4DH7A 5KKRB 3W55A 3SC1A 3ZDUA 2C4GA 1Q3WA 2ITXA 4FTTA 1L3RE 5JGDA 5B7VA 2WIHA 2DUVA 4YZ9A 3O17A 4DH3A 3AD4A 3ALNA 1YI3A 2UW5A 2Y4IB 3D2IA 1M7NA 1MRYA 3QQFA 4MBJA 4BDDA 5DR6A 5ANGA 3ZONA 1IASA 2X2MA 3FI3A 5I9WA 1NVQA 3TZ7A 3OTVA 3TDWA 5E8UA 5CAPA 1M2QA 1OPKA 2ZV7A 3OC1A 2ZOQA 3Q5ZA 4AW1A 4F7LA 5J95A 4N4SA 5HQ0A 1RW8A 3PPJA 3AC2A 1SMHA 4GRBA 5L2SA 1ZWSA 3OEFX 3DZOA 3OT3A 4CZUA 3MS9A 5HO6A 5K4JA 2EUFB 2UZOA 2XKEA 4R7IA 3BCEA 4U81A 5EM7A 4TYHB 3LFDA 3FMDA 3DXQA 3DS6A 4I21A 4EOIA 4UMUA 3RCJA 3MB7A 4I0TA 2B1PA 4XG4A 5GIOE 4RWIA 4RWJA 5IH5A 4EK3A 4YZMA 3DNDA 3RK5A 1O6KA 4MCVA 3DV3A 5DVRA 2BZJA 5A6OA 3PSDA 5AR2A 4F70A 3QTSA 1ZOHA 2R3NA 2XK8A 2GHMA 4OTIA 3KREA 4O83A 1H1RA 4ZIMA 4H36A 3HAVA 1XWSA 2VX1A 5A3XA 4U3YA 3ALOA 3DNEA 2EB2A 4O1OA 4RA4A 4ORKA 2H9VA 5LVPA 3SGCA 1JAMA 2UW8A 5ANOA 3RAIA 3FMLA 5CQUA 1EH4A 5A6NA 3FLYA 4A4XA 5F9EA 2QCSA 3CS9A 2I0EA 4WKQA 5C27A 2O65A 4ZS0A 4D2SA 5FGKA 3V5JA 4FKSA 2W5HA 3LXKA 5D12A 4O86A 3FI8A 2OIDA 5C26A 4YBJA 1UKHA 4IVCA 2WQNA 3MBLA 1APME 1U59A 5K9IA 1U4DA 4FV5A 1DAWA 4PWNA 1JSTA 2ITPA 1Y91A 2XNEA 1HOWA 3LJ0A 3ZCLA 1ZOEA 2J5EA 2NRYA 5BVNA 4KIPA 1YWRA 1V0BA 3QQKA 4KWPA 1VYWA 3TTJA 3K3JA 2C3KA 1H1WA 5HIBA 1PXOA 2Z2WA 1JSVA 4JDHA 4KBAA 5FTOA 2YJSA 2J0LA 4NCTA 2I0YA 4C2VA 1Z57A 4A9RA 3HL7A 3LFCA 4QYGA 5HIDA 2BALA 2R3IA 3QQUA 5AV1A 4IB5A 4DCAA 3NGAA 5CAQA 1NT2A 3R21A 2X81A 4NIFB 4W8EA 5JT2A 1B39A 1LEZA 3ORMA 5E90A 4BGQA 4UZHA 2PZIA 5C8MA 3GI3A 4MQ2A 5CF4A 1PXPA 1PXMA 3GC8A 2YM3A 3W2OA 4BDBA 1GIJA 4Q2AA 3DB6A 4UEUA 3HKOA 3V8SA 2QOCA 4QQJA 3S00A 3LFAA 3LCKA 2JIUA 1DS5A 2JD5A 3QUEA 2CKOA 4J71A 5E4HA 2BZIB 4XNEA 2CGVA 3RM7A 4RIWB 3E5AA 1H27A 1GY3A 4CFNA 3MFTA 4C8BA 3HMIA 4LYNA 1OKZA 2BHHA 3H9FA 2BCJA 1JOWB 1YWNA 4USDA 1UWJA 5CZIA 3SV0A 4L7FA 2I6LA 3Q04A 3RMFA 4MXYA 4BC6A 5ACBC 3VBYA 2C3IB 3PP1A 4PTCA 5DEWA 4EOLA 4S34A 2W9ZB 4DEIA 3Q4UA 5HNIX 3PLAE 1M17A 1OZ1A 3UO6A 1IAJA 5FXQA 5AUUA 4BTKA 4EC9A 1OIYA 1XH4A 2W4OA 3BHYA 5AIKA 3R63A 3G2FA 2WOUA 3UMWA 4F63A 3HV6A 3ORXA 5ETAA 2Q0BA 3EQDA 4EYJA 4HVIA 2XCHA 4LRJA 3ZOSA 4E4MA 1E1XA 4FNZA 2JLDA 2LGCA 4DFYA 4BBEA 3NZ0A 2VZ6A 3N51A 4NUSA 3SRVA 2F4JA 4DH8A 1IAHA 4XP2A 5KMMA 4IXPA 3E7OA 5D10A 3FHRA 5M4UA 3GU8A 5IKWA 4DAWA 3HMPA 3MGYA 4GUEA 2YIRA 3W8LA 4I5CA 3BI6A 4W4VA 4ZSJA 2RIOA 3EN9A 2X9FA 4IDVA 4MWIA 4OBQA 5H8GA 4D0WA 4ANLA 4AAAA 4TWPA 4ZK5A 4DN5A 4RVLA 3JR1A 4RJ6A 4G6LA 4TXCA 3CIKA 5CNOA 4YPSA 2WTJA 4UWYA 4LGDA 2JGZA 2QU6A 3IO7A 5DT0A 3U55A 4G6OA 2W1IA 3IONA 4KIOA 4X6RA 4AN3A 4ZP5A 3HZTA 2KTYA 4AT4A 2R3PA 3LFSA 1ZZLA 4WRGA 4JLCA 3UMXA 3TT0A 1Q8UA 5DMZA 1JPAA 2UZDA 3ZO3A 1JKLA 4IM2A 5ANEA 4KKEA 4L00A 4C62A 4S2ZA 3TDVA 2X2KA 3CKWA 1PRYA 5DEYA 1U5RA 4ASEA 3OY3A 4BCPA 2C0TA 4FYOA 2O64A 3WOWA 1R0PA 4GEOA 5CU0A 2RF9A 3HRFA 3DY7A 4XP3A 5ANDA 2XK3A 4C3RA 3RP9A 2QKRA 4F9WA 4JX7A 4L8MA 4MHAA 5AP3A 5FBOA 5JZNA 4XV9A 4EUTA 5IISA 3NNXA 4XG9A 4BCNA 3UO5A 3REPA 2NRUA 4FV3A 5FXRA 2VWUA 3THBA 3O50A 3QYZA 3UOKA 4KS8A 3F2NA 4KSPA 4O7NA 4RBLA 4O84A 4MQ1A 3QGYA 5AR7A 3GT8A 4B0GA 4O0WA 3BU5A 2BDWA 2Y9QA 4X2FA 5FTGA 3I5ZA 3V51A 3QQLA 1ZRZA 4FKRA 4UALA 3A8WA 3H10A 2JFMA 1R39A 3PXKA 4D4YA 2F7XE 3FHIA 2CSNA 3QX4A 4L42A 4LMNA 3HV4A 4UXLA 2J4ZA 4JJRA 4O2PA 2YAAA 4F4PA 1GZ8A 2AC3A 3ET7A 4GIIA 5AV0A 3BWFA 4GKIA 5FLFA 2C6IA 3CC6A 3IGOA 4WBOA 3DBCA 4E4NA 4HOKA 3AGMA 4CRSA 2VTIA 5IMEA 2JDOA 3JY9A 5AP0A 4CT1A 3HMOA 3MB6A 3OOMA 3UDBA 4WG3A 5EM6A 4JL9A 3WE8A 3E8EA 5A14A 2VGPA 1P5EA 5DGZA 4HYHA 2IZSA 2BAJA 2QOBA 4X7QA 5I9UA 3S95A 4CZYB 3F5XA 4C36A 2CDZA 2O8YA 3KCKA 3MY5A 1ZARA 1S9IA 3MPMA 5K5XA 2ETMA 3A7HA 1XJDA 5HTBA 2FYSA 2ZV9A 3MA3A 4MXXA 3G33A 4O6LA 4C59A 5E8WA 3LMGA 3FDNA 3PRIA 4E6DA 2QOHA 3EQCA 3RPSA 1KOAA 2JAMA 3TTIA 2YM6A 5IDNA 2HK5A 4AGDA 2ZMCA 3UP7A 3SX9A 2V55A 4O21A 5AP6A 4O0UA 4GFMA 5F20A 4X6QC 3T3VA 2ITTA 4NIFA 1GOLA 4GK4A 4YSJA 4IC8A 2GTMA 5FTQA 3KK9A 3NIZA 2B4SB 4HZSA 4KA3A 4MAOA 4YGAA 3VNTA 3CQUA 5G1XA 3VHKA 4JR3A 3O7LB 1BL6A 2VTHA 3DTWA 2ITVA 3COMA 3NPCA 4IZ5A 4QQ5A 4A4LA 3O0GA 1BYGA 3IW4A 4WOVA 5FEDA 2VTTA 3T8OA 3BQCA 2QG5A 2R7IA 4RIWA 4CNHA 2ERKA 1URWA 1H0WA 1JBPE 1OMWA 2OK1A 3A7JA 3L8PA 4J52A 4U5JA 5CTPA 4CT2A 1MQ4A 2GNFA 5DT4A 2HZ4A 4P5QA 3OBGA 5J9LA 3FL5A 1G8AA 4NH1A 5KZIA 1OBDA 4U80A 2QHMA 3EZVA 4FOBA 2NO3A 4CXAA 5CEKA 3V3VA 1DM2A 3QWJA 4R5YA 2OJIA 2PVNA 3MN3A 1ZMWA 1J7LA 3NCZA 3SVVA 1F5QA 4I5PA 1OM1A 3OUNB 4HPTE 2WOTA 2WNTA 3CXWA 5ETCA 4YJNA 5DRBA 3PRFA 5HOAA 3UOLA 2ITNA 3GB2A 1ERKA 5HEZA 3ORPA 1ZY4A 2R3GA 1YXVA 4TPTA 3K2LA 3SOAA 3OTUA 4G3CA 4GKHA 5CU4A 4A07A 5F1ZA 2C30A 1XR1A 5HTCA 2EVAA 3F61A 3G9LX 4BTMA 4YHTA 2X4ZA 3OW4A 4ANMA 3EKNA 1Q8YA 3ENMA 3ZO2A 5H9BA 1RQQA 4AFJA 4D9UA 3EN4A 4O38A 5IF1A 4PDYA 2BRBA 4BKJA 3UBDA 4ARKA 4E7WA 2OBJA 2QLQA 1FMKA 4AG8A 2FSOX 4AP7A 2R9SA 3JUHA 2FVDA 3AC1A 3IOPA 4RQKA 4DG0E 5KCVA 2FH9A 4OTWA 4RIXB 4C35A 4DBNA 2X6DA 1YWVA 2W99B 3I1AA 3KXGA 1Q4LA 3SDJA 4BL1A 4RLLA 2UZLA 4AOTA 4TYGA 2VX0A 1A06A 3GU7A 4Z3VA 4BZOA 5EFQA 3OCSA 4WHZA 4KINA 2QOLA 3OBJA 3DBQA 2Y6MA 2RKUA 4WSQA 3NUAA 4CG8A 2CLXA 3LQ3A 3MVLA 3GC0A 4O91A 4NL0A 2RG5A 2VD5A 4XHKB 1GZNA 5CVGA 2VAGA 3KULB 1YOJA 3DB8A 4NJDA 3C4FA 5TOZA 2HWPA 3NW6A 4FV1A 4JVGA 1JKSA 4O96A 3SXRA 3DFCB 1VZOA 2CCHA 5EKNA 3ENHA 4JNWA 4KAOA 2JKQA 5KHWA 3CPCA 3ZUTA 4XOYA 1IG1A 4O7YA 1WBSA 5EYCA 5CAVA 4OGRA 1PMUA 2VRXA 3TNQB 4TRLA 3HV3A 2YITA 1G8SA 4HCVA 3FSFA 4K0YA 3NYXA 3DXNA 4C0TA 3LW0A 5IH4A 3WIKA 3FZRA 3S2PA 3HX4A 4O0VA 3UQCA 4YJUA 4GMYA 1V1KA 2GNGA 3ZLYA 1H1PA 5M4CA 1SNXA 4FTMA 2WD1A 5EHYA 3ZC5A 4P5ZA 3Q6UA 4HVDA 2YM4A 3MVMA 5FXSA 2DQ7X 4BDAA 4EH6A 3IG7A 5DI1A 3RNYA 4LOQA 3UNJA 2E9UA 2PY3A 3ANRA 4ITHA 5CEIA 4DG2E 3O23A 2W5BA 3NUSA 1K9AA 3FPMA 3R7IA 1KV1A 4AW0A 4FG8A 5AAEA 4ZY5A 2BILB 3QRTA 5CI7A 2RFEA 2W5AA 5BVKA 3V6RA 4FV7A 4YURA 4GFOA 2YLFA 3NRMA 4C3PA 3BEAA 4ZTMA 1W7HA 3UZRA 4FIHA 3VUIA 3ZBXA 3DTCA 5IQIA 3I4BA 1TQPA 4FTAA 2C6EA 4FR4A 5HLWA 5KMOA 4K11A 4KNBA 4LGHA 2BPMA 3QUPA 4YLKA 3VS0A 3W2PA 2ITQA 1WCCA 2XF0A 3PXRA 3R28A 5HE0A 4BCQA 3Q5IA 3R22A 4FV8A 4V05A 2WTVA 2GQGA 1H07A 2HW7A 3AMBA 2J9MA 3H9OA 3KK8A 3LFQA 4FTNA 4I5MA 4IVAA 1UWHA 1ZZ2A 3E8DA 4YZBA 3H30A 3ULIA 1W0XC 4EK6A 5HLPA 4ZTLA 1J1BA 4MF0A 3FQEA 1O6YA 1XBAA 3MJ1A 3PIXA 4H39A 3JVSA 4IBMA 2YCRA 2V7AA 4QP6A 4U8ZA 5CX9A 5E8VA 5JKGA 1RJBA 4UWCA 5HIEA 4UBAA 2VTJA 2JDRA 3D5WA 4BIBA 2BAQA 3UOJA 4DC2A 4BWPA 2PMIA 3QD2B 4B7TA 5LMAA 3LLTA 4CKIA 2ZM3A 5KMKA 3EQPA 4J8NA 3VO3A 2V62A 4K33A 5DA3A 4RT7A 3C50A 3ZUVA 1W8CA 2G1TA 2XM8A 2WB8A 2A19B 3C5IA 4JI9A 2XJ0A 2OO8X 3F5PA 2V22A 4R1VA 3OY1A 4I93A 2OZAA 4IB0A 3ZO1A 1FINA 3MYGA 3NUNA 3F66A 4XRLA 3T3UA 3VQUA 4BTJA 1DAYA 2VWVA 5HCYA 4ALWA 4UN0C 3ORTA 4O0TA 1KUTA 5GINE 2PVFA 4I92A 3LQ8A 3IDBA 5GJDA 3H0ZA 2EXEA 5IA3A 3NUUA 3B2TA 4DT9A 4E73A 1FPUA 4N6YA 4I5HA 2PZRA 3L1SA 1R0EA 3CTQA 4W9WA 3QKKA 4KRDA 3TNIA 4CCBA 3DAJA 4Z16A 3BE2A 4YZDA 4EORA 3WYYA 5L2QA 3P78A 3QZGA 4LM5A 3BHVA 1ZYDA 3NMUF 3DQXA 5IU2A 2XIRA 2WELA 3BLRA 2HELA 4QO9A 2WTDA 4JDKA 5AIRA 2LAVA 3II5A 4OAUC 3BYMA 2XRWA 3QCQA 3L9PA 4LFIA 1Q5KA 2R3MA 2RL5A 5EYKA 2R4BA 4KS7A 3R7GA 2IWIA 1XBCA 3G15A 4AA4A 1Y8YA 2PZYA 2VTQA 4QYFA 4A9SA 1PYXA 3AGLA 3P0MA 5IUHA 2G2FA 3MA6A 4IX3A 4QMLA 4XMOA 5GNKA 3R8MA 5HE2A 1CKJA 3TG1A 4LL0A 3ZC6A 4RFZA 5JSMA 3PP0A 2QOKA 3WARA 4WIHA 4WG5A 4W9XA 2VTOA 3IECA 3CSVA 4YBKA 3Q2JA 4D55A 3QZFA 5FDXA 2CNUA 4YNOA 4N70A 5C03A 5CEQA 4EQCA 3TN8A 2UV2A 3QTQA 3MI9A 2W96B 4ANNA 1J1CA 4D58A 2CKQA 2PMLX 3PJ2A 3QL8A 5HU9A 5HO7A 4JAJA 2UZNA 2F49A 3DGKA 5HGIA 3SKCA 3WI6A 3NEWA 4QMMA 3UIXA 4C4JA 4F0GA 3EKKA 2GDOA 4EK8A 1ZMUA 3K3IA 5LVOA 1H26A 4GVJA 3NYNA 4EH4A 4DFBA 3HLLA 5AP1A 3UVPA 3QD0A 3AG9A 5CZHA 4CSVA 5HTIA 1OUKA 3OFMA 1Q8WA 3BU3A 3RZFA 4Z55A 1Y57A 2W9FB 3R9HA 3VUTA 3V6SA 4ERWA 3P5KA 4FG9A 1M7QA 3E87A 4LGGA 2Z7LA 3CD8A 4C4EA 4EZ7A 4IVBA 2BFYA 3P7BA 1SVEA 2O2UA 3Q4CA 3KULA 4M8TA 5AX9A 2QOIA 3LFEA 3UG2A 5GZ9A 3VRYA 4CMTA 2YCSA 3R8LA 4E4LA 2QR7A 3PXZA 1PKGA 1PKDA 3DKCA 4AT5A 4DLIA 1GZOA 5J7HA 4M69B 3FJQE 2GQRA 3PVUA 4QMUA 4EK4A 2YIXA 3LM5A 5JRQA 3C7QA 3SHEA
chains in the Genus database with same CATH superfamily
1W98A 5KO1A 4V0GB 2XMYA 4XX9A 3NYOA 1I09A 3RPVA 5EW3A 3DOGA 4L45A 2OSCA 3WZKA 4F9AA 3E62A 4BDKA 1OIUA 4IB3A 2R3LA 4Q9ZA 4ITIA 3C4WA 3R2BA 4F09A 4GUBA 1YXTA 3A7GA 3QA8A 4GT4A 2OFVA 5FP6A 4E3CA 4C34A 2YDJA 2ETKA 3HVCA 4X3FB 5FUTA 4S31A 2P55A 4XLIA 1WVXA 5ICPA 3VWAA 4AZFA 3U6IA 4NEUA 3RZBA 3NUPA 3EN7A 2P2HA 4BHNA 1REJA 3E7VA 5BVWA 4O2ZA 3IQ7A 5BVDA 3TUDA 2JBPA 2BIYA 3PXQA 4WG4A 5CU2A 5IQHA 3KU2A 5M06A 1PXNA 4A7CA 4R3RA 4BDEA 2VTNA 4I41A 4BIDA 3VBWA 4O7WA 1FOTA 3EQGA 1KE8A 2VO7A 2VWZA 3AT3A 4UX9A 3BWJA 2VTSA 3QZHA 4I6HA 2X7GA 4QQTA 2RGPA 3P08A 2CCIA 5ANIA 4CV8A 3U87A 3R7UA 4H1JA 3RNIA 2H8HA 4YNEA 4BDHA 5KHXA 1GNGA 1JSUA 5EI2A 5EK7A 3LCTA 3S0OA 2WPAA 4MXOA 4JQ8A 4CKJA 4OLIA 5AUTA 4D1XA 4JMQA 1WFCA 2JDSA 4FIGA 3E8CA 3RCDA 3HV7A 1YHVA 2BVAA 2JITA 3O8TA 5HG7A 4BICA 4U45A 1SVGA 5BNJA 5DG5A 2YERA 4IAZA 3EQIA 4TWOA 3UYTA 4DGLC 4M84A 4WNPA 2VWBA 3SQQA 1OI9A 3PA5A 2EU9A 2ONLC 4I20A 1VEBA 4Y83A 4PDPA 4A9TA 3O51A 3VQHA 4BN1A 4MBIA 3DDPA 5HESA 3A2CA 3BX5A 5EKOA 1ATPE 1OITA 2A27A 3OVVA 3L9LA 3PY0A 3JVRA 4BWKA 3MH1A 3MY0A 4JG7A 5F95A 3LVPA 3GENA 5FDPA 4FEWA 3QLGA 5J7BA 2ZM1A 3FMEA 5L6WL 4AZEA 4CYIA 3NUYA 4P7EA 5BUJA 2Z7QA 3OZ6A 4ONAA 5LMKA 2XZSA 3BHUA 4DHIB 2XUUA 5HBHA 5M07A 5CYIA 1NVRA 3FXXA 3LXLA 3UP2A 1PXJA 3VULA 5IA0A 5IQDA 5GIPE 2R64A 5AP7A 1STCE 4DFLA 3EQRA 4EH3A 4QOXA 2VTAA 3R9OA 2OFUA 4QEBA 2R3HA 4IHPA 5AJQA 1W2FA 1J3HA 5DNRA 4B8MA 3P7CA 3HRCA 4BBFA 3DBDA 3GUBA 3ZS5A 5H2UA 4AW5A 4NU1A 2ZDUA 5E92A 4ZTRA 4J96A 1XQZA 1CTPE 3ANQA 3FLZA 1TVOA 2R3FA 3BL9A 3VS4A 1ZYCA 3A7IA 1DI9A 2PZ5A 4IE9A 4IWQA 1UNLA 2B55A 1OL6A 4FT7A 3W33A 4RX7A 1W83A 2GU8A 3PWDA 4C57A 3ELJA 4EZ5A 3PSCA 2X39A 2CKPA 3JPVA 3F5GA 3QTWA 4K9YA 2BAKA 4C4GA 5I9ZA 2C5OA 1CDKA 4WBBB 2QO9A 3QU0A 3T9TA 1XKKA 1H4LA 3UE4A 4DGMA 3WZDA 4GU6A 4D5KA 2FB8A 4FTKA 3F3UA 5M51A 4FKLA 4B99A 4AUAA 3R6XA 5DFPA 2X7OA 3ACJA 4F64A 4DCEA 2UW9A 3IDPA 2F57A 3U51A 1H01A 2WXVA 3UQGA 4FBXA 3Q96A 4ZJIA 3QRIA 3W0OA 1KWPA 2WZJA 3F69A 4FKIA 5LOHA 5IPJA 5K0KA 2O0UA 3G0FA 5ETIA 3RBWA 3F3WA 5LXMA 4ZMEA 4CLIA 4JBOA 2YWPA 5CT7A 3FLNC 3Q9XA 3MTFA 3ZH8A 2XNNA 3PVBA 1A48A 3ORLA 4ANBA 2VO6A 5IQAA 3D2KA 3PDTA 5JFXA 5LJJA 4ZSLA 4R7BA 4YO4A 1NXKA 3V8WA 2PMNX 3P7AA 4HYUA 4K6ZA 3ROCA 2CPKE 3Q9YA 4C4FA 4JS8A 1G8KA 4D1ZA 4O7VA 4BCJA 2W1EA 2WMTA 3PJ3A 3AQVA 4UZDA 3WZJA 5HKMA 4DHZA 3OWJA 4PRJA 4JRVA 5BMSA 5FG8A 4C37A 3MY1A 4UXQA 2ESMA 4QP1A 3W2RA 5FP5A 3VC4A 3ZFMA 2WQMA 4PL3A 1H1QA 3BU6A 5AV4A 1OL7A 3LM0A 3EQHA 2XNMA 2R3JA 4M69A 4O7TA 3AKKA 4QMPA 5JEBA 5T6KA 3UJGA 1FBNA 3QRKA 5L8JA 1MP8A 2YZLA 4AN9A 3CGFA 4AZTA 2XBJA 4DEHA 4G31A 4JQ7A 5M53A 5AUWA 4D2TA 4V0GA 4NKAA 3DJ7A 4XBRA 2J0MB 5DH3A 4G16A 4AQCA 4AU8A 1OBGA 3G0EA 4YZCA 4G5JA 4JG6A 3D14A 4IX4A 1RE8A 1KE9A 2YZAA 4WNKA 1ZYLA 2ITWA 3G6GA 4AXFA 3QXPA 4DFZE 2XEYA 1H08A 2H34A 2WMWA 3F6XA 3EN6A 4FSQA 1PJKA 4RSSA 3QALE 4AOIA 4KD1A 2HCKA 2VTLA 4IWPA 4PUZA 3GFEA 1Z9XA 2Q83A 3ACKA 3Q4TA 4UYNA 4X3FA 4BHZA 4JQEA 4E6QA 4EK5A 3A61A 5D7AA 3BBTB 3PIYA 2PSQA 2HOGA 4GSBA 3AC4A 2IVTA 2B53A 3QTZA 3ERKA 5TF9A 3OCBA 4MXAA 3SG9A 4D2VA 3ORNA 3HA8A 3QXOA 2IEWA 4IH8A 4LUEA 2DS1A 4ZAUA 1PF8A 3EL8A 1VYZA 3FL4A 3WF8A 4WD5A 5L6OA 5I4NA 3R30A 2AYPA 3MVJA 3UZPA 4AS0A 3RJCA 2H96A 2VTMA 2PZPA 2VWYA 4FMQA 2BTSA 5C4KA 2YACA 3CQWA 5HU3A 5FRIA 3LMIA 1JVPP 2XBAA 4XJ0A 3TKIA 3W2SA 3R7YA 3R1YA 1NVSA 4N6ZA 2QO7A 4MKCA 5CS6A 5A4TA 5D1JA 4F1OA 2B7AA 4I1ZA 5IG1A 4EL9A 5CEMA 5LVNA 1CKPA 2GS6A 3VF9A 3F82A 2W1HA 4U40A 1H8FA 3CY2A 3DT1A 5AUXA 4O22A 4OTPA 3PPKA 2CJMA 4NW6A 2X1NA 5EDQA 4ACDA 1HCLA 2A1AB 2PL0A 1XH7A 3FZSA 4FVPA 3D5UA 4FSTA 4L3LA 4QTAA 5HE1A 5T68A 2X0OA 3CEKA 3SLSA 2NPQA 4ZLZA 1TKIA 3GCUA 4MF1A 5C8KA 2C6OA 4AW2A 2HXQA 4D2RA 2C1BA 4JOAA 4EH2A 4KB8A 2OGVA 4TWCA 4PP9A 3UQFA 3D5XA 3PIZA 4X0MA 3PA3A 4IACA 1GIIA 2XIZA 3GC7A 2WU6A 3LJ2A 3PJ1A 4E93A 1YHSA 3CJGA 3Q3BA 2F9GA 3D7TB 3Q6WA 4BKZA 4AXAA 3I81A 3EL7A 4FX3A 3SAYA 3E64A 4FKGA 4BKYA 3GNIB 4NZWB 2HZIA 4R78A 4BIEA 5M57A 1M52A 2R3QA 2QHNA 1OGYA 2QU5A 4BR3A 5LARA 2GQSA 3UPXA 4C38A 4MYGA 3ZBFA 3TI1A 5EI8A 2WTKC 2BMCA 1QPEA 4YO6A 4BGGA 4KRCA 3PY3A 1G5SA 3VBTA 5A4LA 3TEIA 5DOSA 4KSQA 4U3ZA 3W10A 4C02A 4F1TA 1ND4A 4YP8A 4EI4A 2HZNA 3U8WA 3F2RA 2XCKA 4YC3A 2GHLA 3NW7A 4OW8A 3C0HA 4ZZMA 2X6EA 3CR0A 2OKRA 4IZAA 2XAOA 4QDEA 4XRJA 3BIZA 4RJ8A 2W7XA 3FLSA 3EIDA 2J90A 3QA0A 5I3RA 4C4HA 4O7LA 4NT4A 4IFCA 5AUYA 3RGFA 3LPBA 4FKQA 3U4UA 4G3FA 3VUHA 4F0FA 5AUZA 2PUIA 4BY9E 3ORKA 4GK2A 4H3BA 3QX2A 2WTWA 3OEZA 3CLYA 3KQ7A 4PPBA 2UZTA 2UUEA 1JWHA 4HNFA 4MH7A 3FYKX 2KULA 4R3PA 4DGGA 2WMUA 3I60A 2HXLA 2BRHA 2E9PA 2YCFA 5FM2A 4WO5A 2XS0A 5IUIA 3C5UA 3GOPA 5B2LA 3FWQA 4AE6A 1XH8A 2GFSA 3BE9A 4M3QA 1GZKA 4FKJA 3WE4A 2C3JA 4FIIA 4AA5A 3DJ6A 2R3OA 3MW1A 3TKUA 4FL2A 4IWDA 5BYLA 4YTHA 3S1HA 4J95A 4TYJA 5EDPA 3KRRA 4FSMA 2GNLA 2HWOA 2OZAB 5H8BA 4NSTA 4G3EA 3V8TA 2X8IA 2YEXA 4HGTA 3TZ8A 3KL8A 2SRCA 4GIHA 3NNVA 3AT2A 1REKA 2WMAA 1XH6A 4UMQA 3N9XA 3QCXA 5AEPA 2PE0A 2X2LA 4TL0A 3KCFA 3DPKA 4MD8E 2PULA 2QG7A 2QI8A 3QHWA 2W1ZA 3POZA 4AE9A 5LQFA 5HE3A 1GJOA 2FSLX 3G9NA 3R71A 4FL1A 4M0YA 4U41A 3R8UA 1OL1A 4DFNA 4GW8A 3AXWA 4KKGA 4BTFA 3E93A 3MWUA 3DLSA 4CVAA 3V04A 4NM7A 5IA2A 1IA9A 4IX5A 4O4FA 5CNNA 5D11A 4RIOA 3G6HA 4U7ZA 5HORA 3BGQA 3ZLXA 2WQBA 3BYSA 2P2IA 2B9FA 4WUNA 4CQEA 3HP5A 4L3PA 5JK3A 4XUFA 1PXKA 4F1MA 4HNIA 4B9DA 3Q60A 3NUXA 4RG0A 2IPXA 1F0QA 2YHVA 1UU9A 4DA5A 3IDCA 1UNHA 2OH4A 2PPQA 3QD4A 5E1SA 1TQIA 2G9XA 4CZTA 5JGAA 3KRXA 4G3DA 4XG6A 2Q0NA 4FSNA 4FZDB 5HX8A 2F2CB 2BHEA 5CSHA 2IW8A 3E92A 3NVKI 1ZYSA 3WIGA 5CVHA 2DYLA 1JKKA 3AMAA 3CTJA 3OMVA 3R8VA 2J2IB 4U44A 3RAWA 4CLJA 3QZIA 3H3CA 3DXPA 4ENYA 4S33A 2WMVA 2F7ZE 3U9NA 4CTCA 2AC5A 3PE1A 3OP5A 4FTCA 5F94A 4V01A 1YHWA 4QD6A 1ST0A 4TYEA 5HBJA 4GH2A 3VUKA 4MVFA 3ZFXA 2ZB0A 3QLFA 2YABA 2W06A 3WYXA 4LOOA 4F6UA 2PHKA 4OTRA 1OKWA 4RVKA 1WVYA 1T45A 2C0OA 4NM5A 2XEZA 4O0XA 4AA0A 4FIJA 4ZMFA 4BYJA 5DT3A 3BZ3A 3R04A 5E8TA 3V5LA 3VRZA 3ZRLA 4AGUA 5AR4A 2GMXA 2JC6A 3GCPA 4GL9A 2IJMA 4K18A 5BVEA 4RA5A 1YI4A 3ORIA 2XYUA 2BRMA 4NCTC 2CN8A 3DAEA 4FYNA 5EHOA 3IW7A 4QNAA 1S9JA 2Y4PA 3PZEA 4CFFA 5CF6A 4NFMA 5J9ZA 4ZTQA 2VUWA 2J50A 3O7LD 5LVMA 4NM0A 5B2KA 4TNBA 3F3TA 1H28A 4Y5HA 4IIRA 3BLHA 4GFGA 4I6LA 2BFXA 2ONLA 3RK9A 4APCA 4JT3A 4L46A 4ZXTA 3RVGA 5AADA 5KUPA 4FTQA 3GCVA 3BRBA 4E6CA 2VV9A 2OJFE 3SW4A 4ZY4A 3PLSA 1FVRA 5EOBA 1WBPA 3LZBA 5JH6A 2JDVA 4QP9A 1JKTA 5IDPA 1LP4A 3GQLA 1BX6A 3Q9WA 2IW9A 4HW7A 4FIFA 5FEQA 4E5WA 3TV7A 5J5TA 4DTBA 5T3QA 2QO2A 3IOKA 4D0XA 4R7HA 1Q97A 3U6JA 3VBVA 4K2RA 5KMJA 3O2MA 3QFVA 3KVXA 2HW6A 5CWZA 2OJGA 3OCGA 4XG2A 3I7BA 2C0IA 4IADA 3D7TA 4FTLA 1PY5A 4FGRA 1NA7A 2UVZA 2VWIA 4CEGA 4FVRA 2C5VA 5JQ8A 3A7FA 2ZDTA 3TWJA 4YJQA 3TNPC 1MUOA 4BZNA 2OICA 2BRNA 3FUPA 4JBVA 2UVYA 4BI2A 2XA4A 4L53A 3ZZWA 2Z02A 3QBNA 3FMHA 4KIKB 5DYJA 2HIWA 4QP3A 4YJPA 1XH9A 4JR7A 4I6QA 3VUDA 4AZWA 2XNBA 3I0QA 4E26A 3NVMB 5TR6A 3GC9A 3PG1A 3DZQA 4FC0A 3NNWA 3OUKA 3U6HA 3HUCA 3QTIA 2JBOA 3HP2A 4IM0A 2YISA 3KRJA 3LCOA 2R0UA 4HGEA 3TM0A 2HY81 3IW8A 4L01A 3SD0A 2OF2A 4D2WA 1UVRA 3C51A 3VS6A 2BKKA 2BKZA 3KMWA 3TNWA 3ZZEA 2JDTA 3TKHA 5LMBA 3M1SA 1V0OA 2ITOA 2R3KA 2AQXA 1KV2A 3VAPA 2XIKA 4F08A 4C2WA 4O4DA 3LXNA 4FTUA 4YJOA 4HZRA 4BWXA 3ATTA 2EXMA 3ZEWA 2B9HA 4F9YA 1E1VA 1YXXA 2OZOA 4FV0A 3VJNA 4X3JA 3W2QA 3R9RA 5KKRC 1Q3DA 2R0IA 1BMKA 4FIEA 4FZFB 4M7IA 3MTLA 1AQ1A 2WEVA 4H58A 5CSXA 4CD0A 1PHKA 2JIVA 3IGGA 2Y4IC 4W4YA 2RFDA 4LG4A 1P4OA 2FUMA 4V04A 4AACA 5BX0A 2YIWA 3F7ZA 4ZEGA 3B8RA 3RWQA 4E8AA 4GJ2A 2JKKA 4PL5A 4EKKA 2QC6A 4ALVA 4FTRA 4EOMA 4QP4A 3NS9A 2CGWA 2J0JA 3V5TA 2XK7A 4EQUA 4I0RA 4RWLA 3MV5A 5DLSA 4CGAA 5E8SA 4YJRA 4RX8A 4TYIA 5HVYA 3RPOA 3V5WA 3ZYAA 4DHJA 3U54A 4OUCA 2YDKA 3DBFA 4CFUA 5GZAA 5L8KA 5EH0A 2OU7A 4ACGA 1P2AA 4PDOA 4BBMA 4BRXA 2B52A 4FK3A 4FJVA 4J1RA 4LMUA 4I6FA 3KEXA 4FL3A 1Q24A 5A4CA 4OAVB 3DU8A 4QTDA 3U4WA 4F9CA 2UW3A 4JAIA 4S32A 4XV2A 1KOBA 5AM6A 5DE2A 5KMIA 2WMBA 3VHEA 3UTOA 1BKXA 4BCKA 4QMQA 1L8TA 4LDTA 4MNEB 4ZTSA 2EB3A 5A9UA 2PUNA 4PNKA 3FMNA 1YKRA 3R1SA 4ZZOA 3KMMA 4F7SA 3VUGA 3AC3A 3MIAA 2WEIA 2IF8A 3LAUA 4R5SA 2GTNA 4DH1A 3W0QA 3A99A 3M11A 2G2HA 3BLAA 4KBCA 4RJ3A 4HCUA 4EOJA 3FZOA 3PE2A 2CNVA 2RSVA 4GU9A 5IA5A 1NY3A 3FSKA 4PMMA 4IEBA 4ASDA 4C61A 4OT6A 3BGPA 4GYIA 4KIQA 1XMLA 5ANKA 5KBQA 4ALUA 5CVFA 3BELA 2E9NA 1IR3A 3ZXZA 2W0JA 1TQMA 5EM8A 3FE3A 4D4RA 5K0XA 5C01A 2YM5A 3B2WA 4AF3A 3F9NA 4Z7HA 3QQGA 1PXLA 5HG8A 4U97A 4WA9A 1NW1A 3HNGA 4IANA 5CF5A 4DBXA 4YR8A 1UU8A 3BYUA 3OCTA 2IW6A 4CMOA 2W1FA 2E2BA 3T9IA 1Y8GA 5BQ0A 4W4WA 2ITYA 2VNWA 5M56A 3FV8A 4WRSA 4DT8A 4AFEA 3FMKA 3CQEA 3I6UA 4XOZA 4YTFA 2IG7A 2VN9A 4HVSA 5IEVA 4MD7E 3F2AA 5JQ5A 2W05A 2PVMA 4B8LA 3AOXA 4IWOA 2IVUA 3QQJA 4Y72A 3TUCA 2IO6A 3ML1A 4IB1A 5I3OA 2XNOA 2WMRA 2PVJA 2ERZE 4O27B 1Q8TA 2REIA 2X0GA 5HCXA 5TE0A 3CCNA 4D28A 2C6KA 5EI6A 3ZM9A 2VO0A 5FEEA 3CD3A 3NR9A 2BZKB 4HVHA 4D1SA 4N0SA 4GCJA 1DI8A 3EWHA 3DKOA 3ODYX 3DQWA 1URCA 2P0CA 5M4FA 3TJDA 5E8XA 3UZTA 5AFVA 5IEXA 4MWHA 3A8XA 4L6QA 2WIPA 4ACMA 3FKOA 4FT0A 4PP7A 3F7WA 4HJOA 4IJ9A 3G90X 5HBEA 3KVWA 4J7BA 5HX6A 2ZFYA 1KSWA 4IAYA 1MRUA 3OROA 4F6SA 3R2YA 2XJ2A 2NP8A 4IAIA 4MXZA 5HCZA 3QUDA 4R6VA 5TKDA 3C4XA 3MDYA 4NK9A 4JG8A 4FICA 3FLQA 3Q32A 4D4VA 1W2DA 2PYWA 5IH6A 2XRUA 4X2JA 5JGBA 2VX3A 4BGHA 4EYMA 3QQHA 2XVDA 4PX6A 2WMQA 4XG7A 3FKNA 2XB7A 3E63A 3UIMA 4AN2A 5M44A 4HCTA 2PE2A 4L3JA 1PYEA 4CCUA 3R7EA 3WF9A 4DGOA 2WGJA 2PUPA 2C5NA 4KIKA 4E5BA 4A06A 2FGIA 4A9UA 4CMUA 3A60A 4XG8A 5CT0A 4FGBA 2OW3A 4HYIA 1FVTA 3OXTA 2B9IA 1UV5A 4RVTA 3TXOA 3FAAA 3R0TA 2QODA 4FV2A 3MIYA 4FNWA 4GV1A 3UGCA 2B0QA 4H05A 4FKWA 2I0VA 2HENA 5CU6A 2ZMDA 2XKDA 1ZOGA 3RAHA 4M0ZA 1OKYA 1UKIA 5FQDC 5C8NA 2W17A 3OWPA 3FMMA 4RC3A 3R7OA 1JQHA 4J97A 4MUQA 3VBQA 3ZDIA 4QMXA 1X8BA 1CMKE 4RJ5A 5BVOA 2W4KA 3COIA 4BCMA 4DG3E 3KXXA 2V7OA 4ZLYA 1PMEA 1WBWA 4DFUA 3P9JA 2R3RA 3MFUA 4PPCA 5AR8A 4YHJA 4Q5EA 2Z7SA 4OTHA 5IQFA 5DR2A 4BYIA 2ZJWA 4BDIA 4YHFA 3CJFA 2JKOA 4QT1A 4XG3A 3CPBA 4HPUE 5E91A 4JBPA 2B9JA 2WU7A 5KZ0A 2YJRA 4M12A 3ATSA 2ZM4A 3C0IA 3VJOA 3C0GA 2O5KA 3EZRA 4EBWA 1CSNA 5JRSA 5CSWA 5L2IA 1YDSE 4YTCA 3CKXA 3HMMA 2UW7A 5L2WA 3FQSA 3PXYA 1R78A 1U54B 3GCSA 4FT5A 4OBPA 3EFWA 3MVHA 4O1PA 3ZRKA 2OWBA 4YMJA 3FKLA 1ZAOA 4P4CA 5CI6A 5GHVA 3HA6A 3TJCA 4MXCA 4BVUA 5F4NA 4C4IA 5CXZA 2IVSA 4XP0A 2JEDA 5AP5A 2EWAA 3UIBA 4H3QA 3ZEPA 3EJ1A 2WMXA 4OBOA 3R8PA 4L7SA 4EOQA 3FI2A 3KXNA 4IDTA 1LUFA 1OIQA 3JS2A 4X2KA 4QMNA 2C6MA 3FXWA 3TZMA 2XP2A 4UV0A 4F99A 4U6RA 4ZTHA 2XKCA 4X2GA 3RI1A 4PV0A 1G3NA 3C4CA 2VGOA 4OTQA 3GFWA 5I9VA 4J53A 3AMYA 4CYJA 4F7JA 3F3VA 4ZS4A 2J51A 2PU8A 3QTXA 3R83A 3AKLA 1IRKA 2F7EE 4UMTA 2UZUE 4WNMA 4G1WA 4MNEA 4BI0A 4U43A 4EONA 4EQMA 5IQEA 3ZRMA 4FSRA 2J6MA 4G5PA 5AAFA 4EHEA 3EYGA 4Q5HA 3W32A 2PTKA 2JKMA 3MFRA 2DWBA 2E9OA 4BCHA 2XM9A 4JX3A 2JAVA 2EXCX 1Q8ZA 4PPAA 3TUBA 4DF3A 2UW4A 4FVQA 4MD9E 4Y8DA 4O82A 3KFAA 3VVHA 5CU3A 4RC2A 2XALA 3TV6A 3KY2A 3UPZA 2O63A 3ZUUA 5E7RA 4RGJA 4TTHB 3KGAA 4PL4A 2XIYA 2QVSE 3FC1X 5JFWA 5L6PA 5IQCA 2XKFA 3ROYA 1BI8A 5AWMA 3UODA 4CTBA 4CFVA 5HD7A 3SG8A 4XV3A 2J5FA 4EEVA 1B6CB 2G2IA 2WTIA 3M2WA 3NSZA 4CFWA 2IZTA 2UVXA 2GSFA 1FMOE 1F3MC 3LFFA 4FV4A 4QP2A 2PK9A 2PVRA 3H4JA 3PJCA 4PTGA 1OUYA 3EFJA 3L8VA 4O4EA 4OTGA 5DBXA 4P2KA 2I1MA 4I0SA 4QMVA 3UC4A 4I3ZA 1M2PA 4FTJA 4JDIA 5C9CA 1H1SA 1O9UA 1FGIA 3MPAA 4QMOA 3FY2A 3PY1A 3NX8A 5CEOA 5CALA 2VTRA 4QTBA 4M14A 4Y5QA 3VS2A 2UZEA 4EOKA 2I40A 4QP7A 1J91A 3VW8A 2X8DA 4EOOA 3FMJA 5HO8A 2C69A 1J7IA 4RIYB 3IPHA 4DEBA 4RPVA 3EMGA 3R01A 2XNPA 3PTGA 4JBQA 5ITAA 1JNKA 3I0OA 4J99A 2OJ9A 4XH6A 3COHA 3OOGA 5KNJA 2XJ1A 1K2PA 2UZWE 5J8IA 2XIXA 1BLXA 2OF4A 4K77A 5J87A 1YOMA 3I6WA 1WAKA 5H8EA 2IZRA 3A4PA 3AC5A 4ZSEA 2IN6A 5AP4A 3PWYA 5D7VA 3UO4A 4CRLA 5BUIA 2QOFA 1QPCA 4F0IA 2ZB1A 4O0SA 4RFYA 2QURA 1IEPA 4U42A 5I5ZA 3H9RA 5ANJA 1VJYA 4L43A 2B54A 3OWKA 2GNIA 4UY9A 3R9DA 3RK7A 3LFBA 3HDMA 5K4IA 1WVWA 3FI4A 5HHWA 3F88A 5BV3A 3DAKA 3HMNA 3CTHA 3UNZA 4EOPA 3TIZA 4XLVA 5GJGA 4LRMA 2IZUA 3KB7A 5BVFA 2VWWA 4USFA 1MRVA 4JIKA 4DITA 3HYHA 3QYWA 4FOCA 4OTFA 3SXSA 2XANA 1Q62A 4JXFA 3LLAA 4G9CA 2CHLA 3ZLWA 4LUDA 1KE5A 2UZBA 4OT5A 3G5DA 3W0SA 3DK3A 2YN8A 2ITZA 3RHXA 4EJNA 4LI5A 4IAKA 1WZYA 2W4JA 4QQCA 2FSTX 4GJ3A 4KABA 3ZSHA 5CASA 4IC7A 2VNYA 4RLKA 3QHRA 4D4SA 3DBEA 2Y8OA 3RPRA 3EQFA 4LOPA 4A9YA 1UNGA 5EDRA 5EG3A 3BV3A 5AR5A 4F65A 2ACXA 2BTRA 5AX3A 5HLNA 4NKSA 4Z7GA 1Q99A 1OL2A 3PVWA 4RFMA 4WT6A 2A2AA 1WBVA 4TY1A 2QKWB 4G9RA 4PQNA 4QMWA 2A4LA 4HGSA 3GOKA 5HVKA 3OS3A 2WQOA 4Q9SA 1OGUA 3E88A 3ZMMA 3D15A 4ZJVA 2WMSA 3QRUA 5LVLA 3NCGA 3D5VA 4O4BB 2PWLA 3S3IA 3WZEA 4CFMA 4Y85A 4AGCA 4BDJA 4EKLA 1BUHA 1M2RA 4O4CA 5E8ZA 1UU7A 5CEPA 5M08A 3LXPA 4IFGA 3AT4A 1W82A 1ZLTA 4YC8A 1Y6BA 5KX8A 4FODA 1VR2A 4CKRA 4M13A 3VBXA 4F7NA 3MJ2A 1Z5MA 1GAGA 3ZM4A 4GYGA 2X4FA 5DIAA 5A4QA 4AX8A 3LMHA 1WMKA 4RZVA 3IKAA 3BV2A 4EHZA 3N4TA 1ST4A 2ZV8A 2CGXA 3ZFYA 4R1YA 5EW8A 2C47A 4YSMA 1R3CA 3ZU7A 5C1QB 2VTPA 3HEGA 1OL5A 2XK9A 2PVHA 5IQBA 1H00A 3H0YA 3DFAA 3LE6A 1U54A 3P23A 1WBOA 5AR3A 4AZVA 4ENXA 2OXDA 4TKSA 4TYHA 1QL6A 5E1EA 1UU3A 2AUHA 2PVYA 5AA8A 3SXFA 2OG8A 5KE0A 1OECA 3RPYA 4L52A 3KC3A 4XEYA 4BFMA 4I4FA 4ID7A 4DEGA 1W2CA 4ZJJA 1P4FA 4X21A 5EW9A 5GZ8A 4FKPA 4IJPA 4QP8A 4YZNA 3NLBA 4YTIA 2P33A 3O8UA 2W1CA 3DJ5A 2J0IA 4NM3A 5EOLA 4IW0A 1UA2A 4O7SA 3CP9A 2H6DA 2J7TA 2Y0AA 1SM2A 3PSBA 3QRJA 3DKFA 4I4EA 4I24A 3QCSA 4QMTA 2HAKA 3W18A 4ERKA 3QGWA 5TO8A 3TL8A 4U0IA 1YXUA 1B38A 4FA2A 2XARA 4NJ3A 4ZY6A 2V0DA 5D9HA 3ZSIA 5A54A 2I0HA 2YIYA 4ZLOA 2GCDA 4I6BA 5AP2A 4BF2A 1Q61A 3I79A 1OB3A 2YCQA 5D41A 3HAMA 2PMOX 2VWXA 3DA6A 1QPDA 3P1AA 4ITJA 2QOOA 1E9HA 5EHLA 2F2UA 3C4EA 4E4XA 3COKA 3P4KA 3VS1A 2OI4X 4EWQA 5CSPA 4EH5A 3E3BX 3QC4A 1KE6A 4FKUA 5LCKA 3FPQA 3RAKA 4BB4A 4FSUA 2PUUA 4YJTA 2FA2A 2GFCA 3GQIA 3GEQA 5HZNA 4AAYA 3PJ8A 1YW2A