1EH4A

Binary complex of casein kinase-1 from s. pombe with an atp competitive inhibitor, ic261
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
293
structure length
293
Chain Sequence
NVVGVHYKVGRRIGEGSFGVIFEGTNLLNNQQVAIKFEPRRSDAPQLRDEYRTYKLLAGCTGIPNVYYFGQEGLHNVLVIDLLGPSLEDLLDLCGRKFSVKTVAMAAKQMLARVQSIHEKSLVYRDIKPDNFLIGRPNSKNANMIYVVDFGMVKFYRDPVTKQHIPYREKKNLSGTARYMSINTHLGREQSRRDDLEALGHVFMYFLRGSLPWQGLKAATNKQKYERIGEKKQSTPLRELCAGFPEEFYKYMHYARNLAFDATPDYDYLQGLFSKVLERLNTTEDENFDWNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASEIN KINASE-1
publication title Crystal Structure of a Conformation-Selective Casein Kinase-1 Inhibitor
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 79
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2000-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1eh4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1eh4A01
1P4OA 2W4JA 1Q3DA 2B9FA 5B7VA 2NO3A 4A4XA 3AXWA 2YLFA 2PMLX 4QP9A 1ZWSA 3V5TA 4TTHB 3FBVA 4I5PA 2JFMA 4IVBA 2HXLA 5DRBA 3DBEA 3QQUA 5CQUA 2HYYA 2YCRA 3EQGA 5HGIA 5M08A 3TWJA 3HP2A 3U51A 3FHRA 4UALA 2J0JA 1ZOEA 3CTQA 3CBLA 1ZMWA 3CGFA 3IK3A 3Q32A 4YJUA 5AMNA 5JZJA 3UO4A 3GI3A 4YP8A 3POZA 1IAJA 4PDYA 4IDVA 4YUQA 2F7EE 2O5KA 3D5XA 3UIUA 3MVMA 4W9XA 4AA4A 4F4PA 1H26A 2C0TA 3QFVA 2XCKA 3E62A 4D2TA 4BBEA 1CKPA 4R7IA 1XH6A 4EH8A 3E7VA 2PVKA 2JGZA 4X0MA 3QQKA 4PL3A 3GEQA 4CKRA 4UV0A 3IW8A 4U8ZA 4AXAA 5KX8A 4FOBA 2GS7A 2V7AA 4QPMA 4D4YA 2WMAA 3EN6A 4GUBA 2Y6MA 4CNHA 1LPUA 5GJDA 3SD0A 5A4CA 5BVDA 5M53A 5FTGA 2OK1A 1P5EA 4MXYA 5KMMA 3TKIA 3QXOA 5IEXA 1Q24A 4I4EA 3NSZA 5AP4A 4HVSA 3EN7A 3BELA 2E9PA 5JFWA 5EK7A 4ZMFA 5B2LA 4EK6A 4GJ3A 4X3JA 3CC6A 3UQCA 4C8BA 4IB5A 4EHEA 2HW6A 1GIJA 4CTCA 2GFSA 4BTJA 2C4GA 3UMWA 4O7RA 3PRIA 4UWCA 5FWKK 3RAKA 2YIRA 3BU3A 1IA9A 3ROCA 2OKRA 4NTTA 5CSVA 4NU1A 4YTCA 4FV5A 5IQGA 3L8PA 3FI8A 3WYXA 1OIYA 3ORNA 1FBNA 3KC3A 5E1SA 2AYPA 1FMKA 1SMHA 3PXRA 1F5QA 4WD5A 5LARA 4EOQA 4PRJA 4IX4A 4DEBA 4K2RA 3E8CA 3TEIA 4WHZA 2ITQA 4BCOA 2GNFA 3CS9A 4F9WA 2OI4X 4NM5A 4USEA 3T3VA 4CG8A 4FVPA 1MRUA 4GEOA 3R7OA 3EN9A 4C2VA 5EFQA 5IA1A 5IQIA 4CMOA 1Q41A 2C3LA 4RWJA 2CN5A 4MTAA 4FNYA 4AT3A 3D94A 3GB2A 3DJ5A 1Q62A 1SYKA 5JFVA 3MGYA 5E92A 5C4KA 5I3RA 1K9AA 1JAMA 2PSQA 2YIQA 3BRBA 3QX2A 1OKZA 4GW8A 4X3FB 3NVKI 4YLLA 2QR7A 3OXTA 3HLLA 3QU0A 3EN5A 1Q61A 5IQHA 5FG8A 5F1ZA 3B2WA 3P0MA 4M97A 4BDDA 4XV1A 1LR4A 1PMUA 3V5JA 3LMGA 3Q4ZA 1XO2B 4RLLA 3RAHA 2XJ0A 1W8CA 2WMWA 5LMKA 3LXNA 2CGUA 4QMZA 1A9UA 1PXPA 2CCHA 4IM0A 5E8VA 2W96B 4EZ5A 4P90A 1WBWA 4K33A 1JQHA 2BFYA 4H39A 3H0YA 3NNWA 1PMEA 2BALA 2HOGA 2Q0BA 4I41A 5AV1A 4Y95A 2OG8A 2YHVA 3QTIA 4ITIA 4GIHA 4QNAA 2CNUA 3DKFA 4BCQA 3PYYA 4LMNA 4UX9A 4X3FA 4ANBA 4E4MA 2VTAA 5KKRC 2UVZA 3V5PA 3VHKA 1JVPP 4S30A 1PXIA 3OMVA 1KE7A 4FC0A 4PMPA 3VBWA 4FTOA 3CY3A 2CCIA 3MA3A 3VS3A 4TWOA 3UOLA 5HTCA 4BTMA 1YKRA 4NWMA 3UVRA 3QXPA 3OF0A 4TYJA 4O0SA 4UZDA 3OUNB 3DB8A 1OL5A 4BDEA 4CSVA 4FEXA 4ORKA 3O7LB 1OL7A 3PFQA 3PSDA 5FEDA 1KUTA 4ERKA 3QHRA 2QOBA 3MWUA 3DNEA 3F69A 4LG4A 4MBJA 3GXLA 2GHLA 5KMLA 3EZRA 1O9UA 3BV2A 3UJGA 5DG5A 2BTSA 4AUAA 1M7QA 1KV1A 4GS6A 4JXFA 4FKGA 1Q8UA 3NR9A 4C58A 5E4HA 2ZB0A 4FZFB 2YERA 2HELA 3PPKA 3N4VA 2Q0NA 3QUPA 4I0RA 3UOHA 3KA0A 2X9FA 4X6RA 3C1XA 4AFJA 2XK6A 1J91A 4BDGA 2NNWB 3D0EA 4H05A 4AT5A 4WNPA 1NY3A 4C4JA 4NCTC 5I9WA 4H3BA 2W1IA 2O64A 3KY2A 4GVJA 3HMPA 2P0CA 5CEQA 3WF6A 2BR1A 4BBFA 3A61A 3BHHA 4C4HA 1DM2A 4U40A 3R1QA 3DKOA 4DEGA 4AW2A 5IQCA 1NXKA 4YLJA 4OGRA 4HGTA 2ETKA 4IB0A 5K4JA 4KA3A 4MQ2A 1H00A 2FA2A 4AA5A 3ZC5A 3LFBA 3GVUA 1UU7A 4L43A 3RPOA 3NLBA 3LFCA 2NP8A 4AZFA 4BTKA 4FKSA 4Y5HA 2QU6A 1BI8A 5AFVA 3GCVA 2C3IB 3LXPA 3QGYA 5BPYA 2KULA 4GSBA 3TZMA 4Y5QA 4RIWA 1Q8TA 5EKOA 3L9NA 1GIIA 3VBVA 4FIGA 2RFEA 3QALE 2QOHA 2R0UA 5FM2A 4BCMA 1YXTA 2V62A 2P2HA 3E3BX 4Y85A 3EB0A 4CKIA 3QTWA 4JVGA 5D7AA 3AQVA 4X7QA 4ZAUA 2XRUA 5I9XA 4IAFA 4FT9A 5J79A 4C3PA 5H2UA 4G5PA 4RC4A 4P7EA 2EVAA 4YSJA 2GNGA 2RSVA 4TYHB 5LJJA 2EU9A 3VHEA 3QCYA 1YWNA 5D41A 5KZ0A 3GU6A 4QYFA 5HEZA 4X2FA 2J0KA 1U59A 2QHNA 3OUKA 4G6NA 4MXAA 2WQBA 4R5SA 3V8TA 1GZKA 4JR7A 5LXMA 3ZUUA 1WVWA 3EYHA 3OT3A 4C35A 2C69A 4TYIA 1E9HA 4EQMA 2XNMA 3A4PA 3VUTA 4N57A 2UVXA 2VTOA 3EQPA 4F6SA 3NS9A 3ZLWA 4E3CA 4BC6A 3C0HA 1GIHA 2VO6A 3KXMA 1YDSE 4UYAA 2E9NA 5LWMA 3Q5IA 3COHA 5HORA 5HO8A 2BRMA 4LQMA 4QP8A 4ZZMA 3OS3A 4UEUA 3CD8A 4DFLA 3CQUA 5FUTA 2PE2A 4YTIA 2WTWA 2Z60A 4HCUA 2W9FB 4PV0A 4IZYA 4BCFA 4F7LA 4I3ZA 2YWPA 2W1GA 3RGFA 3CJFA 5IA4A 4EOPA 4QTAA 3PLAE 2CGXA 3UG2A 3PA4A 3ZLSA 4ANMA 1V0PA 4M67A 5L8LA 3BPRA 2F57A 4G3EA 4O96A 4ZJJA 4FV7A 4X21A 4BZDA 1ERKA 2A2AA 4DBNA 4GV1A 5KBRA 3P86A 1UNGA 4YZCA 4PNIA 4JNWA 1MP8A 4E6QA 2CN8A 4JG6A 5FP5A 3COMA 3JUHA 2IN6A 4JDJA 4C2WA 3HAVA 2BAJA 2ITOA 4O1OA 4AP7A 4HW7A 4PX6A 1Y6AA 5GNKA 2XA4A 4FV1A 2J2IB 1H1QA 3PWYA 2UZDA 4RVKA 5HU9A 4XJ0A 4TWPA 3F7ZA 1OUYA 2DUVA 2B54A 4F7JA 3TIYA 3ANRA 4NIFB 4XNEA 3HA6A 3LFFA 2CKEA 3ERKA 3F66A 3BGPA 4IAYA 1NVRA 5HLNA 4DFBA 5IEVA 4P5QA 1IA8A 4G3FA 4BI0A 3ZLXA 3NEWA 4USDA 4LRMA 4FODA 3LXKA 3B8RA 4JIAA 5JSMA 3ODZX 3FI2A 4OTHA 3ORTA 4H3PA 5HBEA 4EZ3A 4YO4A 3OW4A 3RTPA 2OW3A 4FOCA 2WIPA 3UPZA 5HTIA 5KMKA 2PMNX 1RJBA 4H36A 2XRWA 2VNWA 4TYGA 3FKLA 3FPMA 4X2GA 3UPXA 3WZEA 5EQYA 4FKTA 2Y6OA 4OLIA 1WBSA 3FZOA 2BIKB 3I79A 4NIFA 4ZJVA 4BCKA 5EYDA 2RFSA 3QD4A 4NFNA 2C6TA 1WBTA 2J6MA 5F9EA 2UW7A 5JH6A 3NUUA 4P5ZA 5DN3A 4OBQA 5AX9A 3TN8A 3KFAA 3RVGA 3O17A 4RZWA 2CMWA 3I4BA 1YI4A 2PUUA 3HUBA 3ZUTA 4X3FC 2CKQA 4QQCA 4HZSA 3RALA 2IZSA 3SX9A 3UGCA 4BDCA 2YACA 4FTAA 3W2OA 2FSTX 2W05A 5HE2A 3UOKA 4WA9A 3RAWA 4ZY4A 2ITWA 2WU6A 3FLQA 4WKQA 3UVQA 4PP9A 4DFXE 3R9HA 4XV9A 2VRXA 1YXUA 5FRIA 3AGMA 2XJ1A 3MVJA 3D9VA 1JSTA 4M66A 2XM9A 1UNHA 3SQQA 1ATPE 4QO9A 2VU3A 4FKWA 5T3QA 5I5ZA 1KE5A 4EC8A 5DE2A 2PK9A 5K3YA 3WZJA 3ZXZA 3R04A 5GJGA 3F2AA 2VTHA 5HKMA 3ZH8A 4FL1A 4ASZA 2VX0A 4LOOA 1NVSA 4RA5A 2C68A 5CX9A 3COKA 4FTCA 4EC9A 4L01A 1YOMA 4G9RA 5TKDA 4MD7E 4YZ9A 5DIAA 4QRCA 4WRSA 4EZ7A 3GFEA 2ZV2A 3OXIA 3RZBA 3TV7A 4FK6A 3MB6A 4XYFA 3ETAA 5FXQA 4Z16A 1QPEA 5L2WA 3UZTA 1H08A 3KRWA 3R71A 4AAAA 3JS2A 3OT8A 4KS7A 3RK7A 2C5OA 2R2PA 4G2FA 4DN5A 1H4LA 4AW5A 1FINA 1H25A 4W4WA 4FSUA 2NPQA 4V05A 5DHJA 4V0GB 4I0TA 5GZAA 3A7IA 1YW2A 3HZTA 3KKVA 3ODYX 3D7ZA 3QX4A 4L53A 4N6YA 3R2YA 3ZM4A 3KN5A 4S2ZA 1FVRA 2DYLA 4JBPA 4FYOA 4DG3E 4QYHA 2VWVA 3R30A 1TKIA 4RGJA 3UC3A 4RX8A 5CASA 3KMUA 2O3PA 3Q9ZA 4CT1A 4F9CA 5L2SA 2UZLA 3WF5A 4LUDA 3GU4A 2JKKA 1H1WA 2Z2WA 1Q3WA 3O8PA 4F1MA 4JDKA 3IDPA 4DGGA 4FIHA 3IO7A 3VBTA 4L3LA 5AWMA 4CFVA 5TO8A 3SRVB 1APME 4F1TA 5EW3A 5M55A 3ZDIA 3VUIA 5AUVA 2Y0AA 3UOJA 2WTJA 3IQ7A 3MIAA 5CU2A 3PTGA 4GVAA 3DXNA 3TJCA 4GH2A 4FIIA 5IQDA 2BRHA 2PVFA 3F61A 3DQWA 3DTWA 3O0GA 4EJ7A 4M15A 1OL1A 5KMOA 4ZTNA 5JQ8A 4FKOA 3QZFA 5CQWA 5AJQA 4QMMA 3T9TA 4A9YA 4E73A 5IA2A 3ZUVA 2YM3A 4FIJA 4MNEA 5DT0A 1AGWA 2BZHB 4JX7A 2JEDA 4GUEA 5C03A 2JDVA 4I22A 4EK5A 4BDHA 3CPCA 5L3AA 4BKZA 4IQ6A 3CLYA 4BIEA 2RG5A 3BIZA 2VGPA 4OR5A 4IANA 5EYMA 4OAVB 5DRDA 4ACDA 2BAQA 4PDPA 3U6HA 2HXQA 2YM8A 3DJ6A 4FYNA 4ZTSA 3RAIA 3Q96A 3QTXA 4I5CA 4DLJA 5JN2A 5C9CA 4BN1A 4F0IA 4OAUC 3SDJA 3DS6A 3HV7A 4O38A 4E20A 4K8AA 4Q5HA 4FG9A 2XK7A 4XBUA 3CQEA 3N4TA 3QQFA 3TNQB 2C30A 3KXNA 1OPKA 1DS5A 3MBLA 1VYWA 1ZOHA 3GUBA 3WZDA 4CGAA 4HZRA 5E7RA 2X7FA 4LOQA 2Y9QA 2W5BA 3KULA 4R1YA 4I6HA 3R8PA 3OP5A 1JBPE 1UU8A 2F4JA 4IVCA 5AM6A 3PPJA 4CKJA 5HBJA 1F3MC 1ZYDA 2VO7A 5CSHA 1PKGA 4GL9A 3CIKA 1LEWA 4YJTA 4O7ZA 2J0MB 4ZMEA 4AWIA 2B9JA 2OZAA 3RP9A 4D58A 3IW7A 3PVUA 3SXSA 4D5HA 2ZDUA 3C0IA 4CFNA 3GU5A 2VWUA 1W84A 4K6ZA 3BHYA 5DT3A 4IMYA 4FKUA 1RQQA 5ITAA 4AN3A 3WARA 5AX3A 2W1ZA 1OZ1A 3L9MA 3P7AA 4RFYA 1ZY5A 4NKAA 4W8DA 5IQFA 3E88A 3EQHA 4KINA 4WUNA 5IUGA 4L52A 1OGUA 3GCPA 3UNJA 2WXVA 5M4CA 1XBAA 3OCTA 3R7YA 2VTSA 4PDOA 4YTHA 2ITXA 2PHKA 3PA3A 4TT7A 3R9NA 5B2MA 1PHKA 1YRPA 2QHMA 3K2LA 2YIWA 3FY0A 4FICA 4ALVA 2R64A 3OBJA 5BMSA 1WBNA 2GHGA 4BZOA 3BLHA 4DCAA 3WF8A 4KSPA 3WBLA 4RJ3A 5M56A 3LCTA 3LE6A 3CR0A 4G6LA 5L8KA 4RIXA 4G1WA 1P14A 4ZP5A 3Q3BA 1ZYJA 4IVDA 4QT1A 4JIKA 5FD2A 5HVKA 4JRVA 3VS6A 1XKKA 1MRVA 2PE1A 2YZAA 2P33A 3GC7A 5AAGA 4E6AA 1TQPA 4O0XA 4U97A 2Z8CA 1ZY4A 3NCZA 3MPAA 4MXXA 5IEYA 1XH7A 2ZYBA 1U54A 3MH2A 5DNRA 4Q5EA 2R3JA 2REIA 3JPVA 4GT5A 5EYCA 4RX9A 3TXOA 4MK0A 5HLWA 2XBAA 3UODA 1WAKA 2X2KA 2J9MA 2VO0A 4KBKA 3W2PA 4IH8A 5HO7A 3Q4UA 1Y8YA 4CLJA 2QG5A 4I6QA 4D4SA 3TG1A 2YAKA 5FEQA 3AOXA 3KXXA 5J87A 2JDTA 2I0VA 4FSQA 3RBWA 2BRGA 2NRYA 4BF2A 2JBOA 5I4NA 2BAKA 4LL0A 1KE6A 3CY2A 1OBGA 5LVNA 2XK8A 2X9EA 5E8XA 5CU3A 4F9BA 3KVXA 2R3MA 3FMDA 4RC3A 4L00A 3V5LA 3DTCA 2UW9A 3LZBA 2PVHA 2C6IA 3HDMA 5H8EA 3VIDA 4AACA 3D15A 2C6KA 4S33A 3LXLA 3TCPA 4D2RA 5GINE 3OCBA 3LKMA 4YNEA 4BCIA 4MYGA 5ETFA 4J99A 2R3HA 3JVSA 2C3JA 3VC4A 3ENMA 5M06A 4K9YA 3PWDA 3E3PA 5I3OA 5I9UA 2ITVA 2XBJA 3L8SA 4QMWA 2AC3A 2C47A 2HCKA 3CXWA 3R1NA 2FVDA 1L8TA 4BCHA 4BYIA 3QC4A 3O2MA 4IWDA 3KRXA 4TKSA 5G1XA 3F9NA 5IG1A 1ZMVA 2P55A 4YC6A 3G0EA 3ELJA 1GJOA 3PP1A 3Q9WA 2G2HA 3FMJA 4RT7A 5LVPA 5CALA 2C1BA 4MXOA 4OTGA 4HNFA 3G2FA 1Q8WA 4E5BA 4DGLC 1BLXA 1B39A 4OBOA 2UW6A 4IZ5A 5CSPA 5CTPA 4C3RA 4GU6A 2GDOA 5AR4A 1Z5MA 2Z7SA 3PXQA 4IVAA 3UNZA 3LCKA 3GNIB 2BDJA 3EKNA 4GYGA 4DH8A 2WEIA 4FT0A 4KSQA 3RNYA 3I0QA 5CS6A 4FUYA 1OB3A 5HU3A 4Z9LA 5CAVA 3KRRA 2J51A 4TYEA 3ZC6A 1JSVA 1XWSA 5M51A 2ITUA 1H28A 5EI6A 4B6LA 4BHNA 4O7SA 3MY1A 2ZV7A 2A0CX 2ETRA 4OUCA 2XEYA 3O71A 3U6IA 3G15A 3R7UA 2PVRA 3LJ2A 3BHUA 4JBOA 3BZ3A 4PMTA 5J95A 4FKPA 1XH9A 5D11A 4D9UA 4XP3A 4U80A 2EB3A 4U43A 1U5RA 1Y91A 4F65A 3QTRA 1M2PA 2WTDA 4NM0A 3QQGA 4J7BA 4U5JA 4YURA 5KMNA 4AGDA 1JOWB 2HZ4A 3NX8A 3CD3A 4MXCA 4ALWA 5HICA 3FKOA 4XV3A 3ZDUA 3LQ8A 1XH4A 3S3IA 4DTBA 4E4XA 4DGOA 4AX8A 4FKQA 2ZDTA 5JMSA 2VTIA 2X6EA 1TQIA 4QMUA 3LFQA 3T9IA 3IW5A 2YAAA 3AMAA 3DNDA 3QRKA 3BKBA 1J1BA 3VBXA 3PIZA 4WG4A 2YFXA 5AUZA 4MVFA 2JLDA 3JY0A 5BQ0A 5KNJA 4BZNA 4XBRA 3K3IA 3NIEA 3WOWA 2HY0A 3V51A 4PL5A 5AIRA 2VWXA 5AR2A 4ANSA 1O6KA 4BTFA 3NUSA 2W7XA 5M44A 3TDVA 1CTPE 3O96A 4HJOA 4N4SA 3F5GA 1XHAA 4MHAA 5LMAA 4DFUA 3U6JA 5CEPA 4LUEA 4YPDA 4O0YA 3MYGA 5EDQA 3OROA 2XMYA 1JKTA 1Q8YA 3P23A 5BYZA 4EH7A 4UMTA 4DH3A 3VF9A 3EL7A 3OTVA 4IAAA 4IX6A 2UZVA 3O23A 4YZDA 1YWRA 2KTYA 2XYNA 3M42A 4A9UA 1B38A 3C50A 1PXJA 4L46A 3BU6A 1OKYA 4O0VA 4YZNA 4H3QA 3K3JA 2XCHA 5DLSA 4CD0A 5CVGA 2ITPA 3V3VA 2VD5A 4NUSA 5L6OA 2W06A 3SA0A 2AUHA 5TE0A 4XP2A 4QMTA 3ZU7A 3KXGA 3TNHA 5D7VA 2G15A 4L7FA 3TT0A 4M8TA 3FC1X 3WF7A 2XNBA 4RWLA 4Z7GA 4CFXA 4ACMA 2YISA 5IA5A 3ZBFA 2GNJA 3LFSA 3ZONA 2R3KA 4YZMA 4CLIA 5IUHA 2GSFA 3QZGA 2I0YA 3I5NA 4FUXA 4IJ9A 4OTWA 3ORKA 3FI4A 3K54A 4R5YA 2C0OA 1ZZ2A 4O7NA 4NYEA 3UE4A 4Y8DA 5AEPA 5HD4A 5JEBA 4KRDA 4HNIA 3N4UA 3PVGA 5A54A 1XBCA 3EQFA 4QTEA 3GT8A 2IO6A 4FI1A 1I44A 4Y46A 3G0FA 1KV2A 2JKOA 3U9NA 2GQGA 3LFAA 2XKEA 4ZTMA 1UA2A 5CEMA 3F3UA 3TACA 3H9OA 2V22A 4G3GA 2XH5A 4EK8A 4C59A 3POOA 2QO7A 2B0QA 4PTCA 2QD9A 4FIFA 3LW0A 3SGCA 3F5UA 3W8LA 2OIDA 3EL8A 3F5XA 1QMZA 3F88A 3QD3A 4FV3A 5C8NA 3LLTA 4FT7A 2BIYA 3NIZA 5HHWA 4MWHA 4J96A 2OXYA 2OIQA 4ZS0A 1DI9A 3V5WA 4F9YA 3P78A 4LOPA 4W8EA 4HYSA 1DAYA 5CNOA 1KWPA 2XP2A 2VX3A 3IGGA 5TR6A 3R8ZA 4C38A 3ORIA 3L8VA 4ANLA 4PDSA 5KZIA 4QP7A 2J0LA 4APCA 3WIKA 4ALUA 1PJKA 3ZTXA 4U79A 3TV4A 4QMQA 3QWJA 3ID6C 3DK7A 3VUGA 3UYTA 3DKCA 1AQ1A 3EH9A 3EQCA 5AP6A 5H9BA 4CQGA 3M11A 2WTCA 4ITJA 4HGSA 1URWA 2VNYA 3QZIA 3ZO1A 2UW3A 3RWPA 4BIBA 2WELA 3QKMA 2FB8A 3F3ZA 4O0RA 3TL8A 1HCKA 4X2NA 4USFA 4EHZA 2QCSA 1OI9A 3A7JA 2RGPA 1REJA 3DA6A 3R01A 3OTUA 2PPQA 5G6VA 5DMZA 3FL4A 4YHFA 4HPTE 3UVPA 4YR8A 1GZNA 5M09A 5FXSA 5IH4A 4W4YA 2VWYA 3RK5A 4C36A 5B0XA 4BY9E 1ZYSA 2J90A 4IB3A 3S0OA 3GFWA 5LWNA 3R63A 5A46A 5F95A 1M2RA 5EM7A 5ACBC 2WMVA 4F08A 3AT3A 1O6LA 4DBXA 3FV8A 4DAWA 5DGZA 2F7ZE 1Y8GA 2GCDA 3A7HA 2UZOA 3P9JA 4A9RA 1H1PA 3VQHA 4U6RA 3DXQA 3HRCA 5JFSA 4DT9A 2ZM3A 3OD6X 5EDPA 2OZOA 3ZSGA 3WF9A 2WD1A 3NNVA 2B55A 4C62A 3QZHA 2XNNA 3RWQA 2BPMA 4O84A 4PPAA 1ZXEA 3NUYA 4JR3A 3LMIA 4M68A 5L6PA 4IXPA 4W4VA 5E8WA 4XOYA 4O7WA 2OGVA 4CYIA 4IFGA 3T8OA 4XX9A 4G9CA 5BYYA 3ANQA 5A9UA 5HE3A 3BHTA 3K5VA 4J98A 4ASXA 3UQFA 3VULA 1Q99A 3E8DA 2B9HA 4E8AA 2XK9A 4S31A 4BKYA 3R7VA 4FTIA 4BL1A 4BCNA 1YHWA 3HEGA 1XQZA 2IW6A 2X6DA 3DXPA 3PLSA 3AD4A 4R78A 1AD5A 3C5UA 5E8UA 3ZZWA 1R39A 3EN4A 2IJMA 3I7BA 3IW6A 4B4LA 4BGHA 3RNIA 4O27B 4BCPA 5AP7A 3HV4A 4O6EA 5EQEA 5AR5A 4KWPA 4V04A 3ZRMA 3HMIA 3AC2A 5HVYA 4UMUA 2WTVA 4AZEA 2PVYA 3UDBA 4BKJA 3NWWA 4CMUA 2QVSE 3NW6A 1Z57A 2FSOX 1IG1A 3V8WA 4E7WA 4EHGA 4Z55A 4IAKA 3MESA 3C4EA 2RIOA 4BCGA 2WGJA 3LJ1A 2OJFE 4MQ1A 2C3KA 4IE9A 4C4GA 2J4ZA 2ERKA 5DR2A 1X8BA 3MDYA 4LYNA 4EOJA 3QKLA 3L1SA 3I6WA 4D4VA 3GCSA 4ENXA 4UWYA 4Y83A 4L3PA 2PVJA 1JLUE 2XNGA 2IW8A 1GOLA 4U9AA 1FGIA 2R5TA 3UZPA 3H9FA 4EH9A 2WNTA 4YMJA 5IMEA 3F2RA 4ZLYA 5CEOA 3FY2A 3SAYA 4QP4A 4YTFA 5J5SA 3UO5A 3FMMA 3HV3A 3SVVA 5M07A 4PY1A 3R83A 2QODA 3HUCA 1YWVA 2EXCX 3P7BA 4DH7A 3R0TA 1VYZA 3NZ0A 3VF8A 5KO1A 5CF8A 4LGHA 4TYHA 5BVFA 4BR3A 3R8LA 3A60A 2HW7A 1QL6A 4OTPA 3QTZA 4WUAA 3KF4A 3R9RA 4ANQA 1L3RE 2H9VA 2W9ZB 2XS0A 3GGFA 3HL7A 5CF6A 4IBMA 4D55A 5J8IA 5M4UA 5ETIA 4R3CA 4EUUA 4WSQA 4XRLA 5BUIA 1KSWA 4FE2A 5AIKA 3D5UA 3KVWA 2XJ2A 1PKDA 3S4QA 4TWNA 3I81A 1XH5A 1U46A 4L67A 3MPTA 4EH5A 4FIEA 5L4QA 2WMUA 2GNIA 4IB1A 4FT5A 3IG7A 3NNUA 1G5SA 3DAKA 4YJPA 3R7EA 3ORLA 2W1DA 4J8NA 4QP3A 4EOIA 3DAJA 2WMQA 3QYWA 3MY5A 5LCKA 4FL3A 4UY9A 4Z7HA 3W1FA 1REKA 1OECA 2WOUA 4M0YA 3BLRA 4YO6A 3FMNA 2YCFA 3IDBA 3R73A 2QO9A 3ZZEA 1K3AA 4KRCA 3VWAA 3NPCA 4N70A 2B53A 4RX5A 1IR3A 4ZTHA 4GJ2A 2XIKA 2HK5A 5LVLA 2IZUA 3LLAA 2YM6A 2XNEA 4PTEA 3DDPA 2EXEA 4JG8A 3HRBA 3TUBA 4QTBA 2VTMA 3FMHA 3LM0A 3Q4TA 3PY3A 5FTOA 3ZO3A 2WHBA 2VAGA 3QLGA 4JAIA 3Q60A 3DKGA 5DH3A 3U87A 4KABA 3P08A 5C1QB 5IKWA 1VZOA 2Z7LA 4I20A 3RM7A 2JKQA 2X81A 4TPTA 5IUIA 4EBVA 1H1RA 1H0WA 2F9GA 3PJ2A 5CEIA 4FGRA 3WZKA 4ERWA 2WEVA 3MIYA 3WI6A 4QQTA 3M1SA 3PY1A 3QC9A 4IWQA 3VUHA 4MX9A 1BX6A 2YIYA 2YWVA 3BGQA 3PXZA 4FTRA 3SXRA 1FQ1B 3ROYA 5LQFA 3DZQA 3VRZA 3H9RA 3TNPC 4KS8A 4DHFA 4YGAA 1PMNA 4CFWA 2BTRA 2X7GA 3FPQA 4NK9A 4TZRA 3CQWA 4AGCA 1JPAA 3KL8A 3RPVA 2W5AA 2R0IA 3Q52A 1G8SA 5K0KA 3EIDA 1JWHA 4XEYA 3BQRA 1ZYLA 4V01A 1KOAA 2PU8A 3R28A 2VO3A 2XVDA 4CYJA 3OWPA 3IOPA 4O0TA 3R8MA 4F6UA 3FEGA 3RKBA 2PZRA 1SM2A 3F7WA 3JY9A 4G5JA 4IX5A 3TTJA 4FZ6A 3OXZA 3DOGA 3UG1A 3UC4A 3TV6A 2CNQA 3LM5A 3ULIA 3DLSA 3R9OA 2O65A 3R6XA 4IX3A 4RJ6A 4AN9A 4G6OA 5IZFA 2G1TA 5CNNA 3VJOA 3RCJA 4DEIA 3GC9A 3ORPA 5AUYA 2Y7JA 3ORZA 3PP0A 4FSTA 4ZSAA 5JGDA 4YJNA 4OT5A 2VTQA 5CYIA 3UBDA 4KUJA 1PXLA 4DEHA 4D1ZA 3HV6A 4C0TA 4MF1A 2ETMA 5FGKA 3TTIA 3CKXA 4A06A 4BGGA 3VS1A 1PXMA 2FYSA 2UW0A 4W4XA 2W4OA 5AA8A 4DFYA 2QLUA 5EHYA 4RBLA 4XG3A 2OFUA 2C6EA 1W83A 4LV5A 2R3IA 2IVTA 5IH6A 4CFMA 2OFVA 4NW6A 2XYUA 1PYEA 4WOVA 3FYJX 4WNOA 4U3YA 5HO6A 3GP0A 3WIGA 3G5DA 2G01A 2G9XA 5CI6A 4CFFA 4RMZA 2GPHA 1OPLA 5EHOA 3UIXA 1YOJA 2QR8A 5AR8A 4DYMA 4ZSJA 3L9LA 3MH1A 3QA8A 5KBQA 4F0FA 4L44A 4RIYB 2VWBA 3FLZA 4FTJA 3EHAA 4WO5A 2W1FA 4KD1A 3UO6A 4BDAA 3P1AA 4CEGA 3Q9XA 5K0XA 3LQ5A 2BUJA 4CZYB 4O22A 3VW8A 2UV2A 1H01A 5HOAA 3SHEA 1F0QA 4V0GA 1B6CB 3Q6WA 4AA0A 4N0SA 2PL0A 5AUWA 5HCXA 3QQHA 3G90X 2XK3A 3EQDA 3NAYA 3QCSA 5C27A 3S95A 5I0BA 4W9WA 2ONLA 3V01A 1PXOA 3FXXA 4JT3A 2C6OA 4E26A 1SVGA 2PY3A 2WTIA 4BB4A 5BUJA 5H3QA 5LVMA 4O83A 1JKLA 3QYZA 2P3GX 4DEAA 2G2IA 4NSTA 2C5YA 4I21A 5CZIA 1WMKA 3R21A 4ZTQA 1R0EA 3RHXA 3A7FA 4U45A 1CSNA 1J3HA 2V0DA 3QCXA 4IIRA 4MXZA 3SRVA 4CQEA 4MH7A 2BHEA 4G34A 3RI1A 3SC1A 1JKSA 3E5AA 3ZEWA 1VJYA 2OJ9A 4FZDB 4HYIA 1RE8A 3B2TA 4RVMA 5E9EA 1NA7A 2LGCA 4J1RA 1WBOA 2XIXA 4RQVA 1SNUA 3LFDA 4PWNA 3R8VA 3SV0A 4NW5A 3VS2A 4APPA 3MSSA 2ITTA 4FEVA 3FQSA 1FPUA 4R1VA 2B7AA 4A7CA 4XG9A 2PMOX 3QWKA 3IONA 3KF7A 4M3QA 4AS0A 5CU6A 2VUWA 3NUPA 5AP3A 4D9TA 3LFEA 5HIBA 2FSLX 4QYEA 2JAVA 4FV4A 4IACA 5HIEA 4DH1A 2XF0A 3TNIA 5J7HA 3CKWA 1FOTA 2YABA 4IC8A 4E1ZA 5L2IA 1OVEA 2OJJA 3DU8A 4MBIA 3REPA 3ZLYA 2R3PA 4FV2A 5C4LA 4AOTA 2UW8A 1WBVA 4QMOA 3NNXA 2CKOA 3VQUA 4DC2A 4AE6A 1MQBA 2WTKB 1W98A 2VX1A 2XKCA 2XZSA 1V0OA 1UNLA 3AD6A 4OBPA 3O8UA 4BGQA 1FVTA 5TT7A 5AAFA 1MUOA 5A4QA 4BICA 3FYKX 4IJPA 3C4ZA 3HNGA 4FKVA 4E5WA 3S1HA 3NYOA 4C34A 1YVJA 4XRJA 3U4WA 4EI4A 5I9VA 5JT2A 3UIMA 4RVLA 4I5MA 3BE2A 3PRFA 4IC7A 4QMLA 3D7TB 2R7IA 4IW0A 4OTIA 4X2JA 3UMXA 3PDTA 4FV9A 3ZFYA 1LUFA 4DINA 2RFDA 3VUMA 4CRSA 5A4LA 3DLZA 2QKRA 4M7IA 5M4IA 3FC2A 1RW8A 2X2LA 5E90A 2BCJA 3NRMA 3CSVA 3PJ8A 2UW4A 2E9VA 4O7TA 3NUNA 2PZIA 2UVYA 4A07A 1UWHA 3C51A 4D0WA 5BUEA 3EQRA 4UXLA 5DEYA 4D1SA 3S2PA 3HV5A 4D28A 2C6DA 4AE9A 3UTOA 5HE0A 3UNKA 3MH3A 2FUMA 4ANNA 4ZZNA 5HQ0A 2JFLA 2YM5A 1FMOE 2QURA 5CSWA 1OIRA 5CZHA 3Q2JA 2PWLA 4LV8A 2ZJWA 3FMKA 2EWAA 3ALOA 3FHIA 3FZ1A 4Q9ZA 4DITA 2O0UA 4QTDA 4B9DA 1QCFA 3HP5A 2ZB1A 2GS6A 3DFAA 3E7OA 3H0ZA 3ACJA 4ZJIA 2FH9A 4C61A 4U3ZA 3Q2MA 4XUFA 4NKSA 1CKIA 5FEEA 4GG7A 5CEKA 4LM5A 2BDFA 4FV6A 2H6DA 3IECA 3W8QA 2IZRA 5EG3A 5A3XA 1ZYCA 3EFWA 4GK4A 2GMXA 3NW5A 3ORXA 4ZLOA 4ZIMA 4QNYA 5ICPA 4O91A 4UB7A 3F3VA 4ARKA 2UUEA 5JQ5A 4YNOA 1OIUA 3IKAA 4J53A 4CZUA 2Z02A 2VTLA 3DPKA 3LVPA 4LGGA 4EWQA 5KHXA 5IMXA 1JNKA 2WB8A 4GKIA 4AG8A 1URCA 2C5XA 4E6CA 1GZOA 2XNPA 4R3RA 3W16A 4AZSA 2CLQA 4RZVA 2BZIB 2CHLA 3DJ7A 3LAUA 4XS2A 3S00A 4I0SA 2OH0E 4E6DA 4NFMA 4FZ7A 1JKKA 2X8DA 1WCCA 4J71A 3BYSA 3DBQA 4QYYA 3Q04A 5J9YA 2OXDA 1ZMUA 3W2QA 3PY0A 4PF4A 4AN2A 2VV9A 4QMVA 4M12A 5EI2A 3THBA 4BI1A 2ITZA 5A6NA 1NW1A 2GTNA 5D9HA 3A8WA 5DT4A 4FL2A 4JOAA 4KKEA 4Q2AA 2OF4A 2Z7RA 4FNZA 3QCQA 5CLPA 1ZAOA 3OWLA 4JLCA 3W2RA 3VBQA 3FWQA 1KOBA 4I94A 1CDKA 4II5A 5CT0A 3MI9A 4H1MA 4UMQA 5FQDC 4IZ7A 4JAJA 2EXMA 4XG6A 4DLIA 3CJGA 3DT1A 5ANOA 2R7BA 4RWIA 3HYHA 4X6QC 4EKKA 4Q9SA 3VVHA 4HVGA 5BMMA 2XIYA 5IQAA 1Q4LA 4QQ5A 1ZZLA 2JKMA 5IA0A 3PXKA 4TNDA 4DGMA 2XB7A 4AW1A 2YDKA 4XG7A 4R3PA 4FV0A 4BVUA 1ZRZA 3QRIA 4FSNA 3QL8A 3KCKA 3DCVA 4K11A 2IWIA 2GFCA 4JDHA 4TXCA 3LIJA 3PJCA 4XLVA 4QMYA 5FBNC 3PUPA 3ZRLA 2WMTA 3ZXTA 4AGUA 5AM7A 4TN6A 4HOKA 5EHLA 4HVIA 5HESA 2WMBA 3GOPA 3GQIA 2ONLC 4HGEA 4UWBA 3LQ3A 4IWOA 3IS5A 3B8QA 3OEZA 3NMUF 3KRJA 4WBOA 4ZK5A 3KU2A 3BCEA 3C0GA 4MAOA 3D2KA 4OTRA 3I5ZA 4EK4A 3CTHA 5L6WL 3TUDA 5GIPE 3BYMA 1RDQE 2QOCA 3JXWA 2JDOA 4AW0A 3MVHA 3VNTA 4YJOA 5ANDA 3BYUA 5IISA 4EYMA 2W4KA 3OY3A 1CM8A 5HG7A 5LMBA 5JGAA 5E8TA 1YI3A 3E64A 4D2SA 2OLCA 2QONA 2W99B 3R7GA 5J1VA 2PE0A 2OH4A 1OIQA 3A62A 3DK3A 3RHKA 3A8XA 4RX7A 4UN0C 5AUUA 4EHVA 1YHVA 5M4FA 5AUTA 3QUDA 2OF2A 3BQCA 4ZSGA 4PTGA 2VWZA 2PULA 4I6BA 3OFMA 3DBCA 3RM6A 3SW4A 3VS7A 4LFIA 3DZOA 3C9WA 4YJRA 1CKJA 3VN9A 5CVHA 4FNWA 2OBJA 2UZBA 3E92A 3C7QA 3V6SA 5B2KA 3VW6A 4DTKA 4FSZA 4QPSA 1TVOA 1YOLA 4GK3A 5K9IA 5BNJA 4TL0A 3QD2B 5CANA 3FXZA 2QO2A 5DVRA 4FTKA 5HG5A 5I9ZA 5CAOA 3GBZA 3WE4A 1H8FA 1ZARA 4EH3A 3FMLA 3D5VA 2Y4PA 3IDCA 5HCYA 1VEBA 4FKRA 2QKWB 4OTFA 5CAPA 4TW9A 1PF8A 5HI2A 2PTKA 5FTQA 3JR1A 2WMXA 3P4KA 2YEXA 1BI7A 4U42A 5C8MA 3VS4A 3BBTB 3CPBA 4N6ZA 4QPAA 4KKGA 2WO6A 1UVRA 4NTSA 2JD5A 5AV4A 2PUIA 5E91A 1DAWA 4HPUE 3ZFMA 4J95A 5AA9A 4IM3A 4EONA 2ZVAA 4K1BA 2HENA 4M84A 2CKPA 3GQLA 3SLSA 4FSRA 4J97A 2W5HA 4HYHA 4J52A 1OUKA 4RC2A 4IEBA 3UYSA 1FGKA 3FLYA 3A99A 3H3CA 2E9OA 4RWKA 3TDWA 4H58A 4WG5A 3KB7A 4GK2A 1KE8A 5ANEA 4RG0A 5EYKA 3EKKA 1J1CA 2Z7QA 2PZ5A 3FZRA 2X8EA 2E2BA 2WPAA 3BV3A 4J8MA 2WOTA 4BFMA 4EL9A 3LCSA 3PZEA 1GZ8A 5HZNA 3F2NA 3LMHA 1MQ4A 5AP5A 4ANOA 4GFGA 4D2PA 2WTKC 3KCFA 5AP0A 3V8SA 2ESMA 5FP6A 4QMNA 2JIIA 4YBJA 1IAHA 2ITYA 4JQ8A 2YJSA 5HBHA 3MW1A 3R2BA 2VZ6A 2C6LA 4EORA 5J5TA 1G3NA 4MCVA 4EOOA 1H27A 5HVJA 4RIOA 2O2UA 4HCTA 4AZTA 2YLEA 4K18A 2UW5A 3PIYA 1WBPA 3PSCA 4G31A 4RPVA 4TRLA 3UQGA 3Q5ZA 3GCUA 3OWJA 4GFMA 3ZOSA 2XKFA 5D12A 3NCGA 1A06A 5FDXA 2JBPA 4KNBA 4IADA 3TM0A 5CF5A 2WU7A 2X1NA 3TNWA 4BCJA 2QOFA 2PZYA 1G8AA 3FAAA 2OXXA 3GOKA 5AR3A 5CSXA 4NZWB 4O1PA 5GZ8A 4GRBA 3UIBA 4QP2A 2WMSA 2HWOA 3MA6A 4GT3A 2YM7A 2HIWA 5CXHA 4EEVA 4DH5A 2QU5A 5HCZA 1ZLTA 4ACCA 2IPXA 4KB8A 2XM8A 4ASDA 1W0XC 3O51A 3D5WA 5LCJA 3ZYAA 2IVUA 2P4IA 1HCLA 3FL5A 4RFMA 4JJRA 4CRLA 2PMIA 3OBGA 4F64A 3OG7A 2X39A 3VBYA 5EI8A 2ZMDA 3ET7A 5AR7A 4YPSA 2XNOA 3K5UA 5AV3A 3BWJA 3O8TA 3HA8A 3I6UA 2BRBA 4IAIA 2FSMX 3PSBA 3W55A 3QTUA 4A9SA 4K0YA 5AV2A 4DG0E 4A4LA 2XIZA 5ACKA 2P2IA 3PJ1A 4O2PA 2C0IA 3DK6A 4LMUA 2JITA 3NYVA 4QMXA 2GHMA 3OZ6A 3BWFA 4DA5A 2G2FA 4P4CA 4PMMA 4WT6A 1O6YA 4JI9A 3PVBA 5EW9A 1WVXA 3G9LX 4IZAA 4MD9E 5J1WA 1GNGA 1UU3A 3A4OX 3BE9A 3FZTA 5HX8A 5IH5A 1I09A 4FBXA 4M69B 4UYNA 3TKHA 3FI3A 4QMPA 4IAZA 3U9CA 1QPCA 4XG4A 4OTQA 4JDIA 1YXSA 5HD7A 5CAQA 3OCSA 3QQLA 4FG7A 3FQHA 1T45A 3RINA 3C4XA 5TOZA 4DG2E 2ERZE 4MNFA 3P79A 3VJNA 5CU4A 3EZVA 1PYXA 3VS5A 3QHWA 4GMYA 3E63A 4Z3VA 3ATSA 4JQEA 4G17A 1H07A 4PNKA 5J7BA 2R3OA 4F9AA 5DA3A 1OBDA 5EM5A 1J7UA 2YJRA 3TIZA 2C1AA 5HLPA 5JK3A 3PE2A 2CDZA 4NL0A 3OVVA 4U81A 3BU5A 3ZM9A 4M69A 3H30A 4MKCA 5HE1A 5E8SA 5DR9A 4FZAB 3PXYA 4RIWB 2CSNA 4XG2A 2QOLA 3NUAA 5C01A 4RA4A 2H8HA 2QQ7A 4ZTRA 2WQOA 5CF4A 3CGOA 3E93A 4FR4A 4R77A 2VGOA 4NJDA 5IF1A 4XOZA 4RFZA 3IOKA 1WZYA 3KEXA 4DCEA 3LPBA 2PVLA 2BKKA 4XHKB 1UKHA 2O63A 2XEZA 2FO0A 3OOMA 5TF9A 4U7ZA 3SOCA 3LJ0A 2V5QA 4O81A 3PVWA 4BI2A 4FF8A 2YDIA 3DQXA 4FKLA 4AU8A 3QRTA 2QNJA 4RRVA 5E8YA 5FBOA 3VRYA 5K5NA 3VUKA 4F7SA 3FDNA 4D5KA 4I4FA 4F70A 3DB6A 2J0IA 4C57A 4BWXA 1W82A 2VN9A 4X2KA 3QTSA 3TZ7A 1DI8A 3DAEA 4FVRA 1OKWA 4FTMA 4ZLZA 2C5NA 3COIA 3P7CA 4BYJA 5K4IA 4CG9A 4ZOGA 3H4JA 2A1AB 3FZPA 4QYGA 4JBVA 1PY5A 2QLQA 3TKUA 4RJ8A 2YITA 3SG9A 4MEDA 2YIXA 3NYNA 2J5FA 4B8MA 3HMOA 4FA2A 3W32A 3U4UA 3HMNA 2UZWE 5EDRA 3NDMA 3ZSIA 3SXFA 5HX6A 2ZAZA 2A4LA 3PZHA 2LAVA 3OEFX 4LRKA 1OL6A 3ACKA 4L68A 2XK4A 5AP2A 3PXFA 3FKNA 3JYAA 4BRXA 5JRSA 3EYGA 2YDJA 4UXQA 4E4NA 5AUXA 4WIHA 5HNIX 2BMCA 5JRQA 4JBQA 4B8LA 3ZBXA 1M14A 3D4QA 3MTLA 1BMKA 4ID7A 4O21A 4OT6A 5BVNA 4E93A 4CV9A 5IPJA 2BHHA 4EH2A 3AGLA 3FXWA 2A27A 2NRUA 3O50A 4GT4A 3FSKA 4UBAA 5CI7A 3ZO2A 2BILB 4GG5A 1NT2A 1YXVA 1XJDA 2UZTA 4Y73A 4GKHA 5L8JA 4HCVA 4BDIA 1UWJA 3IPHA 5KCVA 5DWRA 3ZEPA 5HG8A 1U4DA 3D14A 3QUEA 4BDFA 3C4CA 3A7GA 3BEAA 5CXZA 2EUFB 3V6RA 3NGAA 2WAJA 4AT4A 4FTTA 5AV0A 5BYLA 1UKIA 4JS8A 1IRKA 2WFYA 4EK3A 4FSWA 2JC6A 3W18A 4BDJA 4EWHA 4RVTA 5EOLA 2H34A 2OIBA 3V5QA 5T6KA 4O86A 3MFSA 3KK8A 5DFPA 3DBFA 4D4RA 4AF3A 1PMVA 3HGKA 4CCUA 5HTBA 3TZ8A 4KIPA 4XP0A 2BFXA 5HNBA 1LP4A 3FUPA 5BX0A 5ETAA 3C13A 4KKHA 3BLQA 2X0GA 4YHTA 3UP7A 4GFOA 3WE8A 3MS9A 2WQEA 4IWPA 1YQJA 3AT2A 3BHVA 4TNBA 3R7IA 3I1AA 2QOIA 3OC1A 1R0PA 3E8NA 3F6XA 3DBDA 4U0IA 4KBCA 1VR2A 4ZXTA 1Q5KA 4AQCA 5BVOA 1OM1A 4QQJA 2HZNA 2F7XE 4ENYA 3PE1A 2Y4IB 4IM2A 4PL4A 4EBWA 5ANKA 4DEDA 3R00A 3EFLA 3UZRA 3TJDA 5FDPA 3W33A 3U55A 5JZNA 4F09A 3AMBA 3BYVA 2C5VA 5CAUA 4FMQA 3CE3A 2OO8X 4G3CA 2RF9A 4ZSLA 5JGBA 2VTTA 3NAXA 3OWKA 4S34A 3TZ9A 3ATTA 4EQCA 1SZMA 1SVHA 5LMKC 4GU9A 4EOSA 2GNLA 1XBBA 3R9DA 3OHTA 1CMKE 2X7OA 4F1OA 2QOQA 3AG9A 3RPSA 4M14A 4E4LA 2PYWA 4PPBA 1Y57A 4FKJA 4YLKA 2VTNA 3DDQA 3VO3A 4YJVA 3W10A 2CGVA 2F49A 4DE4A 4WNMA 4LL5A 4UMPA 4BWPA 3PA5A 4CTBA 4M13A 2GU8A 4DEEA 4CFUA 2V55A 3ZFXA 4GCJA 4B0GA 3HECA 4B7TA 3DFCB 1M7NA 4QP1A 3NVMB 2QC6A 4A9TA 3DV3A 5AAEA 2DS1A 3KN6A 3CEKA 1YXXA 3E87A 4NEUA 4RJ5A 2YM4A 4WSYA 1GAGA 4XH6A 3QTQA 4B99A 1E1VA 3MY0A 3ZHPC 4KIKB 4QP6A 4EJNA 3G6GA 5GIOE 2W17A 1M52A 3PPZA 3MV5A 3WZUA 5CENA 3TUCA 2CJMA 2J5EA 2J7TA 4EH6A 4DTAA 2B9IA 3ITZA 5F20A 1OITA 4O7VA 3T3UA 4ACHA 3QAME 4DFNA 3RPYA 4I23A 1SNXA 1YDTE 4MWIA 3W2CA 4RSSA 5BVWA 4IFCA 2C6MA 2CPKE 3GU7A 3HDNA 4RJ4A 5EM6A 5DBXA 4FK3A 5AADA 3U54A 4YZBA 4D0XA 2ZMCA 1UU9A 4FGBA 3MFUA 4K77A 2XKDA 3QQJA 2YA9A 4KIOA 2HZIA 3V04A 2OJIA 3Q53A 3MJ1A 3ULZA 4JL9A 3KREA 3KK9A 4KIKA 2XIRA 3R22A 1OMWA 1WFCA 3IGOA 4C3FA 2SRCA 1Y6BA 2I6LA 3MPMA 2PVNA 2R3GA 5IA3A 4FKIA 3FLSA 1QPJA 3ENHA 4MBLA 4O2ZA 5EW8A 3MH0A 2BKZA 3BGZA 3QD0A 4YC3A 3MJ2A 4ZTLA 4C7TA 4AOJA 2B4SB 3KRLA 3RMFA 4PPCA 4DGNA 5A4TA 4RQKA 1OL2A 4P2KA 5J9ZA 4XCUA 4KIQA 4D2WA 3DGKA 4OTDA 1P2AA 5D10A 2ZOQA 4MNEB 2YCSA 4LGDA 4NH1A 5EOBA 5ANGA 3BEGA 1HOWA 3IW4A 2IVVA 1ZOGA 4TY1A 1MRYA 3EQBA 4L45A 4RIYA 4FTLA 1IEPA 4U41A 1STCE 3GC8A 4CXAA 2JDSA 3G51A 4CZTA 4C4EA 4EOKA 2VTRA 2O8YA 4ZSEA 4CCBA 3L9PA 1R1WA 3LCOA 3EMGA 5L2QA 4C33A 2UZEA 4O7YA 1WVYA 1ND4A 5KHWA 4C4IA 4KBAA 4O0WA 1K2PA 4WG3A 2JIVA 3QRJA 3EOCA 4NT4A 2CGWA 5DYJA 4AFEA 1V0BA 4DF3A 3KULB 3Q9YA 3MFRA 3QGWA 4GYIA 3EWHA 3TI1A 5GZ9A 2X4ZA 4O82A 3D2IA 4G3DA 1S9JA 4FNXA 2A19B 5C26A 2PUPA 4IDTA 2OZAB 2CNVA 1PRYA 3NW7A 5AP1A 3MB7A 4BIDA 4EUTA 3AC3A 3BI6A 2GNHA 4AGWA 4G16A 2ZV9A 4D2VA 5KUPA 2BRNA 2DWBA 3C4FA 2DQ7X 3BX5A 2R4BA 4YU2A 3Q6UA 4FG8A 3OW3A 5IQBA 4AZWA 2BZJA 3GU8A 3MFTA 4FSMA 3OY1A 3E8EA 3L8XA 3WILA 5IDNA 3RZFA 3ZMMA 4EKLA 2QOOA 3R02A 2BROA 3QRUA 4L6QA 4O6LA 4QD6A 5CWZA 1SVEA 4C4FA 2I1MA 2GTMA 4PQNA 2H96A 4EOMA 4HVDA 3AD5A 2X2MA 1U5QA 3BYOA 3HKOA 3QF9A 2ZM4A 3W2SA 5FM3A 3OOGA 1XH8A 1NVQA 3F3TA 2HY81 3FJQE 4O0UA 5E8ZA 3KXZA 5L2TA 3EFJA 1J7LA 2R3FA 2YN8A 4NM3A 4WNKA 3HX4A 4F63A 3AC1A 2R9SA 2R3RA 4ZY6A 4YC8A 1PXNA 2WQMA 4DT8A 3P5KA 5DPVA 3I7CA 5DI1A 1J7IA 3H10A 2R3QA 3LHJA 3U8WA 4RIXB 5HIDA 5F94A 2W0JA 3RK9A 4I5HA 1BUHA 5CT7A 3I60A 3KGAA 4ZZOA 2OJGA 2B1PA 5EM8A 2PVMA 4FX3A 3AC5A 3RPRA 3NYXA 3MN3A 3F3WA 3VAPA 2OWBA 3HMMA 4A4OA 1U54B 2RKUA 5D1JA 3R1YA 3GC0A 3KQ7A 3FLNC 4OW8A 5J9LA 2WMRA 4QOXA 4I93A 3F82A 5BVKA 5ETCA 4UMRA 3M2WA 3F5PA 4GIIA 2UZNA 4C37A 2BZKB 1IASA 2X8IA 3KMWA 4R8QA 5CVFA 3D7TA 2OICA 1P4FA 2I0EA 2VTPA 1T46A 2W1HA 3QLFA 4F6WA 4F0GA 3LFNA 4CV8A 4YBKA 2QG7A 5KMJA 5H8BA 2I0HA 1EH4A 5A6OA 1QPDA 4L9IA 5H8GA 4DFZE 2RG6A 3D83A 3NUXA 4I1ZA 1V1KA 4JG7A 5CY3A 1M2QA 1PW2A 4YJSA 1R78A 4IHPA 3FE3A 3G9NA 4I24A 4BHZA 4S32A 5I9YA 4QTCA 3MTFA 5FLFA 4EOLA 3QBNA 2GQSA 3FLWA 4BDBA 4FEWA 3KXHA 3I0OA 4Y72A 5E1EA 2EB2A 5JKGA 2Y4IC 1W7HA 1H24A 3Q4CA 5IQEA 4TWCA 2VTJA 4YJQA 2J50A 4C02A 1R3CA 3HRFA 3MVLA 4BBMA 1XR1A 5EKNA 5T68A 2I40A 2F2UA 2JAMA 3KMMA 4FEQA 5HG9A 5C8KA 5KKRB 4ACGA 2WQNA 3FSFA 3EJ1A 4PUZA 4R6VA 2BDWA 3SKCA 5IU2A 2W1EA 2YCQA 3BBWA 3FQEA 4JX3A 2QI8A 4HYUA 2UZUE 3AT4A 3JVRA 2AC5A 3A2CA 3RCDA 4I92A 4ITHA 3SOAA 1M17A 4EH4A 4AOIA 5LVOA 4WBBB 3DY7A 1Q8ZA 4XMOA 4RLKA 4L8MA 2YZLA 3LOKA 4O7LA 1H1SA 2XUUA 2ZV8A 1LEZA 3FMEA 4MD8E 4AZVA 4NJ3A 3AC8A 1KE9A 4FT3A 4F99A 2HZ0A 2IG7A 4HGLA 3EFKA 5M57A 3WYYA 3ZSHA 4H1JA 1BL6A 1OPJA 3GENA 3PIXA 3N51A 4RJ7A 4CT2A 3ZO4A 3G33A 4D1XA 2RL5A 1OKVA 2OSCA 1YI6A 2OU7A 3LCDA 3HAMA 4L7SA 4ASEA 4ZEGA 4M0ZA 3SG8A 4PMSA 3PJ3A 1S9IA 3ZRKA 2FGIA 3II5A 3SW7A 4R7BA 2E9UA 1BKXA 3RJCA 4E5AX 3VUDA 4EYJA 5FXRA 2JIUA 4FV8A 4QMSA 5EH0A 5A4EA 2Q83A 5ANJA 2VWIA 3CP9A 1YHSA 2X4FA 1Q97A 3EQIA 4NM7A 3R1SA 4JRNA 5DOSA 3G6HA 3GCQA 4R7HA 5GHVA 5GJFA 4YSMA 4CMTA 4U44A 4UZHA 4FVQA 2R3LA 2ITNA 1GY3A 2WIHA 4LRJA 4XV2A 3O7LD 4MF0A 1A48A 4F7NA 5IDPA 2R3NA 3C5IA 4FEUA 2Y8OA 1PXKA 3C4WA 4YHJA 5A14A 4ONAA 5KMIA 3FZSA 2BVAA 3N9XA 2RFNA 3CCNA 2IW9A 4FTUA 5CU0A 2CLXA 2GS2A 5BVEA 3ORMA 2PZPA 1YDRE 3AC4A 2HWPA 1Z9XA 5F4NA 3QA0A 2F2CB 4ZY5A 4PP7A 1JSUA 1E1XA 4ZS4A 5EQPA 4BWKA 2IZTA 4NCTA 5DEWA 5KE0A 3VS0A 2PUNA 2IVSA 3AMYA 4CVAA 2HAKA 2GQRA 2ZM1A 4FTNA 4HVHA 3QKKA 2B52A 3PG1A 3ALNA 4L3JA 2JDRA 5K5XA 4I6FA 4FSYA 5ANIA 2ACXA 4LI5A 3R8UA 1FVVA 4L42A 1BYGA 1TQMA 1BL7A 1UV5A 3CTJA 2VWWA 3OCGA 4FTQA 4JQ7A 3ZS5A 4KAOA 4BDKA 3HVCA 5HNGA 2W1CA 5JFXA 1H0VA 4XG8A 2I7QA 2V7OA 3PG3A 3UP2A 4WRGA 3ZCLA 2WZJA 4EQUA 2QOKA 5LOHA 5DR6A 4XLIA 2WKMA
chains in the Genus database with same CATH superfamily
1P4OA 2W4JA 1Q3DA 2B9FA 5B7VA 2NO3A 4A4XA 3AXWA 2YLFA 2PMLX 4QP9A 1ZWSA 3V5TA 4TTHB 4O4EA 3FBVA 4I5PA 2JFMA 4IVBA 2HXLA 5DRBA 3DBEA 3QQUA 5CQUA 2HYYA 2YCRA 3EQGA 5HGIA 5M08A 3TWJA 3HP2A 3U51A 3FHRA 4UALA 2J0JA 1ZOEA 3CTQA 3CBLA 1ZMWA 3CGFA 3IK3A 3Q32A 4YJUA 5AMNA 5JZJA 3UO4A 3GI3A 4YP8A 3POZA 1IAJA 4PDYA 4IDVA 4YUQA 2F7EE 2O5KA 3D5XA 3UIUA 1W2CA 3MVMA 4W9XA 4AA4A 4F4PA 1H26A 2C0TA 3QFVA 2XCKA 3E62A 4D2TA 4BBEA 1CKPA 4R7IA 1XH6A 4EH8A 3E7VA 2PVKA 2JGZA 4X0MA 3QQKA 4PL3A 3GEQA 4CKRA 4UV0A 3IW8A 4U8ZA 4AXAA 5KX8A 4FOBA 2GS7A 2V7AA 4QPMA 4D4YA 2WMAA 3EN6A 4GUBA 2Y6MA 4CNHA 1LPUA 5GJDA 2NYAA 3SD0A 5A4CA 5BVDA 5M53A 5FTGA 2OK1A 1P5EA 4MXYA 5KMMA 3TKIA 3QXOA 5IEXA 1Q24A 4I4EA 3NSZA 5AP4A 4HVSA 3EN7A 3BELA 2E9PA 5JFWA 5EK7A 4ZMFA 5B2LA 4EK6A 4GJ3A 4X3JA 3CC6A 3UQCA 4C8BA 4IB5A 4EHEA 2HW6A 1GIJA 4CTCA 2GFSA 4BTJA 2C4GA 3UMWA 4O7RA 3PRIA 4UWCA 5FWKK 3RAKA 2YIRA 3BU3A 1IA9A 3ROCA 2OKRA 4NTTA 5CSVA 4NU1A 4YTCA 4FV5A 5IQGA 3L8PA 3FI8A 3WYXA 1OIYA 3ORNA 1FBNA 3KC3A 5E1SA 2AYPA 1FMKA 1SMHA 3PXRA 1F5QA 4WD5A 5LARA 4EOQA 4PRJA 4IX4A 4DEBA 4K2RA 3E8CA 1G8JA 3TEIA 4WHZA 2ITQA 4BCOA 2GNFA 3CS9A 4F9WA 2OI4X 4NM5A 4USEA 3T3VA 4CG8A 4FVPA 1MRUA 4GEOA 3R7OA 3EN9A 4C2VA 5EFQA 5IA1A 5IQIA 4CMOA 1Q41A 2C3LA 4RWJA 2CN5A 4MTAA 4FNYA 4AT3A 3D94A 3GB2A 3DJ5A 1Q62A 1SYKA 5JFVA 3MGYA 5E92A 5C4KA 5I3RA 1K9AA 1JAMA 2PSQA 2YIQA 3BRBA 3QX2A 1OKZA 4GW8A 4X3FB 3NVKI 4YLLA 2QR7A 3OXTA 3HLLA 3QU0A 3EN5A 1Q61A 5IQHA 5FG8A 5F1ZA 3B2WA 3P0MA 4M97A 4BDDA 4XV1A 1LR4A 1PMUA 3V5JA 3LMGA 3Q4ZA 1XO2B 4RLLA 3RAHA 2XJ0A 1W8CA 2WMWA 5LMKA 3LXNA 1VLRA 2CGUA 4QMZA 1A9UA 1PXPA 2CCHA 4IM0A 5E8VA 2W96B 4EZ5A 4P90A 1WBWA 4K33A 1JQHA 2BFYA 4H39A 3H0YA 3NNWA 1PMEA 2BALA 2HOGA 2Q0BA 4I41A 5AV1A 4Y95A 2OG8A 2YHVA 3QTIA 4ITIA 4GIHA 4QNAA 2CNUA 3DKFA 4BCQA 3PYYA 4LMNA 4UX9A 4X3FA 4ANBA 4E4MA 2VTAA 5KKRC 2UVZA 3V5PA 3VHKA 1JVPP 4S30A 1PXIA 3OMVA 1KE7A 4FC0A 4PMPA 3VBWA 4FTOA 3CY3A 2CCIA 3MA3A 3VS3A 4TWOA 3UOLA 5HTCA 4BTMA 1YKRA 4NWMA 3UVRA 3QXPA 3OF0A 4TYJA 4O0SA 4UZDA 3OUNB 3DB8A 1OL5A 4BDEA 4CSVA 4FEXA 4ORKA 3O7LB 1OL7A 3PFQA 3PSDA 5FEDA 1KUTA 4ERKA 3QHRA 2QOBA 3MWUA 3DNEA 3F69A 4LG4A 4MBJA 3GXLA 2GHLA 5KMLA 3O5AA 3EZRA 1O9UA 3BV2A 3UJGA 5DG5A 2BTSA 4AUAA 1M7QA 1KV1A 4GS6A 4JXFA 4FKGA 1Q8UA 3NR9A 4C58A 5E4HA 2ZB0A 4FZFB 2YERA 2HELA 3PPKA 3N4VA 2Q0NA 3QUPA 4I0RA 3UOHA 3KA0A 2X9FA 4X6RA 3C1XA 4AFJA 2XK6A 1J91A 4BDGA 2NNWB 3D0EA 4H05A 4AT5A 4WNPA 1NY3A 4C4JA 4NCTC 5I9WA 4H3BA 2W1IA 2O64A 3KY2A 4GVJA 3HMPA 2P0CA 5CEQA 3WF6A 2BR1A 4BBFA 3A61A 3BHHA 4C4HA 1DM2A 4U40A 3R1QA 3DKOA 4DEGA 4AW2A 5IQCA 1NXKA 4YLJA 4OGRA 4HGTA 2ETKA 4IB0A 5K4JA 4KA3A 4MQ2A 1H00A 2FA2A 4AA5A 3ZC5A 3LFBA 3GVUA 1UU7A 4L43A 3RPOA 3NLBA 3LFCA 2NP8A 4AZFA 4BTKA 4FKSA 4Y5HA 2AQXA 1BI8A 2QU6A 5AFVA 3GCVA 2C3IB 3LXPA 3QGYA 5BPYA 2KULA 4GSBA 3TZMA 3W0RA 4Y5QA 4RIWA 1Q8TA 5EKOA 3L9NA 1GIIA 3VBVA 4FIGA 2RFEA 3QALE 2QOHA 2R0UA 5FM2A 4BCMA 1YXTA 2V62A 2P2HA 3E3BX 2AEGA 4Y85A 3EB0A 4CKIA 3QTWA 4JVGA 5D7AA 3AQVA 4X7QA 1OGYA 4ZAUA 2XRUA 5I9XA 4IAFA 4FT9A 5J79A 4C3PA 5H2UA 4G5PA 4RC4A 4P7EA 2EVAA 4YSJA 2GNGA 2RSVA 4TYHB 5LJJA 2EU9A 3VHEA 3QCYA 1YWNA 5D41A 5KZ0A 3GU6A 4QYFA 5HEZA 4X2FA 2J0KA 1U59A 2QHNA 3OUKA 4G6NA 4MXAA 2WQBA 4R5SA 3V8TA 1GZKA 4JR7A 5LXMA 3ZUUA 1WVWA 1G8KA 3EYHA 3OT3A 4C35A 2C69A 4TYIA 1E9HA 4EQMA 2XNMA 3A4PA 3VUTA 4N57A 2UVXA 2VTOA 3EQPA 4F6SA 3NS9A 3ZLWA 4E3CA 4BC6A 3C0HA 1GIHA 2VO6A 3KXMA 1YDSE 4UYAA 2E9NA 5LWMA 3Q5IA 3COHA 5HORA 5HO8A 2BRMA 4LQMA 4QP8A 4ZZMA 3OS3A 4UEUA 3CD8A 4DFLA 3CQUA 5FUTA 2PE2A 4YTIA 2WTWA 2Z60A 4HCUA 2W9FB 4PV0A 4IZYA 4BCFA 4F7LA 4I3ZA 2YWPA 2W1GA 3RGFA 3CJFA 5IA4A 4EOPA 4QTAA 3PLAE 2CGXA 3UG2A 3PA4A 3ZLSA 4ANMA 1V0PA 4M67A 5L8LA 3BPRA 2F57A 4G3EA 4O96A 4ZJJA 4FV7A 4X21A 4BZDA 1ERKA 2A2AA 4DBNA 4GV1A 5KBRA 3P86A 1UNGA 4YZCA 4PNIA 4JNWA 1MP8A 4E6QA 2CN8A 4JG6A 5FP5A 3COMA 3JUHA 2IN6A 4JDJA 4C2WA 3HAVA 2BAJA 2ITOA 4O1OA 4AP7A 4HW7A 4PX6A 1Y6AA 5GNKA 2XA4A 4FV1A 2J2IB 1H1QA 3PWYA 2UZDA 4RVKA 5HU9A 4XJ0A 4TWPA 3F7ZA 1XMLA 1OUYA 2DUVA 2B54A 4F7JA 3TIYA 3ANRA 4NIFB 4XNEA 3HA6A 3LFFA 2CKEA 3ERKA 3F66A 3BGPA 4IAYA 1NVRA 5HLNA 4DFBA 5IEVA 4P5QA 1IA8A 4G3FA 4BI0A 3ZLXA 3NEWA 4USDA 4LRMA 4FODA 3LXKA 3B8RA 3VONA 4JIAA 4LDTA 5JSMA 3ODZX 3FI2A 4OTHA 3ORTA 4H3PA 5HBEA 4EZ3A 4YO4A 3OW4A 3RTPA 2OW3A 4FOCA 2WIPA 3UPZA 5HTIA 5KMKA 2PMNX 1RJBA 4H36A 2XRWA 2VNWA 4TYGA 3FKLA 3FPMA 4X2GA 3UPXA 3WZEA 5EQYA 4FKTA 2Y6OA 4OLIA 1WBSA 3AKJA 3FZOA 2BIKB 3I79A 4NIFA 4ZJVA 4BCKA 5EYDA 2RFSA 3QD4A 4NFNA 2C6TA 1WBTA 2J6MA 5F9EA 2UW7A 5JH6A 3NUUA 4P5ZA 5DN3A 4OBQA 5AX9A 3TN8A 3KFAA 3RVGA 3O17A 4RZWA 2CMWA 3I4BA 1YI4A 2IEWA 2PUUA 3HUBA 3ZUTA 4X3FC 2CKQA 4QQCA 4HZSA 3RALA 2IZSA 3SX9A 3UGCA 4BDCA 2YACA 4FTAA 3W2OA 2FSTX 2W05A 5HE2A 3UOKA 4WA9A 3RAWA 4ZY4A 2ITWA 2WU6A 3FLQA 4WKQA 3UVQA 1TZDA 4PP9A 4DFXE 3R9HA 4XV9A 2VRXA 1YXUA 5FRIA 3AGMA 2XJ1A 3MVJA 3D9VA 1JSTA 4M66A 2XM9A 1UNHA 3SQQA 1ATPE 4QO9A 2VU3A 4FKWA 5T3QA 5I5ZA 1KE5A 4EC8A 5DE2A 2PK9A 5K3YA 3WZJA 3ZXZA 3R04A 5GJGA 3F2AA 2VTHA 5HKMA 3ZH8A 4FL1A 4ASZA 2VX0A 4LOOA 1NVSA 4RA5A 2C68A 5BV3A 5CX9A 3COKA 4FTCA 4EC9A 4L01A 1YOMA 4G9RA 5TKDA 4MD7E 4YZ9A 5DIAA 4QRCA 4WRSA 4EZ7A 3GFEA 2ZV2A 3OXIA 3RZBA 3TV7A 4FK6A 3MB6A 4XYFA 3ETAA 5FXQA 4Z16A 1QPEA 5L2WA 3UZTA 1H08A 3KRWA 3R71A 4O4CA 4AAAA 3JS2A 3OT8A 4KS7A 3RK7A 2C5OA 2R2PA 4G2FA 4DN5A 1H4LA 4AW5A 4AXFA 1FINA 1H25A 4W4WA 4FSUA 2NPQA 4V05A 5DHJA 4V0GB 4I0TA 5GZAA 3A7IA 1YW2A 3HZTA 3KKVA 3ODYX 3D7ZA 3QX4A 4L53A 4N6YA 3R2YA 3ZM4A 3KN5A 4S2ZA 1FVRA 2DYLA 4JBPA 3NFGB 4FYOA 4DG3E 4QYHA 2VWVA 3R30A 1TKIA 4RGJA 3UC3A 4RX8A 5CASA 3KMUA 2O3PA 4DHIB 3Q9ZA 4CT1A 4F9CA 5L2SA 2UZLA 3WF5A 4LUDA 3GU4A 2JKKA 1H1WA 2Z2WA 1Q3WA 3O8PA 4F1MA 4JDKA 3IDPA 4DGGA 4FIHA 3IO7A 3VBTA 4L3LA 5AWMA 4CFVA 5TO8A 3SRVB 1APME 4F1TA 5EW3A 5M55A 3ZDIA 3VUIA 5AUVA 2Y0AA 3UOJA 2WTJA 3IQ7A 3MIAA 5CU2A 3PTGA 4GVAA 3DXNA 3TJCA 4GH2A 4FIIA 5IQDA 2BRHA 2PVFA 3F61A 3DQWA 3DTWA 3O0GA 4EJ7A 4M15A 1OL1A 5KMOA 4ZTNA 5JQ8A 4FKOA 3QZFA 5CQWA 5AJQA 4QMMA 3T9TA 4A9YA 4E73A 5IA2A 3ZUVA 2YM3A 4FIJA 4MNEA 5DT0A 1AGWA 2BZHB 4JX7A 2JEDA 4GUEA 5C03A 2JDVA 4I22A 4EK5A 4QDEA 4BDHA 3CPCA 5L3AA 4BKZA 4IQ6A 3CLYA 4BIEA 2RG5A 3BIZA 2VGPA 4OR5A 4IANA 5EYMA 4OAVB 5DRDA 4ACDA 2BAQA 4PDPA 3U6HA 2HXQA 2YM8A 3DJ6A 4FYNA 4ZTSA 3RAIA 3Q96A 3QTXA 4I5CA 4DLJA 5JN2A 5C9CA 4BN1A 4F0IA 4OAUC 3SDJA 3DS6A 3HV7A 4O38A 4E20A 4K8AA 4Q5HA 4FG9A 2XK7A 4XBUA 3CQEA 3N4TA 3QQFA 3TNQB 2C30A 3KXNA 1OPKA 1DS5A 3MBLA 1VYWA 1ZOHA 3GUBA 3WZDA 4CGAA 4HZRA 5E7RA 2X7FA 4LOQA 2Y9QA 2W5BA 3KULA 4R1YA 4I6HA 3R8PA 3OP5A 1JBPE 1UU8A 2F4JA 4IVCA 5AM6A 3PPJA 4CKJA 5HBJA 1F3MC 1ZYDA 2VO7A 5CSHA 1PKGA 4GL9A 3CIKA 1LEWA 4YJTA 4O7ZA 2J0MB 4ZMEA 4AWIA 2B9JA 2OZAA 3RP9A 4D58A 3IW7A 3PVUA 3SXSA 4D5HA 2ZDUA 3C0IA 4CFNA 3GU5A 2VWUA 1W84A 4K6ZA 3BHYA 5DT3A 4IMYA 4FKUA 1RQQA 5ITAA 4AN3A 3WARA 5AX3A 2W1ZA 1OZ1A 3L9MA 3P7AA 4RFYA 1ZY5A 4NKAA 4W8DA 5IQFA 3E88A 3EQHA 4KINA 4WUNA 5IUGA 4L52A 1OGUA 3GCPA 3UNJA 2WXVA 5M4CA 1XBAA 3OCTA 3R7YA 2VTSA 4PDOA 4YTHA 2ITXA 2PHKA 3PA3A 4TT7A 3R9NA 5B2MA 1PHKA 1YRPA 2QHMA 3K2LA 2YIWA 3FY0A 4FICA 4ALVA 2R64A 3OBJA 5BMSA 1WBNA 2GHGA 4BZOA 3BLHA 4DCAA 3WF8A 3TYKA 4KSPA 3WBLA 4RJ3A 5M56A 3LCTA 3LE6A 3CR0A 4G6LA 5L8KA 4RIXA 4G1WA 1P14A 4ZP5A 3Q3BA 1ZYJA 4IVDA 4QT1A 4JIKA 5FD2A 5HVKA 4JRVA 3VS6A 1XKKA 1MRVA 2PE1A 2YZAA 2P33A 3GC7A 5AAGA 4E6AA 1TQPA 4O0XA 4U97A 2Z8CA 1ZY4A 3NCZA 3MPAA 4MXXA 5IEYA 1XH7A 2ZYBA 1U54A 3MH2A 5DNRA 4Q5EA 3UDSA 2XARA 2R3JA 2REIA 3JPVA 4GT5A 5EYCA 4RX9A 3TXOA 4MK0A 5HLWA 2XBAA 3UODA 1WAKA 2X2KA 2J9MA 2VO0A 4KBKA 3W2PA 4IH8A 5HO7A 3Q4UA 1Y8YA 4CLJA 3P5JC 2QG5A 4I6QA 4D4SA 3TG1A 2YAKA 4BJJA 5FEQA 3AOXA 3KXXA 5J87A 2JDTA 2I0VA 4FSQA 3RBWA 2BRGA 2NRYA 4BF2A 2JBOA 5I4NA 2BAKA 4LL0A 1KE6A 3CY2A 1OBGA 5LVNA 2XK8A 2X9EA 5E8XA 5CU3A 4F9BA 3KVXA 2R3MA 3FMDA 4RC3A 4L00A 3V5LA 3DTCA 2UW9A 3LZBA 2PVHA 2C6IA 3HDMA 5H8EA 3VIDA 4AACA 3D15A 2C6KA 4S33A 3LXLA 3TCPA 4D2RA 5GINE 3OCBA 3LKMA 4YNEA 4BCIA 4MYGA 5ETFA 4J99A 2R3HA 3JVSA 2C3JA 3VC4A 3ENMA 5M06A 4K9YA 3PWDA 3E3PA 5I3OA 5I9UA 2ITVA 2XBJA 3L8SA 4QMWA 2AC3A 2C47A 2HCKA 3CXWA 3R1NA 2FVDA 1L8TA 4BCHA 4BYIA 3QC4A 3O2MA 4IWDA 3KRXA 4TKSA 5G1XA 3F9NA 5IG1A 1ZMVA 2P55A 4YC6A 3G0EA 3ELJA 1GJOA 3PP1A 3Q9WA 2G2HA 3FMJA 4RT7A 5LVPA 5CALA 2C1BA 4MXOA 4OTGA 4HNFA 3G2FA 1Q8WA 4E5BA 4DGLC 1BLXA 1B39A 4OBOA 2UW6A 4IZ5A 5CSPA 5CTPA 4C3RA 4GU6A 2GDOA 5AR4A 1Z5MA 2Z7SA 3PXQA 4IVAA 3UNZA 3LCKA 3GNIB 2BDJA 3EKNA 4GYGA 4DH8A 2WEIA 4FT0A 4KSQA 3RNYA 3I0QA 5CS6A 4I6LA 4FUYA 1OB3A 5HU3A 4Z9LA 5CAVA 3KRRA 2J51A 4TYEA 3ZC6A 1JSVA 1XWSA 5M51A 2ITUA 1H28A 5EI6A 4B6LA 4BHNA 4O7SA 3MY1A 2ZV7A 2A0CX 2ETRA 4OUCA 2XEYA 3O71A 3U6IA 3G15A 3R7UA 2PVRA 3LJ2A 3BHUA 4JBOA 3BZ3A 4PMTA 5J95A 4FKPA 1XH9A 5D11A 4D9UA 4XP3A 4U80A 2EB3A 4U43A 1U5RA 1Y91A 4F65A 3QTRA 1M2PA 2WTDA 4NM0A 3QQGA 4J7BA 4U5JA 4YURA 5KMNA 4AGDA 1JOWB 2HZ4A 3NX8A 3CD3A 4MXCA 4ALWA 5HICA 3FKOA 4XV3A 3ZDUA 3KIOC 3LQ8A 1XH4A 3S3IA 4DTBA 4E4XA 4DGOA 4AX8A 4FKQA 2ZDTA 5JMSA 2VTIA 2X6EA 1TQIA 4QMUA 3LFQA 3T9IA 3IW5A 2YAAA 3AMAA 3DNDA 3QRKA 3BKBA 1J1BA 3VBXA 3PIZA 4WG4A 2YFXA 5AUZA 4MVFA 2JLDA 3JY0A 5BQ0A 5KNJA 4BZNA 4XBRA 3K3IA 3NIEA 3WOWA 2HY0A 3V51A 4PL5A 5AIRA 2VWXA 5AR2A 4ANSA 1O6KA 4BTFA 3NUSA 2W7XA 5M44A 3TDVA 1CTPE 3O96A 4HJOA 4N4SA 4FJVA 3F5GA 1XHAA 4MHAA 5LMAA 4DFUA 3U6JA 5CEPA 4LUEA 4YPDA 4O0YA 3MYGA 5EDQA 3OROA 2XMYA 1JKTA 1Q8YA 3P23A 5BYZA 4EH7A 4UMTA 4DH3A 3VF9A 3EL7A 3OTVA 4IAAA 4IX6A 2UZVA 3O23A 4YZDA 1YWRA 2KTYA 2XYNA 3M42A 4A9UA 1B38A 3C50A 1PXJA 4L46A 3BU6A 1OKYA 4O0VA 4YZNA 4H3QA 3K3JA 2XCHA 5DLSA 4CD0A 5CVGA 2ITPA 3V3VA 2VD5A 4NUSA 5L6OA 2W06A 3SA0A 2AUHA 5TE0A 4XP2A 4QMTA 3ZU7A 3KXGA 3TNHA 5D7VA 2G15A 4L7FA 3TT0A 4M8TA 3FC1X 3WF7A 2XNBA 4RWLA 4Z7GA 4CFXA 4ACMA 2YISA 5IA5A 3ZBFA 2GNJA 3LFSA 3ZONA 2R3KA 4YZMA 4CLIA 5IUHA 2GSFA 3QZGA 2I0YA 3I5NA 4FUXA 4IJ9A 4OTWA 3ORKA 3FI4A 3K54A 4R5YA 2C0OA 1ZZ2A 4O7NA 4NYEA 3UE4A 4Y8DA 5AEPA 5HD4A 5JEBA 4KRDA 4HNIA 3N4UA 3PVGA 5A54A 1XBCA 3EQFA 4QTEA 3GT8A 2IO6A 4FI1A 1I44A 4Y46A 3G0FA 1KV2A 2JKOA 3U9NA 2GQGA 3LFAA 2XKEA 4ZTMA 1UA2A 5CEMA 3F3UA 3TACA 3H9OA 2V22A 4G3GA 2XH5A 4EK8A 4C59A 3POOA 2QO7A 2B0QA 4PTCA 2QD9A 4FIFA 3LW0A 3SGCA 3F5UA 3W8LA 2OIDA 3EL8A 3F5XA 1QMZA 3F88A 3QD3A 4FV3A 5C8NA 3LLTA 4FT7A 2BIYA 3NIZA 5HHWA 4MWHA 4J96A 2OXYA 2OIQA 4ZS0A 1DI9A 3V5WA 4F9YA 3P78A 4LOPA 4W8EA 4HYSA 1DAYA 5CNOA 1KWPA 2XP2A 2VX3A 3IGGA 5TR6A 3R8ZA 4C38A 3ORIA 3L8VA 4ANLA 4PDSA 5KZIA 4QP7A 2J0LA 4APCA 3WIKA 4ALUA 1PJKA 3ZTXA 4U79A 3TV4A 4QMQA 3QWJA 3ID6C 3DK7A 3VUGA 3UYTA 3DKCA 1AQ1A 3EH9A 3EQCA 5AP6A 5H9BA 4CQGA 3M11A 2WTCA 4ITJA 4HGSA 1URWA 2VNYA 3QZIA 3ZO1A 2UW3A 3RWPA 4BIBA 2WELA 3QKMA 2FB8A 3F3ZA 4O0RA 3TL8A 1HCKA 4X2NA 4USFA 4EHZA 2QCSA 1OI9A 3A7JA 2RGPA 1REJA 3DA6A 3R01A 3OTUA 2PPQA 5G6VA 5DMZA 3FL4A 4YHFA 4HPTE 3UVPA 4YR8A 1GZNA 5M09A 5FXSA 5IH4A 4W4YA 2VWYA 3RK5A 4C36A 5B0XA 4QEBA 4BY9E 1ZYSA 2J90A 4IB3A 3S0OA 3GFWA 5LWNA 3R63A 5A46A 5F95A 1M2RA 5EM7A 5ACBC 2WMVA 4F08A 3AT3A 1O6LA 4DBXA 3FV8A 4DAWA 5DGZA 2F7ZE 1Y8GA 2GCDA 3A7HA 2UZOA 3P9JA 4A9RA 1H1PA 3VQHA 4U6RA 3DXQA 3HRCA 5JFSA 4DT9A 2ZM3A 3OD6X 5EDPA 2OZOA 3ZSGA 3WF9A 2WD1A 3NNVA 2B55A 4C62A 3QZHA 2XNNA 3RWQA 4JMQA 2BPMA 4O84A 4PPAA 1ZXEA 3NUYA 4JR3A 3LMIA 4M68A 5L6PA 4IXPA 4W4VA 5E8WA 4XOYA 4O7WA 2OGVA 4CYIA 4IFGA 3T8OA 4XX9A 4G9CA 5BYYA 3ANQA 5A9UA 5HE3A 3BHTA 3K5VA 4J98A 4ASXA 3UQFA 3VULA 1Q99A 3E8DA 2B9HA 4E8AA 2XK9A 4S31A 4BKYA 3R7VA 4FTIA 4BL1A 4BCNA 1YHWA 3HEGA 1XQZA 2IW6A 2X6DA 3DXPA 3PLSA 3AD4A 4R78A 1AD5A 3C5UA 4DHZA 5E8UA 3ZZWA 1R39A 3EN4A 2IJMA 3I7BA 3IW6A 4B4LA 4BGHA 3PUFC 3RNIA 4O27B 4BCPA 5AP7A 3HV4A 4O6EA 5EQEA 5AR5A 4KWPA 4V04A 3ZRMA 3HMIA 3AC2A 5HVYA 4UMUA 2WTVA 4AZEA 2PVYA 3UDBA 4BKJA 3NWWA 4CMUA 2QVSE 3NW6A 1Z57A 2FSOX 1IG1A 3V8WA 4E7WA 4EHGA 4Z55A 4IAKA 3MESA 3C4EA 2RIOA 4BCGA 2WGJA 3LJ1A 2OJFE 4MQ1A 2C3KA 4IE9A 3PFYA 4C4GA 2J4ZA 2ERKA 5DR2A 1X8BA 3MDYA 4LYNA 4EOJA 3QKLA 3L1SA 3I6WA 4D4VA 3GCSA 4ENXA 4UWYA 4Y83A 4L3PA 2PVJA 1JLUE 2XNGA 2IW8A 1GOLA 4U9AA 1FGIA 2R5TA 3UZPA 3H9FA 4EH9A 2WNTA 4YMJA 5IMEA 3F2RA 4ZLYA 5CEOA 3FY2A 3SAYA 4QP4A 4YTFA 5J5SA 3UO5A 3FMMA 3HV3A 3SVVA 5M07A 4PY1A 3R83A 2QODA 3HUCA 1YWVA 2EXCX 3P7BA 4DH7A 3R0TA 1VYZA 3NZ0A 3VF8A 5KO1A 5CF8A 4LGHA 4TYHA 5BVFA 4BR3A 3R8LA 3A60A 2HW7A 1QL6A 4OTPA 3QTZA 4WUAA 3KF4A 3R9RA 4ANQA 1L3RE 2H9VA 2W9ZB 2XS0A 3GGFA 3HL7A 5CF6A 4IBMA 4D55A 5J8IA 5M4UA 5ETIA 4R3CA 4EUUA 4WSQA 4XRLA 5BUIA 1KSWA 4FE2A 5AIKA 3D5UA 3KVWA 2XJ2A 1PKDA 3S4QA 4TWNA 3I81A 1XH5A 1U46A 4L67A 4F78A 3MPTA 4EH5A 4FIEA 5L4QA 2WMUA 2GNIA 4IB1A 4FT5A 3IG7A 3NNUA 1G5SA 3DAKA 4YJPA 3R7EA 3ORLA 2W1DA 4J8NA 4QP3A 4EOIA 3DAJA 2WMQA 3QYWA 3MY5A 5LCKA 4FL3A 4UY9A 4Z7HA 3W1FA 1REKA 1OECA 2WOUA 4M0YA 3BLRA 4YO6A 3FMNA 2YCFA 3IDBA 3R73A 2QO9A 3ZZEA 1K3AA 4KRCA 3VWAA 3NPCA 4N70A 2B53A 4RX5A 1IR3A 4ZTHA 4GJ2A 2XIKA 2HK5A 5LVLA 2IZUA 3LLAA 2YM6A 2XNEA 4PTEA 3DDPA 2EXEA 4JG8A 3HRBA 3TUBA 4QTBA 2VTMA 3FMHA 3LM0A 3Q4TA 3PY3A 5FTOA 3ZO3A 2WHBA 2VAGA 3QLGA 4JAIA 3Q60A 3DKGA 5DH3A 3U87A 1TFFA 4KABA 3P08A 5C1QB 5IKWA 1VZOA 2Z7LA 4I20A 3RM7A 2JKQA 2X81A 4TPTA 5IUIA 4EBVA 1H1RA 1H0WA 2F9GA 3PJ2A 5CEIA 4FGRA 3WZKA 4ERWA 2WEVA 3MIYA 3WI6A 4QQTA 3M1SA 3PY1A 3QC9A 4IWQA 3VUHA 4MX9A 1BX6A 2YIYA 2YWVA 3BGQA 3PXZA 4FTRA 3SXRA 1FQ1B 3ROYA 5LQFA 3DZQA 3VRZA 3H9RA 3TNPC 4KS8A 4DHFA 4YGAA 1PMNA 4CFWA 2BTRA 2X7GA 3FPQA 4NK9A 4TZRA 3CQWA 4AGCA 1JPAA 3KL8A 3RPVA 2W5AA 2R0IA 3Q52A 1G8SA 5K0KA 3EIDA 1JWHA 4XEYA 3BQRA 1ZYLA 4V01A 1KOAA 2PU8A 3BL7A 3R28A 2VO3A 2XVDA 4CYJA 3OWPA 3IOPA 4O0TA 3R8MA 4F6UA 3FEGA 3RKBA 2PZRA 1SM2A 3F7WA 3JY9A 4G5JA 4IX5A 3TTJA 4FZ6A 3OXZA 3DOGA 3UG1A 3UC4A 3TV6A