4BI2A

Scaffold focused virtual screening: prospective application to the discovery of ttk inhibitor
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
279
structure length
253
Chain Sequence
QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQVGTVNYMPPEAIKDISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Scaffold-Focused Virtual Screening: Prospective Application to the Discovery of Ttk Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 253
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bi2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bi2A01
3FSFA 4B9DA 2C30A 3DLZA 3TNWA 3ZM9A 2YCRA 4QMTA 1MQBA 4ZXTA 1XHAA 4BWKA 5H8GA 4AWIA 2C0OA 3AC8A 3CGFA 4FK3A 5I3OA 3PXQA 3ZYAA 1YQJA 3ZDUA 5JFVA 3TL8A 2X2LA 3CIKA 3BYMA 3FMJA 4FIEA 4L67A 2BZHB 2HOGA 4I20A 4BR3A 4XG6A 5M09A 3FLQA 4ACMA 2OH0E 1REJA 4AZFA 5CAPA 4QTCA 5HTIA 2F7ZE 3QTZA 2W1EA 3UC4A 2YHVA 3W2PA 1IEPA 2XKCA 5FM3A 2CSNA 5HKMA 1E9HA 4F70A 5KMKA 5C27A 2VX3A 2PZRA 5IZFA 4Y8DA 1FVTA 3HVCA 3QHRA 4EH2A 3SW7A 2UVXA 1Q8UA 3H3CA 3G9NA 4IHPA 4IWQA 1VJYA 4ANMA 2C68A 3V04A 4UB7A 3UE4A 5CANA 3LKMA 1LP4A 4FZ6A 5AV2A 4O7NA 5HO6A 4I6QA 3RI1A 2XUUA 2XYNA 4F9WA 3A7HA 1UU8A 4CTBA 3ITZA 3V5PA 4AA5A 4XH6A 3EN5A 5I3RA 4BGQA 4QMXA 4IANA 3DNDA 5C4KA 3KXGA 3OROA 1MUOA 1V1KA 5KMMA 3OY1A 3L9LA 4GT3A 3G6HA 4IM2A 3BE9A 4EOKA 4ZLYA 3EH9A 5CY3A 4K33A 4R7HA 1KE5A 4F7LA 3O17A 3B8RA 4K0YA 5TO8A 3G2FA 3HX4A 4H36A 4FNWA 4EYJA 4HVHA 5AP5A 1M7QA 5H3QA 5L4QA 3F69A 4UX9A 4X3FA 1W84A 3PY0A 2EU9A 2P2HA 5DN3A 2RFEA 3BGQA 4BDCA 1UVRA 4IM3A 4PMTA 1YOJA 4FV0A 3ZLSA 3FAAA 5HU9A 2X7OA 2H34A 4MNEA 4BHNA 3QQJA 4BTKA 3DZOA 1OITA 2A1AB 3GC0A 4YHFA 2YIRA 2XBJA 3MIYA 5CNOA 1WVWA 3ULIA 2XK7A 3F5UA 1ZY5A 5HG8A 4JR7A 4PPAA 4U97A 4AE9A 3ERKA 2VTAA 3TIYA 4A9UA 4L3LA 1JSTA 4QYYA 1RQQA 4EK8A 4BCQA 3D0EA 5CI6A 3WILA 4K77A 4LMUA 2YZAA 4UBAA 3D83A 2YEXA 1YHWA 5ANGA 2YM4A 5JH6A 3BBTB 2CHLA 2J5FA 3JYAA 3PXFA 2PHKA 3QUEA 4HGLA 2OJIA 5EH0A 5IPJA 3L9NA 2W1IA 3VVHA 3L8SA 3QRJA 4BCIA 3EL7A 3PG1A 2R3OA 3OEFX 5IF1A 1IAHA 5A9UA 3NRMA 2XKDA 3PJ8A 2VGOA 3U9NA 2ITQA 4BZDA 4C4EA 4DG0E 2PYWA 2F57A 2OH4A 3FKLA 5L6WL 3KXZA 5LOHA 5ANIA 3ZO4A 5EKOA 3RHXA 2JBOA 4XYFA 2R3GA 5K0XA 4FTLA 3OY3A 3PA5A 2X4ZA 4LOOA 4NM5A 3CTJA 4QMWA 2UUEA 5IH4A 3VJOA 2J5EA 5CENA 4CZUA 4EHZA 4D2TA 1IASA 3DQWA 4L44A 5DR2A 4QTBA 4R1YA 3ORPA 3PY1A 4GEOA 2ZDUA 2WNTA 4IX6A 2WOUA 3NUSA 3P4KA 4FV8A 3RPYA 4ZTHA 2WTCA 5HICA 2FUMA 3T3VA 4UMRA 2Y0AA 2C6MA 1W7HA 2YITA 3BGPA 3BWJA 3H9OA 3Q9WA 4JAJA 4K18A 3OTUA 3E3BX 2OXYA 4FE2A 3EQIA 1E1XA 2JC6A 1J1BA 3F3UA 3MH2A 3MFRA 4IAZA 1WCCA 2W4JA 2OICA 3V3VA 4MTAA 3KA0A 1G3NA 5DEYA 4C59A 4F1TA 5GZ8A 1OPKA 3UG2A 1CSNA 4P7EA 5CT0A 5EHLA 2C47A 4HVSA 3VHEA 3PA3A 3QHWA 4I93A 4ITHA 5HQ0A 1BX6A 4W8DA 3ZEPA 1PMUA 2X6DA 4F9YA 4O0SA 4YC8A 5LVNA 4DEBA 4AZSA 3HNGA 4UWYA 4W9WA 2VTMA 3KN6A 4I5CA 4IQ6A 4OGRA 4YPSA 2J0LA 4L42A 3RVGA 4L52A 3VUHA 3DT1A 3OW3A 3N4TA 4FSWA 5HE3A 3SQQA 5GINE 3K54A 5CZIA 4U9AA 3ZDIA 2W1DA 2CNQA 3EL8A 3ZM4A 1NT2A 2R3JA 3RCDA 4EHEA 2OXDA 1J1CA 5KKRB 2PE1A 4FTNA 5AUTA 1ZRZA 4AUAA 5F9EA 3GCSA 3OP5A 5AX3A 3UVPA 3QQFA 5ICPA 2HY81 2YLFA 3MWUA 2QOIA 3ODZX 1JSUA 3EN4A 4IDVA 5AJQA 3UMWA 1YXTA 1VYZA 3BWFA 2Z7SA 3O8UA 4BN1A 4UXLA 4YR8A 4ZLZA 5HX6A 3AC3A 3UNZA 3UODA 2QNJA 5DRBA 2XP2A 1SVEA 3PIYA 2UZBA 5HCXA 4M8TA 4L6QA 2R0IA 4JIAA 4M69B 1YI4A 4AW0A 1LPUA 1H08A 1OIRA 5E8TA 4EH7A 3Q9YA 4KS8A 1SM2A 1JNKA 4C58A 1PF8A 5LVLA 4RC4A 3IW4A 5FXQA 5K9IA 3OC1A 3FXWA 4YJRA 2GS2A 3KK8A 4CMUA 3DBQA 4II5A 5ANDA 2X2MA 4J98A 4XRJA 2WZJA 1W83A 2JITA 3UQGA 2XK9A 3BU3A 3TUDA 5BYLA 3R9NA 3MH3A 4HYIA 3W8LA 5HOAA 3D94A 4B8MA 1FVRA 3UQCA 4ENYA 2YWPA 3CKWA 4I5HA 3EOCA 4F6SA 3VF9A 4QP7A 3CY3A 3H9RA 2JIIA 2NRYA 3BU6A 4RPVA 4CFXA 2VWIA 3JPVA 4D9UA 1SNUA 2KTYA 2OJJA 4ZOGA 4BHZA 4AT4A 3HV7A 3A62A 4EOOA 3H10A 1OBDA 5I9XA 3W18A 5HBJA 1Y6BA 5HG5A 4AF3A 2BDFA 5H8BA 1QL6A 3PP0A 4FGRA 2R7BA 4P2KA 3TT0A 3F2NA 5CSXA 3R1NA 4DLIA 3ID6C 3CKXA 2O65A 3GU6A 5CVFA 4CMOA 4U42A 4KKEA 2UZVA 5AFVA 3RNYA 4O0YA 3FI2A 5FD2A 1DI9A 3FY2A 4AGUA 4RX5A 1XH7A 2QHNA 3EFJA 5KBQA 1CKIA 5M44A 3VC4A 1YWVA 2J50A 2IVUA 4ID7A 4QMSA 3P7AA 4X6RA 2WU6A 4PL3A 4CRSA 4YZ9A 4DT8A 4FG8A 4ZJVA 4BI2A 3O2MA 5B2KA 3CTHA 3IW8A 1OPLA 5FLFA 3QTRA 4FT0A 1TVOA 3MSSA 5FRIA 3FLSA 3EJ1A 5HTBA 4H3QA 4QQJA 2UVZA 4EH6A 4FVQA 5DR9A 3DXQA 5CAUA 3RPOA 3CY2A 3KXNA 3PJ1A 3DA6A 3F5PA 2JDVA 4QMQA 1ZARA 2HW7A 5JEBA 4R3RA 4AW2A 4EZ5A 4CKJA 4HPUE 4IM0A 2DQ7X 5DBXA 4E4NA 2R3RA 3QL8A 3NUNA 1Y91A 3QRKA 4KB8A 5F95A 2QONA 3UNKA 5K3YA 1KE9A 4C3RA 5HG9A 2OI4X 4QTAA 1OIYA 4YU2A 3U6IA 3D5XA 2OZAA 2ZYBA 3LFQA 4TYJA 4NWMA 4FOCA 1MRYA 4YJOA 2XB7A 4XCUA 3HA6A 4NIFA 5AV0A 3PSCA 4FTTA 3FLNC 4EC8A 1H0WA 2A4LA 2Y4IB 4TYGA 5FM2A 5AV1A 2O0UA 1R0EA 4QMMA 5E1SA 3HP5A 3PTGA 3E62A 2PE0A 3QBNA 4YPDA 3T9IA 2R7IA 3HMOA 3UG1A 4EH9A 4ERKA 3ELJA 1QMZA 4NW5A 4JR3A 3U9CA 2J9MA 3RGFA 1B38A 2CPKE 2XZSA 4A4LA 3QD4A 1YOMA 2C6TA 5HG7A 4ACGA 4IH8A 4C61A 4C62A 2R3NA 4EBVA 2BMCA 5LCJA 1G8SA 4C4FA 3L8VA 4ZTSA 3HMNA 3BCEA 2G2IA 4RSSA 3SD0A 3R71A 2IW6A 1JVPP 4U80A 3NUYA 3DTWA 3PXZA 5FGKA 2HZIA 2O8YA 3CPCA 5LVOA 4ZMFA 4Q9SA 4M84A 3EMGA 3LQ8A 4DTKA 5M57A 2EXCX 3W8QA 3HP2A 2PVNA 4KRCA 4WRGA 1BUHA 1FOTA 2VV9A 1Q8ZA 3F6XA 3PWDA 3SVVA 3CEKA 3LCSA 4X2NA 4AE6A 4UYAA 4CFWA 4MD7E 5IUGA 4FTQA 5M4CA 4MXOA 5CEMA 3QAME 2C4GA 2BROA 3QCYA 4O6EA 4U3ZA 2C5XA 3UTOA 4Z7GA 4IVDA 4DFXE 3QD2B 4IW0A 1BYGA 4FL3A 4YNOA 2PMLX 4ZTLA 5D7VA 1GNGA 1AD5A 2X8IA 3QQHA 4GUBA 3V8SA 3NNWA 2H9VA 3A60A 3E7OA 2QQ7A 4QMYA 5FEDA 3VAPA 4BDJA 1A06A 4XG4A 4CVAA 3GCPA 1CTPE 3D9VA 1ZWSA 3AOXA 3KRJA 4QMNA 2X2KA 4MBLA 4D1XA 4FUXA 1I09A 2XJ2A 5EYCA 2V55A 3ZRKA 5KMNA 5EHYA 4DEGA 4GVJA 4IC7A 2C3JA 4JI9A 5BX0A 3UVRA 1M17A 4E4LA 3IGGA 4ZMEA 4WUNA 1CKJA 1WBPA 2UZUE 4QO9A 3WOWA 2XJ0A 4BCGA 1KE6A 2BTRA 2NO3A 4UWBA 4W8EA 1WBWA 4MXAA 1OZ1A 4CKRA 3UOKA 1OPJA 3S4QA 2H6DA 3HEGA 4L53A 2QOHA 4FSUA 4YO6A 3FSKA 3QTIA 4A9TA 1KV2A 3RPSA 4GIIA 3R73A 1H0VA 2R5TA 5IEXA 2FVDA 3HRCA 4JBQA 2XVDA 3I6WA 4L00A 3BYSA 3D5WA 4E5AX 5BQ0A 5JK3A 2C0TA 3KXMA 4GK4A 4JBOA 2XCHA 3QXOA 5IQEA 1APME 1Q8YA 2ITYA 3FV8A 3CS9A 4Z16A 4OTGA 2WOTA 3R21A 3O0GA 4M13A 3LQ5A 1Q24A 5HNIX 4YTHA 1WZYA 4AZVA 3LMHA 5E8UA 2XIKA 5CU2A 5AR8A 1M2RA 3D5VA 2HELA 3A99A 4Y73A 2UZDA 4D4YA 2BRHA 5L2TA 3TEIA 3W2OA 5EI6A 2DS1A 2WMSA 1CMKE 3NIZA 4M7IA 2QOFA 2WKMA 3R1QA 4TRLA 2WB8A 2W7XA 2BAJA 4YJPA 5HD7A 3UNJA 2XMYA 3WF9A 3D7TB 5JRQA 2VRXA 4L7FA 1REKA 3W16A 3R7VA 3A4PA 3P78A 4IFCA 4WIHA 5H2UA 3Q52A 4O6LA 5LMBA 2R0UA 5CVGA 1ZOGA 2W0JA 3FYJX 3GB2A 4QT1A 4CQGA 4IZ5A 3AT3A 3UZTA 5DH3A 4CXAA 4LM5A 5EI2A 1DI8A 3IW5A 3R2BA 2BAKA 2WTKB 5AUXA 2C3IB 5M4UA 4FKUA 2X7FA 4KIQA 5JMSA 2ONLA 2Q0NA 2J2IB 3E3PA 4IZ7A 4ARKA 4BGHA 2W06A 3GENA 1M2PA 4BF2A 2QHMA 1OB3A 2B4SB 4GIHA 5LWNA 4G9CA 2WMBA 3LHJA 4OBQA 4YJSA 3WZDA 4FBXA 4X3FC 1TQIA 3R6XA 3P08A 5DOSA 3RBWA 2UW6A 4BCJA 3W2QA 1GZOA 4I0RA 3UBDA 5I9YA 4EORA 4XX9A 1Z9XA 2VX1A 4IZYA 3EIDA 3U4UA 5AADA 4RT7A 4L01A 4ZSGA 3R7UA 3SV0A 5BUIA 2VTJA 2R3LA 4GL9A 3FPMA 1JWHA 3DB8A 2UZOA 3B2TA 3GUBA 1ATPE 4QYGA 3OTVA 1UKIA 2Z2WA 4ZTRA 4DBNA 3I5ZA 5J7BA 3VO3A 3V51A 3EYGA 3G51A 3VS4A 3QQGA 3RJCA 4FKGA 4DEEA 2YISA 5J7HA 2VWWA 4FKVA 1ZOEA 2BAQA 3ZRMA 3QTXA 3VWAA 4YUQA 3RZFA 2NRUA 4ZTMA 3Q32A 1R3CA 5LVMA 4GKIA 4YGAA 4YZMA 5CU0A 3E7VA 3JS2A 3VUIA 4HW7A 4FSMA 4HYUA 3C4ZA 4UY9A 4G31A 3T9TA 2J0MB 5AR4A 3SG9A 1QPJA 3AQVA 4GSBA 2GQSA 2F7XE 3QFVA 3I0QA 4QYEA 4CNHA 5IA2A 3R7GA 1SVGA 4G34A 5KMOA 2X81A 4NTTA 2IN6A 5TT7A 4CCBA 4Y85A 3PUPA 3WZUA 4ASDA 1YRPA 4FZ7A 3UOHA 4CFMA 5KBRA 1OM1A 4RFZA 2CKQA 3LXLA 5IA1A 4E93A 3DDQA 3GT8A 4G3EA 2OU7A 3MVMA 3C4FA 3JY9A 4CG9A 2RFNA 4UN0C 4J8MA 3H0ZA 5CLPA 1L3RE 3DAEA 5C9CA 4WO5A 2AYPA 1R78A 4WA9A 1RW8A 5DI1A 2ITUA 1H4LA 2QOQA 3NCZA 1OKVA 1OIQA 4FI1A 5KO1A 2NPQA 5IA5A 2QLUA 4WHZA 3NMUF 3PPKA 4NCTA 2OJFE 2XM8A 3LXPA 5CAOA 5GIPE 2OIQA 2OJ9A 3LPBA 2UVYA 4QRCA 3POZA 4K11A 4USDA 3WF8A 2PVJA 2VUWA 4I23A 2JAMA 3FLWA 4LUDA 4IWDA 5AP3A 2QD9A 5B0XA 1H24A 3FZRA 3QCXA 4B6LA 4O0TA 4I94A 4YZCA 3C13A 4QQTA 5I9WA 4BYJA 4CEGA 4W4YA 4QTDA 1PYXA 1ZYCA 3E8NA 3NDMA 4G6OA 4CLJA 3P1AA 3WF6A 1UU9A 1U5RA 2VWXA 4PV0A 3R8VA 1B6CB 4PP7A 4DG3E 3MTFA 3JXWA 4H39A 4ZSEA 1WBSA 4KRDA 4GMYA 4F1MA 3E63A 4FODA 5IQFA 1KE8A 1LEZA 4RG0A 5AUYA 2XIRA 4XBRA 3NW6A 4X2JA 1U4DA 3LFCA 4U3YA 3ZU7A 2F9GA 1PY5A 3QGWA 1PXJA 4YHJA 5J8IA 5A6OA 4QPSA 3R8ZA 3WYYA 5T68A 4KIKB 1T45A 4ACCA 3M2WA 1JAMA 3FEGA 1IA8A 2Z7LA 5G6VA 4OT5A 2F49A 4RRVA 4CT2A 4E6DA 3TUCA 3DGKA 2PUNA 1I44A 3OOMA 3UZPA 3ZLYA 4FTRA 3G90X 3SX9A 4E4XA 4DTBA 4AFJA 3OG7A 4Y5QA 3RALA 4W9XA 3FMDA 5FG8A 4MXZA 4I41A 3WF7A 3FMLA 4APCA 3EQDA 5TOZA 3AXWA 5FDXA 3GC7A 3COIA 3HRBA 3Q4TA 3VNTA 2IW8A 3OUKA 2EXEA 3OWPA 3UZRA 4E6CA 1JKLA 3LM5A 3Q9XA 3DBEA 2XNBA 2QI8A 1WBNA 1RDQE 3WZEA 4CKIA 4AZEA 5D11A 2YLEA 2YABA 3AD5A 4FIGA 1OL6A 4EZ7A 4DTAA 5HO8A 2X9EA 5J9YA 5EDPA 3VN9A 4RIXB 4BB4A 2CLQA 2ZAZA 4WBOA 1PKDA 2IVSA 3A8XA 3IW6A 3NYNA 4IBMA 4RGJA 2C6IA 3FI4A 4YLJA 3DBFA 1J91A 3QTQA 4BYIA 3EWHA 5LMAA 2WMAA 2X39A 2Z7RA 3LLAA 4KAOA 2JIVA 3SAYA 3A4OX 3DNEA 4TYEA 1PHKA 5LJJA 3GFEA 4XP0A 2H96A 4FEXA 1E1VA 2W96B 4XP2A 3KMMA 4MVFA 4KA3A 3ORIA 4BBMA 4YTFA 3OXTA 3R02A 1YVJA 2XEZA 3UIXA 3R83A 4UYNA 5G1XA 3CE3A 5K4JA 2V5QA 4AQCA 4JRVA 2B0QA 3GCUA 4WRSA 2B7AA 2GQRA 5LQFA 1SZMA 3DV3A 2BCJA 5CNNA 1Q3DA 2JDTA 4NH1A 4FTIA 3R8MA 3KXXA 4EH3A 4EOQA 3VBVA 3QCSA 3EQGA 5BVEA 2XNEA 4Y5HA 5I9VA 2PL0A 4B7TA 1QPDA 4ENXA 2AC5A 4F7NA 3ZLWA 4IEBA 1H1RA 4U44A 3ALOA 3MB6A 2GNGA 1JKKA 4UZHA 3HMMA 1JKTA 4BI0A 3UO5A 5H9BA 4S30A 4R3PA 4EKKA 2QR8A 4V0GB 1U5QA 2E9PA 3TNQB 4EHGA 4Z7HA 1QPEA 2Y8OA 4QMPA 1M14A 4UV0A 3KY2A 4HZRA 4ANSA 4L45A 1PXNA 2F7EE 4MWHA 4R7IA 5D10A 3WARA 3GNIB 3QD3A 2B9HA 4AA0A 3NW7A 4C4IA 2WTDA 5M55A 4PTGA 2GDOA 5CF4A 5AIRA 3P5KA 4BDKA 2HZ4A 3DXNA 2BFYA 4E3CA 2R3MA 5HIBA 4C38A 5KZIA 4TWOA 5DT0A 3DQXA 1H26A 2GFCA 3NSZA 2GFSA 5CSPA 4GRBA 4M15A 5D41A 4O21A 3A8WA 4O1PA 5AA8A 2EB2A 4AG8A 4FIJA 4LG4A 4JBVA 4Y83A 5HIDA 5ANEA 2RGPA 4AACA 3P86A 4K8AA 4C4GA 5L8KA 4U81A 3BQRA 5HZNA 3PA4A 5EHOA 3QYWA 4RA4A 4D5KA 4IZAA 4A9RA 3NPCA 3A61A 4QMZA 4XRLA 3QA8A 4W4XA 4M67A 1PXOA 4RJ3A 1YWRA 5ACKA 4RX9A 3FZ1A 1YXSA 2VWYA 2XK3A 2XRUA 2FSMX 2YIQA 4FF8A 2VO3A 5GJFA 3G0FA 1O6YA 2X4FA 1F0QA 5FTGA 3VS7A 4I24A 2YJRA 4EH5A 3Q6UA 1XBAA 3BU5A 4MF1A 4XOYA 4C34A 5IDPA 2Z60A 3D15A 3DBDA 4BCFA 4JAIA 4LFIA 4XUFA 1ZMWA 5JSMA 3V8TA 2BALA 4I4EA 3F7ZA 4C4JA 3PPZA 4FA2A 2VTOA 4ZZNA 4ANNA 3OT8A 2YACA 3OCBA 3S3IA 4U43A 2PVHA 4EKLA 3MFTA 2PVLA 3Q96A 4FIIA 4CV8A 4H3BA 2B54A 2HWOA 3FZOA 5DWRA 5E8VA 3OWKA 3R28A 4O7VA 3EB0A 3E93A 5E8WA 2ZV7A 3QZGA 3THBA 4E8AA 1PW2A 4YHTA 5IA0A 3ORTA 3TV7A 5ACBC 2PVFA 5J79A 4RFMA 2W4OA 3HDNA 4O7LA 4C0TA 5CSWA 1VZOA 4OTPA 3Q53A 3UQFA 1J7UA 4ZEGA 2YZLA 2VTHA 2PZYA 5HCZA 3W2CA 4KD1A 1XH8A 2B53A 4WG5A 4QYHA 5CF8A 1H1SA 4G1WA 5C8MA 2GNFA 4QMOA 4W4VA 3DJ5A 4O96A 4I0TA 4OTWA 3HMPA 2G1TA 3KMWA 4EWHA 4HGSA 3LW0A 2R3IA 2ZMDA 3EFKA 3MY1A 5AAGA 5HEZA 4DH1A 3DJ7A 4XJ0A 4C37A 2JKMA 4IAFA 2B9IA 4OTRA 1PXMA 3QTSA 1JLUE 4E20A 4UMUA 5K5XA 3QQLA 2O2UA 5IMEA 1WVYA 4R8QA 3HUBA 5A3XA 4UWCA 2UW8A 2JKKA 2YDJA 4EJNA 5M08A 1V0BA 3OXZA 4DN5A 1H00A 4F6WA 4IAAA 5E91A 4F9BA 2RSVA 3E92A 2V62A 3SRVB 3GU8A 1DAYA 1HCKA 4FSYA 4IXPA 4NFMA 3UPXA 2HW6A 5IISA 2ONLC 3ZSGA 1OUKA 3EZRA 1XR1A 2HK5A 3KFAA 4LI5A 3F9NA 5AUZA 3O7LB 3OFMA 1Y57A 5CI7A 1RE8A 5I9UA 4GK2A 4D2VA 4U79A 4QNYA 3A7FA 3LFFA 3TDWA 4UEUA 1KV1A 5L8LA 3SA0A 4DFUA 3IONA 4IACA 3H0YA 3HYHA 1YOLA 1R0PA 3NAXA 2BIYA 2IZRA 2PVRA 3GU4A 1U54A 5KUPA 4P90A 4F9CA 2WTIA 3PDTA 5IEYA 4BDHA 4YLKA 1XH5A 4CQEA 4GUEA 4LOPA 2OO8X 2QU6A 3E8CA 3HECA 3KCFA 2BKZA 1OIUA 1ZYSA 4F65A 2FSLX 2VTPA 2C6KA 4MBJA 3Q60A 3PE2A 4KIPA 1VR2A 3S2PA 4A9YA 4FSRA 3KL8A 1WVXA 2ZM3A 4CLIA 3C4EA 3GEQA 4CGAA 2NP8A 5AP4A 2YN8A 3PLSA 4IX4A 4G17A 3BLQA 2G2FA 5E8SA 4ZTQA 3ZO3A 3LCKA 4TL0A 4WOVA 1ZMUA 2WMTA 2E9NA 2G9XA 3KXHA 3F7WA 3POOA 3PXRA 1XH6A 3Q9ZA 1OL1A 3RK7A 3UC3A 2WMXA 2R64A 2XK4A 4DAWA 4KS7A 4KSQA 5ITAA 5CU3A 4Y46A 4F7JA 1Q8TA 4M14A 2VTNA 4FTJA 4LUEA 3GU5A 3MVLA 3QALE 4HCUA 5DFPA 1LEWA 4D58A 4NKAA 2OXXA 5JQ5A 5FUTA 4DYMA 5KMJA 2ETMA 3QX4A 2BZKB 3GC8A 4N6ZA 4TN6A 2ZOQA 4DEIA 3N4VA 4Y72A 4D1ZA 5D9HA 1PMEA 3BRBA 2WEIA 2C3KA 4O0VA 2I0EA 5JGBA 4MD8E 3WZKA 2X8DA 3WE4A 2AC3A 2X0GA 3QLGA 2YA9A 3L9MA 4RIWA 4ACHA 2OLCA 3NUUA 4BCKA 4RC2A 3ANRA 3K5VA 3DK3A 4KBKA 2H8HA 3DB6A 3HRFA 4GT5A 5CQWA 2C5OA 2JDRA 1XH9A 3VJNA 3Q5IA 3DKCA 4RZVA 4YZNA 5D1JA 5TE0A 1V0PA 4ASEA 4CZTA 3TCPA 3IK3A 2XNMA 4QNAA 1Q61A 5EYDA 2VTSA 4NCTC 4PRJA 3II5A 4OBOA 4IJ9A 4K6ZA 3IOPA 4PUZA 2R9SA 4TPTA 3SKCA 2W9ZB 2V7AA 3MFSA 3SDJA 4CFFA 2YAKA 3AMYA 3FC1X 4LL5A 3BE2A 3I0OA 2YCFA 4QD6A 2ITTA 3I5NA 4WSQA 2B52A 1JPAA 3V6SA 4M3QA 5ANKA 4U8ZA 5DGZA 3QRIA 5JQ8A 3S95A 4GU9A 1J7LA 5BUJA 5ETIA 4X3FB 4I92A 4NKSA 4TKSA 4CMTA 3R8PA 3GP0A 1PMNA 1XWSA 2JGZA 4HNIA 1PXIA 1GZKA 2OBJA 2VTIA 3QZFA 4MNEB 3P79A 5EOLA 5BYYA 2P33A 3PJCA 3ACKA 2C1BA 4TNBA 4YJNA 3BHHA 1AGWA 2C5VA 1JBPE 3AC4A 3FLZA 4P5QA 2OFUA 5D7AA 4PL4A 4YMJA 3MV5A 1ZLTA 3MJ1A 4F08A 3NVMB 4G5JA 5HLPA 4QP8A 4BY9E 1JSVA 2HZNA 3KVWA 4LMNA 4KUJA 3OXIA 3ZFXA 2ITOA 3D14A 4DGGA 3LJ2A 3UOLA 4EONA 4K9YA 4F99A 2PUPA 3AC5A 5DLSA 1PXLA 3C50A 1V0OA 3ZRLA 1P4FA 3LQ3A 3B8QA 3MH0A 2ERKA 4IWPA 2PWLA 4WG4A 3V6RA 4O83A 3L8PA 3F3ZA 3M1SA 4I6FA 5GNKA 5FTQA 3LCDA 3NYVA 2ITPA 1K2PA 4FSNA 4MXCA 2VGPA 5CEOA 2YIYA 3GQIA 2CNVA 1JQHA 4AFEA 1BL7A 3VS6A 5A4CA 4RJ8A 4UMTA 2ZMCA 3FZPA 4RIYA 4F7SA 4FV4A 5E92A 1ND4A 3FMNA 3W32A 3NX8A 5AAEA 3LXNA 2IZUA 5BVDA 3IECA 3WF5A 1DAWA 1O6LA 4MD9E 5L3AA 3GQLA 2IZTA 4MNFA 3BQCA 1KOAA 3DPKA 3EQPA 3DAJA 4F64A 3CLYA 2WO6A 3BV3A 4IX5A 1FGKA 4BZOA 4FIHA 4FKPA 3NCGA 4ALWA 3UIMA 3KGAA 4I3ZA 4MEDA 4NYEA 4XNEA 2E9VA 4DEHA 2ZM1A 4O7TA 2VWVA 2BDJA 4N0SA 4GT4A 4BIDA 3UIUA 5CSVA 3U4WA 1WBOA 4EZ3A 1H07A 4BGGA 3ORXA 4NW6A 4C7TA 1A48A 5M4IA 1H1WA 1SVHA 4O2ZA 3RTPA 1URWA 3RWQA 2CCHA 2EUFB 2XK6A 4FV5A 5JKGA 2R3HA 1RJBA 4OAUC 4BL1A 3V8WA 1UU3A 3HL7A 5J1VA 4OTQA 5HI2A 2R3FA 3CTQA 4IB5A 3VQHA 4D2WA 3ENHA 2WFYA 1FVVA 3BYVA 4XHKB 3VW8A 4O0WA 4MXXA 1XO2B 3PSBA 3BX5A 2CGUA 2YDIA 3C51A 4NFNA 3RPVA 5IUHA 2OJGA 2UV2A 5BVWA 4TYHA 5BVOA 5FBOA 3FMMA 2IPXA 4AT5A 4A9SA 5DE2A 2JFMA 2I0VA 4V05A 2J7TA 2BZJA 3FQHA 2C6OA 2GNHA 4ZP5A 3UYSA 3TV4A 3PRFA 3R9HA 2YIXA 3E88A 4F0IA 2WMVA 3CJGA 5EW8A 3TNHA 2CCIA 2CKEA 4FT7A 5M56A 2OF4A 3IQ7A 3ZZEA 4TTHB 4FKQA 4ZSLA 4JG7A 4GFGA 4MCVA 4HYHA 4G3GA 2W4KA 2W17A 5HBHA 1PXKA 4HGEA 3GXLA 4ZJJA 4BIEA 3N9XA 2GCDA 2BRBA 5KHXA 2C0IA 3QTWA 4YJQA 2ZV2A 5KMIA 5EQYA 4XP3A 5CYIA 5EI8A 2XS0A 5FP5A 1W82A 2BIKB 3TIZA 4YJUA 4FL1A 4AN2A 1P5EA 3UOJA 1BL6A 3JY0A 3KCKA 3PJ3A 4G3CA 4XV3A 1AQ1A 4R3CA 2GTMA 4ZSJA 5H8EA 5E90A 3EHAA 4F0GA 3BLHA 4GFOA 4DEDA 4G3FA 4PY1A 1KUTA 3FI8A 5E1EA 5GJDA 3C0GA 4J8NA 5K0KA 3LMGA 2XNNA 4JVGA 1GZNA 3UDBA 3DY7A 2EVAA 3LIJA 3HV3A 3OUNB 3DDPA 4HYSA 4PWNA 5DIAA 2BKKA 3GOKA 3KREA 3MVHA 4YC3A 2QLQA 4YTCA 1QPCA 3QZIA 3CC6A 4P5ZA 4GV1A 3RNIA 1GOLA 3ROCA 3C9WA 5LCKA 1PXPA 3DLSA 2QOLA 2WU7A 2QKRA 3PVBA 4FICA 2JFLA 1UWJA 2ZDTA 3QWJA 4Q5EA 4DG2E 3CQEA 3C7QA 4NM0A 4RLKA 3NUXA 3KEXA 3ZFYA 3VRZA 4L9IA 5AUWA 5K4IA 3ZZWA 2BFXA 3NYXA 4GH2A 2E2BA 2JLDA 3IPHA 5AM6A 1P14A 2QO2A 3GI3A 1DS5A 4RBLA 3LFAA 2JKOA 5DVRA 1WFCA 4AOJA 3BKBA 4HVDA 2ETKA 3CQWA 3LZBA 4QPAA 3GC9A 5JGDA 5LVPA 4MQ1A 2YDKA 2QOBA 3FHRA 4NEUA 3VS2A 4L46A 5CF5A 5HNBA 1YXVA 2QOCA 4KWPA 3K3IA 4BDDA 5M06A 5DMZA 3D7ZA 5L2QA 3ZFMA 3MJ2A 1YWNA 4Z55A 3FI3A 4IVCA 4HOKA 4APPA 4Q9ZA 4FZFB 5CEQA 4I5PA 3TI1A 5J87A 4L43A 5BNJA 4O27B 4USFA 5GZAA 3FMEA 2R2PA 5IU2A 4NM3A 4GG7A 1M2QA 2RG5A 5IQGA 2W9FB 3ZHPC 4H1MA 4TYIA 1BLXA 2UW5A 2GNLA 2W05A 5CSHA 3TNPC 5J9ZA 3FJQE 4CSVA 1O9UA 3QA0A 2OZAB 3MA3A 4GS6A 3VF8A 4IJPA 4HVGA 2WMRA 5AP6A 4ALUA 5FEQA 2VTTA 5AR7A 5HVYA 3VBQA 5C8KA 4BC6A 2OSCA 4NIFB 4YC6A 2UW3A 2CN5A 3GVUA 3P9JA 2ZM4A 4R7BA 1DM2A 4RJ6A 3EQCA 4S2ZA 3R00A 3CD3A 3ORLA 3JVSA 4I6HA 4U45A 3EKNA 4O91A 5L2WA 3AD6A 2W99B 4D28A 2J6MA 4X2KA 2EXMA 5HNGA 1GIJA 4TT7A 3PYYA 3D5UA 1H1QA 4ZY4A 3V5WA 4RIOA 3ATTA 1FMKA 3UVQA 4M68A 4BDAA 2YFXA 4E73A 1U59A 1P4OA 4DH5A 3AMBA 4WNMA 3C5IA 2QR7A 2O63A 2VTLA 4HCTA 1URCA 2XEYA 4DCAA 4MBIA 3ACJA 5AV3A 5HLNA 5HTCA 1FBNA 3LAUA 4MF0A 3OWLA 4X2FA 4PDSA 3ZXTA 4U6RA 4D4VA 3WI6A 4ITIA 3PPJA 1JKSA 3QQUA 3BZ3A 2GNIA 2PMOX 3B2WA 3RZBA 3MH1A 4A06A 2BR1A 2E9UA 3LFDA 3CR0A 2WEVA 2ZB0A 5L2IA 2R3KA 2XNOA 4O84A 4NJ3A 3QLFA 2O64A 5CXHA 1MP8A 3VS5A 4DGLC 4J53A 1W0XC 4O81A 1NVRA 4JX3A 3P7BA 3PVGA 4IB3A 2CGWA 5FXSA 4F1OA 2WELA 4DC2A 2HZ0A 4QMUA 4S34A 2BHHA 3DU8A 3N51A 3RWPA 3PVUA 4CZYB 2OF2A 4BICA 3N4UA 3R7EA 3V5JA 3DFAA 3FUPA 4FV3A 5HHWA 4FEWA 4J7BA 1W98A 3EZVA 4DFNA 5E4HA 4J99A 3TZ7A 3H9FA 4GJ2A 3U6HA 5HESA 3HAMA 1XQZA 3TACA 4BRXA 1OKYA 4E7WA 4XV9A 3TTJA 5AA9A 3VBWA 5CF6A 1UA2A 4KNBA 3T3UA 4IVBA 2QG7A 3FMKA 3QUPA 4RWIA 5CTPA 3VBTA 4F9AA 4YZBA 1FGIA 2XNPA 1FMOE 2ITVA 4V04A 4RMZA 2XBAA 2X7GA 2W5AA 3KK9A 2CMWA 3VUTA 3PY3A 2QODA 5GZ9A 4RX7A 5AP7A 3ETAA 3BGZA 3NLBA 4FZAB 1PKGA 1TQMA 5HE1A 1OI9A 3OBGA 4KBAA 1F5QA 3O8TA 4FX3A 5AEPA 3PIZA 3OF0A 4IB1A 5JFWA 3CJFA 2WMQA 2LGCA 3KKVA 2XRWA 1A9UA 3MA6A 5IA3A 2E9OA 4XG7A 4AU8A 1T46A 3ZXZA 3R63A 2VD5A 2LAVA 3DCVA 3EYHA 4L68A 3OCGA 5ANOA 3PG3A 3Q3BA 3BHTA 2IWIA 3U55A 3V5TA 1YDRE 4JDHA 3VRYA 4EOSA 1PYEA 4QP3A 3PP1A 4IE9A 4FMQA 4G3DA 5DYJA 3RK5A 1K3AA 4WUAA 4C35A 1J3HA 3AG9A 4EK5A 3S00A 5F20A 5EW9A 4L8MA 5AUVA 4ZJIA 2A19B 2W5HA 3U87A 5CASA 4IDTA 4B8LA 3MY5A 4K1BA 4O7YA 3NZ0A 4PNIA 5A4LA 2F2CB 5AUUA 3TKHA 5C01A 3VUKA 2ITXA 2OGVA 2J90A 5FQDC 3W2SA 1OL7A 4EUUA 1PMVA 4I4FA 4M0YA 4OTHA 4DHFA 4DT9A 1KE7A 3HA8A 4LL0A 2P0CA 4FTKA 2G2HA 2RG6A 4DBXA 2BHEA 3OEZA 4NZWB 2C1AA 2VTRA 5IH6A 3LCTA 4LGDA 3M11A 3ZO1A 3BYOA 2ITZA 5TF9A 5IQHA 2IO6A 5HBEA 5BMMA 4R5YA 4EI4A 1ZYDA 4Q5HA 3PE1A 4DEAA 4PMMA 4RVTA 2REIA 3P7CA 5KCVA 3GGFA 4XS2A 4FV1A 4EOPA 3P0MA 2ZVAA 4CCUA 4DCEA 4EH4A 1XBBA 3EQBA 3OWJA 4M69A 4PX6A 5AWMA 3EKKA 3NGAA 4S32A 4DF3A 4FC0A 3W33A 3CQUA 1ZYJA 2OG8A 3HMIA 3JR1A 1G5SA 3C4XA 3QD0A 5CEIA 4D4RA 2CKOA 3ENMA 1MQ4A 4ZK5A 4TXCA 3VS0A 3MTLA 4BIBA 5CU6A 5DNRA 4D5HA 4EOLA 4UMPA 1X8BA 3IDBA 3ORKA 4GG5A 3LLTA 4X0MA 1OUYA 3KRWA 5A4QA 3DKOA 3F3WA 2V22A 3HGKA 5FP6A 4R77A 1WAKA 2DWBA 4FTMA 3VS3A 4D9TA 1UV5A 2GSFA 4BVUA 5LARA 3KRLA 3MS9A 4KBCA 4DINA 5AIKA 1H1PA 5IQDA 3MVJA 3RAKA 3NWWA 4R1VA 4NUSA 4QMLA 5J5SA 1F3MC 1UWHA 3BHYA 2RFSA 2WIHA 3G6GA 3R30A 3NYOA 4JDIA 2HENA 4RVKA 3LJ1A 5CZHA 3AGLA 3V01A 5LWMA 2XIZA 2YJSA 4DFBA 4F0FA 3G15A 4FNYA 3K5UA 2CN8A 3HUCA 3MYGA 3G33A 5CXZA 3QKMA 4XG3A 4QP1A 3RM6A 2PTKA 2C69A 5E8XA 3S1HA 5AM7A 3CCNA 5IQCA 4G6NA 1OVEA 1SMHA 4CT1A 1ZZLA 3HV5A 3EN6A 4F09A 4J1RA 3I7BA 4CV9A 2VZ6A 4KINA 4QP4A 5CALA 3OOGA 1UKHA 3OVVA 2VO6A 3JVRA 5HVKA 4CYJA 1OKWA 3A7IA 4C33A 2BILB 2KULA 4ACDA 1NVSA 4GW8A 3LFBA 4AW1A 4OLIA 5K5NA 1NA7A 2OW3A 3AD4A 4DLJA 2X6EA 5B2MA 3R1SA 3QGYA 3D4QA 3NNVA 4ZZOA 3R9RA 2C6LA 3RAWA 4J71A 3O96A 1M7NA 3QF9A 4FSZA 4E6AA 1Q41A 2VX0A 4ZTNA 4E4MA 2Y9QA 3R04A 4OBPA 3OCSA 3NAYA 2DUVA 4LRKA 4FTUA 3ZS5A 4BFMA 4O82A 4L3JA 4WT6A 2BUJA 4JLCA 4DH7A 5CAVA 5T3QA 3PZHA 4JJRA 3Q6WA 2PVKA 3OMVA 1YXUA 4RA5A 1O6KA 3R01A 5EM7A 4FKWA 4WSYA 2B55A 3CBLA 2YM5A 2ZJWA 4I0SA 2V7OA 5EOBA 3A7JA 5KHWA 2Q83A 1LR4A 2P4IA 4O0XA 1BI8A 5AP1A 2QC6A 2YIWA 3HV6A 3OHTA 3OW4A 5HE0A 1WBTA 4O86A 4CYIA 3KULB 4PDYA 4QP9A 3ORMA 4FTAA 5CWZA 2JDOA 4JL9A 2ETRA 4D1SA 2UZLA 5CU4A 5M4FA 3NW5A 4KKGA 3REPA 3QC9A 4FNXA 4DGNA 4IIRA 2HCKA 5KMLA 3ANQA 3ZBFA 3ZTXA 3ZLXA 4BDEA 4ZS4A 4LV8A 4JG6A 5BMSA 4RWJA 4PTEA 5I4NA 4E5WA 5L2SA 3R9OA 3LCOA 2XF0A 4I5MA 4EYMA 2X1NA 4MQ2A 4FKOA 4N57A 4FOBA 2YM6A 2OWBA 5J95A 2YCSA 3OD6X 1GZ8A 5DT3A 2ITWA 3QUDA 4ONAA 5KZ0A 3G0EA 2QG5A 2VO0A 3GU7A 4CFUA 5A46A 2YM3A 4EUTA 5JGAA 3F2AA 2WQEA 3QU0A 1B39A 4FL2A 3ATSA 4D0XA 3TN8A 2B9JA 2JAVA 1XJDA 4FSQA 3O71A 5CX9A 3DFCB 2ZB1A 4DGMA 4A4OA 4JOAA 2CGXA 3LM0A 3Q04A 5BVKA 1G8AA 3VW6A 4FIFA 4AXAA 4O7SA 5DT4A 4YURA 4ZY5A 3MESA 3QZHA 4N6YA 4LGGA 4U7ZA 2UW4A 4FYOA 3MIAA 3COHA 2IJMA 4AA4A 4DITA 2PMIA 2FO0A 3R8LA 3M42A 2PUUA 2UZTA 5BVNA 2X8EA 4ASXA 2PUIA 5FTOA 3NUPA 4TWCA 3FQEA 4FKTA 4LQMA 4NT4A 1VYWA 1L8TA 3COKA 3HAVA 5E8YA 3TZ8A 4O7WA 2XIXA 3KMUA 2Z7QA 3H30A 5HVJA 5F94A 5HU3A 4JXFA 4GKHA 3RINA 5AR3A 4NL0A 3IDCA 1EH4A 1Y8GA 5IQAA 3F61A 3R2YA 5LMKA 4E1ZA 5EW3A 2Z02A 2YAAA 1IAJA 4FV2A 4GK3A 5EDRA 3R1YA 4ZIMA 4C4HA 1YDTE 1S9IA 4JIKA 1ZAOA 3C0IA 5EYKA 4NU1A 3DOGA 5M53A 1Q62A 4AT3A 3E64A 3SGCA 4FSTA 3MI9A 5E9EA 2XYUA 2XCKA 4RC3A 5EM6A 4BCNA 2RFDA 3FZSA 3K3JA 5IQBA 3Q5ZA 4N4SA 3FKOA 4EHVA 5FEEA 4U40A 3LJ0A 4GFMA 4IAKA 2UZEA 4W4WA 3W10A 4AGCA 2WTVA 2JDSA 1TKIA 3BI6A 4JDKA 3SXFA 3O50A 4XG8A 3WZJA 4TWPA 5AR5A 4O2PA 3E87A 3L1SA 3WIGA 3ZEWA 3AC1A 4EEVA 4LRJA 4BDBA 4EK4A 1YXXA 5CEKA 2VO7A 3O23A 2BTSA 3E5AA 1Z57A 2VWUA 3D2KA 3FL4A 3ZMMA 2OFVA 2O3PA 4FVRA 3ZC5A 2HY0A 4IX3A 5ETAA 3VBXA 3PWYA 3SLSA 2RF9A 4PNKA 2JEDA 3GOPA 3FQSA 1Q8WA 1Q4LA 1ERKA 2FGIA 2JKQA 3D7TA 3E8DA 3UP2A 2QOOA 4R6VA 3FMHA 3BELA 4RFYA 4RZWA 1HOWA 5CVHA 5CQUA 3Q4CA 1MRVA 4BTFA 4C8BA 3DJ6A 3UMXA 3MY0A 3ZOSA 3ORZA 4RVLA 4YLLA 4BKZA 3VBYA 3IG7A 4AGWA 4FT3A 4BKYA 5HGIA 3F82A 4RWLA 4X21A 3PSDA 4KSPA 5JZJA 3ORNA 1ZXEA 4GYIA 5IA4A 3TXOA 3NNXA 3I4BA 4D4SA 3IOKA 4DE4A 2W1CA 4ASZA 5J5TA 4NSTA 3FL5A 3SOCA 1SYKA 4UMQA 2ZV9A 3PVWA 3QXPA 3PZEA 4HPTE 4ITJA 3IKAA 3DK6A 4S33A 5GHVA 4M0ZA 3G5DA 1UNLA 3R0TA 3L9PA 2QVSE 4WG3A 3FPQA 3GBZA 2R3PA 3NIEA 4O0UA 5IKWA 4QYFA 4QOXA 3FC2A 1ZMVA 2I7QA 3Q2JA 4LOQA 5EDQA 4MH7A 5KE0A 3NUAA 4AW5A 3WIKA 3C5UA 4AAAA 4CRLA 4Q2AA 3MBLA 3AMAA 4QQCA 4C02A 3AGMA 4LRMA 5DPVA 1YHVA 2W1GA 3KVXA 5E8ZA 4E6QA 2YWVA 3RM7A 2UW9A 3GCVA 3HKOA 4NJDA 4CTCA 4DA5A 5CEPA 3QCQA 5BYZA 5DEWA 3HLLA 4PQNA 3QYZA 2GU8A 3MDYA 4MYGA 2J0JA 4C36A 4RX8A 2WGJA 4FGBA 5D12A 2W5BA 3TV6A 2JD5A 3LXKA 1H8FA 5CS6A 1BKXA 1GY3A 5DRDA 5B7VA 4UXQA 4WD5A 3WYXA 4JNWA 5BPYA 3PLAE 2XKFA 4X6QC 3QQKA 4CD0A 5C8NA 2A0CX 4YJVA 3R8UA 3PJ2A 3LFSA 4JQEA 4DFZE 1H01A 3KRRA 4EBWA 2ESMA 4FNZA 4GVAA 2YM7A 3R9DA 2A27A 2EWAA 4ALVA 2JIUA 5L6PA 4B0GA 5A6NA 2IVTA 2OZOA 3F66A 4BKJA 2BRGA 4JQ7A 3HV4A 2XA4A 5EQEA 2PY3A 3PFQA 5FWKK 3NNUA 5HX8A 3RP9A 3ROYA 4HVIA 3PIXA 1GIIA 2FH9A 3CP9A 3F3TA 2IW9A 4M12A 3KC3A 2BVAA 4ANLA 2P2IA 4HZSA 3S0OA 3Q4ZA 4D2PA 4R5SA 4EH8A 2QO7A 3BPRA 4BTMA 5C4LA 3F88A 2GHLA 4G6LA 3QKLA 4IFGA 4IVAA 5C03A 3FZTA 3FHIA 3PRIA 2HIWA 3K2LA 5FBNC 4O22A 4ANQA 4QTEA 5AP0A 1Y8YA 4A7CA 2WXVA 4CG8A 3LFNA 2FSOX 2WQBA 5BUEA 4S31A 3SHEA 1KOBA 3UPZA 4I1ZA 3KN5A 5EYMA 2BZIB 2IVVA 4FG7A 2IG7A 3DTCA 2GTNA 4IC8A 1CKPA 3VUGA 1XBCA 2SRCA 4YNEA 5E7RA 5AX9A 3CSVA 1HCLA 3QWKA 4B99A 3I79A 4LYNA 2PZIA 2RKUA 3DBCA 2I0YA 2J0KA 3NEWA 1S9JA 1MRUA 2I40A 5J1WA 4BTJA 4ERWA 2WTWA 3EQRA 4FG9A 4U5JA 3WBLA 1Q5KA 3VULA 4FKJA 4A4XA 3A7GA 2CDZA 5JRSA 2CJMA 5KKRC 4MAOA 5JT2A 2QOKA 3BYUA 4FTCA 3ET7A 2HXQA 4EQMA 5EM8A 1KSWA 4IADA 4G2FA 4H3PA 4XEYA 2WMWA 4NK9A 4O7RA 2J51A 3LVPA 3OCTA 3BEGA 4ANBA 3ZSIA 4HGTA 3I7CA 4N70A 4HNFA 3TZ9A 5F4NA 4PPBA 4FT9A 3ZSHA 4EWQA 4AN3A 4X3JA 4BZNA 3RMFA 3Q2MA 2PMNX 4X7QA 4EC9A 4FR4A 2QO9A 5ETFA 2XNGA 5M07A 4AS0A 5KX8A 1U54B 3MB7A 1H28A 2IZSA 3EN9A 4JQ8A 5AAFA 5I0BA 4A07A 5HCYA 4BWPA 4BI1A 3TDVA 2VWBA 4UZDA 4KIKA 3RAIA 3U6JA 3W1FA 3CXWA 4BDFA 3CD8A 4YTIA 3ZH8A 3FKNA 2QU5A 2Y6MA 3SG8A 3PXKA 5DG5A 3W2RA 1J7IA 4OTDA 3TJDA 3RKBA 3NVKI 5ETCA 4YZDA 4OT6A 4GJ3A 1IG1A 2GPHA 3FYKX 4O1OA 4OR5A 3VS1A 5C26A 3MPAA 4G16A 4QQ5A 3ODYX 3QTUA 1YW2A 2GHMA 4H1JA 4FZDB 4Z3VA 4YSJA 5I9ZA 4R78A 3U54A 2R4BA 2C6DA 5LXMA 4AN9A 2VU3A 4RWKA 4YSMA 3TZMA 2UW7A 4JBPA 2CKPA 2GMXA 4XBUA 2UZNA 3C1XA 3RCJA 1YDSE 4FV6A 1UNHA 4EQUA 4F63A 5IMXA 4QPMA 3OT3A 3O8PA 4DH8A 4E5BA 5I5ZA 3NS9A 4O38A 3CGOA 3F3VA 4D2SA 4PPCA 4IWOA 4C3PA 4D0WA 3MGYA 5ANJA 3DAKA 4FTOA 3FDNA 4M97A 5EM5A 4ZY6A 4FT5A 4ANOA 1Q97A 4PP9A 4MKCA 4RIXA 5DR6A 4RIWB 3ZBXA 4WKQA 2ITNA 2Y7JA 4GU6A 4X2GA 3U8WA 2NNWB 2XIYA 4IMYA 4YBKA 4YBJA 4TWNA 3F5XA 4ZLOA 5FDPA 4JX7A 4EOMA 3BEAA 4JG8A 3F5GA 4FVPA 4OW8A 4PL5A 3TG1A 3R7IA 4RQKA 3TTIA 3KF4A 4PMPA 1YI6A 1IA9A 3RHKA 4WNPA 1FINA 2WAJA 4BDGA 4OTIA 3SW4A 2BRNA 4HCVA 4ZS0A 4BCOA 4PDPA 3VUDA 4XV1A 1OMWA 4O7ZA 2C3LA 2W1FA 1LUFA 4ZSAA 3R7YA 5JN2A 4DGOA 4YP8A 1STCE 2PPQA 4E26A 3DZQA 4USEA 3Q4UA 3VIDA 2VNYA 3KU2A 3EQFA 2C6EA 3DKFA 3UYTA 1Z5MA 3IDPA 1NVQA 4RVMA 4C57A 4MWIA 1FQ1B 1IRKA 3MFUA 4TY1A 1M52A 2RL5A 3OS3A 3PXYA 2ZV8A 2HAKA 3HZTA 4OTFA 4AP7A 3BV2A 5EFQA 4ZAUA 5B2LA 1H25A 2QURA 4V01A 4AOTA 3VUMA 4BBEA 5JFSA 1WBVA 2OIDA 5T6KA 5EQPA 3EN7A 5IDNA 2WTJA 1FPUA 3GFWA 4HJOA 5M51A 2UZWE 4NTSA 2XM9A 2Y4IC 2F4JA 4G9RA 3U51A 4F6UA 1GIHA 2ERZE 3P23A 5J9LA 4FYNA 3IS5A 3TWJA 3ZONA 3IW7A 4V0GA 3UGCA 1WMKA 1YI3A 2WQOA 2GHGA 4I21A 3SXRA 2V0DA 3I1AA 5AP2A 4O0RA 1OKZA 4FKRA 4BCMA 2WMUA 3QX2A 4IB0A 2G15A 3IGOA 3MPTA 2BPMA 3G9LX 1NW1A 1Q99A 2B1PA 2PZ5A 4Y95A 5F1ZA 1YKRA 2VNWA 3ALNA 4M66A 5GJGA 1UU7A 2VAGA 2X9FA 1K9AA 1GJOA 4TW9A 2CLXA 2YCQA 3RK9A 3SOAA 3V5QA 3O51A 4JDJA 2B9FA 4XG2A 3RAHA 4OAVB 2WPAA 3GCQA 3TKUA 5IG1A 3JUHA 2GQGA 3I6UA 3A2CA 4RIYB 5HD4A 4I6BA 3BIZA 4UALA 3O7LD 3MPMA 5IEVA 4AZWA 3MW1A 4FKSA 4TNDA 2P55A 2CNUA 2G01A 1JOWB 3QRUA 4C3FA 3UP7A 2EB3A 5DA3A 1NY3A 3I60A 1ZZ2A 3AC2A 3H4JA 4LV5A 2W1HA 2R3QA 4EK6A 4AX8A 2WIPA 4XLVA 2RIOA 1R1WA 2PSQA 3TNIA 3OZ6A 5JZNA 1QCFA 2VN9A 4F4PA 1Q3WA 4BBFA 4CFVA 5A4TA 3MN3A 5L6OA 4L7SA 2XKEA 3EFWA 2FSTX 1GAGA 1H27A 3QC4A 4PMSA 4RLLA 3SXSA 3W55A 3ZUVA 5EK7A 3SC1A 4FKIA 2QKWB 2GS7A 3QRTA 1ZYLA 1OECA 3C4CA 2QCSA 2Q0BA 4H05A 2HWPA 3ZCLA 2Y6OA 4J97A 4MXYA 4JS8A 5C1QB 3LFEA 4IAYA 4MHAA 4P4CA 4TZRA 4D55A 4GCJA 2BDWA 2F2UA 1XKKA 2I0HA 2I6LA 5LMKC 3COMA 3BHVA 2PU8A 2I1MA 2XK8A 4EOIA 1P2AA 4C2WA 4QP6A 1TQPA 3FY0A 1OBGA 2PK9A 4U0IA 3BBWA 2W1ZA 4K2RA 1NXKA 2UW0A 4BDIA 2XH5A 3OBJA 2GS6A 4TYHB 5TR6A 3KULA 1W8CA 3NR9A 2WHBA 2JBPA 1XH4A 4FV7A 2ACXA 3BLRA 5L8JA 2XJ1A 4L3PA 4QP2A 4J95A 5HIEA 4XV2A 4AOIA 2O5KA 5TKDA 5EKNA 3E8EA 4FUYA 4XMOA 3TM0A 3LOKA 3UJGA 3FLYA 2WQMA 3AT2A 5HLWA 3BHUA 2VWZA 4J96A 5CT7A 4RJ7A 1SNXA 3ULZA 4MX9A 4WBBB 4DFYA 4ORKA 3EQHA 2C5YA 4BCHA 3KF7A 4WNOA 3C4WA 1KWPA 5GIOE 3ZO2A 4BCPA 4EK3A 4KKHA 4YO4A 3DXPA 4BWXA 4FEUA 3L8XA 4FEQA 3HDMA 4JRNA 4XLIA 4ZZMA 3EFLA 3LE6A 4IAIA 4PDOA 5IQIA 1ZY4A 4EQCA 3I81A 3LMIA 3VQUA 3FXZA 2A2AA 5AV4A 3FWQA 4EL9A 4U41A 1UNGA 4EOJA 3KQ7A 2PVYA 3KB7A 5AMNA 4C2VA 3R7OA 5JFXA 1PJKA 4FV9A 1Y6AA 5A54A 2Z8CA 3DKGA 3TJCA 5AR2A 3UO6A 4LGHA 4EJ7A 4DH3A 2FYSA 1CDKA 1IR3A 3DK7A 3IO7A 1U46A 2BRMA 4KABA 1BMKA 4WNKA 2OKRA 2WTKC 4RQVA 4I22A 3ZC6A 4FKLA 3SRVA 4B4LA 3T8OA 4G5PA 4DFLA 4FK6A 4NM7A 4JT3A 3V5LA 5EG3A 3QKKA 2DYLA 4MK0A 3CPBA 2CGVA 1R39A 1OGUA 4RJ4A 2WD1A 2YERA 4QMVA 2HYYA 4H58A 3WE8A 4D2RA 2OIBA 5HO7A 5IH5A 3D2IA 3UIBA 3AT4A 4PTCA 4XOZA 1PRYA 2AUHA 5A4EA 2PZPA 3DS6A 4J52A 5FXRA 4KIOA 3C0HA 3KRXA 4PF4A 4AGDA 3F2RA 1BI7A 2PE2A 4OUCA 4XG9A 5HORA 1ZOHA 1OL5A 2VTQA 2PVMA 4GYGA 4CFNA 5BVFA 2PULA 2J0IA 3FXXA 4YJTA 2P3GX 2C5NA 1CM8A 4FEVA 5A14A 2HXLA 3TKIA 5KNJA 5CAQA 5DHJA 1OL2A 1VEBA 3FBVA 4Z9LA 3RPRA 3TUBA 2OK1A 5IUIA 2FB8A 2J4ZA 2Y4PA 5HE2A 3FE3A 3ZUTA 3VHKA 3ZUUA 2GNJA 2WQNA 4RJ5A 3UO4A 2FA2A 3R22A 2YM8A 1YHSA 4AZTA
chains in the Genus database with same CATH superfamily
3FSFA 4B9DA 2C30A 3DLZA 3TNWA 3ZM9A 2YCRA 4QMTA 1MQBA 4ZXTA 1XHAA 4BWKA 5H8GA 4AWIA 2C0OA 3AC8A 3CGFA 4FK3A 5I3OA 3PXQA 3ZYAA 1YQJA 3ZDUA 5JFVA 3TL8A 2X2LA 3CIKA 3BYMA 3FMJA 4FIEA 4L67A 2BZHB 2HOGA 4I20A 4BR3A 4XG6A 5M09A 3FLQA 4ACMA 2OH0E 1REJA 4AZFA 5CAPA 4QTCA 5HTIA 2F7ZE 3QTZA 2W1EA 3UC4A 2YHVA 3W2PA 1IEPA 2XKCA 5FM3A 2CSNA 5HKMA 1E9HA 4F70A 5KMKA 5C27A 2VX3A 2PZRA 5IZFA 4Y8DA 1FVTA 3HVCA 3QHRA 4EH2A 3SW7A 2UVXA 1Q8UA 3H3CA 3G9NA 4IHPA 4IWQA 1VJYA 4ANMA 2C68A 3V04A 4UB7A 3UE4A 5CANA 3LKMA 1LP4A 4FZ6A 5AV2A 4O7NA 5HO6A 4I6QA 3RI1A 2XUUA 2XYNA 4F9WA 3A7HA 1UU8A 4CTBA 3ITZA 3V5PA 4AA5A 4XH6A 3EN5A 5I3RA 4BGQA 4QMXA 1W2CA 4IANA 3DNDA 5C4KA 3KXGA 3OROA 1MUOA 1V1KA 5KMMA 3OY1A 3L9LA 4FJVA 4GT3A 3G6HA 4IM2A 3BE9A 4EOKA 4ZLYA 3EH9A 5CY3A 4K33A 4R7HA 1KE5A 4F7LA 3O17A 3B8RA 4K0YA 5TO8A 3G2FA 3HX4A 4H36A 4FNWA 4EYJA 4HVHA 5AP5A 1M7QA 5H3QA 5L4QA 3F69A 4UX9A 4X3FA 1W84A 3PY0A 2EU9A 2P2HA 5DN3A 2RFEA 3BGQA 4BDCA 1UVRA 4IM3A 4PMTA 1YOJA 4FV0A 3ZLSA 3FAAA 5HU9A 2X7OA 2H34A 4MNEA 4BHNA 3QQJA 4BTKA 3DZOA 1OITA 2A1AB 3GC0A 4YHFA 2YIRA 2XBJA 3MIYA 5CNOA 1WVWA 3ULIA 2XK7A 3F5UA 1ZY5A 5HG8A 4JR7A 4PPAA 4U97A 4AE9A 3ERKA 3ML1A 2VTAA 3TIYA 4A9UA 4L3LA 1JSTA 4QYYA 1RQQA 4EK8A 4BCQA 3D0EA 5CI6A 3WILA 4K77A 4LMUA 2YZAA 4UBAA 3D83A 2YEXA 1YHWA 5ANGA 2YM4A 5JH6A 3BBTB 2CHLA 2J5FA 3JYAA 3PXFA 2PHKA 3QUEA 4HGLA 2OJIA 5EH0A 5IPJA 3L9NA 2W1IA 4QDVA 3VVHA 3L8SA 3QRJA 4BCIA 3EL7A 3PG1A 2R3OA 3OEFX 5IF1A 1IAHA 5A9UA 3NRMA 2XKDA 3PJ8A 2VGOA 3U9NA 2ITQA 4BZDA 4C4EA 4DG0E 2PYWA 5BV3A 2F57A 2OH4A 3FKLA 5L6WL 3KXZA 5LOHA 5ANIA 3ZO4A 5EKOA 3RHXA 2JBOA 4XYFA 2R3GA 5K0XA 4FTLA 3OY3A 3PA5A 2X4ZA 4LOOA 4NM5A 3CTJA 4QMWA 2UUEA 5IH4A 3VJOA 2J5EA 5CENA 4CZUA 4EHZA 4D2TA 1IASA 3DQWA 4L44A 5DR2A 4QTBA 4R1YA 3ORPA 3PY1A 4GEOA 2ZDUA 2WNTA 4IX6A 2WOUA 3NUSA 3P4KA 4FV8A 3RPYA 4ZTHA 2WTCA 5HICA 2FUMA 3T3VA 4UMRA 2Y0AA 2C6MA 1W7HA 2YITA 3BGPA 3BWJA 3H9OA 3Q9WA 4JAJA 4K18A 3OTUA 3E3BX 2OXYA 4FE2A 2A98A 3W0RA 3EQIA 1E1XA 2JC6A 1J1BA 3F3UA 3MH2A 3MFRA 4IAZA 1WCCA 2W4JA 2OICA 3V3VA 4MTAA 3KA0A 1G3NA 5DEYA 4C59A 4F1TA 5GZ8A 1OPKA 3UG2A 1CSNA 4P7EA 5CT0A 5EHLA 2C47A 4HVSA 3VHEA 3PA3A 3QHWA 4I93A 4ITHA 5HQ0A 1BX6A 4W8DA 3ZEPA 1PMUA 2X6DA 4F9YA 4O0SA 4YC8A 5LVNA 4DEBA 3BL7A 4AZSA 3HNGA 4UWYA 4W9WA 2VTMA 3KN6A 4I5CA 4IQ6A 4OGRA 4YPSA 2J0LA 4L42A 3RVGA 4L52A 3VUHA 3DT1A 3OW3A 3N4TA 4FSWA 5HE3A 3SQQA 2AEGA 5GINE 3K54A 5CZIA 4U9AA 3ZDIA 2W1DA 2CNQA 3EL8A 3ZM4A 1NT2A 2R3JA 3RCDA 4EHEA 2OXDA 1J1CA 5KKRB 2PE1A 4FTNA 5AUTA 1ZRZA 4AUAA 5F9EA 3GCSA 3OP5A 5AX3A 3UVPA 3QQFA 5ICPA 2HY81 2YLFA 3MWUA 2QOIA 3ODZX 1JSUA 3EN4A 4IDVA 5AJQA 3UMWA 4QEBA 3W0OA 1YXTA 1VYZA 3BWFA 2Z7SA 3O8UA 4BN1A 4UXLA 4YR8A 4ZLZA 4O4BB 3AC3A 3UNZA 3UODA 5HX6A 2XANA 2QNJA 5DRBA 2XP2A 1SVEA 3PIYA 2UZBA 5HCXA 4M8TA 4L6QA 2R0IA 4JIAA 4M69B 1YI4A 4AW0A 1LPUA 1H08A 1OIRA 5E8TA 4EH7A 3Q9YA 4KS8A 1SM2A 1JNKA 4C58A 1PF8A 5LVLA 4RC4A 3IW4A 5FXQA 5K9IA 3CSVA 3OC1A 3FXWA 4YJRA 2GS2A 3KK8A 4CMUA 3DBQA 4II5A 5ANDA 2X2MA 4J98A 4XRJA 2WZJA 1W83A 2JITA 3UQGA 2XK9A 3BU3A 3TUDA 5BYLA 3R9NA 3MH3A 4HYIA 3W8LA 5HOAA 3D94A 4B8MA 1FVRA 3UQCA 4ENYA 2YWPA 3CKWA 4I5HA 3EOCA 4F6SA 3VF9A 4QP7A 3CY3A 3H9RA 2JIIA 2NRYA 3BU6A 4RPVA 4CFXA 2VWIA 3JPVA 4D9UA 1SNUA 2KTYA 2OJJA 4ZOGA 4BHZA 4AT4A 3HV7A 3A62A 4EOOA 3H10A 1OBDA 5I9XA 3W18A 5HBJA 1Y6BA 5HG5A 4AF3A 2BDFA 5H8BA 1QL6A 3PP0A 4FGRA 2R7BA 4P2KA 3TT0A 3F2NA 5CSXA 3R1NA 4DLIA 3ID6C 3CKXA 2O65A 3GU6A 5CVFA 4CMOA 4U42A 4KKEA 2UZVA 5AFVA 3RNYA 4O0YA 3FI2A 5FD2A 1DI9A 3FY2A 4AGUA 4RX5A 1XH7A 2QHNA 3EFJA 5KBQA 1CKIA 5M44A 3VC4A 1YWVA 2J50A 2IVUA 4ID7A 4QMSA 3P7AA 4X6RA 2WU6A 4PL3A 4CRSA 4YZ9A 4DT8A 4FG8A 4ZJVA 4BI2A 3O2MA 5B2KA 3CTHA 3IW8A 1OPLA 5FLFA 3QTRA 4FT0A 4AXFA 1TVOA 3MSSA 5FRIA 3FLSA 3EJ1A 5HTBA 4H3QA 4QQJA 2UVZA 4EH6A 4FVQA 5DR9A 3DXQA 5CAUA 3RPOA 3CY2A 3KXNA 3PJ1A 3W0MA 3DA6A 3F5PA 2JDVA 4QMQA 1ZARA 2HW7A 5JEBA 4R3RA 4AW2A 4EZ5A 4CKJA 4HPUE 4IM0A 2DQ7X 5DBXA 4E4NA 2R3RA 3QL8A 3NUNA 3TYKA 1Y91A 3QRKA 4KB8A 5F95A 2QONA 3UNKA 5K3YA 1KE9A 4C3RA 5HG9A 2OI4X 4QTAA 1OIYA 4YU2A 3U6IA 3D5XA 2OZAA 2ZYBA 3LFQA 4TYJA 4NWMA 4FOCA 1MRYA 4YJOA 2XB7A 4XCUA 3HA6A 4NIFA 5AV0A 3PSCA 4FTTA 3FLNC 4EC8A 1H0WA 2A4LA 2Y4IB 4TYGA 5FM2A 5AV1A 2O0UA 1R0EA 4QMMA 5E1SA 3HP5A 3PTGA 3E62A 2PE0A 3QBNA 4YPDA 3T9IA 2R7IA 3HMOA 3UG1A 4EH9A 4ERKA 3ELJA 1QMZA 4NW5A 4JR3A 3U9CA 2J9MA 3RGFA 1B38A 2CPKE 2XZSA 4A4LA 3QD4A 1YOMA 2C6TA 5HG7A 4ACGA 4IH8A 4C61A 4C62A 2R3NA 4EBVA 2BMCA 5LCJA 1G8SA 4C4FA 3L8VA 4ZTSA 3HMNA 3BCEA 2G2IA 4RSSA 3SD0A 3R71A 2IW6A 1JVPP 4U80A 3NUYA 3DTWA 3PXZA 5FGKA 2HZIA 2O8YA 3CPCA 5LVOA 4ZMFA 4Q9SA 4M84A 3EMGA 3LQ8A 4DTKA 5M57A 2EXCX 3W8QA 3HP2A 2PVNA 4KRCA 4WRGA 1BUHA 1FOTA 2VV9A 1Q8ZA 3F6XA 3PWDA 3SVVA 3CEKA 3LCSA 4X2NA 4AE6A 4UYAA 4CFWA 4MD7E 5IUGA 4FTQA 5M4CA 4MXOA 5CEMA 3QAME 2C4GA 2BROA 3QCYA 4O6EA 4U3ZA 2C5XA 3UTOA 4Z7GA 4IVDA 4DFXE 3QD2B 4IW0A 1BYGA 4FL3A 4YNOA 2PMLX 4ZTLA 5D7VA 1GNGA 1AD5A 2X8IA 3QQHA 4GUBA 3V8SA 3NNWA 2H9VA 3A60A 3E7OA 2QQ7A 4QMYA 5FEDA 3VAPA 4BDJA 1A06A 4XG4A 4CVAA 3GCPA 1CTPE 3D9VA 1ZWSA 3AOXA 3KRJA 4QMNA 2X2KA 4MBLA 1ST0A 4D1XA 4FUXA 1I09A 2XJ2A 5EYCA 2V55A 3ZRKA 5KMNA 5EHYA 3TMOA 4DEGA 4GVJA 4IC7A 2C3JA 4JI9A 5BX0A 3UVRA 1M17A 4E4LA 3IGGA 4ZMEA 4WUNA 1CKJA 1WBPA 2UZUE 4QO9A 3WOWA 2XJ0A 4BCGA 1KE6A 2BTRA 2NO3A 4UWBA 4W8EA 1WBWA 4MXAA 1OZ1A 4CKRA 3UOKA 1OPJA 3S4QA 2H6DA 3HEGA 4L53A 2QOHA 4FSUA 4YO6A 3FSKA 3QTIA 4A9TA 1KV2A 3RPSA 4GIIA 3R73A 1H0VA 2R5TA 5IEXA 2FVDA 3HRCA 4JBQA 2XVDA 3I6WA 4L00A 3BYSA 3D5WA 4E5AX 5BQ0A 5JK3A 2C0TA 3KXMA 4GK4A 4JBOA 2XCHA 3QXOA 5IQEA 1APME 1Q8YA 2ITYA 3FV8A 3CS9A 4Z16A 4OTGA 2WOTA 3R21A 3O0GA 4M13A 3LQ5A 1Q24A 5HNIX 4YTHA 1WZYA 4AZVA 3LMHA 5E8UA 2XIKA 5CU2A 5AR8A 1M2RA 3D5VA 2HELA 3A99A 4Y73A 2UZDA 4D4YA 2BRHA 5L2TA 3KIOC 3TEIA 3W2OA 5EI6A 2DS1A 2WMSA 1CMKE 3NIZA 4M7IA 2QOFA 2WKMA 3R1QA 4TRLA 2WB8A 2W7XA 2BAJA 4YJPA 5HD7A 3UNJA 2XMYA 3WF9A 3D7TB 5JRQA 2VRXA 4L7FA 1REKA 3W16A 3R7VA 3A4PA 3P78A 4IFCA 4WIHA 5H2UA 3Q52A 4O6LA 5LMBA 2R0UA 5CVGA 1ZOGA 2W0JA 3FYJX 3GB2A 4QT1A 4CQGA 4IZ5A 3AT3A 3UZTA 5DH3A 4CXAA 4LM5A 5EI2A 1DI8A 3IW5A 3R2BA 2BAKA 2WTKB 5AUXA 2C3IB 5M4UA 4FKUA 2X7FA 4KIQA 5JMSA 2ONLA 2Q0NA 2J2IB 3E3PA 4IZ7A 4ARKA 4BGHA 2W06A 3GENA 1M2PA 4BF2A 2QHMA 1OB3A 2B4SB 4O4EA 4GIHA 5LWNA 4G9CA 2WMBA 3LHJA 4OBQA 4YJSA 3WZDA 4FBXA 4X3FC 1TQIA 3R6XA 3P08A 5DOSA 3RBWA 2UW6A 4BCJA 3W2QA 1GZOA 4I0RA 3UBDA 5I9YA 4EORA 4XX9A 1Z9XA 2VX1A 4IZYA 3EIDA 3U4UA 5AADA 4RT7A 4L01A 4ZSGA 3R7UA 3SV0A 5BUIA 2VTJA 2R3LA 4GL9A 3FPMA 1JWHA 3DB8A 2UZOA 3B2TA 3GUBA 1ATPE 4QYGA 3OTVA 1UKIA 2Z2WA 4ZTRA 4DBNA 3I5ZA 5J7BA 3VO3A 3V51A 3EYGA 3G51A 3VS4A 3QQGA 3RJCA 4FKGA 4DEEA 2YISA 5J7HA 2VWWA 4FKVA 1ZOEA 2BAQA 3ZRMA 3QTXA 3VWAA 4YUQA 3RZFA 2NRUA 4ZTMA 3Q32A 1R3CA 5LVMA 4GKIA 4YGAA 4YZMA 5CU0A 3E7VA 3JS2A 3VUIA 4HW7A 4FSMA 4HYUA 3C4ZA 4UY9A 4G31A 3T9TA 2J0MB 5AR4A 3SG9A 1QPJA 3AQVA 4GSBA 2GQSA 2F7XE 3QFVA 3I0QA 4QYEA 4CNHA 5IA2A 3R7GA 1SVGA 4G34A 5KMOA 2X81A 4NTTA 2IN6A 5TT7A 4CCBA 4Y85A 3PUPA 3WZUA 4ASDA 1YRPA 4FZ7A 3UOHA 4CFMA 5KBRA 1OM1A 4RFZA 2CKQA 3LXLA 5IA1A 4E93A 3DDQA 3GT8A 4G3EA 2OU7A 3MVMA 3C4FA 3JY9A 4CG9A 2RFNA 4UN0C 4J8MA 3H0ZA 5CLPA 1L3RE 3DAEA 5C9CA 4WO5A 2AYPA 1R78A 4WA9A 1RW8A 5DI1A 2ITUA 1H4LA 2QOQA 3NCZA 1OKVA 1OIQA 4FI1A 5KO1A 2NPQA 5IA5A 2QLUA 4WHZA 3NMUF 3PPKA 4NCTA 2OJFE 2XM8A 3LXPA 5CAOA 5GIPE 2OIQA 2OJ9A 3LPBA 2UVYA 4QRCA 3POZA 4K11A 4USDA 3WF8A 2PVJA 2VUWA 4I23A 2JAMA 3FLWA 4LUDA 4IWDA 5AP3A 2QD9A 4O4DA 1H24A 3FZRA 3QCXA 5B0XA 4B6LA 4O0TA 4I94A 4YZCA 3C13A 4QQTA 5I9WA 4BYJA 4CEGA 4W4YA 4QTDA 1PYXA 1ZYCA 3E8NA 3NDMA 4G6OA 4CLJA 3P1AA 3WF6A 1UU9A 1U5RA 2VWXA 4PV0A 3R8VA 1B6CB 4PP7A 4DG3E 3MTFA 3JXWA 4H39A 4ZSEA 1WBSA 4KRDA 4GMYA 4F1MA 3E63A 4FODA 5IQFA 1KE8A 1LEZA 4RG0A 4DHIB 5AUYA 2XIRA 4XBRA 3NW6A 4X2JA 1U4DA 3LFCA 4U3YA 3ZU7A 2F9GA 1PY5A 3QGWA 1PXJA 4YHJA 5J8IA 5A6OA 4QPSA 3R8ZA 3WYYA 5T68A 4KIKB 1T45A 4ACCA 3M2WA 1JAMA 3FEGA 1IA8A 2Z7LA 5G6VA 4OT5A 2F49A 4RRVA 4CT2A 4E6DA 3TUCA 3DGKA 2PUNA 1I44A 3OOMA 3UZPA 3ZLYA 4FTRA 3G90X 3SX9A 4E4XA 4DTBA 4AFJA 3OG7A 4Y5QA 3RALA 3UDSA 4W9XA 3FMDA 5FG8A 4MXZA 4I41A 3WF7A 3FMLA 4APCA 3EQDA 5TOZA 3AXWA 5FDXA 3GC7A 3COIA 3HRBA 3Q4TA 3VNTA 2IW8A 3OUKA 2EXEA 3OWPA 3UZRA 4E6CA 1JKLA 3LM5A 3Q9XA 3DBEA 2XNBA 2QI8A 1WBNA 1RDQE 3WZEA 4CKIA 4AZEA 5D11A 2YLEA 2YABA 3AD5A 4FIGA 1OL6A 4EZ7A 4DTAA 5HO8A 2X9EA 5J9YA 5EDPA 3VN9A 4RIXB 4AAYA 4BB4A 2CLQA 2ZAZA 4WBOA 1PKDA 2IVSA 3A8XA 3IW6A 3NYNA 4IBMA 4RGJA 2C6IA 3FI4A 4YLJA 3DBFA 1J91A 3QTQA 4BYIA 3PUFC 3EWHA 5LMAA 2WMAA 2X39A 2Z7RA 3LLAA 4KAOA 2JIVA 3SAYA 3A4OX 3DNEA 4TYEA 1PHKA 5LJJA 3GFEA 4XP0A 2H96A 4FEXA 1E1VA 2W96B 4XP2A 3KMMA 4MVFA 4KA3A 3ORIA 4BBMA 4YTFA 3OXTA 3R02A 1YVJA 2XEZA 3UIXA 3R83A 4UYNA 5G1XA 3CE3A 5K4JA 2V5QA 4AQCA 4JRVA 2B0QA 3GCUA 4WRSA 2B7AA 2GQRA 5LQFA 1SZMA 3DV3A 2BCJA 5CNNA 1Q3DA 2JDTA 4NH1A 4FTIA 3R8MA 3KXXA 4EH3A 4EOQA 3VBVA 3QCSA 3EQGA 5BVEA 2XNEA 4Y5HA 5I9VA 2PL0A 4B7TA 1QPDA 4ENXA 2AC5A 4F7NA 3ZLWA 4BJJA 4IEBA 1H1RA 4U44A 3ALOA 3MB6A 2GNGA 1JKKA 4UZHA 3HMMA 1JKTA 4BI0A 3UO5A 5H9BA 4S30A 4R3PA 4EKKA 2QR8A 4V0GB 1U5QA 2E9PA 3TNQB 4EHGA 4Z7HA 1QPEA 2Y8OA 4QMPA 1M14A 4UV0A 3KY2A 4HZRA 4ANSA 4L45A 1PXNA 2F7EE 4MWHA 4R7IA 5D10A 3WARA 3GNIB 3QD3A 2B9HA 4AA0A 3NW7A 4C4IA 2WTDA 5M55A 4PTGA 2GDOA 5CF4A 5AIRA 3P5KA 4BDKA 2HZ4A 3DXNA 2BFYA 4E3CA 2R3MA 5HIBA 4C38A 5KZIA 4TWOA 5DT0A 3DQXA 1H26A 2GFCA 3NSZA 2GFSA 4FRFA 4GRBA 4M15A 5CSPA 5D41A 4O21A 3A8WA 4O1PA 5AA8A 2EB2A 4AG8A 4FIJA 4LG4A 3UDZA 4JBVA 4Y83A 5HIDA 5ANEA 2RGPA 4AACA 3P86A 4K8AA 4C4GA 5L8KA 4U81A 3BQRA 5HZNA 3PA4A 5EHOA 3QYWA 4RA4A 4D5KA 4IZAA 4A9RA 3NPCA 3A61A 4QMZA 4XRLA 3QA8A 4W4XA 4M67A 1PXOA 4RJ3A 1YWRA 5ACKA 4RX9A 3FZ1A 1YXSA 2VWYA 2XK3A 2XRUA 2FSMX 2YIQA 4FF8A 2VO3A 5GJFA 3G0FA 1O6YA 2X4FA 1F0QA 5FTGA 3VS7A 4I24A 2YJRA 4F78A 4EH5A 3Q6UA 1XBAA 3BU5A 4MF1A 4XOYA 4C34A 5IDPA 2Z60A 3D15A 3DBDA 4BCFA 4JAIA 4LFIA 4XUFA 1ZMWA 5JSMA 3V8TA 2BALA 4I4EA 3F7ZA 4C4JA 3PPZA 4FA2A 2VTOA 4ZZNA 4ANNA 3OT8A 2YACA 3OCBA 3S3IA 4U43A 2PVHA 4EKLA 3MFTA 2PVLA 3Q96A 4FIIA 4CV8A 4H3BA 2B54A 2HWOA 3NFGB 3FZOA 5DWRA 5E8VA 3OWKA 3R28A 4O7VA 3EB0A 3E93A 5E8WA 2ZV7A 3QZGA 3THBA 4E8AA 1PW2A 4YHTA 5IA0A 3ORTA 3TV7A 5ACBC 2PVFA 5J79A 4RFMA 2W4OA 3HDNA 4O7LA 4C0TA 5CSWA 1VZOA 4OTPA 3Q53A 3UQFA 1J7UA 4ZEGA 2YZLA 2VTHA 2PZYA 5HCZA 3W2CA 4KD1A 1XH8A 2B53A 4WG5A 4QYHA 5CF8A 1H1SA 4G1WA 5C8MA 2GNFA 4QMOA 4W4VA 3DJ5A 4O96A 4I0TA 4OTWA 3HMPA 2G1TA 3KMWA 4EWHA 4HGSA 3LW0A 2R3IA 2ZMDA 3EFKA 3MY1A 5AAGA 5HEZA 4DH1A 3DJ7A 4XJ0A 4C37A 2JKMA 4IAFA 2B9IA 4OTRA 1PXMA 3QTSA 1JLUE 4E20A 4UMUA 5K5XA 3QQLA 2O2UA 5IMEA 1WVYA 4R8QA 3HUBA 5A3XA 4UWCA 2UW8A 2JKKA 2YDJA 4EJNA 5M08A 1V0BA 3OXZA 4DN5A 1H00A 4F6WA 4IAAA 5E91A 4F9BA 2RSVA 3E92A 2V62A 3SRVB 3GU8A 1DAYA 1HCKA 4FSYA 4IXPA 4NFMA 3UPXA 2HW6A 5IISA 2ONLC 5IQCA 3ZSGA 1OUKA 3EZRA 1XR1A 1XMLA 2HK5A 3KFAA 4LI5A 3F9NA 5AUZA 3O7LB 3OFMA 1Y57A 5CI7A 1RE8A 5I9UA 4GK2A 4D2VA 4U79A 4QNYA 3A7FA 3LFFA 3TDWA 4UEUA 1KV1A 5L8LA 3SA0A 4DFUA 3IONA 4IACA 3H0YA 3HYHA 1YOLA 1R0PA 3NAXA 2BIYA 2IZRA 2PVRA 3GU4A 1U54A 5KUPA 4AXCA 4P90A 4F9CA 2WTIA 3PDTA 5IEYA 4BDHA 4YLKA 1XH5A 4CQEA 4GUEA 4LOPA 2OO8X 2QU6A 3E8CA 3HECA 3KCFA 2BKZA 1OIUA 1ZYSA 4F65A 2FSLX 1ST4A 2VTPA 2C6KA 4MBJA 3Q60A 3PE2A 4KIPA 1VR2A 3S2PA 4A9YA 4AQKA 4FSRA 3KL8A 1WVXA 2ZM3A 4CLIA 3C4EA 3GEQA 4CGAA 2NP8A 5AP4A 2YN8A 3PLSA 4IX4A 4G17A 3BLQA 2G2FA 5E8SA 4ZTQA 3ZO3A 3LCKA 4TL0A 4WOVA 1ZMUA 2WMTA 2E9NA 2G9XA 3KXHA 3F7WA 2NYAA 3POOA 3PXRA 1XH6A 3Q9ZA 1OL1A 3RK7A 3UC3A 2WMXA 2R64A 2XK4A 4DAWA 4KS7A 4KSQA 5ITAA 5CU3A 4Y46A 4F7JA 1Q8TA 4M14A 2VTNA 4FTJA 4LUEA 3GU5A 3MVLA 3QALE 4HCUA 5DFPA 1LEWA 4D58A 4NKAA 2OXXA 5JQ5A 5FUTA 4DYMA 5KMJA 2ETMA 3QX4A 2BZKB 3GC8A 4N6ZA 4TN6A 2ZOQA 4DEIA 3N4VA 4Y72A 4D1ZA 5D9HA 1PMEA 3BRBA 2WEIA 2C3KA 4O0VA 2I0EA 5JGBA 4MD8E 3WZKA 2X8DA 3WE4A 2AC3A 2X0GA 3QLGA 2YA9A 3L9MA 4RIWA 4ACHA 2OLCA 4AXDA 3NUUA 4BCKA 4RC2A 3BL9A 3ANRA 3K5VA 3DK3A 4KBKA 2H8HA 3DB6A 3HRFA 4GT5A 5CQWA 2C5OA 2JDRA 1XH9A 3VJNA 3Q5IA 3DKCA 4RZVA 4YZNA 5D1JA 5TE0A 1V0PA 4ASEA 4CZTA 3TCPA 3IK3A 2XNMA 4QNAA 1Q61A 5EYDA 2VTSA 4NCTC 4PRJA 3II5A 4OBOA 4IJ9A 4K6ZA 3IOPA 4PUZA 2R9SA 4TPTA 3SKCA 2W9ZB 2V7AA 3MFSA 3SDJA 4CFFA 2YAKA 3AMYA 3FC1X 4LL5A 3VONA 3BE2A 3I0OA 2YCFA 4QD6A 2ITTA 3I5NA 4WSQA 2B52A 1JPAA 3V6SA 4M3QA 5ANKA 4U8ZA 5DGZA 3QRIA 5JQ8A 3S95A 4GU9A 1J7LA 5BUJA 5ETIA 4X3FB 4I92A 4NKSA 4TKSA 4CMTA 3R8PA 3GP0A 1PMNA 1XWSA 2JGZA 4HNIA 1PXIA 1GZKA 2OBJA 2VTIA 3QZFA 4MNEB 3P79A 5EOLA 5BYYA 2P33A 3PJCA 3ACKA 2C1BA 4TNBA 4YJNA 3BHHA 1AGWA 2C5VA 1JBPE 3AC4A 3FLZA 4P5QA 2OFUA 5D7AA 4PL4A 4YMJA 3MV5A 1ZLTA 3MJ1A 4F08A 3NVMB 4G5JA 5HLPA 4QP8A 4BY9E 1JSVA 2HZNA 3KVWA 4LMNA 4KUJA 3OXIA 3ZFXA 2ITOA 3D14A 4DGGA 3LJ2A 3UOLA 4EONA 4K9YA 4F99A 2PUPA 3AC5A 5DLSA 1OGYA 1PXLA 3C50A 1V0OA 3ZRLA 1P4FA 3LQ3A 3B8QA 3MH0A 2ERKA 4IWPA 2PWLA 4WG4A 3V6RA 4O83A 3L8PA 3F3ZA 3M1SA 4I6FA 5GNKA 5FTQA 3LCDA 3NYVA 2ITPA 1K2PA 4FSNA 4MXCA 2VGPA 5CEOA 2YIYA 3GQIA 2CNVA 1JQHA 4AFEA 1BL7A 3VS6A 5A4CA 4RJ8A 4UMTA 2ZMCA 3FZPA 4RIYA 4F7SA 4FV4A 5E92A 1ND4A 3FMNA 3W32A 3NX8A 5AAEA 3LXNA 2IZUA 5BVDA 3IECA 3WF5A 1DAWA 1O6LA 4MD9E 5L3AA 3GQLA 2IZTA 4MNFA 3BQCA 1KOAA 3DPKA 3EQPA 3DAJA 4F64A 3CLYA 2WO6A 3BV3A 4IX5A 1FGKA 4BZOA 4FIHA 4FKPA 3NCGA 4ALWA 3UIMA 3KGAA 4I3ZA 4MEDA 4NYEA 4XNEA 2E9VA 4DEHA 2ZM1A 4O7TA 2VWVA 2BDJA 4N0SA 4GT4A 4BIDA 3UIUA 5CSVA 3U4WA 1WBOA 4EZ3A 1H07A 4BGGA 3ORXA 4NW6A 4C7TA 1A48A 5M4IA 1H1WA 1SVHA 4O2ZA 3RTPA 1URWA 3RWQA 2CCHA 2EUFB 2XK6A 4FV5A 5JKGA 2R3HA 1RJBA 4OAUC 4BL1A 3V8WA 1UU3A 3HL7A 5J1VA 4OTQA 5HI2A 2R3FA 3CTQA 4IB5A 3VQHA 4D2WA 3ENHA 2WFYA 1FVVA 3BYVA 4XHKB 3VW8A 2XALA 4O0WA 4MXXA 1XO2B 3PSBA 3BX5A 2CGUA 2YDIA 3C51A 4NFNA 3RPVA 5IUHA 2OJGA 2UV2A