4EI4A

Jak1 kinase (jh1 domain) in complex with compound 20
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
302
structure length
289
Chain Sequence
GDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKHIADLKKEIEILRNLYHENIVKYKGICTGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKETVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK1
publication title Discovery and optimization of C-2 methyl imidazopyrrolopyridines as potent and orally bioavailable JAK1 inhibitors with selectivity over JAK2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 84
structure length 289
sequence length 302
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ei4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ei4A01
3EQDA 3OXIA 3MPAA 4FL1A 4NEUA 2JAVA 3DTWA 5CNOA 3QD0A 3UTOA 5BMSA 4LGGA 2IO6A 2JLDA 3R63A 3L8VA 4O38A 4YJNA 4TWCA 2AUHA 3ELJA 3G6HA 3AOXA 3PA5A 4IZYA 4QD6A 3QZGA 3MH0A 1OZ1A 3OROA 4FTJA 3BGPA 1E1XA 4JOAA 1U54A 4CFXA 3IGGA 2IG7A 1AD5A 4NTSA 2QLUA 1XWSA 3NUNA 4G6LA 2PPQA 3VVHA 3ZUVA 1RW8A 3OD6X 5CZHA 2OJ9A 3ZXZA 3AMYA 3VS3A 4FV5A 3QCYA 4KINA 5IQGA 2JDTA 4KRDA 4FGRA 3C7QA 5B0XA 1ZOGA 4PDSA 2VTMA 4UYNA 3V5QA 1PXJA 3AC1A 2AYPA 2XNNA 1J3HA 3MTFA 2PZ5A 4PX6A 4BCFA 5I0BA 4UX9A 4XUFA 3TZ8A 5EHOA 4MD9E 2FO0A 4C38A 4ZTHA 3EZVA 2R7IA 2Z60A 3IOKA 2J0IA 4IVAA 2OU7A 4I94A 3TTJA 5BVDA 1ATPE 1PXOA 2JDOA 4O7TA 5EFQA 3OOGA 2CKQA 4G9RA 4I20A 5K4IA 1JKLA 1U54B 4IX6A 5JQ5A 2NO3A 5HG5A 3RPOA 4X3FA 1OBGA 1GZ8A 4RIWA 1PW2A 1URWA 3BEGA 4FG8A 1FMKA 4PF4A 2XIYA 4TWNA 5DBXA 4J71A 4WOVA 3MIYA 1WBTA 5EM7A 1WVYA 5AAEA 2VTQA 3GEQA 4P4CA 4YHJA 3KN6A 4XMOA 5BNJA 1XBCA 4CLJA 3BKBA 3PSDA 4O21A 3GI3A 2J0MB 1IEPA 1HCLA 2J0JA 3BE9A 3IW4A 4CKJA 2VWVA 4FV2A 3CJFA 5EM5A 3CTJA 5TR6A 4BHZA 3HUCA 2QHNA 4UY9A 4JBQA 4IC8A 3FMDA 4AN9A 4AZWA 4OBPA 1JQHA 3TNPC 4FGBA 4EUTA 4O86A 3R02A 5CX9A 4DT9A 5IG1A 2Z7LA 4NW6A 1OL2A 2X8DA 1Y6AA 2BUJA 2GNGA 3HUBA 2RFEA 5F94A 4V05A 2ITQA 3HAMA 3KB7A 4NT4A 4RG0A 4XNEA 3UODA 4RIWB 4GFGA 1WFCA 2WQBA 5HHWA 2E9OA 1ND4A 5EOLA 2PY3A 2ZJWA 4ITJA 4L46A 3PJ2A 4QP3A 4KS7A 1ZXEA 4MX9A 4RX9A 2W1DA 3KCFA 5EW3A 4B0GA 5J87A 3UDBA 5C01A 3VAPA 2YACA 2BALA 3O7LB 4NCTA 2X81A 4EK3A 3Q4TA 4FKIA 4CG9A 2ETRA 3CTQA 4BCHA 4Z7HA 2W4KA 3VUMA 5DNRA 4BCIA 5BVEA 4EOIA 3LM0A 3LIJA 5LWMA 3I81A 2ITXA 4E7WA 2UZEA 2ESMA 1H8FA 5IQBA 4M67A 3TIYA 3IGOA 4F99A 2PVHA 4Z55A 2GNLA 4IEBA 3LFEA 3HNGA 5AP2A 1V0BA 2QOFA 3GVUA 4Y5HA 3U6HA 5HOAA 2JDSA 3DAKA 2RKUA 1VYZA 2HOGA 2J90A 3WI6A 3IS5A 2YHVA 3G9LX 1H26A 3F69A 4I92A 4OT5A 2CKEA 3QRIA 2G2HA 3FJQE 4G2FA 5GJDA 4C2WA 4E4NA 1QPJA 2XK9A 3IW7A 4C7TA 2RGPA 3PA4A 4M69B 4BIBA 3WYYA 3R9NA 4EKKA 5I3OA 4BTKA 1F3MC 4G3CA 1Q4LA 3GT8A 3QQJA 4F63A 4J99A 3CKXA 4XG8A 5AUUA 5CSHA 3Q9ZA 1P4FA 5M4FA 4WRSA 3FXZA 1Z57A 2QR7A 5AP6A 3N4VA 3W10A 3GCPA 3JPVA 4D4RA 4FSYA 2V5QA 2BRNA 4AGDA 4AW5A 4YPDA 5AUZA 4ANLA 3D5XA 5H8EA 2OFVA 3QZHA 2ERZE 2P2IA 3R9DA 4EJ7A 3PE2A 2RFSA 5DG5A 3UVRA 3UQCA 4MQ2A 5AV1A 5L6PA 4UMTA 4OTQA 2WNTA 5DGZA 3SXRA 3QTQA 4R8QA 4F09A 2R0UA 2BIKB 2W1IA 3GQIA 4GG5A 5LARA 3FXXA 1IR3A 4CZUA 1YXSA 3HLLA 4AFJA 2BHHA 3GU5A 4LUEA 2BFYA 5A4EA 3TV4A 5CU3A 2BRBA 5FDXA 3C4CA 2YM8A 3VC4A 4IVCA 5L4QA 4O0RA 4O82A 1P4OA 4IZ7A 4N70A 3DKFA 2BKZA 2GHGA 5EI6A 4CZYB 2PMOX 1GIIA 5K5XA 5HE2A 4GRBA 5KE0A 1FPUA 1Y57A 2A19B 3FZRA 4TYIA 4ACHA 3VBWA 4AQCA 2OBJA 4FT0A 4O0UA 5DT3A 1M2RA 1YXVA 4ZIMA 4O1PA 4GEOA 4QMXA 5ANJA 2YCFA 5FEQA 1MRUA 2P4IA 3UMWA 2R7BA 4G34A 4HPTE 4RWIA 4GKHA 4BZOA 4G3FA 1PMUA 3W2RA 3PPKA 3OCSA 5DR6A 3LFFA 5C4KA 3PPJA 5ETFA 4J52A 1PXMA 4IADA 5DIAA 3LFNA 2G2IA 4GT5A 4ONAA 4NTTA 4HVIA 3O96A 3RP9A 3V6SA 5CVFA 2Y6MA 3SXFA 3VUTA 3ZO2A 4A4LA 5A46A 5IUHA 2UZDA 1UNLA 2PL0A 3SKCA 3UOHA 2HCKA 2HXLA 1PKDA 5GZ9A 3V6RA 2IZTA 4ZSJA 4R5SA 3F3UA 4AGCA 5G1XA 5FXSA 2KTYA 4YBJA 1LP4A 4J1RA 3WZKA 4CT2A 1G3NA 4APPA 4RVMA 2JGZA 1UWHA 5AUVA 4EZ7A 3CPBA 2REIA 4BDBA 1IAHA 3R8VA 2BDFA 3TTIA 2GSFA 4YJSA 2XMYA 3UQFA 1Q8TA 3IDBA 4KUJA 2O0UA 3P0MA 2Z02A 3PXYA 5ANGA 4XV1A 2OKRA 3V01A 4FEQA 1M14A 2WTWA 4ASDA 5HE1A 4DA5A 5HX6A 3UG2A 4HCTA 3EQBA 5F9EA 1U5QA 2HAKA 3C1XA 4FZDB 4U44A 2XYNA 3V04A 1FQ1B 3OCTA 3O23A 2E9UA 2VV9A 3HGKA 3BU6A 4H3BA 5EDPA 3FC1X 5D41A 1FINA 2R3PA 4F4PA 3PE1A 3S1HA 1OKZA 4FSUA 1ZMWA 3FDNA 2OK1A 4DEGA 5J8IA 4KSPA 4IX4A 1OIYA 4B4LA 4DFNA 4FE2A 3NAYA 2H96A 4W8EA 4ZTLA 3PVUA 5CAOA 4F6UA 4R78A 3IW5A 4PWNA 3RNIA 3TT0A 1CTPE 3UNZA 4HNIA 4BIDA 1H0WA 5IEXA 3QL8A 4XLVA 3R21A 3D2IA 1H1QA 5ETCA 4EH5A 3LJ2A 2FB8A 3SXSA 3R83A 3LPBA 2R3OA 4DITA 1CKPA 5L6WL 3BZ3A 1J1CA 2PVJA 3C0IA 5AA8A 4L9IA 4NFNA 1ZYJA 3RAHA 1KE6A 3P79A 2W99B 5AMNA 2NPQA 1MRVA 1W84A 2O63A 3JS2A 1XH8A 2X2LA 4F9AA 4CXAA 3KULA 3MB6A 4DF3A 4FTRA 4JIAA 5BUEA 5J79A 1KV1A 2XP2A 4BWKA 4CNHA 4XG2A 1XH7A 1DI9A 3S3IA 4W4VA 4ZTRA 5I9VA 5AV3A 1KWPA 3G2FA 3TDWA 3FV8A 1WBSA 1M17A 2EUFB 1XR1A 3ZLWA 4M12A 4NKAA 3TJDA 3UIBA 4AA0A 3QA8A 4ZEGA 3OWLA 3UOLA 4MD7E 3EN6A 2B52A 3FPMA 3GU7A 2OO8X 2BIYA 3KXXA 1UNGA 4ZZOA 4EQMA 4BDCA 1CM8A 1HCKA 3MY0A 4GT4A 3RHXA 4HCVA 3ZO1A 3R8PA 1PHKA 3OT3A 4QP9A 3QTZA 4JBOA 4PL3A 1WBOA 2PVFA 3VUIA 4H36A 2GS6A 5HD4A 4UWCA 3PSBA 4EWQA 3UZTA 2VN9A 1JLUE 3FXWA 3DJ7A 3MYGA 5JFSA 3AT3A 4I5HA 4TYHA 3IG7A 4EK5A 3D5UA 4JBPA 2VUWA 3W55A 3E7OA 4J96A 4RZWA 5HE3A 4BDAA 4CMOA 1OECA 3FWQA 3PY3A 2CKPA 2B4SB 2C1AA 3PXRA 5HO7A 3KEXA 3NVMB 4IH8A 2VTNA 2JKKA 2Z8CA 4CMUA 4D2SA 3MDYA 4PTEA 4IMYA 3LFAA 5DLSA 4D1ZA 3BWJA 2E9NA 5J95A 3S00A 3QD3A 3QHRA 1NXKA 3PIZA 1GAGA 3C51A 2ITYA 4FV8A 3I5ZA 3WIGA 4LRJA 5DRDA 5EH0A 4FSTA 5T6KA 2FGIA 2HW7A 4PUZA 3ALOA 5CSWA 4AUAA 2ZYBA 4NWMA 1PMEA 2HENA 3ROCA 4BDHA 2YIYA 4FKQA 4RC2A 5HBHA 3WF5A 4DH3A 3UNKA 3UO5A 2QOLA 4FBXA 3ZONA 4BI0A 2CKOA 1Y8YA 5CQUA 2FA2A 1Q3WA 4XYFA 5HCYA 2VWZA 3VIDA 3VS5A 4DG0E 2GHLA 4LUDA 3QLGA 4YP8A 3F6XA 1JVPP 3QYZA 2XB7A 2UZNA 3RAWA 4RJ3A 2VX0A 3D15A 1YWVA 2PUNA 2QO9A 2OF2A 2YAKA 3FE3A 3HRCA 3FI2A 4FL2A 3NNWA 1B39A 3PG1A 3UPXA 1PRYA 4XP0A 2X6EA 4PPAA 4IB1A 4U43A 4FTUA 1AQ1A 4M68A 4FKOA 4R77A 2XJ2A 5CVHA 1XJDA 1IA8A 3OHTA 2XZSA 3CXWA 3OWKA 4L43A 4MXOA 2Y0AA 2I0YA 1H01A 2PVKA 4DBXA 3ZRKA 4AS0A 3WE4A 2YDIA 1W83A 4S33A 4RQKA 2XIXA 3NSZA 3QFVA 3LZBA 4BC6A 3UPZA 3C0HA 3DBFA 1YKRA 3KVXA 2X2KA 3OXZA 2CN8A 4JI9A 1Z9XA 4R7HA 3Q32A 4ASXA 5ITAA 4P5ZA 5F95A 3U87A 1VR2A 3UO6A 3H3CA 3IO7A 2A1AB 3O7LD 2YJSA 4C4IA 5EQPA 5TO8A 3BIZA 3BGQA 5H2UA 4F9YA 4BCOA 4O96A 3F3WA 3CE3A 3RAIA 3VW6A 4NFMA 2FSTX 3PLSA 4HJOA 4RIXA 5EHLA 1OPKA 3DAJA 4RQVA 1OBDA 1TKIA 3L9MA 3LQ3A 4JLCA 3AD6A 3GGFA 4YZMA 3S95A 3TNIA 3GQLA 3AGLA 3ORKA 4KKEA 5TE0A 1Y6BA 4GJ2A 4GIIA 1ZY5A 2B54A 3OP5A 3F82A 3TXOA 1OUKA 1P14A 1VJYA 2FSLX 3R00A 2XNMA 4CG8A 4XG3A 5AUTA 5HTCA 4YZDA 4ZJJA 1YXTA 2HW6A 3ERKA 1W8CA 2YIXA 4AW1A 3AMBA 3GFEA 1FGKA 1ZYCA 3D2KA 5HG9A 4XG7A 2JD5A 4PNKA 3FZOA 2GTNA 3GNIB 4QPSA 5ANOA 2B9JA 2C3JA 3F9NA 4YHTA 4EHVA 3QD4A 2VX1A 5AAGA 2W1ZA 2J6MA 3FZSA 4BZDA 3QCQA 4D2RA 4E73A 2WOTA 3JVSA 4FNWA 4O81A 2EVAA 3NRMA 4PDPA 5CEIA 4C36A 2XJ0A 3WOWA 4AW0A 1PXNA 2FYSA 4O2ZA 3LCKA 1H0VA 2YM5A 5HE0A 4G3EA 3ZDUA 5CEMA 4RVKA 4EUUA 1WBVA 3O8TA 4CFNA 4R3PA 3MFRA 2PVLA 5KKRB 3ITZA 4EHEA 4P5QA 4ANOA 4F9CA 3VN9A 4BWXA 2W96B 4Z9LA 1VZOA 3JUHA 4JG7A 4C3FA 5CAPA 2PZRA 4QP2A 3TKHA 4JBVA 5FM2A 2UW8A 2BZJA 4NL0A 1PMNA 4QMYA 2WQMA 4ZS4A 4KBKA 4N0SA 4NW5A 4ZY5A 4FV1A 2R3JA 2BDJA 5IA4A 3PWDA 3CCNA 5EW9A 3MA3A 3BHTA 4HGLA 3NVKI 3FKLA 5E91A 4Y46A 2W9ZB 3QTUA 5EKNA 3CD8A 1WZYA 5EM8A 4C4FA 2BRGA 4EOQA 4D1XA 4JAJA 4XCUA 3ODZX 2RFDA 5M57A 2VAGA 3CD3A 4ID7A 4E3CA 3EN4A 2XNPA 2VGPA 1H07A 5ANDA 5I9YA 4YTFA 3SG9A 4OBQA 3BYOA 3HMMA 3DZOA 2IZSA 4C4EA 4OAVB 4NZWB 3NNUA 2DUVA 3RZFA 3PIXA 4XOYA 1MQBA 2BZHB 5FWKK 3E62A 3FZPA 4FKRA 1UV5A 4FZ6A 4ALVA 5HEZA 3LQ5A 3I6WA 4FOBA 3RPVA 3FEGA 4BB4A 5JK3A 1S9IA 1GIJA 3COIA 2W17A 4U80A 3BU5A 2R3GA 5EDRA 3TACA 4OTDA 3ZH8A 4AG8A 5GZAA 3GB2A 1Q8ZA 3VNTA 3Q53A 5E1EA 5J5SA 4FG7A 4FT9A 5FBOA 2HY0A 2YERA 4C58A 2CMWA 3VHEA 3NW6A 3JVRA 2YIQA 3QQGA 3IPHA 2BPMA 3EN7A 3MI9A 3QQHA 2BRHA 2OXYA 4NYEA 4O7SA 4ZMFA 5M09A 3HX4A 2JBOA 3BBWA 3NX8A 4G9CA 2C5OA 4HVSA 2ITNA 3BX5A 5A3XA 3LXPA 5FXQA 3OZ6A 1J91A 3OWJA 3TZ7A 2Z7QA 1OVEA 5JSMA 4KD1A 4EOOA 4QMQA 3ZU7A 2QD9A 4N6ZA 3RMFA 4D5KA 4YGAA 4YU2A 4EK4A 3DK7A 2R2PA 3KF4A 3A7JA 4UBAA 5LMKC 4WNKA 4ZOGA 4DE4A 4R5YA 4IB3A 4CEGA 3DOGA 4DFBA 2PMNX 3LCDA 2H9VA 2WXVA 3MB7A 3PJ1A 3SRVA 3JY0A 3V5TA 1RE8A 2C6KA 2GHMA 4OT6A 3Q4CA 2W05A 4XRLA 2VWUA 3AXWA 1BLXA 2WTIA 4BDIA 3PRFA 3W2PA 4MXCA 1Q8YA 2WIHA 3BYVA 2B9FA 1K9AA 4NUSA 3TDVA 4EH2A 3NMUF 2V7AA 3RK7A 5IH6A 4U97A 5CXHA 3TUDA 3ETAA 3ORIA 1OL7A 4GU6A 4M0YA 5I3RA 2B55A 3R01A 4E93A 4PTGA 1F0QA 4K77A 4CFUA 3QX2A 4GMYA 5EDQA 2OH0E 4IWOA 3RCJA 3GOPA 4USEA 4RX5A 2GTMA 1GZNA 3UZPA 5K3YA 1TQMA 5J9LA 4EC8A 2XKEA 3CJGA 5DA3A 2UW4A 4A9SA 2W9FB 5IA0A 5AV0A 4ZJIA 4AFEA 4Q2AA 4FIEA 3ENMA 4Y72A 5BUJA 3VS2A 3GC8A 4FKGA 1ZMUA 3WBLA 4FKPA 3OW4A 3OWPA 3SRVB 2QG7A 3DLZA 4BCKA 2UW0A 4BKZA 3QQLA 1UU8A 3QRJA 5D1JA 1PJKA 4D28A 3N4UA 2XRUA 2OJJA 4DEAA 5GIOE 3ULIA 1U46A 3NZ0A 5M55A 4YBKA 3CPCA 1H1PA 3JXWA 2J2IB 4OGRA 2ZV8A 4C61A 3O50A 4D2TA 4Z3VA 1YOJA 5L8JA 4DAWA 1ZYDA 3A7IA 4WBBB 4Y85A 4U9AA 5ACBC 2V22A 3L8PA 1A48A 4BYJA 5HBJA 3FZ1A 3NUSA 5M08A 1CSNA 4IHPA 2YWPA 4LFIA 4C2VA 2YDKA 4MYGA 4E5BA 3M11A 5AR2A 1W7HA 3BHHA 5EG3A 3ZTXA 5IQDA 2X9EA 4C4GA 5I9XA 5KUPA 1T46A 4O0XA 4S30A 5CI7A 4ZTQA 5L8LA 3P08A 3AT4A 4X2GA 3SLSA 2CGXA 1MP8A 3WF9A 2VD5A 5FEDA 4PL4A 2IW6A 4KBAA 4YJPA 5CAVA 3P78A 3PA3A 2ZDTA 4QMNA 1IA9A 4LOPA 4U3ZA 5DI1A 2JIVA 3ORTA 4O7NA 5IA2A 4EYMA 4KIOA 5CF6A 4EH7A 4EBWA 1FGIA 3KXMA 3W8LA 3EFLA 1M52A 3RVGA 3W2OA 3VBYA 3KXHA 5HVJA 4EOSA 4F65A 4ZSEA 1KE8A 2C3IB 5E9EA 5I4NA 4UWYA 4I4EA 4FTTA 3NUYA 5A6NA 4QPMA 4CKRA 1SM2A 4YC3A 3PPZA 3UNJA 4JIKA 3WZDA 2YITA 2XF0A 3DQXA 4YNEA 3UP2A 4IAKA 5M51A 4WNOA 4U42A 5L2SA 1L3RE 4FSMA 5IEYA 3ODYX 3U4UA 4HNFA 4M84A 4PDOA 5CAUA 4QQJA 3ZBXA 2VO6A 4JR7A 1JNKA 4GYIA 3SVVA 3DU8A 2QHMA 2WEIA 3P9JA 4KABA 5KBQA 4U79A 4KIKA 5JFWA 4X2FA 3QTSA 1K3AA 2JBPA 3TKIA 1OPJA 5KNJA 3DB6A 3QRKA 5D11A 5IMXA 2W4OA 3H0ZA 5HLNA 2PMLX 3QTXA 3EZRA 1YRPA 1YVJA 3DKCA 2B0QA 3U8WA 3Q5ZA 4BTFA 1SVEA 5E8VA 3C9WA 2BAQA 2YLFA 3WF7A 4PQNA 4BHNA 4ERKA 2YCQA 2E9VA 4GFOA 2XKDA 4ARKA 1Y8GA 5DOSA 3E8NA 1ZRZA 4XP2A 2QU6A 2R3RA 1NA7A 3FY0A 3NAXA 3H9OA 3BCEA 4CFFA 5KMLA 1JKTA 3BYSA 3CGFA 4N4SA 2ITWA 3EL7A 3KK8A 4A7CA 3E8EA 4G1WA 4Q9SA 5AFVA 3LMIA 4I24A 5ANKA 2ITUA 3V8WA 3ORZA 3D83A 4R6VA 3O51A 3DKGA 4KIKB 4BN1A 2Y9QA 4D2PA 1STCE 3R73A 2I40A 3C13A 3KGAA 4BCGA 4AOJA 4QP1A 5L6OA 1LEWA 2WU6A 4QYEA 3DJ6A 1OM1A 2QOIA 3GUBA 3NUUA 4IM3A 3TKUA 4YSJA 2ONLC 3HECA 2A27A 3CTHA 3FLYA 3RM6A 3RJCA 3K5UA 3REPA 4DEIA 3RINA 3F7WA 3U9NA 3FY2A 2WGJA 3K5VA 3P5KA 4CD0A 4GK2A 1U4DA 4PP9A 2QNJA 4GW8A 5JRSA 4X3FB 2QURA 4G16A 2GS7A 5L3AA 2PU8A 3B8RA 5M4UA 3RWQA 1B6CB 1NW1A 4BWPA 4USDA 5I5ZA 5L2QA 3UE4A 2C6TA 4EH4A 4FUYA 2Y7JA 2PE2A 2C47A 3DBQA 3L9NA 5A4TA 1P5EA 2F2UA 3O8UA 2C1BA 3H0YA 3P7CA 4JDHA 2R3HA 4F6WA 4PPCA 5FXRA 3NYVA 1T45A 4P2KA 3UQGA 3A4OX 4W8DA 4GVAA 3SQQA 4YLJA 3PJ8A 4RZVA 1NVSA 3R6XA 3OXTA 3V5PA 4F0IA 2HYYA 3U6JA 1GIHA 2ITTA 4MXAA 4XBUA 2PUPA 1ZARA 3EYHA 1CDKA 4RWJA 4PL5A 3LMHA 2XBJA 3PSCA 2VGOA 3B2TA 2X1NA 3F5UA 3FLQA 3R71A 4ZXTA 3LLTA 4WHZA 2I7QA 2RIOA 4M13A 2R9SA 2ZVAA 1TQIA 2JC6A 2OH4A 4A06A 4AGUA 3NDMA 5CT7A 4A9RA 4CZTA 4BI2A 1JPAA 4M3QA 5TF9A 4CQEA 3A4PA 4AU8A 1J7UA 4AT4A 4UV0A 4E8AA 4JNWA 2YIWA 5AJQA 3ZRLA 2C6DA 4YC6A 5EOBA 4L3PA 5ETIA 3H10A 3PYYA 1PF8A 3I7CA 4L52A 2VO7A 2VO0A 2X9FA 3HRFA 4L45A 1K2PA 4RJ5A 5H9BA 3NCGA 3RGFA 4EH9A 2CGVA 2OZOA 4RVLA 4Y95A 3MY5A 4DG2E 2J7TA 3SV0A 5FTGA 4TNDA 3ZO3A 2CCIA 3MS9A 3S2PA 3NR9A 5KHXA 2WMBA 4FTOA 3RAKA 4AZVA 2IN6A 3DAEA 3R1QA 5AP1A 4FI1A 2YAAA 3IDCA 3HL7A 1XH5A 3MN3A 4HZSA 3OTVA 4IDVA 2GCDA 4X6RA 1KSWA 3AQVA 2BAJA 3M42A 4O22A 2YCSA 3PLAE 5AP3A 2WMVA 3KREA 2VO3A 4DT8A 5HIEA 1FBNA 2BFXA 4S2ZA 4H58A 3PZHA 4RVTA 3TV6A 2BKKA 3KFAA 2GNHA 2C3LA 5AM7A 4WG3A 3VBXA 4RGJA 5L2IA 2B53A 3UIUA 4WT6A 2ZV9A 5DRBA 4CTBA 4F0GA 4IAFA 4EH8A 4GS6A 4OTRA 2F57A 2HIWA 5JMSA 5CENA 5C4LA 1DAWA 4YZ9A 5AUYA 5EYMA 4GVJA 4I6QA 4S31A 3OUNB 3EH9A 2ETKA 5A4LA 4D4SA 2OLCA 2W5BA 4UZDA 1YDRE 2ZB0A 3WIKA 5BVKA 4ANMA 2WMWA 2HWPA 5JGBA 4G5PA 3IK3A 3QX4A 3UIXA 2XYUA 2WFYA 3LJ0A 3RNYA 3VBQA 2QI8A 5LQFA 3BQRA 4FSZA 4FTLA 5IZFA 3QTIA 4LQMA 4AGWA 2IVTA 1PMVA 1Q97A 3HRBA 4H3PA 4OTWA 4X2NA 3QC4A 3SW4A 3ZLYA 5B2LA 3EQGA 4FVQA 5E8TA 1BUHA 4AF3A 2EB2A 4LRKA 3II5A 5J5TA 4QMTA 5KMKA 3PG3A 3U9CA 1FOTA 4LYNA 4OTIA 3R28A 3UJGA 4PMMA 1H24A 4GL9A 3ZSHA 3U54A 2P55A 2BDWA 1JKSA 3FMJA 2IW8A 4YZBA 3FMNA 4O0TA 4FEXA 2UZBA 4ITIA 2Y4IB 3KL8A 4WNPA 1QPCA 1O6KA 1WVWA 2C3KA 1H1WA 3HA6A 5HIDA 3A2CA 4MCVA 2HZNA 1OKYA 1ZYLA 3DTCA 3TJCA 4W4WA 3ZUTA 4DGNA 2GS2A 2XUUA 1W0XC 2WTKB 5JN2A 1SYKA 5HLWA 4XLIA 2V62A 3C0GA 4XG4A 4Y5QA 1PXPA 2PUUA 2KULA 1GOLA 4IQ6A 3C4XA 4TWOA 2I6LA 3ANRA 3ZFXA 4ANNA 3ANQA 4A4OA 3IECA 3C5IA 4DGOA 4C37A 3A8WA 3FSKA 2QOHA 5KMMA 3HMNA 2XNGA 4RFYA 4A9UA 2EWAA 3ZRMA 3MVHA 3DBDA 4BCPA 4RFZA 1OITA 4MWIA 3QQUA 4XBRA 5FDPA 1UVRA 3D7ZA 3O8PA 4KIPA 3G0EA 1UNHA 3F66A 3VQUA 4QO9A 4IJPA 4B8LA 2F4JA 2PVYA 1WCCA 4I41A 2IZUA 3TI1A 3R8UA 2QO7A 4LV8A 2J51A 4DFXE 2QOKA 3CQEA 3R22A 5J7HA 4FIGA 3F2RA 4BBFA 2X6DA 3SA0A 3FMLA 3R7EA 2R3FA 3EYGA 2YZLA 3QUEA 2PWLA 4XH6A 4X21A 3QXPA 2F7XE 3NYOA 3LFSA 4FICA 5JT2A 2QVSE 3DLSA 3R9RA 5LVLA 5IKWA 2OWBA 2O2UA 4IWDA 3MVMA 3DT1A 3UP7A 4D1SA 2PYWA 4B9DA 4DFLA 4M66A 3OVVA 5DEYA 3P1AA 2YA9A 4G6OA 3EQFA 2ITOA 5FQDC 3PJCA 3E63A 4QT1A 4EBVA 1BX6A 3LFDA 1IRKA 2OFUA 4JR3A 1MRYA 3F5PA 3CGOA 4FYNA 3HP2A 3FLSA 4RWLA 4EKLA 3Q52A 2XIRA 5CEPA 4C35A 4K9YA 4ZLYA 2XVDA 3FSFA 3NYNA 3LHJA 1G8SA 5CANA 3U6IA 3AC3A 3TEIA 1LR4A 3FMMA 4RIOA 4BRXA 2XCHA 2ZM3A 4J7BA 4DH7A 4FIJA 4P90A 1QPEA 4DEEA 3OY3A 3KULB 3P23A 4UN0C 3POOA 5D9HA 4JDIA 3VRYA 4CYJA 2UZUE 4FV6A 4BVUA 3NIEA 3Q6WA 4WSYA 5E92A 3R9OA 3R1SA 5E8XA 4QMMA 2XKCA 4MF1A 4BGGA 3HZTA 3OS3A 3WARA 2C0TA 4JQEA 1XHAA 4PTCA 5HO6A 4ZLZA 1A9UA 3KC3A 2ZV2A 4FTMA 3OY1A 2XM8A 4KBCA 3CR0A 3F5GA 4U5JA 4YZNA 2YM4A 2IW9A 3QKLA 2NP8A 2W7XA 2XJ1A 3PTGA 1PKGA 2VTRA 3O17A 3ZO4A 3R04A 2UZOA 4J97A 1NT2A 2EXCX 3FUPA 3A7HA 3T9TA 4B8MA 2J0LA 4MBIA 5AR8A 4IAAA 5DMZA 4YTHA 2BVAA 4YJTA 3QBNA 4QMSA 3W1FA 5IQAA 2BZIB 2W5AA 2UVXA 3TWJA 3G0FA 4BKJA 4L42A 4BR3A 4FTAA 3U55A 1CKIA 3NUXA 4DHFA 2JKQA 4TYHB 4GFMA 3N51A 4NSTA 2WTVA 3LCSA 4HPUE 4TW9A 2ITVA 4J8NA 4WUAA 5AP4A 5IEVA 5FUTA 3SGCA 2OJFE 4EOPA 4FTIA 3FQSA 4GG7A 3OUKA 3QZFA 5BYLA 4FKLA 4N57A 5IQEA 2X7OA 2X4ZA 1R0PA 2CCHA 2OXXA 4V01A 4MHAA 3ACKA 4XV9A 3MV5A 1ZAOA 2VTSA 3EQPA 4XV2A 4DTKA 5EQEA 5G6VA 2VTIA 3L8XA 3RALA 5C26A 4OR5A 2BAKA 3CQWA 4IM2A 3QA0A 4KIQA 5E4HA 3UYSA 3OMVA 4C3RA 2YISA 4CV9A 4YJUA 5CTPA 2G2FA 3IOPA 3QQKA 3DB8A 2R3IA 4TZRA 2C6OA 4QQCA 2GQRA 5AAFA 4D0WA 5K5NA 3E8DA 4FEUA 1YHVA 1UU7A 5FD2A 2ZM4A 3H9FA 4CGAA 3FZTA 5BYYA 2OJIA 3BHYA 3ZYAA 2YDJA 1APME 1LPUA 5LVOA 5J7BA 3VS4A 4BTJA 3DXQA 3A61A 5JZNA 4B99A 3MFUA 1XH4A 4FL3A 4C3PA 2F7EE 1M7QA 4DTAA 4J8MA 4IWQA 1JOWB 3BYUA 3TV7A 2G15A 4OTFA 4O7LA 3E87A 2CPKE 3BPRA 2GPHA 3KXNA 4O6EA 2WMUA 4U40A 3DFCB 4J95A 3UC4A 1Z5MA 4XJ0A 3WF8A 2FUMA 5GINE 3KRRA 1Q61A 2I0VA 3ZC5A 5BVNA 4IM0A 3GCVA 4LL0A 5TKDA 4F0FA 4FTKA 2F49A 1XBAA 3MA6A 4XG6A 3TUBA 2PHKA 4F70A 5CASA 4K1BA 4I5MA 2PUIA 3L9PA 5TT7A 3R7UA 3HP5A 4XG9A 4QOXA 3O71A 4X2JA 3ORXA 5CS6A 5IH4A 5IQCA 1GZKA 4CCBA 3P7BA 4L6QA 4TNBA 2C5YA 2QOCA 2XK8A 3NS9A 4ZSGA 4BZNA 4GT3A 1PXLA 2IVUA 2XKFA 4O7YA 4JQ8A 3BV3A 3F2AA 4YJOA 4AX8A 5IQIA 5BPYA 5C03A 4YURA 4Q5EA 5JKGA 5ACKA 1OL5A 4MF0A 2OIDA 1ZOEA 4WG5A 5T3QA 4U41A 4CFWA 2R0IA 4PMSA 5EK7A 4PPBA 1XKKA 3AG9A 4DG3E 3AT2A 3M1SA 4I5CA 4KRCA 4WSQA 2AC5A 3R7OA 3UG1A 4QRCA 5LCJA 4CV8A 1Y91A 3HDNA 4G17A 5M4IA 2VWIA 3H9RA 3BWFA 2BTSA 3DDQA 4YSMA 1BL7A 3E64A 4DFUA 4RLKA 2EXEA 3FLNC 2GU8A 4RIXB 3RPSA 2JKMA 4RC3A 5DR2A 4EI4A 3EN5A 2WMTA 3R7GA 4M7IA 4FV4A 4MVFA 4XV3A 5ETAA 2WQEA 2QQ7A 4CFMA 3FBVA 3F3ZA 2VX3A 2RSVA 2ITPA 3PY1A 4L3JA 1X8BA 3KK9A 2GMXA 2R4BA 4QTBA 3QZIA 2JAMA 4HGTA 4I0SA 3MSSA 2Y8OA 3KQ7A 4II5A 4S32A 1OIUA 1YDSE 4D4VA 5JFXA 5IUIA 4E5WA 1BI7A 1Q24A 1SNXA 3O0GA 2UW9A 3QGWA 3UYTA 4MBLA 1R3CA 5EI8A 4ZTNA 2PULA 5M07A 3PVWA 4LI5A 2GDOA 3TUCA 5FTOA 4U6RA 1YWNA 1YOMA 2RFNA 3G33A 4R1VA 2RG6A 1SVHA 2UVYA 5LCKA 5C27A 5HCXA 4D0XA 3PY0A 3DCVA 3OC1A 1YHWA 4TTHB 5FBNC 4AOTA 5IDNA 4QP6A 4YZCA 5H8GA 2VRXA 4Y8DA 3QU0A 2JIUA 2P2HA 3EQHA 2XK3A 2P0CA 3COHA 1OKWA 1V0OA 1GNGA 3BHUA 2BR1A 4FC0A 4JXFA 4ZY6A 4CT1A 1XH9A 3SW7A 3EN9A 1UKIA 4UMPA 3D4QA 2H6DA 3ALNA 5EYKA 4QYFA 2ZB1A 4RLLA 3NEWA 2NRYA 2VNWA 2QKWB 3VF9A 4DEHA 5DPVA 2NRUA 3OF0A 3R2YA 4AN2A 2VZ6A 5GJFA 3C4EA 2JDVA 4JQ7A 4IX5A 5CYIA 4UEUA 5HX8A 3GFWA 3K2LA 1I44A 3R7VA 2PZPA 3MH1A 3P86A 5J9YA 5BQ0A 4HYSA 3PFQA 4AN3A 5KMOA 5M56A 3SDJA 3BGZA 3FHRA 3B2WA 3LW0A 4MD8E 2F9GA 2WTCA 5HI2A 3V3VA 3HMOA 1OL6A 4HCUA 4H1JA 3ORMA 2IVVA 4X3FC 2WAJA 3R9HA 3CKWA 4XX9A 2J50A 4Y73A 4I1ZA 1FVTA 3FL4A 3ZMMA 3G5DA 4QQTA 5CEKA 5AV2A 3Q4UA 3RPYA 2ZMDA 3CY3A 3DBEA 5AM6A 1YW2A 5IH5A 5M06A 2GNJA 4OLIA 3E7VA 3I79A 4XHKB 3I60A 2DQ7X 3I7BA 4O84A 4NK9A 2JFMA 4FR4A 4HVHA 3FHIA 3C4FA 4FNYA 4MBJA 4OBOA 1BKXA 5HLPA 1LUFA 3BRBA 4FG9A 4JL9A 1H1RA 2WZJA 4AT3A 3MY1A 1QCFA 3ZUUA 4FK3A 5AP7A 4ASZA 4FVPA 4F7LA 1EH4A 4JG8A 4BFMA 4NU1A 3OOMA 2X39A 4EOMA 4X6QC 4GUBA 3QTWA 3L8SA 4FKJA 5E7RA 4IWPA 4JVGA 4DCAA 2OIQA 3NLBA 4HVDA 4HVGA 4I5PA 5I9ZA 2Q0BA 4MQ1A 2B7AA 3A62A 2WB8A 5CY3A 3DXPA 2PVMA 3HV4A 4D55A 4EH6A 5EM6A 3O2MA 2ZAZA 5KHWA 3V51A 5BX0A 3Q3BA 3F61A 3GC7A 4APCA 4NCTC 1G8AA 2GFCA 4QNYA 4H39A 2UVZA 4EOKA 2ZDUA 4QMLA 3AD4A 2PTKA 3UC3A 1R39A 4IC7A 3KRWA 4CSVA 4ZAUA 5KCVA 2UZWE 4LL5A 4YPSA 5AUWA 3ULZA 5I9WA 1U5RA 4G5JA 4DGLC 5FGKA 1S9JA 3BELA 4FVRA 2W1EA 5CVGA 4A07A 2Y4PA 3UBDA 3E3PA 2R3LA 4RRVA 3VBVA 3QKMA 3MFTA 2Q0NA 3FMKA 3DKOA 4IVDA 4S34A 5A4QA 2JFLA 2W1FA 3F88A 4YC8A 4ACMA 2YWVA 2A2AA 3EJ1A 4YTIA 2A0CX 4DH8A 3DQWA 3ZSIA 3EHAA 4GH2A 5CF5A 2YABA 4IXPA 3E92A 3KKVA 4K33A 4V0GA 3QKKA 5AP5A 4EOJA 1BYGA 5AWMA 3S4QA 3ET7A 5LOHA 3LCTA 4ANSA 2C6IA 4WUNA 4CKIA 4ZLOA 4C4JA 1ZOHA 5FP5A 4DINA 4Z7GA 3LM5A 3DFAA 4K6ZA 2DS1A 3SOAA 4W9XA 3VS6A 3KMUA 3ZS5A 5HG8A 4MKCA 1YWRA 4E6DA 1NY3A 1SNUA 4GK3A 4WO5A 1WBPA 3V5JA 4FMQA 4RX8A 3RCDA 2UW6A 4JDJA 4K2RA 5HGIA 3K3JA 4C33A 1KE7A 1TQPA 3U51A 3UOKA 3NWWA 5LWNA 5JZJA 2WKMA 4HYHA 4FF8A 2BHEA 5D10A 4FKSA 3FPQA 4I0TA 4ITHA 4EH3A 1KE9A 4EQCA 3CP9A 3F2NA 3OEZA 4IDTA 3BQCA 4JAIA 5J1VA 1WMKA 3HV3A 4RBLA 3R8MA 3DBCA 3EKNA 4V0GB 2UZLA 5DWRA 3RK9A 4NJDA 4E6AA 1G5SA 3TNQB 1OL1A 5CU4A 4IZ5A 4GK4A 4BYIA 1NVRA 5HBEA 3RKBA 4F1TA 4B6LA 2O65A 2ETMA 2I0EA 3A8XA 3VJNA 2EU9A 4FT3A 4IJ9A 4OW8A 3VUHA 2C6EA 5AIRA 2PSQA 2WMQA 5FG8A 4DFYA 4ERWA 3AC5A 4UZHA 2JKOA 2PZIA 3DGKA 4YHFA 4ACGA 3V5WA 2Y4IC 5H3QA 4H1MA 3U4WA 4AE6A 2XA4A 2E9PA 2WELA 1PXIA 4YO4A 1B38A 4QYHA 4RC4A 4FX3A 2GNFA 3F7ZA 5JFVA 5HU3A 2X0GA 2IPXA 2WTKC 4ZS0A 5AR7A 4BCJA 3GC9A 3SX9A 4BDKA 5B2MA 3W2CA 3HEGA 4NM0A 3D9VA 4EC9A 4MNFA 2V0DA 3SOCA 3GU8A 4OTHA 4ZP5A 3EL8A 4ZZNA 4BBMA 3CLYA 3VUDA 3DY7A 4IACA 4YLLA 4BDGA 5CSVA 5E8SA 4KS8A 3TZMA 3OCGA 4D9TA 4ZTMA 4I3ZA 4QTDA 4NH1A 2DWBA 5LVMA 4FEVA 4QMWA 4CVAA 2FVDA 4FIFA 3THBA 2WQNA 4FTNA 2XK6A 4F1MA 4FIHA 5C9CA 5C8MA 4Q5HA 3N9XA 4GCJA 5BUIA 2W0JA 2QU5A 4V04A 5CWZA 3CBLA 3LXKA 4BBEA 3PVGA 1ZZ2A 1VEBA 3QALE 3QXOA 4JRNA 2VTHA 4JT3A 1J7IA 4TL0A 1DS5A 4FNXA 2UUEA 3VJOA 3V8SA 1ZY4A 4BGQA 2XIZA 3DK6A 3VHKA 4N6YA 3I1AA 4GIHA 3ZC6A 5HNBA 4XS2A 4CRLA 1UKHA 2GNIA 3ZM9A 4E4LA 4ZJVA 3D5VA 2VTOA 5ICPA 2PE1A 3I4BA 1W98A 4CQGA 2NNWB 4EONA 4FT5A 4QMPA 5K0XA 4U3YA 3H4JA 2Z2WA 1BL6A 4DLJA 2UW5A 2XIKA 3DA6A 4KKHA 2PZYA 4QPAA 3FQEA 3OG7A 4ALUA 1J7LA 4EZ3A 4O27B 3QQFA 1M2QA 4EK8A 4DLIA 4RJ4A 2X8EA 2OW3A 5LMKA 4DBNA 4EK6A 5KMNA 2XBAA 2HWOA 4MXZA 4C59A 3HA8A 4HOKA 1E9HA 4X2KA 4FK6A 2X8IA 3HKOA 5CQWA 5IMEA 3NNXA 5CLPA 3COKA 4CCUA 5CSXA 4USFA 4JJRA 1WVXA 5IUGA 2C30A 3MW1A 3QYWA 3R1YA 4FIIA 1REJA 2FH9A 3OTUA 5JEBA 3E8CA 2PVRA 4W4YA 3TNWA 4R1YA 4RT7A 4MXYA 4C57A 5AA9A 2WOUA 3FLWA 4I6BA 3MBLA 3QLFA 5DFPA 2B9IA 5B7VA 5CEOA 2YIRA 2CDZA 4TXCA 1GJOA 3RWPA 3JR1A 3OT8A 2PE0A 4M69A 5GJGA 3MPMA 5FEEA 5CALA 3OW3A 3R30A 3N4TA 1H08A 2X7GA 4X7QA 3E3BX 3ZXTA 4FSWA 4F1OA 3C4WA 4MNEA 4PRJA 4QMOA 5JGDA 4FV3A 2J9MA 3ZCLA 3DXNA 3OCBA 3RHKA 3RZBA 1WBNA 3MVJA 2SRCA 2Q83A 2XRWA 3OEFX 5JQ8A 4JX7A 4L7FA 4E5AX 4H05A 4ANQA 4RJ6A 4ENXA 3MESA 3NW5A 2FSMX 5IA5A 4H3QA 3ORPA 2YFXA 4P7EA 2WD1A 3ORNA 5FP6A 4L67A 4IAYA 1CMKE 3SHEA 1Q8UA 4KAOA 1OKVA 2J5EA 4BI1A 4CMTA 2HZ0A 4KSQA 3JY9A 2B9HA 3MVLA 4O7ZA 1ZMVA 3VO3A 2F2CB 4I93A 3WZUA 4PY1A 3FKOA 1H4LA 2A4LA 1OPLA 2C0OA 4QMZA 4W9WA 3DNEA 3IW8A 3FC2A 4WIHA 2QKRA 3D0EA 3Q96A 4IW0A 4GSBA 2R3MA 4MNEB 4PV0A 3DNDA 4O2PA 3W33A 4UMUA 4QNAA 3NUAA 4IB0A 4BDDA 3AGMA 5AX3A 3VS1A 4PDYA 3KRLA 3QF9A 2JIIA 1KOAA 3UO4A 3SC1A 3CC6A 3EMGA 4ENYA 5A4CA 5L8KA 4IANA 3OBJA 3TIZA 4YJVA 1CKJA 5LJJA 3BLHA 3TG1A 4F7NA 3W8QA 4TRLA 3UGCA 5GNKA 2YEXA 4FTCA 1RJBA 2XCKA 5EYDA 4FOCA 1R0EA 4XEYA 4LOOA 4OAUC 2QLQA 3KY2A 3LJ1A 1SVGA 3RTPA 3MGYA 2OIBA 3ZSGA 2BCJA 2WTJA 3GBZA 1L8TA 5D7AA 2CJMA 1UA2A 2C68A 3G15A 2WHBA 2VTAA 4UMQA 4FYOA 4XRJA 2J5FA 3Q2MA 4IAIA 4RFMA 3Q6UA 4MTAA 2PVNA 2XNOA 3FYKX 3HMIA 3KCKA 1URCA 4FV0A 4QYGA 3ZLSA 4BCNA 3BU3A 4MWHA 2RL5A 5T68A 4DEBA 4I6FA 3HV6A 4LMUA 4NKSA 5FRIA 1LEZA 4YTCA 5HIBA 2W06A 3V5LA 3AC8A 3I6UA 2HY81 2W5HA 3RPRA 5HTBA 5E90A 2G1TA 4IAZA 5DH3A 4ALWA 4RJ7A 1OGUA 2ITZA 3QUDA 4DH1A 3DS6A 5JRQA 5L2TA 3DV3A 5LVNA 4PMTA 1XH6A 2WMXA 2XNEA 1R78A 5E8ZA 5BVOA 3Q5IA 3QHWA 4HW7A 5DT4A 3ZHPC 3PZEA 4KKGA 3AC4A 3FL5A 2P33A 2R3QA 5K9IA 1ZZLA 3ZLXA 2O5KA 3NIZA 2RF9A 3TCPA 2ERKA 2UV2A 4FZFB 3VUKA 1QPDA 4A9TA 2CNUA 5CF4A 4D2WA 2XM9A 4MAOA 4QP4A 2UW3A 5AR4A 4FKTA 2YCRA 3PVBA 4QTCA 5EYCA 5AUXA 5K4JA 4M15A 3VW8A 1UU9A 3QRUA 3Q9WA 2JDRA 3HV5A 2OGVA 2XK4A 3LMGA 3QCXA 3FI8A 5KKRC 4QTEA 4ZSLA 4FUXA 3BBTB 4L01A 4MXXA 3VWAA 4NJ3A 3PP0A 2VU3A 2R64A 3IKAA 3EFWA 4RWKA 2PMIA 5A9UA 4LGHA 4O7VA 5AEPA 4E6CA 5A6OA 5A54A 5M4CA 2J0KA 4F9BA 3QAME 3L9LA 2CLXA 2ONLA 2VWWA 3OBGA 4U7ZA 3GCQA 5CI6A 4C02A 5IF1A 3D7TA 3BLQA 3DDPA 4HGEA 4O83A 3UVPA 3E93A 1P2AA 3KMWA 3TZ9A 1FVRA 5F4NA 4WRGA 4JRVA 5H8BA 4UALA 4UYAA 4FODA 5KZ0A 4L68A 3AMAA 3ORLA 4I22A 5KX8A 3GCSA 4NIFA 2WMRA 5HORA 4ACDA 1YI6A 4LG4A 4BKYA 3CIKA 4GV1A 4ZMEA 4FSQA 4F9WA 2GFSA 3FI4A 3NUPA 5IISA 3LE6A 4LOQA 5KZIA 4G6NA 3A7FA 3Q2JA 3GP0A 4RJ8A 4ZK5A 5A14A 4C0TA 5C8NA 2CGWA 5HO8A 1JAMA 5EHYA 4IBMA 4L00A 3BE2A 2O8YA 2I0HA 2YN8A 1SMHA 4QQ5A 4XP3A 1Q8WA 4LMNA 5BVWA 3EB0A 3VS7A 5HU9A 4D9UA 3QC9A 5KMJA 5D12A 5J1WA 3FAAA 3TN8A 3D7TB 3RM7A 3LXLA 3FI3A 2RG5A 4IFCA 3I0OA 4AZFA 4AZTA 4QTAA 2I1MA 1WBWA 4O1OA 3TL8A 3W16A 1SZMA 2V55A 5DYJA 4TYEA 3T8OA 4ZY4A 2C69A 3KN5A 2R5TA 4NIFB 3Q9YA 4CTCA 1E1VA 5FTQA 5GIPE 3NCZA 4OTGA 5CU2A 4UXQA 1Q41A 2YZAA 2HZIA 2OJGA 5C8KA 5GHVA 1XO2B 4BDEA 3FQHA 1JSTA 3EFKA 4RPVA 2VTTA 3MWUA 2O64A 5TOZA 5CU0A 2C0IA 4GUEA 3CSVA 3PXZA 3W18A 4ZSAA 2X7FA 4E4XA 4EQUA 5CT0A 5AADA 4A9YA 4I6HA 2LGCA 3FLZA 5M44A 1IAJA 5D7VA 4L53A 3BV2A 4YUQA 1YDTE 4L44A 3A7GA 1JSVA 3ZM4A 1DAYA 4U81A 2Z7SA 3PIYA 3LVPA 2IVSA 3PXFA 4QP8A 3ATSA 5IQHA 4HZRA 4J53A 4U45A 3V8TA 1XQZA 2XNBA 3CQUA 3PP1A 1REKA 2QOQA 4TY1A 4ZZMA 1Q3DA 4C62A 3NGAA 4PMPA 2OG8A 4E20A 5CF8A 1OMWA 5FM3A 3LLAA 1H25A 2ACXA 2HZ4A 4FKUA 3GU6A 2C5NA 4M0ZA 4I23A 5KMIA 4AW2A 4YJQA 3MFSA 3T3VA 4E4MA 2YM6A 1IG1A 1MQ4A 1H00A 4MK0A 5DR9A 5EI2A 3P7AA 4W4XA 5HVKA 2HXQA 4AZEA 2CN5A 3EIDA 3LFQA 4M14A 4FSNA 5AX9A 1BI8A 3R8LA 3WF6A 3ZOSA 5BYZA 4WBOA 2C5VA 5LMAA 4EORA 4RIYA 5KBRA 2W1HA 4L3LA 5EKOA 3Q04A 1MUOA 1V0PA 3VRZA 5DVRA 3MPTA 4G3DA 4WNMA 4BCQA 4O6LA 1I09A 4O0YA 3SG8A 3AD5A 4DC2A 4O7WA 1QMZA 5DN3A 3AC2A 2VWBA 3PUPA 3LFBA 4D58A 3S0OA 1JWHA 4GU9A 1OIRA 3POZA 2VNYA 3MJ1A 2QO2A 2EB3A 3VS0A 4FT7A 4IB5A 1JKKA 2XH5A 5FLFA 3T9IA 2R3NA 3MJ2A 3F5XA 2OF4A 4BY9E 4PNIA 4FSRA 4K18A 5J9ZA 4RSSA 4FTQA 3UOJA 1VYWA 4UXLA 4AA5A 1W82A 2PK9A 3KU2A 2VWXA 5HTIA 5E8YA 3ZEPA 4RIYB 3EQIA 4AP7A 3VF8A 4EYJA 4Q9ZA 4UB7A 3A99A 5E8UA 3QCSA 2P3GX 1TVOA 3F3VA 2HELA 3Q4ZA 5I9UA 2CGUA 2WMSA 1YXXA 2UZTA 1OI9A 2WQOA 4I21A 4TWPA 3IQ7A 4RMZA 4YLKA 3QUPA 2X4FA 3BEAA 5B2KA 4YJRA 1JSUA 5IDPA 1YOLA 1IASA 3BYMA 4K0YA 3ID6C 5HNIX 5CNNA 4YMJA 4GYGA 2WU7A 4R7BA 5BVFA 3IDPA 3G9NA 5AR5A 3BI6A 4I4FA 4JG6A 2GQGA 2WO6A 3T3UA 3TNHA 5KO1A 4MH7A 2JEDA 2VWYA 3QD2B 4FV7A 4QYYA 3LAUA 2ZOQA 3D94A 1KV2A 4E6QA 1J1BA 1PXKA 2ZM1A 4G3GA 3SAYA 4AE9A 4KWPA 4KA3A 4ZTSA 3WE8A 3QWJA 3ATTA 1R1WA 4L8MA 4WKQA 2GQSA 3GOKA 3L1SA 4DN5A 4QMUA 2AC3A 2YM7A 4YO6A 3HVCA 3WYXA 2E2BA 4OTPA 4UMRA 3HMPA 2BTRA 2R3KA 4IX3A 2CNVA 4GJ3A 4E26A 1A06A 3GENA 5L2WA 1ERKA 1DI8A 3GXLA 1FMOE 4BDFA 4BL1A 5IA3A 5ANEA 2FSOX 5LVPA 3E88A 3MIAA 4RA5A 5DHJA 4M97A 1XBBA 3LCOA 1ZLTA 4TYGA 3DZQA 4UWBA 5HNGA 4GKIA 5HCZA 1UU3A 4F6SA 2BROA 3NW7A 4F7JA 4TYJA 4LM5A 4DCEA 4BCMA 3K3IA 4QMVA 5HESA 3G90X 3NPCA 5AV4A 2W4JA 5CZIA 2WPAA 1OUYA 3CS9A 1H28A 3H30A 4DGGA 4R7IA 4QP7A 1O9UA 3UIMA 3ZZWA 4NM7A 2WTDA 4CYIA 1YHSA 2QOBA 3NNVA 3DPKA 4TT7A 3KRJA 3C4ZA 3EFJA 2G01A 3F3TA 3HAVA 3CY2A 4NM3A 3Q9XA 4EJNA 3R2BA 3W32A 3A60A 1WAKA 1ZWSA 3KXGA 2CLQA 4ASEA 2EXMA 1RQQA 2BZKB 4DEDA 2C6MA 1PYXA 3ZFMA 4C4HA 2C4GA 3GC0A 2UW7A 2ZV7A 4YR8A 4YNOA 3BHVA 2XEZA 3RI1A 5HZNA 4D2VA 3UVQA 3WZJA 2VTPA 2YJRA 2F7ZE 4X3JA 4A4XA 4EWHA 5IA1A 1UWJA 3KVWA 3PXQA 4EOLA 4E1ZA 1Q62A 3PWYA 4IIRA 4LV5A 3EKKA 4O91A 3RBWA 2OI4X 2X2MA 3FKNA 5HKMA 4C8BA 3KXZA 3IONA 4AZSA 4DH5A 1U59A 3RK5A 4AACA 4FNZA 2BMCA 4O7RA 4DTBA 4BTMA 2QR8A 4DYMA 1KUTA 3FYJX 3G6GA 4TN6A 5EQYA 4WA9A 5CEQA 2W1GA 4XOZA 4BF2A 5DT0A 2H34A 3VQHA 1YXUA 3HYHA 1PYEA 5CAQA 4JDKA 4AOIA 3PXKA 2WMAA 1QL6A 3ACJA 4KNBA 4M8TA 5IPJA 5AR3A 4CRSA 2CNQA 3D14A 5DE2A 5JH6A 5LXMA 5AIKA 4U8ZA 1Q5KA 2OXDA 2WIPA 3KRXA 3UMXA 2DYLA 3UZRA 3HV7A 5GZ8A 4JX3A 3FMHA 3QRTA 4BDJA 1O6LA 3LOKA 4D5HA 2LAVA 4BGHA 4CFVA 3WILA 1GZOA 3DK3A 2WEVA 4J98A 3R7YA 2XK7A 4WG4A 3G51A 4HYUA 4O0SA 4ACCA 5CSPA 5HVYA 1YI4A 3Q60A 4R3CA 3K54A 3EQRA 3EQCA 2W1CA 2IJMA 5HQ0A 4FKVA 4RA4A 5JGAA 3BLRA 4X0MA 3CEKA 2QOOA 2C6LA 2Y6OA 4OUCA 1KE5A 3ZZEA 2J4ZA 1M7NA 3ZDIA 3ZBFA 4K11A 4TKSA 2QODA 2QONA 5CXZA 3EWHA 4EZ5A 4Y83A 2JITA 4AA4A 3LXNA 1HOWA 2O3PA 4O0WA 4EHZA 4F7SA 3PDTA 3R1NA 5M53A 5CU6A 2QCSA 5HG7A 3HDMA 2H8HA 1PY5A 1H1SA 2IWIA 2QC6A 2UZVA 4I0RA 3GU4A 4O0VA 1M2PA 3ZFYA 3PRIA 3VUGA 1OIQA 1AGWA 2QG5A 3IW6A 2Z7RA 2OSCA 3ZEWA 3MH3A 3R0TA 3ENHA 3OFMA 4G31A 3MTLA 2C5XA 2G9XA 3COMA 4L7SA 4C34A 1YQJA 3LFCA 2BRMA 3KF7A 4TPTA 1YI3A 3P4KA 4BICA 4IVBA 5E8WA 4EEVA 3B8QA 4IE9A 4JS8A 4AWIA 5IU2A 3R8ZA 5ANIA 3M2WA 3KA0A 4F64A 4ORKA 5DEWA 3ROYA 3TM0A 2YM3A 4AT5A 5EW8A 3EOCA 4IFGA 3KMMA 3FMEA 4DFZE 2YLEA 3SD0A 4RX7A 3D5WA 3R7IA 4R3RA 2VTJA 1DM2A 5AP0A 4FA2A 4K8AA 3I5NA 1GY3A 3C5UA 1JBPE 3LKMA 4WD5A 5F20A 3DJ5A 5C1QB 3NYXA 2OZAA 3QTRA 5HICA 1RDQE 1BMKA 4HYIA 4DGMA 4IZAA 4PP7A 2BILB 3E5AA 1V1KA 4HGSA 1KOBA 2IZRA 1O6YA 5IQFA 1ZYSA 3PJ3A 3W2QA 4LGDA 1F5QA 2B1PA 5F1ZA 4KB8A 4CLIA 1Q99A 3VULA 4D4YA 3C50A 4FKWA 4LRMA 5E1SA 2CHLA 3QGYA 4AAAA 4Z16A 5LMBA 1NVQA 3LQ8A 2XEYA 2CSNA 1OB3A 2OICA 4FZ7A 3JYAA 4U0IA 5BMMA 4MEDA 1FVVA 5K0KA 4ANBA 4B7TA 4BIEA 3VBTA 4EL9A 4F08A 3WZEA 4NM5A 4FZAB 3W2SA 2XS0A 3I0QA 2HK5A 4FEWA 2OZAB 1H27A 2V7OA 3MH2A 2ZMCA 4FV9A 2VTLA 4EHGA 3QWKA 3GCUA 5HD7A 4AXAA
chains in the Genus database with same CATH superfamily
3EQDA 3OXIA 3MPAA 4FL1A 4NEUA 2JAVA 3DTWA 5CNOA 3QD0A 3UTOA 5BMSA 4LGGA 2IO6A 2JLDA 3R63A 3L8VA 4O38A 4YJNA 4TWCA 2AUHA 3ELJA 3G6HA 3AOXA 3PA5A 4IZYA 4QD6A 3QZGA 3MH0A 1OZ1A 3OROA 4FTJA 3BGPA 1E1XA 4JOAA 1U54A 4CFXA 3IGGA 2IG7A 1AD5A 4NTSA 2QLUA 1XWSA 3NUNA 4G6LA 2PPQA 3VVHA 3ZUVA 1RW8A 3OD6X 5CZHA 2OJ9A 3ZXZA 3AMYA 3VS3A 4FV5A 3QCYA 4KINA 5IQGA 2JDTA 4KRDA 4FGRA 3C7QA 5B0XA 1ZOGA 4PDSA 2VTMA 4UYNA 3V5QA 1PXJA 3AC1A 2AYPA 2XNNA 1J3HA 3MTFA 2PZ5A 4PX6A 4BCFA 5I0BA 4UX9A 4XUFA 3TZ8A 5EHOA 4MD9E 2FO0A 4C38A 4ZTHA 3EZVA 2R7IA 2Z60A 3IOKA 2J0IA 4IVAA 2OU7A 4I94A 3TTJA 5BVDA 1ATPE 1PXOA 2JDOA 4O7TA 5EFQA 3OOGA 2CKQA 4G9RA 4I20A 5K4IA 1JKLA 1U54B 4IX6A 5JQ5A 2NO3A 5HG5A 3RPOA 4X3FA 1OBGA 1GZ8A 4RIWA 1PW2A 1URWA 3BEGA 4FG8A 1FMKA 4PF4A 2XIYA 4TWNA 5DBXA 4J71A 4WOVA 3MIYA 1WBTA 5EM7A 1WVYA 5AAEA 2VTQA 3GEQA 4P4CA 4YHJA 3KN6A 4XMOA 5BNJA 1XBCA 4CLJA 3BKBA 3PSDA 4O21A 3GI3A 2J0MB 1IEPA 1HCLA 2J0JA 3BE9A 3IW4A 4CKJA 2VWVA 4FV2A 3CJFA 5EM5A 3CTJA 5TR6A 4BHZA 3HUCA 2QHNA 4UY9A 4JBQA 4IC8A 3FMDA 4AN9A 4AZWA 4OBPA 1JQHA 3TNPC 4FGBA 4EUTA 4O86A 3R02A 5CX9A 4DT9A 5IG1A 2Z7LA 4NW6A 1OL2A 2X8DA 1Y6AA 2BUJA 2GNGA 3HUBA 2RFEA 5F94A 4V05A 2ITQA 3HAMA 3KB7A 4NT4A 4RG0A 4XNEA 3UODA 4RIWB 4GFGA 1G8JA 1WFCA 2WQBA 5HHWA 2E9OA 1ND4A 5EOLA 3UDZA 2PY3A 2ZJWA 4ITJA 4L46A 3PJ2A 4QP3A 3ML1A 4KS7A 1ZXEA 4MX9A 4RX9A 2W1DA 3KCFA 5EW3A 4B0GA 5J87A 3UDBA 5C01A 3VAPA 2YACA 2BALA 3O7LB 4NCTA 2X81A 4EK3A 3Q4TA 2A98A 4FKIA 2ETRA 3CTQA 4BCHA 4Z7HA 2W4KA 3VUMA 4CG9A 5DNRA 4BCIA 2XANA 5BVEA 4EOIA 3LM0A 3LIJA 5LWMA 3I81A 2ITXA 4E7WA 2ZFYA 2UZEA 2ESMA 1H8FA 5IQBA 4M67A 3TIYA 3IGOA 4F99A 3W0PA 2PVHA 4Z55A 2GNLA 4IEBA 3LFEA 3HNGA 5AP2A 1V0BA 2QOFA 3GVUA 4Y5HA 3U6HA 5HOAA 2JDSA 3DAKA 2RKUA 1VYZA 2HOGA 2J90A 3WI6A 3IS5A 2YHVA 3G9LX 1H26A 3F69A 4I92A 4OT5A 2CKEA 3QRIA 2G2HA 3FJQE 4G2FA 5GJDA 4C2WA 4E4NA 1QPJA 2XK9A 3IW7A 4C7TA 2RGPA 3PA4A 4M69B 4BIBA 3WYYA 3R9NA 4EKKA 5I3OA 4BTKA 1F3MC 4G3CA 1Q4LA 3GT8A 3QQJA 4F63A 4J99A 3CKXA 4XG8A 5AUUA 5CSHA 3Q9ZA 1P4FA 5M4FA 4WRSA 3FXZA 1Z57A 2QR7A 5AP6A 3N4VA 3W10A 3GCPA 3JPVA 4D4RA 4FSYA 2V5QA 2BRNA 4AGDA 4AW5A 4YPDA 5AUZA 4ANLA 3D5XA 5H8EA 2OFVA 3QZHA 2ERZE 2P2IA 3R9DA 4EJ7A 3PE2A 2RFSA 5DG5A 3UVRA 3UQCA 4MQ2A 5AV1A 5L6PA 4UMTA 4OTQA 2WNTA 5DGZA 3SXRA 3QTQA 4R8QA 4F09A 2R0UA 2BIKB 2W1IA 3GQIA 4GG5A 5LARA 3FXXA 1IR3A 4CZUA 1YXSA 3HLLA 4AFJA 2BHHA 3GU5A 4LUEA 2BFYA 5A4EA 3TV4A 5CU3A 2BRBA 5FDXA 3C4CA 2YM8A 3VC4A 4IVCA 5L4QA 4O0RA 3TMOA 4O82A 1P4OA 4IZ7A 4N70A 3DKFA 2BKZA 2GHGA 5EI6A 4CZYB 2PMOX 1GIIA 5K5XA 5HE2A 4GRBA 5KE0A 1FPUA 1Y57A 2A19B 3FZRA 4TYIA 4ACHA 3VBWA 4AQCA 2OBJA 4FT0A 4O0UA 5DT3A 1M2RA 1YXVA 4ZIMA 4O1PA 1TFFA 4GEOA 4QMXA 5ANJA 2YCFA 5FEQA 1MRUA 2P4IA 3UMWA 1OGYA 2R7BA 4G34A 4HPTE 4RWIA 4GKHA 4BZOA 4G3FA 1PMUA 3W2RA 3PPKA 3OCSA 3AKLA 5DR6A 3LFFA 4F78A 3PPJA 5ETFA 5C4KA 4J52A 1PXMA 4IADA 5DIAA 3LFNA 2G2IA 4GT5A 4ONAA 4NTTA 4HVIA 3O96A 3RP9A 3V6SA 3PUFC 5CVFA 2Y6MA 3SXFA 3VUTA 3ZO2A 4A4LA 5A46A 5IUHA 2UZDA 1UNLA 2PL0A 3SKCA 3UOHA 2HCKA 2HXLA 1PKDA 5GZ9A 3V6RA 2IZTA 4ZSJA 4R5SA 3F3UA 4AGCA 5G1XA 5FXSA 2KTYA 4YBJA 1LP4A 4J1RA 3WZKA 4CT2A 1G3NA 2IEWA 4RVMA 2JGZA 4APPA 1UWHA 5AUVA 4EZ7A 3CPBA 2REIA 4BDBA 1IAHA 3R8VA 2BDFA 3TTIA 2GSFA 4YJSA 2XMYA 3UQFA 1Q8TA 3IDBA 4KUJA 1W2CA 2O0UA 3P0MA 2Z02A 3PXYA 5ANGA 4XV1A 2OKRA 3V01A 4FEQA 1M14A 2WTWA 4ASDA 5HE1A 4DA5A 5HX6A 3UG2A 4HCTA 3EQBA 5F9EA 1U5QA 2HAKA 3C1XA 4FZDB 4U44A 2XYNA 3V04A 1FQ1B 3OCTA 3O23A 2E9UA 2VV9A 3HGKA 3BU6A 4H3BA 5EDPA 3FC1X 5D41A 1FINA 2R3PA 4F4PA 3PE1A 3S1HA 1OKZA 4FSUA 1ZMWA 3FDNA 2OK1A 4DEGA 5J8IA 4KSPA 4IX4A 1OIYA 4B4LA 4DFNA 4FE2A 3NAYA 2H96A 4W8EA 4ZTLA 3PVUA 5CAOA 4F6UA 4R78A 3IW5A 4PWNA 3RNIA 3TT0A 1CTPE 3UNZA 4HNIA 4BIDA 1H0WA 5IEXA 3QL8A 4XLVA 3R21A 1ST0A 3D2IA 1H1QA 5ETCA 4EH5A 3LJ2A 2FB8A 3SXSA 3R83A 3LPBA 2R3OA 4DITA 1CKPA 5L6WL 3BZ3A 1J1CA 2PVJA 3C0IA 5AA8A 4L9IA 4NFNA 1ZYJA 3RAHA 1KE6A 3P79A 2W99B 5AMNA 2NPQA 1MRVA 1W84A 2O63A 3JS2A 1XH8A 2X2LA 4F9AA 4CXAA 3KULA 3MB6A 4DF3A 4FTRA 4JIAA 5BUEA 5J79A 1KV1A 2XP2A 4BWKA 4CNHA 4XG2A 1XH7A 2AEGA 1DI9A 3S3IA 4W4VA 4ZTRA 5I9VA 5AV3A 1KWPA 3G2FA 4O4EA 3TDWA 3FV8A 1WBSA 4DDGA 1M17A 2EUFB 1XR1A 3ZLWA 4M12A 4NKAA 3TJDA 3UIBA 4AA0A 3QA8A 4ZEGA 3OWLA 3UOLA 4MD7E 3EN6A 2B52A 3FPMA 3GU7A 2OO8X 2BIYA 3KXXA 1UNGA 4ZZOA 4EQMA 4BDCA 1CM8A 1HCKA 3MY0A 4GT4A 3RHXA 4HCVA 3ZO1A 3R8PA 1PHKA 3OT3A 4QP9A 3QTZA 4JBOA 4PL3A 1WBOA 2PVFA 3VUIA 4H36A 2GS6A 5HD4A 4UWCA 3PSBA 4EWQA 3UZTA 2VN9A 1JLUE 3FXWA 3DJ7A 3MYGA 5JFSA 3AT3A 4I5HA 4TYHA 3IG7A 4EK5A 3D5UA 4JBPA 2VUWA 3W55A 3E7OA 4J96A 4RZWA 5HE3A 4BDAA 4CMOA 1OECA 3FWQA 3PY3A 2CKPA 2B4SB 2C1AA 3PXRA 5HO7A 3KEXA 3NVMB 4IH8A 2VTNA 2JKKA 2Z8CA 4CMUA 4D2SA 3MDYA 4PTEA 4IMYA 3LFAA 5DLSA 4D1ZA 3BWJA 2E9NA 5J95A 3S00A 3QD3A 3QHRA 1NXKA 3PIZA 1GAGA 3C51A 2ITYA 4FV8A 3I5ZA 3WIGA 4LRJA 5DRDA 5EH0A 4FSTA 5T6KA 2FGIA 2HW7A 4PUZA 3ALOA 5CSWA 4AUAA 2ZYBA 4NWMA 1PMEA 2HENA 3ROCA 4BDHA 2YIYA 4FKQA 4RC2A 5HBHA 3WF5A 4DH3A 3UNKA 3UO5A 2QOLA 4FBXA 3ZONA 4BI0A 2CKOA 1Y8YA 5CQUA 2FA2A 1Q3WA 4XYFA 5HCYA 2VWZA 3VIDA 3VS5A 4DG0E 2GHLA 4LUDA 3QLGA 4YP8A 3F6XA 1JVPP 3QYZA 2XB7A 2UZNA 3RAWA 4RJ3A 3W0OA 2VX0A 3D15A 1YWVA 2PUNA 2QO9A 2OF2A 2YAKA 3FE3A 3HRCA 3FI2A 4FL2A 3NNWA 1B39A 3PG1A 3UPXA 1PRYA 4XP0A 2X6EA 4PPAA 4IB1A 4U43A 4FTUA 1AQ1A 4M68A 4FKOA 4R77A 2XJ2A 5CVHA 1XJDA 1IA8A 3OHTA 2XZSA 3KIOC 3CXWA 3OWKA 4L43A 4MXOA 2Y0AA 2I0YA 1H01A 2PVKA 4DBXA 3ZRKA 4AS0A 3WE4A 2YDIA 1W83A 4S33A 4RQKA 2XIXA 3NSZA 3QFVA 3LZBA 4BC6A 3UPZA 3C0HA 3DBFA 1YKRA 3KVXA 2X2KA 3OXZA 2CN8A 4JI9A 1Z9XA 4R7HA 3Q32A 4ASXA 5ITAA 4P5ZA 5F95A 3U87A 1VR2A 3UO6A 3H3CA 3IO7A 2A1AB 3O7LD 2YJSA 4C4IA 5EQPA 5TO8A 3BIZA 3BGQA 5H2UA 4F9YA 4BCOA 4O96A 3F3WA 3CE3A 3RAIA 3VW6A 4NFMA 2FSTX 3PLSA 4HJOA 4RIXA 5EHLA 1OPKA 3DAJA 4RQVA 1OBDA 1TKIA 3L9MA 3LQ3A 4JLCA 3AD6A 3GGFA 4YZMA 3S95A 3TNIA 3GQLA 3AGLA 3ORKA 4KKEA 5TE0A 1Y6BA 4GJ2A 4GIIA 1ZY5A 2B54A 3OP5A 3F82A 3TXOA 1OUKA 1P14A 1VJYA 2FSLX 3R00A 2XNMA 4CG8A 4XG3A 5AUTA 5HTCA 4YZDA 4ZJJA 1YXTA 2HW6A 3ERKA 1W8CA 2YIXA 4AW1A 3AMBA 3GFEA 1FGKA 1ZYCA 3D2KA 5HG9A 4XG7A 2JD5A 4PNKA 3FZOA 2GTNA 3GNIB 4QPSA 5ANOA 2B9JA 2C3JA 3F9NA 4YHTA 4EHVA 3QD4A 2VX1A 5AAGA 2W1ZA 2J6MA 3FZSA 4BZDA 3QCQA 4D2RA 4E73A 2WOTA 3JVSA 4FNWA 4O81A 2EVAA 3NRMA 4PDPA 5CEIA 4C36A 2XJ0A 3WOWA 4AW0A 1PXNA 2FYSA 4O2ZA 3LCKA 1H0VA 2YM5A 5HE0A 4G3EA 3ZDUA 5CEMA 4RVKA 4EUUA 1WBVA 3O8TA 4CFNA 4R3PA 3MFRA 2PVLA 5KKRB 3ITZA 4EHEA 4P5QA 4ANOA 4F9CA 3VN9A 4BWXA 2W96B 4Z9LA 4DHJA 1VZOA 3JUHA 4JG7A 4C3FA 5CAPA 2PZRA 4QP2A 3TKHA 3NFGB 4JBVA 5FM2A 2UW8A 2BZJA 4NL0A 1PMNA 4QMYA 2WQMA 4ZS4A 4KBKA 4N0SA 4NW5A 4ZY5A 4FV1A 2R3JA 2BDJA 5IA4A 3PWDA 3CCNA 5EW9A 3MA3A 3BHTA 4HGLA 3NVKI 3FKLA 5E91A 4Y46A 2W9ZB 3QTUA 5EKNA 1W2DA 3CD8A 1WZYA 5EM8A 4C4FA 2BRGA 4EOQA 4D1XA 4JAJA 4XCUA 3ODZX 2RFDA 5M57A 2VAGA 3CD3A 4ID7A 4E3CA 3EN4A 2XNPA 2VGPA 1H07A 5ANDA 5I9YA 4YTFA 3SG9A 4OBQA 3BYOA 3HMMA 3DZOA 2IZSA 4C4EA 4OAVB 4NZWB 3NNUA 2DUVA 3RZFA 3PIXA 4XOYA 1MQBA 2BZHB 5FWKK 3E62A 3FZPA 4FKRA 1UV5A 4FZ6A 4ALVA 5HEZA 3LQ5A 3I6WA 4FOBA 3RPVA 3FEGA 4BB4A 5JK3A 1S9IA 1GIJA 3COIA 2W17A 4U80A 3BU5A 2R3GA 5EDRA 3TACA 4OTDA 3ZH8A 4AG8A 5GZAA 3GB2A 1Q8ZA 3VNTA 3Q53A 5E1EA 5J5SA 4FG7A 4FT9A 5FBOA 2HY0A 2YERA 4C58A 2CMWA 3VHEA 3NW6A 3JVRA 2YIQA 3QQGA 3IPHA 2BPMA 3EN7A 3MI9A 3QQHA 2BRHA 2OXYA 4NYEA 4O7SA 4BJJA 4ZMFA 3HX4A 2JBOA 3BBWA 3NX8A 4G9CA 2C5OA 4HVSA 2ITNA 3BX5A 5A3XA 3LXPA 5FXQA 3OZ6A 1J91A 3OWJA 3TZ7A 2Z7QA 1OVEA 5JSMA 4KD1A 4EOOA 4QMQA 3ZU7A 2QD9A 4N6ZA 3RMFA 4D5KA 4YGAA 4YU2A 4EK4A 3DK7A 2R2PA 3KF4A 3A7JA 4UBAA 5LMKC 4WNKA 4ZOGA 4DE4A 4R5YA 4IB3A 4CEGA 3DOGA 4DFBA 2PMNX 3LCDA 2H9VA 2WXVA 3MB7A 3PJ1A 3SRVA 3JY0A 3V5TA 1RE8A 2C6KA 2GHMA 4OT6A 3Q4CA 2W05A 4XRLA 2VWUA 3AXWA 1BLXA 2WTIA 4BDIA 3PRFA 3W2PA 4MXCA 1Q8YA 2WIHA 3BYVA 2B9FA 1K9AA 4NUSA 3TDVA 4EH2A 3NMUF 2V7AA 3RK7A 5IH6A 4U97A 5CXHA 3TUDA 3ETAA 3ORIA 1OL7A 4GU6A 4M0YA 5I3RA 2B55A 4BJJB 3R01A 4E93A 4DHIB 4PTGA 1F0QA 4K77A 4CFUA 3QX2A 4GMYA 3BL7A 5EDQA 2AQXA 2OH0E 4IWOA 3GOPA 3RCJA 4USEA 4RX5A 2GTMA 1GZNA 3UZPA 5K3YA 1TQMA 5J9LA 4EC8A 2XKEA 3CJGA 5DA3A 2UW4A 4A9SA 2W9FB 5IA0A 5AV0A 4ZJIA 4AFEA 4Q2AA 4FIEA 3ENMA 4Y72A 5BUJA 3VS2A 3GC8A 4FKGA 1ZMUA 3WBLA 4FKPA 3OW4A 3OWPA 3SRVB 2QG7A 3DLZA 4BCKA 2UW0A 4BKZA 3QQLA 1UU8A 3QRJA 5D1JA 1PJKA 4D28A 3N4UA 2XRUA 2OJJA 4DEAA 5GIOE 3ULIA 1U46A 3NZ0A 5M55A 4YBKA 3CPCA 1H1PA 3JXWA 2J2IB 4OGRA 2ZV8A 4C61A 3O50A 4D2TA 4Z3VA 1YOJA 5L8JA 4DAWA 1ZYDA 3A7IA 4WBBB 4Y85A 4U9AA 5ACBC 2V22A 3L8PA 1A48A 4BYJA 5HBJA 3FZ1A 3NUSA 5M08A 1CSNA 4IHPA 2YWPA 4LFIA 4C2VA 2YDKA 4MYGA 4E5BA 3M11A 5AR2A 1W7HA 3BHHA 5EG3A 3ZTXA 5IQDA 2X9EA 4C4GA 5I9XA 5KUPA 1T46A 4O0XA 4S30A 5CI7A 4ZTQA 5L8LA 3P08A 3AT4A 4X2GA 3SLSA 2CGXA 1MP8A 3WF9A 2VD5A 5FEDA 4PL4A 2IW6A 4KBAA 4YJPA 5CAVA 3P78A 3PA3A 2ZDTA 4QMNA 1IA9A 4LOPA 4U3ZA 5DI1A 2JIVA 3ORTA 4O7NA 5IA2A 4EYMA 4KIOA 5CF6A 4EH7A 4EBWA 1FGIA 3KXMA 3W8LA 3EFLA 1M52A 3RVGA 3W2OA 3VBYA 3KXHA 5HVJA 4EOSA 4F65A 4ZSEA 1KE8A 2C3IB 5E9EA 5I4NA 4UWYA 4I4EA 4FTTA 3NUYA 5A6NA 4QPMA 4CKRA 1SM2A 4YC3A 3PPZA 3UNJA 4JIKA 3WZDA 2YITA 2XF0A 3DQXA 4YNEA 3UP2A 4AAYA 4IAKA 5M51A 4WNOA 4U42A 5L2SA 1L3RE 4FSMA 5IEYA 3ODYX 3U4UA 4HNFA 4M84A 4PDOA 5CAUA 4QQJA 3ZBXA 2VO6A 4JR7A 1JNKA 4GYIA 3SVVA 3DU8A 2QHMA 2WEIA 3P9JA 4KABA 5KBQA 4U79A 4KIKA 5JFWA 4X2FA 3QTSA 1K3AA 2JBPA 3TKIA 1OPJA 5KNJA 3DB6A 3QRKA 5D11A 5IMXA 2W4OA 3H0ZA 5HLNA 2PMLX 3QTXA 3EZRA 3NFFB 1YRPA 1YVJA 3DKCA 2B0QA 3U8WA 3Q5ZA 4BTFA 1SVEA 5E8VA 3C9WA 2BAQA 2YLFA 3WF7A 4PQNA 4BHNA 4ERKA 2YCQA 2E9VA 4GFOA 2XKDA 4ARKA 1Y8GA 5DOSA 3E8NA 1ZRZA 4XP2A 2QU6A 2R3RA 1NA7A 3FY0A 3NAXA 3H9OA 3BCEA 4CFFA 5KMLA 1JKTA 3BYSA 3CGFA 4N4SA 2ITWA 3EL7A 3KK8A 4A7CA 3E8EA 4G1WA 4Q9SA 5AFVA 3LMIA 4I24A 5ANKA 2ITUA 3V8WA 3ORZA 2X0OA 3D83A 4R6VA 3W0SA 3O51A 3DKGA 4KIKB 4BN1A 2Y9QA 4D2PA 1STCE 3R73A 2I40A 3C13A 3KGAA 4BCGA 4AOJA 4QP1A 5L6OA 1LEWA 2WU6A 4QYEA 3DJ6A 1OM1A 2QOIA 3GUBA 3NUUA 4IM3A 3TKUA 4YSJA 2ONLC 3HECA 2A27A 3CTHA 3FLYA 3RM6A 3RJCA 3K5UA 3REPA 4DEIA 3RINA 3F7WA 3U9NA 3FY2A 2WGJA 3K5VA 3P5KA 4CD0A 4GK2A 1U4DA 4PP9A 2QNJA 4GW8A 1TZDA 5JRSA 4QDVA 4X3FB 2QURA 4G16A 2GS7A 5L3AA 2PU8A 3B8RA 5M4UA 3RWQA 1B6CB 1NW1A 4BWPA 4USDA 5I5ZA 5L2QA 3UE4A 2C6TA 4EH4A 4FUYA 2Y7JA 2PE2A 2C47A 3DBQA 3L9NA 5A4TA 1P5EA 2F2UA 3O8UA 2C1BA 3H0YA 3P7CA 4JDHA 2R3HA 4F6WA 4PPCA 5FXRA 3NYVA 1T45A 4P2KA 3UQGA 3A4OX 4W8DA 4GVAA 3SQQA 4YLJA 3PJ8A 4RZVA 1NVSA 3R6XA 3OXTA 3V5PA 4F0IA 2HYYA 3U6JA 1GIHA 2ITTA 4MXAA 4XBUA 2PUPA 1ZARA 3EYHA 1CDKA 4RWJA 4PL5A 3LMHA 2XBJA 3PSCA 2VGOA 3B2TA 2X1NA 3F5UA 3FLQA 3R71A 4ZXTA 3LLTA 4WHZA 2I7QA 2RIOA 4M13A 2R9SA 2ZVAA 1TQIA 2JC6A 2OH4A 4A06A 4AGUA 3NDMA 5CT7A 4A9RA 4CZTA 4BI2A 1JPAA 4M3QA 5TF9A 4CQEA 3A4PA 4AU8A 1J7UA 4AT4A 4UV0A 4E8AA 4JNWA 2YIWA 5AJQA 3ZRLA 2C6DA 4YC6A 5EOBA 4L3PA 5ETIA 4AXAA 3H10A 3PYYA 1PF8A 3I7CA 4L52A 2VO7A 2VO0A 2X9FA 3HRFA 4L45A 1K2PA 4RJ5A 5H9BA 3NCGA 3RGFA 4EH9A 2CGVA 2OZOA 4RVLA 4Y95A 3MY5A 4DG2E 2J7TA 3SV0A 5FTGA 4TNDA 3ZO3A 2CCIA 3MS9A 3S2PA 3NR9A 5KHXA 2WMBA 4FTOA 3RAKA 4AZVA 2IN6A 3DAEA 3R1QA 5AP1A 4FI1A 2YAAA 3IDCA 3HL7A 1XH5A 3MN3A 4HZSA 3OTVA 4IDVA 2GCDA 4X6RA 1KSWA 3AQVA 2BAJA 3M42A 4O22A 2YCSA 3PLAE 5AP3A 2WMVA 3KREA 2VO3A 4DT8A 5HIEA 1FBNA 2BFXA 4S2ZA 4H58A 3PZHA 4RVTA 3TV6A 2BKKA 3KFAA 2GNHA 2C3LA 5AM7A 4WG3A 3VBXA 4RGJA 5L2IA 2B53A 3UIUA 4WT6A 2ZV9A 5DRBA 4CTBA 4F0GA 4IAFA 4EH8A 4GS6A 4OTRA 2F57A 2HIWA 5JMSA 5CENA 4FJVA 5C4LA 2XARA 1DAWA 4YZ9A 5AUYA 5EYMA 4GVJA 4I6QA 4S31A 3OUNB 3EH9A 2ETKA 5A4LA 4D4SA 2OLCA 2W5BA 4UZDA 1YDRE 2ZB0A 3WIKA 5BVKA 4ANMA 2WMWA 2HWPA 5JGBA 4G5PA 3IK3A 3QX4A 3UIXA 2XYUA 2WFYA 3LJ0A 3RNYA 3VBQA 2QI8A 5LQFA 3BQRA 4FSZA 4FTLA 5IZFA 3QTIA 4LQMA 4AGWA 2IVTA 1PMVA 1Q97A 3HRBA 4H3PA 4OTWA 4X2NA 3QC4A 3SW4A 3ZLYA 5B2LA 3EQGA 4FVQA 5E8TA 1BUHA 4AF3A 2EB2A 4LRKA 3II5A 5J5TA 4QMTA 5KMKA 3PG3A 3U9CA 1FOTA 4LYNA 4OTIA 3R28A 3UJGA 4PMMA 1H24A 4GL9A 3ZSHA 3U54A 2P55A 2BDWA 1JKSA 3FMJA 2IW8A 4YZBA 3FMNA 4O0TA 4FEXA 2UZBA 4ITIA 2Y4IB 3KL8A 4WNPA 1QPCA 1O6KA 1WVWA 2C3KA 1H1WA 3HA6A 5HIDA 3A2CA 4MCVA 2HZNA 1OKYA 1ZYLA 3DTCA 3TJCA 4W4WA 3ZUTA 4DGNA 2GS2A 2XUUA 1W0XC 2WTKB 5JN2A 1SYKA 5HLWA 4XLIA 2V62A 3C0GA 4XG4A 4Y5QA 1PXPA 2PUUA 2KULA 1GOLA 4IQ6A 3C4XA 4TWOA 2I6LA 3ANRA 3ZFXA 4ANNA 3ANQA 4A4OA 3IECA 3C5IA 4DGOA 4C37A 3A8WA 3FSKA 2QOHA 5KMMA 3HMNA 2XNGA 4RFYA 4A9UA 2EWAA 3ZRMA 3MVHA 3DBDA 4BCPA 3W0NA 4RFZA 1OITA 4MWIA 3QQUA 4XBRA 5FDPA 1UVRA 3D7ZA 3O8PA 4KIPA 3G0EA 1UNHA 3F66A 3VQUA 4QO9A 4IJPA 4B8LA 2F4JA 2PVYA 1WCCA 3O5AA 4I41A 2IZUA 3TI1A 3R8UA 2QO7A 4LV8A 2J51A 4DFXE 2QOKA 3CQEA 3R22A 5J7HA 4FIGA 3F2RA 4BBFA 2X6DA 3SA0A 3FMLA 3R7EA 2R3FA 3EYGA 2YZLA 3QUEA 2PWLA 4XH6A 4X21A 3QXPA 2F7XE 3NYOA 3LFSA 4FICA 5JT2A 2QVSE 3DLSA 3R9RA 5LVLA 5IKWA 2OWBA 2O2UA 4IWDA 3MVMA 3DT1A 3UP7A 4D1SA 2PYWA 4B9DA 4DFLA 4M66A 3OVVA 5DEYA 3P1AA 2YA9A 4G6OA 2XAOA 3EQFA 2ITOA 5FQDC 3PJCA 3E63A 4QT1A 4EBVA 1BX6A 3LFDA 1IRKA 2OFUA 4JR3A 1MRYA 3F5PA 3CGOA 4FYNA 3HP2A 3FLSA 4RWLA 4EKLA 3Q52A 2XIRA 5CEPA 4C35A 4K9YA 4ZLYA 2XVDA 3FSFA 3NYNA 3LHJA 1G8SA 5CANA 3U6IA 3AC3A 3TEIA 1LR4A 3FMMA 4RIOA 4BRXA 2XCHA 2ZM3A 4J7BA 4DH7A 4FIJA 4P90A 1QPEA 4DEEA 3OY3A 3KULB 3P23A 4UN0C 3POOA 5D9HA 4JDIA 3VRYA 4CYJA 2UZUE 4FV6A 4BVUA 3NIEA 3Q6WA 4WSYA 5E92A 3R9OA 3R1SA 5E8XA 4QMMA 2XKCA 4MF1A 4BGGA 3HZTA 3OS3A 3WARA 2C0TA 4JQEA 1XHAA 4PTCA 5HO6A 4ZLZA 4O4DA 1A9UA 3KC3A 2ZV2A 4FTMA 3OY1A 2XM8A 4KBCA 3CR0A 3F5GA 4U5JA 4YZNA 2YM4A 2IW9A 3QKLA 2NP8A 2W7XA 2XJ1A 3PTGA 1PKGA 2VTRA 3O17A 3ZO4A 3R04A 2UZOA 4J97A 1NT2A 2EXCX 3FUPA 3A7HA 3T9TA 4B8MA 2J0LA 4MBIA 5AR8A 4IAAA 5DMZA 4YTHA 2BVAA 4YJTA 2X0QA 3QBNA 4QMSA 3W1FA 5IQAA 2BZIB 2W5AA 2UVXA 3TWJA 3G0FA 4BKJA 4L42A 4BR3A 4FTAA 3W0RA 3U55A