4EI4A

Jak1 kinase (jh1 domain) in complex with compound 20
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
302
structure length
289
Chain Sequence
GDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKHIADLKKEIEILRNLYHENIVKYKGICTGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKETVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK1
publication title Discovery and optimization of C-2 methyl imidazopyrrolopyridines as potent and orally bioavailable JAK1 inhibitors with selectivity over JAK2.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 289
sequence length 302
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ei4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ei4A01
3KL8A 4NZWB 4CNHA 4R5SA 2WMAA 2AC5A 2YJRA 3NYOA 5F4NA 5FTOA 5IA0A 4M14A 2VWWA 4W4WA 4CMUA 5EW3A 4O0SA 3RCJA 3NGAA 3O8PA 4KIOA 1ZOGA 1F5QA 3OXIA 4RVKA 3TZMA 4YZMA 2GNHA 3AMYA 3NLBA 2Q0BA 3QQJA 4LUDA 3FBVA 3ZDUA 4XRLA 3ZO1A 3ZS5A 3G6HA 5HTBA 4G3EA 3NUPA 3G90X 4FSWA 1APME 2A2AA 4XP2A 2WMRA 2OJJA 5LWNA 5A4LA 2V5QA 2C3KA 5AR3A 3ZZEA 1PYEA 1OUKA 3UOKA 1OPLA 4CLJA 4HGEA 4TY1A 5T68A 3VRYA 4IZ5A 2X39A 4Q5EA 3LQ8A 4I4FA 4IIRA 2VTOA 5JFWA 2G2FA 4TWNA 4UXQA 4GFGA 2XBAA 4EC8A 3NUSA 3QTSA 2GTMA 4CCUA 3ZLWA 2XKDA 1Y57A 2E9NA 3VS1A 3P7BA 3SW4A 2PUIA 3DAEA 1IA8A 2CDZA 4EKLA 3FKNA 5BVFA 1BL6A 3LJ0A 4FT0A 5JT2A 1UU9A 3VUMA 4D1XA 4G6OA 4EK6A 2Z7LA 4FSUA 4ERWA 2AYPA 3GENA 4N70A 5M55A 4Y95A 3OWKA 4YTIA 3E7OA 3KXGA 3F5PA 4YJSA 3KXHA 2YLFA 2BALA 1KE7A 4KINA 3WARA 1Q8ZA 2CLQA 4ANLA 3BYUA 4FZAB 2R7BA 4FL1A 4UALA 2PULA 3MPMA 1WBPA 2QG5A 1R0PA 5LARA 4ARKA 4R78A 2J2IB 2YDKA 4QMQA 3Q53A 4GVJA 1OKWA 5JRQA 3R9OA 4FZ6A 4BWPA 3UZTA 5HKMA 3AC3A 5HQ0A 2BRGA 3ZMMA 2NRYA 2B4SB 2BROA 2PMOX 4E6QA 2C6OA 4BTFA 1ZY4A 5IF1A 3CC6A 5HNIX 1YXVA 3R2YA 3R7GA 4K0YA 3TN8A 2C0IA 5EW8A 5LXMA 4XJ0A 3EYGA 1CKIA 2P2HA 5AV2A 4OTWA 3C50A 4FV3A 4J71A 3K2LA 4ITJA 3Q4CA 3C4FA 1MQBA 3PJ2A 2QONA 2GU8A 3HVCA 4AXAA 4AZEA 5EQPA 3EQCA 4DGOA 4F9YA 5GNKA 5CAQA 5CTPA 3E87A 4AN3A 5E8XA 4ANOA 4KS7A 4AGCA 4KKEA 3FJQE 4NL0A 2C1BA 5HE2A 4RA5A 1FVVA 5AUXA 5CVFA 1GIIA 3ZBFA 5DBXA 5BVDA 2OIQA 3O50A 4Y85A 5E8WA 3FMLA 2J9MA 3W55A 4F0IA 3OBGA 5JEBA 4H3BA 3FZPA 4QMLA 3DA6A 4BCIA 4XG2A 3MSSA 3MIYA 4A9TA 2VN9A 5F20A 4Q5HA 4BKZA 5CSPA 3F69A 2R3PA 4RJ6A 4NH1A 4QTDA 4QYEA 3TKHA 4OAUC 2ZDTA 4RWLA 5AV0A 3DNEA 5CQWA 3BQRA 4HPTE 1Q4LA 2UVXA 2CCHA 3F88A 3F2RA 3L9LA 2YA9A 3AC2A 4K77A 3PVBA 5EDPA 5CAOA 3Q4UA 5KHWA 2J0LA 5DEYA 4CZUA 3E3BX 3IOKA 4TTHB 4AAAA 3ZO4A 4JRVA 2NNWB 1H25A 4QP2A 3NUAA 3DJ6A 5CNOA 4FNYA 4LOPA 4DLIA 2BUJA 1PXJA 4FTOA 2PE0A 4F9WA 3Q6UA 3F61A 5BYZA 4F6SA 4M0ZA 4BYJA 5JGDA 2RF9A 3DPKA 4CFUA 3U4UA 5B2MA 5HOAA 4N57A 5E8VA 4AA0A 3IW8A 3FHRA 4NFNA 2XCKA 4YSJA 4Q2AA 5AP6A 4ACCA 2WOTA 2IWIA 2W1FA 4W4XA 3BWJA 5M44A 3DZOA 2BZHB 4CMTA 4RRVA 1SVGA 4FGRA 4AW2A 5CT0A 3QFVA 4ASDA 4AN9A 4AN2A 3H10A 3OEZA 2RKUA 4PY1A 4TPTA 2P4IA 4ZTNA 4R7BA 4BR3A 4QQ5A 3QLFA 4DGNA 4D2VA 3FQSA 4L67A 2IZSA 4U45A 4QP3A 4TW9A 2GNLA 1A9UA 1PHKA 3OT3A 3CGOA 2XJ1A 5M57A 5AX3A 2E9UA 5I9YA 3FSKA 3KVWA 5F95A 3TTIA 3UO4A 3MY5A 4A4OA 4PNKA 4NTTA 2BHEA 5AEPA 4FTQA 3FZRA 2PPQA 4RQVA 1GZ8A 2C0OA 4BN1A 3JPVA 3JY9A 3CTJA 5HESA 3CCNA 3NMUF 3A4OX 3VBVA 3HGKA 1WVXA 4G6LA 1H24A 3D2KA 5IUGA 2C4GA 2X6EA 3WF9A 4EK5A 2C6IA 2ITXA 2WTDA 3FUPA 3MPTA 3P08A 4I41A 3C4ZA 3TIYA 3DJ5A 4UEUA 3FLZA 2BHHA 4QMWA 3CQWA 2R3HA 2YAKA 4XLVA 3KXZA 1O6LA 3FMNA 4WO5A 4F0FA 2Z2WA 5CU3A 1YHSA 2WFYA 5M07A 4R6VA 4MNEA 4JVGA 2GNGA 3MIAA 2QOIA 4KKGA 4L9IA 4HCTA 4BL1A 4ZTHA 4XG4A 3UO5A 3U87A 4BBMA 5HLWA 4NT4A 4QTBA 4BFMA 2E9VA 5ANDA 4PPAA 3KMUA 4CT2A 5K5NA 3S1HA 3VUTA 4EOPA 5AAFA 3JXWA 4IZYA 1KOBA 4GJ2A 5J79A 3Q96A 4XG6A 2R3JA 4FV0A 4M68A 2LAVA 5IA1A 2PVKA 5C8MA 4U7ZA 3QRIA 4FNZA 4ACMA 4JBQA 4TYHB 5ANEA 5HCXA 4C02A 3ROYA 4G5JA 3FZ1A 3WILA 4JJRA 2XEYA 5AV3A 4EHVA 5HG9A 4AT4A 5CEQA 4QMSA 2XB7A 3ULIA 4EH5A 5L2SA 4H58A 1DI8A 1JQHA 2C3JA 3WOWA 4GG7A 4QTAA 3ZM4A 4FG8A 1XJDA 3FLSA 3A61A 3PWDA 3FLQA 1FOTA 4CKIA 5FXSA 2ITTA 3SOCA 4LOOA 4F4PA 1XBAA 4JNWA 4LGHA 3PXQA 4FV2A 2ERZE 2WMQA 4YSMA 4O22A 3CJFA 5AUUA 1JKLA 3BQCA 5E1SA 3BE2A 3E62A 1DS5A 3D2IA 1ZXEA 4TWCA 4A4LA 4FF8A 4M12A 2R0IA 3OOMA 4RT7A 4U3ZA 3F3ZA 2EXEA 3FLNC 5ACBC 4O7RA 1Q3WA 3OTVA 1G8AA 4L3PA 2CKPA 4IWDA 4DCEA 4DEDA 4J96A 2VGPA 4PP9A 3O0GA 3PWYA 5IQDA 3GU4A 2C5YA 3TNIA 3ZZWA 2ZV9A 5L2QA 4QOXA 3GC7A 3DDPA 3I7BA 2IJMA 2WMXA 4QQJA 4BRXA 4C4HA 5CU4A 3ENHA 3HP2A 3MH3A 3QD0A 3NWWA 4HCVA 3WI6A 2PHKA 3H9FA 3ALOA 5HO7A 4R77A 4FA2A 3OWPA 3COIA 4OUCA 4C3PA 4AZTA 5IEYA 2CN5A 2IN6A 3KCFA 5G6VA 3TCPA 4C8BA 3VUDA 3A4PA 4MTAA 4L44A 4BCJA 3UC3A 2WU7A 4YJTA 3C0IA 4ACGA 4H36A 5F9EA 1JKKA 4HYSA 2Z60A 1Q24A 2FB8A 2J0MB 4BZDA 3CPBA 2YWPA 5H8BA 1YKRA 4O0RA 3KCKA 4ALWA 3DGKA 4KSQA 4FKSA 3EH9A 4KSPA 2CNVA 5C26A 4LYNA 2RFSA 2VTQA 4IADA 4UMTA 2BZJA 2PVNA 4PRJA 5IMXA 1YI4A 2X7OA 3EYHA 3JS2A 3R71A 2VTPA 4II5A 5GZ8A 4TL0A 4BCHA 4YURA 2UW5A 3EFJA 4GUBA 2JD5A 4EH6A 4GYIA 2VWXA 5DGZA 4C36A 3SG8A 2ITYA 3K54A 3RZFA 4CEGA 4GW8A 2YZAA 4Y5QA 3EN5A 3MA6A 5IQFA 5A14A 1ZYSA 2E9PA 2F2UA 4E8AA 5CX9A 4YZ9A 4FNXA 4AT5A 2CN8A 3EB0A 4IC7A 3TUCA 3PTGA 4I94A 4K33A 1F3MC 4JIAA 3TJDA 4PMPA 4NM5A 4YNEA 3VHKA 4MVFA 3RNYA 4DLJA 2CCIA 4IDVA 4JAIA 5LQFA 4YJUA 2PVRA 2CSNA 4EEVA 2B9FA 5M51A 4IW0A 5J1WA 5J1VA 1IR3A 3Q4TA 5E4HA 5T6KA 3I0OA 4QPSA 3E64A 4WD5A 3TEIA 2ETRA 3E8DA 4AOJA 2ZV7A 3BHVA 5ANOA 3MY1A 4XG8A 3ORKA 4QP1A 2XNPA 1S9IA 3N51A 3A8WA 3OZ6A 2F57A 2VTTA 1OL5A 3QBNA 3S3IA 4RBLA 4V05A 4XOZA 2ZB1A 3NUXA 2W99B 1U59A 2BDJA 5DVRA 2X8EA 4FSZA 3S00A 2C5OA 2WTKB 1LP4A 3QX2A 2QHMA 2VWUA 3QZIA 4FTLA 3F2NA 2YHVA 3AG9A 4FZ7A 5JGAA 5HLPA 2OBJA 3BGZA 3CLYA 4D2SA 4R5YA 5CF5A 2WIPA 3FXXA 3PXZA 3H0YA 2ITOA 3F3WA 3NW6A 5DT4A 3ZRKA 1YHVA 1OM1A 2ITZA 3OOGA 3FYKX 3R83A 4EZ3A 4IAFA 3AT2A 4NKSA 2WU6A 4OLIA 2UW8A 4KIPA 3CJGA 4CD0A 1YOJA 2VX3A 3C4EA 4RIXB 3QQFA 4U6RA 4QMNA 4ZZMA 3KF4A 2C1AA 2RSVA 3LPBA 2YDJA 4DG3E 4DFYA 1XWSA 3EZRA 3FPQA 4OTFA 2O5KA 5HCYA 2UVZA 4K18A 4MKCA 3UDBA 3BKBA 3R22A 4Y8DA 5A6NA 3RWPA 4XP3A 1OVEA 4QPMA 5HX8A 5K5XA 5JH6A 2F2CB 5H3QA 3R8MA 3ZSHA 4GU6A 4HCUA 5HIBA 3CR0A 3IW4A 2O64A 3JR1A 3MB6A 4O7ZA 1K2PA 5TR6A 5GZAA 3P5KA 3SC1A 4BWXA 4F09A 2QKWB 3MJ1A 2BRHA 2IO6A 4F7NA 3VW8A 1H4LA 4HGSA 1BI7A 1PW2A 4D9TA 2OZAB 3ALNA 2JBPA 3QKMA 1NXKA 4L7FA 3W8QA 2HWPA 3OMVA 2PE2A 3CEKA 2ITWA 1O6KA 2R0UA 3IDPA 1YHWA 4X2GA 4Y5HA 1BX6A 4FEXA 1VZOA 3O2MA 4PL5A 3LFFA 2W5HA 5AP3A 3RINA 4RLKA 3A60A 2WQNA 5D9HA 4FSRA 4CMOA 2GNIA 1MRVA 2YIQA 5GJGA 3HZTA 2QODA 2WTKC 4I24A 2UZBA 2EUFB 3VUGA 1ZWSA 4XG9A 3R8PA 2Y6MA 2B9JA 5EW9A 3LM5A 5EOLA 4EBWA 5H8GA 3DKGA 4BY9E 5JMSA 2W1GA 2ITQA 2UZUE 4U79A 3U8WA 2JKQA 5FTGA 2RL5A 2ZM3A 1WVYA 3OROA 5IZFA 2OFUA 2C6TA 2OXYA 1W98A 2GHGA 2IVTA 5EFQA 3W2SA 3I0QA 3V6RA 3W32A 4FTRA 5HO6A 5JFXA 3RVGA 4YZDA 4M13A 5EHYA 5F94A 1IAJA 1U5RA 3C5UA 4C4FA 5AP5A 3R28A 3KVXA 4QMPA 2C5VA 2IVVA 4R3CA 4IAIA 2YWVA 4QP9A 3TV4A 2Y6OA 4U97A 5CF8A 1UWJA 4DITA 1ZYLA 5CI6A 3NR9A 4C61A 3QCSA 4FTMA 3CTHA 3PIYA 4FUYA 2V62A 1JSTA 2YCSA 2O8YA 3G0EA 3SQQA 1TQPA 5A6OA 2H9VA 4JR7A 1Y91A 4KB8A 2GQRA 3O7LD 4O0YA 4DG2E 2PZPA 4WUNA 4LMUA 1JKTA 3LJ1A 4PMMA 1Q99A 3K3JA 3QC4A 4HGTA 1MUOA 2H8HA 3T8OA 4RIYB 3DQXA 3ATTA 1CKJA 4FIIA 4CSVA 2W9FB 3P23A 4FTUA 4MEDA 3OF0A 4QMUA 4HVGA 5CAUA 3FZOA 3LQ5A 2Y8OA 4TWOA 3RHKA 2BKZA 4CRLA 4TYJA 5JFVA 1OI9A 3NNVA 1M2QA 4JG8A 2XIYA 3KC3A 4BKJA 2I7QA 4ZJVA 3PZHA 3G0FA 3FWQA 5C27A 3E92A 2JIUA 3KRJA 4AW0A 3DBCA 4WRSA 3R7VA 4HZSA 3UZRA 3UMXA 3ZEPA 2GFSA 1Y6BA 5LMAA 4ANNA 2XP2A 4BCNA 4P7EA 4YGAA 5FXRA 3THBA 3LIJA 3Q52A 3ET7A 4FOBA 3E88A 4HVHA 1PXOA 3ZRMA 4C33A 1H0VA 1GIJA 4XOYA 3U55A 2OXXA 3HV3A 3K5UA 4TYEA 2XKCA 2OF4A 4FG9A 2QO7A 5AIKA 3MH2A 2HZNA 4OW8A 2JAVA 3O17A 5I3OA 4FV8A 3WZJA 3Q5IA 1W8CA 2YCFA 3MYGA 4E4LA 4M84A 5GIPE 3QTZA 3DS6A 2HY0A 4Z7GA 3FXZA 2YIRA 3AT3A 4BB4A 1SVEA 3PFQA 3M42A 1YVJA 5BVWA 3Q60A 2WD1A 2YIYA 4WRGA 4CYJA 5ETCA 4EHGA 2V7OA 5K4JA 3W16A 2X2MA 3FAAA 4FKGA 4S33A 3FI4A 3WZDA 3NUUA 3F3VA 3QKLA 4X3FB 2VO6A 5I0BA 4IAAA 3C5IA 4E7WA 3QTQA 3HA8A 3A7FA 1OKYA 3AC8A 3IDBA 1YI6A 4QTCA 4ZLZA 5CAPA 2JDRA 3GU5A 4LI5A 2B9HA 4RX5A 1OZ1A 3U51A 4AFJA 4B4LA 3SXSA 4ZZOA 3UP2A 5BVEA 4FV4A 2H34A 4MAOA 4BHNA 4C35A 3PY3A 3RP9A 3A7JA 2F49A 4RMZA 2C3LA 4ZJIA 3U4WA 4ANBA 3G33A 4K11A 4B7TA 5EI2A 2OJIA 3QRUA 3L8XA 3GQLA 3O71A 4DYMA 3N4UA 2QKRA 4CZYB 4BDBA 3MJ2A 5B2LA 2VGOA 2B0QA 4E5BA 3VS7A 2VAGA 5J5TA 5KHXA 3ZC6A 3DKFA 3WF6A 5J9ZA 2ZDUA 1M2RA 3Q9XA 3I5NA 4IVCA 2BIYA 4GRBA 3NIEA 4FTNA 4KKHA 4R3RA 3UMWA 4IM2A 4F1TA 4AGDA 2A4LA 4DBXA 1YDRE 4LL0A 2WQEA 3VNTA 4ZSJA 4ZY5A 3UG1A 4PP7A 2ZM4A 2O65A 3QRKA 3R7OA 2VD5A 4TN6A 4EZ7A 3ITZA 4IJPA 1U54B 4CRSA 3R73A 3IS5A 2PWLA 2GNJA 3KXNA 5FBNC 4UWYA 4R7IA 2V55A 1PMVA 3QD2B 2YDIA 2QLQA 4ACDA 4CFVA 5BVOA 5L2IA 2I40A 3QU0A 3QUDA 4J97A 4UMRA 1XH8A 4AFEA 5DYJA 3FC1X 3ZLYA 1ZOHA 2BRMA 4UN0C 4KIQA 2E9OA 3SKCA 4BDAA 3DAKA 3RALA 3KF7A 4D1ZA 2X9EA 4LFIA 5GIOE 3DNDA 4TNDA 2W9ZB 4ACHA 5I9ZA 4LUEA 5D7VA 3PLAE 1OMWA 2UZOA 1RJBA 2UW6A 3MVJA 4GT3A 3FDNA 2JITA 5HX6A 3COMA 3BU3A 1IG1A 5I9UA 1FPUA 4LV8A 2X4FA 3VUKA 3TG1A 2BDFA 3KRLA 2IG7A 1Y8GA 3QX4A 4YU2A 2X8IA 4FIGA 3OFMA 3RKBA 2BRBA 1XH9A 4EHEA 4E73A 5C8KA 4GSBA 4DG0E 1YOLA 5I9VA 2JFLA 2XYNA 4FT9A 3CXWA 1AGWA 2VTLA 3IKAA 2XIZA 4H1JA 4IM3A 4ASXA 1F0QA 1SMHA 4I0TA 4YTCA 4FV1A 2PUNA 1RE8A 3KGAA 4IQ6A 4D5KA 3UVPA 3OC1A 1ZRZA 3H9OA 4AOTA 4GK4A 3ZUUA 2HIWA 4OT6A 3TNHA 3WYXA 2QD9A 2A1AB 4WA9A 4NEUA 3R30A 4MWHA 3V8TA 4CLIA 5HORA 5LCJA 3DKOA 3EZVA 4X0MA 4CTCA 2BRNA 4PUZA 4IHPA 4BDEA 5DT3A 5IQAA 4DGLC 4MXAA 2O0UA 5HI2A 5L8LA 3EQGA 4FZFB 4IJ9A 4XG7A 3JVSA 3ERKA 3RBWA 4EUTA 2VWZA 3OW3A 2GHLA 4DH1A 3HA6A 3MVHA 4IB3A 2HZIA 3V5LA 5HNBA 4WOVA 3D7TB 4EYJA 1PMNA 5CEOA 1WAKA 2W0JA 2B53A 3AMBA 4O21A 4RZVA 4C2WA 4AE6A 3VIDA 4A07A 3PPKA 1WBNA 4XYFA 3EN4A 5IDPA 2IZTA 3MVMA 2YCQA 3MVLA 1WVWA 2OH4A 3W8LA 1HCKA 3A7HA 4TRLA 4TYIA 5HE1A 2VTIA 1PXNA 2PSQA 1LR4A 3NW5A 5GJFA 4BGQA 2QR7A 4FC0A 4N6ZA 1WBVA 3OUKA 4RSSA 5IQIA 3P7AA 3RAWA 4A4XA 4D28A 1OBDA 4EWQA 2X81A 2HW7A 2X9FA 5FM2A 3D5UA 2PMLX 3GI3A 3QL8A 5AV1A 3QD3A 4B8LA 4BDGA 1EH4A 5HCZA 5HHWA 3TKIA 4AACA 3U9NA 5IISA 1OIUA 2C3IB 4DTBA 5BUJA 4O82A 2HXQA 2C47A 4QMMA 3EKNA 4ENYA 1QL6A 4EOKA 3QTIA 4FIJA 4RIXA 4MYGA 2VO0A 4QNYA 4F6UA 3SXRA 4QYHA 2XZSA 4YZBA 5D11A 3FI8A 4BIBA 2WXVA 3OCSA 3ZO3A 4ZJJA 2HZ4A 4EOOA 1VYWA 3C7QA 4ZMFA 2QOHA 1KE9A 1SVHA 1W83A 1B39A 5CALA 2O2UA 4O38A 2OJ9A 1YDSE 2R3MA 3OCBA 4F7LA 2OLCA 3LW0A 4D2TA 4PNIA 3RK9A 4BDIA 3B2WA 4FK3A 4O6LA 2OZAA 1IA9A 2WO6A 4ASEA 2X4ZA 3DXNA 5CNNA 4BZOA 1Q3DA 3I6UA 4F64A 3C0GA 4F9CA 2W7XA 2OG8A 4YC8A 3PPZA 3D7ZA 2ETKA 3RPOA 1VJYA 2W1HA 3HMMA 3A8XA 2Z7QA 4WNPA 5I9WA 4RIWB 4ENXA 3L8VA 2VTHA 3M11A 2R3GA 3SDJA 4ANSA 5HU9A 3NVKI 3PJ1A 1J1BA 1FMKA 2F7XE 5EI6A 2F9GA 1XH7A 1E1VA 4I0RA 5CY3A 2XNOA 4JT3A 2W1EA 3CPCA 2VX1A 2VTMA 1NT2A 3EQPA 3NCZA 3LLTA 2XH5A 2GMXA 3QKKA 4V0GB 1H07A 3EWHA 2B7AA 2FA2A 4RC4A 2I0VA 4YLKA 3REPA 4E4NA 4NSTA 1YI3A 2C68A 4A9UA 3TUBA 4IWOA 5LMKC 3L9MA 4OR5A 3QXOA 3LCTA 4TZRA 4DFBA 1OL1A 4BBFA 2F4JA 2G01A 2IVSA 3DBDA 1JAMA 5EHLA 4EC9A 2PU8A 4P4CA 2RIOA 1J91A 5EM8A 3RCDA 3BU5A 1IEPA 5L8KA 4EJNA 4O86A 3PSDA 4I5PA 5JFSA 4OBQA 4PX6A 4ZTLA 4V04A 2G2IA 4FT5A 4WT6A 2YM3A 2UW3A 4OTIA 5EDQA 4F9BA 5CU2A 4GT4A 2QO2A 5E8ZA 3ZLXA 3AGLA 3HEGA 3R1SA 1DI9A 4FICA 5AIRA 3T3UA 1LUFA 3HUCA 4NYEA 2BIKB 4YJNA 3EQHA 3OXZA 4IB0A 4M15A 2I0EA 2PVFA 4YO4A 3RM7A 4V01A 2XVDA 2PTKA 2WKMA 4RIYA 4W8EA 4MXCA 3S2PA 1FGIA 1FVRA 1T46A 3P78A 3IONA 4OTPA 2OIBA 3WE4A 4KABA 1KOAA 4JBVA 4AP7A 4CKJA 4EOIA 4KAOA 4USEA 4GG5A 2JEDA 3QHRA 3EFKA 4IH8A 3LQ3A 3W2CA 5BQ0A 5J5SA 1NVRA 2OH0E 5T3QA 4U81A 4F0GA 2OWBA 4BCGA 5FEEA 4HW7A 5IA5A 5E8SA 4RGJA 1PRYA 3KFAA 3R8UA 3T9TA 3FXWA 5E91A 5EM7A 4BIEA 3GEQA 3AD5A 4W9WA 2PUPA 2W4OA 4KWPA 5FLFA 5M53A 5DMZA 3COHA 4HZRA 1Q8WA 2GHMA 5CSVA 4MD8E 3QTXA 3MN3A 4FTKA 5HIDA 4XNEA 4F99A 3G51A 3TM0A 4GKIA 5IH5A 2YCRA 3CGFA 2C6EA 5GZ9A 4Z55A 2PZIA 4OBOA 4WNKA 2B55A 2JDOA 1ZOEA 4ZY4A 4DA5A 3SD0A 2CHLA 3KRRA 4EONA 3SA0A 3NSZA 5LVPA 3OTUA 3ZFMA 2WTCA 2BVAA 4MXZA 5IQGA 4J8NA 5AAEA 4EOMA 3BELA 4D2PA 4FSMA 3RPYA 4XV3A 5FUTA 5TOZA 3RK5A 5JQ5A 4S34A 1W7HA 5KCVA 2JLDA 4JG7A 2CMWA 4HJOA 5AP2A 4PL4A 2JGZA 4FSTA 1M17A 2YJSA 4X3FA 2UZNA 4JS8A 3DK7A 5C1QB 3HV4A 2QCSA 3C51A 2C30A 3ORPA 5AX9A 3U9CA 3BBTB 3ENMA 2IVUA 3C1XA 2EWAA 3AGMA 2OF2A 3NYNA 4CFXA 3FMHA 2RG6A 1XH6A 3FYJX 2JIVA 4QPAA 3C13A 3ZYAA 3QAME 4BHZA 3Q2JA 3IPHA 2ERKA 1KE6A 5M08A 1OL7A 4E3CA 1WCCA 4FIFA 3VF8A 1Q5KA 2I0HA 2YISA 4Z3VA 5EOBA 1FBNA 2VTAA 2GSFA 2JKMA 4DN5A 3EJ1A 3TNPC 1Y8YA 2BCJA 3ZOSA 1URWA 4RWJA 2ZMCA 5ANKA 3TDVA 2XK3A 3PIZA 2DQ7X 1PY5A 4Z16A 1RW8A 3TNWA 5KBRA 2CKEA 2BKKA 3RZBA 4FYNA 3GXLA 2PY3A 4JQ8A 4O91A 5FEDA 5DN3A 5BYYA 3PP1A 3C4CA 4K1BA 4U41A 4OTDA 3ZM9A 3VS6A 3M1SA 4DTAA 2WEIA 4FKRA 2C5XA 1CMKE 1U54A 1WMKA 3H4JA 5AFVA 3PRFA 4XH6A 4O0XA 3A7GA 3DKCA 2PZ5A 1CKPA 3EL8A 4FV5A 4EL9A 3TZ9A 4EZ5A 2PZRA 3G9NA 1IAHA 2UW9A 1UU8A 5D41A 5LMBA 4FZDB 5TF9A 5EDRA 1G3NA 2XNGA 5A3XA 3O8TA 4ZLYA 1OB3A 1PF8A 4RIOA 4BI2A 3ATSA 5C4LA 4CQGA 3GGFA 2ONLC 4IXPA 3ZEWA 4C38A 5DR9A 3EFWA 4EH4A 4UWCA 3VRZA 4L68A 2Y4IC 3GC0A 3HP5A 3DK3A 3QWKA 4X3JA 5AUWA 4ZK5A 4UBAA 4JR3A 3TXOA 1J7UA 5DIAA 4PPCA 2JDVA 3CE3A 1R0EA 3QTWA 5CT7A 4D1SA 5C4KA 2JFMA 3BX5A 2QOQA 4FUXA 1GJOA 4H39A 4Q9ZA 3BEGA 1UU3A 2Y0AA 5M4IA 4DCAA 4RC2A 3QQKA 5DI1A 2G2HA 2P2IA 3IG7A 4Y72A 1W82A 3LFNA 5HBEA 5B2KA 1GZOA 5M4FA 5ANGA 4O7SA 4J8MA 4FODA 4JIKA 4ZSGA 3G15A 2BZKB 5EK7A 1H8FA 2IW8A 3LFCA 3UZPA 2VWYA 4FV7A 5KZIA 3BYMA 3F2AA 1TVOA 4AW5A 3LZBA 1XO2B 2HELA 3DJ7A 3D5VA 3POZA 1PXMA 3SRVA 4UMUA 4PTEA 1O6YA 3TZ7A 4J7BA 4IFGA 2Q83A 1UWHA 1P4FA 3GFWA 2VWBA 4QTEA 5DR6A 5BX0A 1PKGA 3B8RA 1Q41A 3E3PA 3R1YA 1YXSA 5EQYA 3OY3A 5EKNA 1Q8TA 2RG5A 2Y9QA 3QCXA 3D7TA 3HDNA 4EH2A 4GU9A 5BMMA 2FSLX 4CGAA 5A9UA 4M8TA 4D5HA 3IO7A 4DGGA 3UOJA 4BCOA 3NW7A 3U54A 1NVSA 4IAZA 3ZBXA 1P5EA 4ANQA 1CTPE 4X21A 1GY3A 2VTNA 4IANA 3NYXA 2XRUA 1TQIA 4FT7A 4XBUA 4MQ1A 3HL7A 4MBJA 3V51A 4AA5A 5BYLA 4GEOA 4AQCA 2ZV2A 4XG3A 3NUNA 5FD2A 3BRBA 4QMTA 3RAKA 4NTSA 3D5WA 2XK7A 4MF1A 4W9XA 4MHAA 1SNUA 4IC8A 4BCMA 5AM6A 5CU6A 5HTIA 1H1QA 5D7AA 3CBLA 1YRPA 5CF4A 3I1AA 3OXTA 4QP6A 4H3QA 3RJCA 3ODYX 4NJ3A 4L3LA 4JDIA 4JRNA 5IEXA 3VS3A 3O23A 3ZUTA 2EB3A 3KK8A 5J9YA 4NIFB 4P5ZA 4WIHA 3LMHA 1E1XA 3HLLA 3UODA 1B6CB 4FTCA 2BAKA 3RGFA 3SOAA 3WZUA 5HZNA 4E93A 3E8EA 2O63A 3C4XA 2WGJA 3AMAA 2DUVA 3NAYA 3G2FA 4EK8A 3QZHA 4QP7A 1OIYA 4BWKA 2QO9A 2W4JA 1ZLTA 5TT7A 2B1PA 2QVSE 4ONAA 3BHHA 4JDKA 5L8JA 4ZEGA 5DRBA 4GK3A 4MH7A 5CEKA 1GNGA 3MB7A 4BGHA 4RWKA 4G3CA 3UG2A 4CVAA 3KKVA 5E8UA 5CEPA 3QZFA 5E1EA 2YM5A 3KA0A 4KS8A 3TZ8A 3EOCA 4EHZA 5HVKA 2VNWA 3I81A 5I5ZA 3EFLA 3F5GA 1KSWA 3N9XA 3BU6A 1VYZA 4RJ5A 2NRUA 4RIWA 4M69B 3LFEA 4UZHA 3VULA 1ERKA 1W0XC 1H01A 3DLZA 2UZDA 2XK4A 3V04A 2R4BA 2R5TA 4L8MA 2OGVA 3RWQA 3MESA 2EXMA 4WG3A 2W4KA 4AWIA 1GOLA 2GTNA 4D9UA 2YM4A 2YITA 3EN7A 4U5JA 3PJ3A 4I22A 4GKHA 2PK9A 3AC4A 4IBMA 4V0GA 2J0KA 5TKDA 1V0OA 1M7QA 5IQCA 1M2PA 3NIZA 4EI4A 4YR8A 3L9PA 2QOBA 3DAJA 1BKXA 5DWRA 4I93A 1GAGA 2BFXA 1UKHA 4YMJA 3FMKA 5IA3A 2PVJA 2W5BA 3CQEA 4APPA 4O0UA 2P33A 4NCTC 3LE6A 2XEZA 3OVVA 3QD4A 1URCA 2UV2A 3QYZA 5E90A 3P0MA 3R7IA 3PE1A 3FY2A 4UXLA 2UW7A 3Q9YA 2FGIA 4J98A 5IPJA 4RX9A 2AC3A 3UP7A 3ORNA 1MRUA 4K9YA 4JG6A 5TE0A 5HD4A 2C6KA 3AC1A 1QPDA 4AZFA 4M0YA 4J99A 4FKJA 2X1NA 4GIIA 3UO6A 4F7SA 2R3KA 5A4TA 2UW4A 4GT5A 4IVAA 3LCOA 3B2TA 1YXTA 4PQNA 3MH0A 3KULB 2OZOA 3I60A 3OUNB 4O84A 2OXDA 2PMNX 4X2NA 4Y46A 1ZY5A 2WMSA 3F9NA 3GOPA 3PJ8A 3UQCA 3E8NA 3A2CA 3NEWA 5AM7A 4GV1A 3GBZA 5AP0A 2CKQA 2C6MA 4DC2A 3ZU7A 4IX4A 4DINA 3JYAA 5EG3A 4KIKB 5LCKA 3UNZA 4G5PA 4FVRA 4OTGA 3V5JA 5C03A 3VJOA 4IAYA 4E5AX 3QUPA 1Q97A 3BBWA 4G2FA 2OIDA 1W84A 1XH4A 3GU7A 1H1PA 4BTKA 1QMZA 4F6WA 4YLJA 1XQZA 3CTQA 3ORZA 3PA5A 1JSUA 4J52A 5AR8A 1YXUA 2X8DA 3PVUA 2J0IA 5C9CA 3RAHA 4KRDA 4AOIA 2FSTX 4YBJA 5J7HA 2W1DA 4D2WA 3IQ7A 4XBRA 1Q8UA 3EQDA 3RTPA 4CG9A 2ITPA 4B9DA 3DTWA 3H30A 4FVPA 1ZAOA 3BV2A 3Q9WA 3TNQB 4GS6A 1H1RA 2GPHA 2BZIB 4FX3A 4R7HA 3DT1A 4C37A 3PY0A 5KMOA 4FE2A 5EYDA 5AA9A 3P9JA 4QRCA 5DG5A 2VX0A 2XKFA 3RHXA 5CF6A 2PMIA 4HNIA 5AA8A 2EB2A 2VWIA 3GU8A 4N4SA 3QA0A 4YP8A 4XRJA 3A7IA 4ZSEA 3ULZA 3ZHPC 4AA4A 3LLAA 2CLXA 2QQ7A 4FTTA 2JAMA 1BYGA 5CVGA 3QQHA 4FGBA 2ONLA 2XCHA 3NNXA 3ZONA 4CFFA 3HDMA 4JX3A 5CASA 3IDCA 5DOSA 2KTYA 5CEMA 4OAVB 3FC2A 5EHOA 4C57A 4DFZE 2XNNA 2JDSA 3PSBA 3LMIA 2ZJWA 1OUYA 4LRKA 3D94A 4AZVA 1YOMA 3DFCB 2I6LA 3PA4A 4EH3A 5JRSA 3UJGA 3NUYA 4AZWA 1JSVA 3V5QA 3W2RA 4HOKA 3W1FA 4QNAA 5KNJA 4BGGA 1ZYCA 3R02A 1M52A 4L7SA 4L42A 2VU3A 4RC3A 3R8VA 2ITUA 5H2UA 3GVUA 5IA4A 4DF3A 4FTIA 2BTSA 4MCVA 3SG9A 2CGWA 4NM3A 4TXCA 2PVLA 3O51A 1HOWA 2J90A 1NVQA 2OW3A 1WFCA 3II5A 1O9UA 4FBXA 4PTCA 3F82A 2O3PA 4RVLA 4YO6A 2FVDA 4GVAA 4LQMA 2R9SA 5FDXA 4EK4A 3E93A 3QCYA 5E8YA 5JQ8A 2R7IA 1UU7A 3HMIA 4F9AA 3V5TA 3EQBA 4ZP5A 3LOKA 2DS1A 4GL9A 4MNFA 3UIUA 2OKRA 2WB8A 3EN6A 3LCDA 1SZMA 1XBBA 4AGUA 5KMLA 3BGPA 4CFMA 4H05A 3BHUA 4BDDA 2XIRA 3PPJA 4LM5A 1R1WA 2XA4A 2ZM1A 4JX7A 3RAIA 5KKRC 5DE2A 3R1QA 2R64A 3PSCA 3DZQA 2VWVA 3SHEA 3D4QA 5FP5A 1UVRA 2OU7A 1PJKA 3QGWA 1JPAA 2VUWA 3SV0A 4ALVA 3DBFA 4L53A 3R7EA 4X6RA 3MFSA 4M97A 4O2PA 5HNGA 3H9RA 4O1PA 4OGRA 5K3YA 2QLUA 5BMSA 5FP6A 3GU6A 3ZO2A 3FPMA 3QQLA 2UW0A 2EU9A 2WMWA 3SXFA 4DH5A 2RFDA 5L2WA 3PJCA 1STCE 1T45A 1I44A 2X2LA 4OTQA 5EI8A 3V3VA 3VQHA 5DNRA 4DH8A 3DLSA 3AD6A 4HYIA 4ZAUA 3IECA 5IUIA 5JSMA 4O7VA 4YHTA 5L6WL 2HW6A 3CD8A 4ID7A 4J53A 3MV5A 2XKEA 1V0BA 4YNOA 3F6XA 3NCGA 4RG0A 2XJ2A 2X0GA 3IGGA 2WEVA 1S9JA 2KULA 3HNGA 4PWNA 4L3JA 3UNJA 5L2TA 2C6DA 4AT3A 3UIXA 3WBLA 4CQEA 3RPSA 3V5PA 4GMYA 2IZUA 3IGOA 2F7ZE 5DEWA 5AMNA 3G5DA 1Z57A 2Y4PA 3DV3A 2WMBA 4Y83A 3OD6X 3WF8A 4G9RA 2VV9A 3R00A 2YM6A 3Q4ZA 4DH7A 2WQMA 4UV0A 4LG4A 5L6OA 2R3IA 2UUEA 5HE0A 3RMFA 4DEAA 4I6FA 5K0KA 3QALE 4E4XA 3CS9A 5C8NA 1OIRA 3BYVA 1J1CA 4ZY6A 5AUTA 4L6QA 4MBIA 2DYLA 5LVLA 3UPXA 3HAMA 3SX9A 4BKYA 1R3CA 3P86A 4BCFA 4RFMA 1JBPE 4HPUE 4IWPA 4L52A 2OSCA 4U43A 4YHFA 5CXHA 5HBHA 3TDWA 4FKVA 2PVHA 3POOA 1QCFA 4EH8A 3FL5A 2XK6A 4BYIA 2J5EA 3CY3A 4UB7A 3MGYA 3FSFA 5CEIA 3LCSA 3PY1A 3Q2MA 3VW6A 2BAJA 2C0TA 3ACKA 4FKTA 2ZOQA 4WNMA 3LXLA 4AE9A 2XNEA 4YJQA 1LEWA 2GS2A 4M3QA 4O2ZA 3GCSA 3UYTA 4B0GA 3HMPA 5JZJA 4EJ7A 3TKUA 3VUHA 4WHZA 3SRVB 4QMOA 4BF2A 5J8IA 1VEBA 1XR1A 3MA3A 3I5ZA 5E92A 4XV9A 1OL2A 3LVPA 3VC4A 3RM6A 4FV9A 4TNBA 5I3RA 1H28A 1QPEA 2VO3A 4NCTA 4BCPA 3W2PA 5E7RA 1JLUE 3S0OA 3GUBA 3MFRA 3AT4A 3OHTA 4NIFA 4UMQA 2A0CX 1ZARA 3BYSA 3R9HA 3TV7A 1JWHA 3CD3A 3KXXA 3QUEA 4N6YA 4XV1A 3QYWA 3R01A 5BPYA 1KE8A 5CYIA 4LV5A 4JQ7A 3B8QA 5A4CA 1Z5MA 4CFNA 1WBWA 3KXMA 2EVAA 3EQRA 2UZEA 3CKXA 1BLXA 2JBOA 3G6GA 3LCKA 3R7UA 3QZGA 3QF9A 3OWLA 4GK2A 4S2ZA 3OS3A 4UWBA 1KV1A 3GCUA 2QURA 4FNWA 4RWIA 5JZNA 3FY0A 1CSNA 3LXKA 3FMJA 4DFLA 4X2FA 4PTGA 3PRIA 1OECA 3MI9A 4PMTA 5HEZA 3R2BA 3UOHA 4FVQA 3T3VA 3VBYA 4DGMA 2P3GX 2YLEA 1ZZ2A 4ITHA 4M69A 1R78A 3HRFA 4FSYA 3HECA 3SLSA 5EM6A 2BAQA 4PF4A 4G3FA 4QP8A 2HXLA 5LVOA 3NPCA 4CG8A 4HYUA 3ACJA 3Q6WA 5IUHA 3HYHA 5HLNA 3VF9A 4NKAA 2WELA 4CZTA 4PDYA 3V5WA 2B52A 4RA4A 3RI1A 4YUQA 2CGVA 2AUHA 4LOQA 4F63A 4GFMA 3P79A 4F70A 1B38A 3ZLSA 4ZMEA 4EKKA 3MH1A 3JY0A 4C3FA 2QC6A 2X6DA 3MFUA 4L00A 5AAGA 5IEVA 5KBQA 3P4KA 4UZDA 1PMUA 2HK5A 5AP4A 3ZUVA 4YTFA 1SM2A 1AQ1A 2QOCA 3O96A 4IAKA 5AP7A 4ZTMA 4C62A 5BUIA 3DXPA 3UQGA 3VAPA 1HCLA 5AP1A 4O7TA 3CY2A 4I0SA 2R3NA 3CQUA 5AUZA 4WKQA 3NZ0A 1J3HA 2XM9A 2UZLA 5CSWA 4UYNA 2NPQA 3PUPA 2WTWA 5CU0A 4KBKA 5AUVA 4BDKA 3BGQA 2Z7SA 4XCUA 4YTHA 4DTKA 3TTJA 3LFAA 1Z9XA 5ANIA 4E1ZA 3KULA 3T9IA 4QYFA 3F7WA 2C5NA 3AD4A 1NW1A 1KV2A 2DWBA 2GS6A 2QOKA 3EIDA 4C3RA 4EORA 5HG8A 5CZHA 5HBJA 2WHBA 3BLQA 3ZFYA 1JNKA 3ORXA 4I23A 3L9NA 4GFOA 4RX8A 4KIKA 5TO8A 4HVIA 1K9AA 3MY0A 2R3QA 4QMYA 2YIXA 2XM8A 4B99A 4HNFA 3EHAA 4S30A 4JDJA 4APCA 2W96B 2CGUA 2X2KA 2YM8A 3WZKA 4PDOA 4O7WA 3VBTA 3ANQA 3QWJA 4BIDA 2GDOA 3AXWA 4IZAA 5M09A 4XX9A 3BE9A 2G15A 3HMOA 4YBKA 5J95A 5LJJA 5IU2A 1H0WA 4HGLA 2NP8A 3D9VA 5FBOA 4JDHA 3LXNA 5EM5A 3PA3A 2QU6A 3OP5A 4ZIMA 4A06A 3VS0A 4RZWA 4QYYA 4Z7HA 4JBOA 3MTLA 2C69A 1L3RE 2VZ6A 2UVYA 3V8WA 3GOKA 3QXPA 3LAUA 3R21A 4FIHA 4FEVA 3M2WA 4FR4A 4QO9A 3K3IA 4FSNA 3PXYA 4RX7A 5BUEA 5FXQA 3R9DA 4EQMA 5BVKA 2CKOA 4QYGA 4GCJA 3BLRA 5HTCA 1PMEA 4QP4A 2FO0A 2PYWA 4O1OA 5J87A 3F3UA 5D10A 3PVWA 3FZSA 2G9XA 2FSOX 2WMTA 3KQ7A 4YC3A 3VS2A 3GT8A 4QQCA 2WQBA 4M67A 4ZTRA 5KZ0A 3QC9A 3WF5A 4JI9A 3QLGA 4PL3A 4FSQA 4LL5A 1ND4A 3TV6A 3UPZA 5KE0A 3OT8A 3FI3A 3VBXA 4WG5A 3GB2A 3VWAA 2J50A 4E5WA 2XIKA 3GCPA 4U44A 5AJQA 4BCQA 1FQ1B 1WZYA 1OITA 2WOUA 4S32A 3PLSA 5LWMA 2UZVA 5LVMA 4IVDA 2PUUA 5GJDA 4AUAA 4YZCA 5A4QA 3HRBA 1MRYA 2ETMA 4G16A 2GCDA 3NNWA 4ZSLA 4KBAA 4YPSA 2HYYA 3ETAA 1ATPE 3GCVA 3R0TA 1PYXA 5AR7A 1QPCA 2CGXA 4Q9SA 5AUYA 3PP0A 3JVRA 5J7BA 4ZTSA 3UNKA 2ZB0A 2A27A 4WUAA 5ETAA 3I4BA 4BVUA 3HMNA 4RLLA 2CNQA 3FLYA 5FG8A 2HZ0A 4UY9A 2Y4IB 5ETIA 4O81A 3FMEA 4D2RA 2HENA 2H6DA 1WBTA 1FINA 4AGWA 1J7IA 4X7QA 2V22A 5DH3A 3H0ZA 4MK0A 4P2KA 5EH0A 3EQIA 4L45A 1ZYDA 2YIWA 4YJOA 4C59A 5IMEA 4RFYA 5KMNA 4ZSAA 4C58A 4IX6A 4XEYA 4K6ZA 4DEHA 3E8CA 3AQVA 3MDYA 3BIZA 4YHJA 3FQEA 4DBNA 3C0HA 3W2OA 3PXKA 1UA2A 2WTJA 3IW6A 3L1SA 4DAWA 4KUJA 2OJGA 4Y73A 1V0PA 2WTVA 5FDPA 3ZTXA 4FOCA 3MPAA 4G31A 4XHKB 1OGUA 4MD7E 2VTRA 3DK6A 4I1ZA 2QOFA 3KY2A 3P7CA 2WTIA 3DBQA 5F1ZA 3F5UA 3HX4A 4DH3A 4AW1A 3DQWA 1TKIA 4O7YA 4BI0A 4E6AA 1OIQA 4LRMA 3QA8A 4H3PA 2JKOA 5CLPA 2ACXA 4AZSA 4DFNA 4ZS4A 4A9RA 4OT5A 4BTJA 2PVMA 3NDMA 4FK6A 4G3GA 3RPRA 2YZLA 2XRWA 4XV2A 3KRWA 3I79A 3WIGA 2ITNA 3NRMA 1TQMA 4WSYA 5A54A 4OTRA 5JKGA 4DEBA 3L8SA 3WF7A 4CXAA 4GJ3A 5CXZA 2CNUA 3MTFA 4FKOA 3SVVA 4DT8A 3QHWA 3D5XA 3LFDA 3HRCA 5IH6A 2J7TA 2W1ZA 5IQBA 3GFEA 2YEXA 1DAWA 1XH5A 2JDTA 3ORLA 3UTOA 2YACA 4GYGA 4NW6A 4QMXA 3V6SA 3LKMA 3U6IA 5CI7A 4EBVA 4FI1A 3HV7A 4ASZA 2CPKE 1PXPA 2WNTA 4AG8A 5AADA 2XK8A 2FUMA 1NA7A 2FYSA 4IE9A 5FWKK 5CANA 4FEUA 4L01A 3KRXA 4RJ3A 4XUFA 4ZXTA 3UQFA 2XNBA 2JIIA 5AV4A 4H1MA 4HVSA 4GIHA 3MS9A 4LGDA 2BPMA 2E2BA 1GZNA 4O7NA 4AS0A 3NYVA 1LPUA 4BDJA 4EK3A 2GQGA 2WAJA 2A19B 3PYYA 4D4YA 5KUPA 3BV3A 2UZTA 3E63A 2H96A 3OG7A 2J4ZA 2R3LA 4DFXE 4GUEA 5K0XA 5AR2A 1M7NA 4FIEA 4L43A 4FKUA 1I09A 4KBCA 4A7CA 4E6DA 4NW5A 3ZFXA 2EXCX 5FQDC 5HG7A 4C2VA 4J1RA 4DE4A 2BMCA 3A99A 1PXLA 4IEBA 5HG5A 4MQ2A 1OKZA 5A46A 1AD5A 4RJ4A 2C6LA 5HVJA 2IW9A 5ICPA 2VTSA 3ANRA 3IW5A 5HU3A 1H26A 4I6QA 4IX3A 4G1WA 3MBLA 4FKIA 3MFTA 5KX8A 4QMZA 3FZTA 3QCQA 5I9XA 1P14A 3TIZA 3R8LA 1P2AA 3O7LB 4BC6A 2REIA 4C7TA 1UV5A 5K9IA 4NFMA 4C4JA 1SNXA 2QI8A 3JUHA 1FMOE 3QGYA 3WZEA 5JK3A 3SW7A 1DM2A 3SAYA 3ROCA 5BVNA 5IKWA 4J95A 3ORMA 4LMNA 1H08A 5A4EA 5KMJA 3Q3BA 4CV8A 3PG1A 2W06A 3FE3A 1XKKA 3Q04A 4YLLA 3ELJA 4ZS0A 3F3TA 3UVRA 3BLHA 2ESMA 3MWUA 2XJ0A 4C4EA 1GIHA 2ZMDA 4E26A 5LMKA 5EQEA 1R39A 2RFEA 3C9WA 4UX9A 3BHYA 3BPRA 1REJA 5CS6A 3ZSIA 3HAVA 2YM7A 1V1KA 4BDCA 1BMKA 5K4IA 1FVTA 4JXFA 2JC6A 2W05A 4G3DA 1G8SA 3GCQA 3EMGA 4XMOA 4I21A 3VHEA 4ITIA 2QR8A 3DB6A 3LFBA 4W8DA 3U6JA 1U5QA 3NS9A 3ID6C 5IH4A 2WMVA 4NM0A 5CWZA 4Z9LA 2Z8CA 5B7VA 2G1TA 4OBPA 2FH9A 3FMMA 3KEXA 4LGGA 5GINE 4I4EA 2I0YA 5CSXA 4D4VA 1XBCA 1E9HA 3PXFA 2WQOA 4I20A 4RJ7A 4N0SA 5FEQA 5HVYA 4X2JA 4FKPA 4CT1A 3ZSGA 5ETFA 4IM0A 1M14A 1H1SA 1KWPA 2LGCA 5CZIA 5DFPA 4EOLA 2BR1A 5DRDA 5ITAA 4O6EA 4EQCA 2XMYA 3F66A 5AR5A 3N4VA 1H27A 3W10A 3BI6A 4CFWA 2XIXA 2ZV8A 3K5VA 4JL9A 5FRIA 5HICA 5IG1A 5L3AA 1A48A 4F1MA 2BFYA 4JQEA 3R1NA 4R3PA 4G9CA 4G34A 5G1XA 4M7IA 5H9BA 5L4QA 2HAKA 2QOLA 2P0CA 1UNHA 2GQSA 4DHFA 4LRJA 1ZZLA 3I6WA 1GZKA 3VBQA 3UOLA 3RK7A 1OL6A 1FGKA 4U9AA 3R8ZA 3ZRLA 3UIMA 3PIXA 5D1JA 4I6BA 4F7JA 3VO3A 3OBJA 4IB1A 3LHJA 4WG4A 5CVHA 5FGKA 2ZAZA 3S95A 3U6HA 4YPDA 2Z02A 5AWMA 3CSVA 4K2RA 2PVYA 3BEAA 4CCBA 4KNBA 3V8SA 4EOJA 1VR2A 3F5XA 1OKVA 2X7GA 3HKOA 3E5AA 1CM8A 3PE2A 2YFXA 3DOGA 3NNUA 4I92A 4D0XA 4F1OA 3TACA 3Q32A 2YAAA 2XF0A 4X6QC 3FKOA 3KN5A 4D0WA 2B54A 2HOGA 3GQIA 2IPXA 3D14A 2VRXA 3RNIA 5JN2A 2WPAA 4PV0A 4U0IA 1NY3A 1YDTE 3OY1A 2YABA 3VS5A 3DY7A 4UMPA 4CTBA 4JOAA 4KD1A 4G6NA 3UIBA 1H00A 4E6CA 2Q0NA 4CKRA 1WBSA 2PL0A 3FKLA 4ZLOA 3O8UA 1ZMUA 3PZEA 4FKQA 5M56A 1MQ4A 4ZOGA 1BI8A 4BDHA 3DDQA 1YW2A 3UVQA 4U3YA 4BDFA 3FEGA 3ZC5A 1G5SA 3AC5A 1LEZA 4IB5A 3OWJA 3N4TA 1Q61A 3EQFA 4EYMA 3OCGA 1H1WA 3BZ3A 2XBJA 2ITVA 3R7YA 3LJ2A 2W1CA 3Q5ZA 4BICA 4IFCA 1DAYA 1YXXA 4ANMA 5CQUA 4AU8A 4DFUA 4QMVA 3LM0A 5E9EA 2XS0A 3ZH8A 4MXOA 4W4VA 1UNGA 4C4IA 2PE1A 1U4DA 4IWQA 2OO8X 5EYCA 1UKIA 3TL8A 4AF3A 1OBGA 5IA2A 4O7LA 3TT0A 2R3RA 3UE4A 5H8EA 4I6HA 4AX8A 3DXQA 3ODZX 4IZ7A 4NK9A 2Y7JA 4O0TA 3PDTA 1ZMWA 2Z7RA 3NAXA 3UGCA 4IMYA 2R3FA 4C4GA 4PDPA 2QNJA 3G9LX 3OW4A 2HY81 5AR4A 3KMWA 5D12A 1MP8A 3IW7A 3DTCA 2W17A 3LFSA 4WSQA 2W1IA 2OICA 3Q9ZA 5E8TA 3FL4A 5JGBA 4FEWA 4S31A 1Y6AA 2YN8A 3H3CA 3W18A 3VUIA 4F08A 3GNIB 3UBDA 2VNYA 4R8QA 4GH2A 4FMQA 4TYGA 3VJNA 4O83A 4D4SA 4I5HA 5CENA 5KKRB 4XP0A 3KU2A 4RPVA 3BHTA 3BCEA 4FKLA 4DEIA 2OK1A 2PZYA 3UYSA 2OFVA 4I5CA 3VBWA 4NWMA 2I1MA 4EOSA 3LMGA 3VN9A 5FTQA 3P1AA 3W33A 5BNJA 2XK9A 3LFQA 2RFNA 4YJRA 1PKDA 4RFZA 2YERA 3CKWA 3IK3A 4MXXA 3TI1A 4XLIA 2J51A 4D4RA 3TJCA 4EH9A 4JLCA 4TT7A 4ZZNA 2QG7A 2J6MA 4UYAA 4D58A 5DT0A 2XNMA 3D15A 3ZCLA 1JVPP 4TKSA 1OPKA 2XYUA 4FEQA 4FYOA 4U80A 1U46A 3S4QA 4P5QA 3PG3A 3R04A 4BBEA 4XS2A 5M4CA 4KRCA 1YWVA 3WIKA 4MD9E 3C4WA 3CP9A 3I7CA 3WYYA 3OCTA 1BUHA 3HUBA 2GNFA 4DEGA 4I5MA 4E4MA 2B9IA 4NJDA 2NO3A 2QOOA 3COKA 3A62A 3E7VA 5DA3A 2HWOA 4ZTQA 4R1VA 3AOXA 4USFA 4IACA 4OTHA 2BILB 1ZMVA 1Q62A 5GHVA 3R9RA 4DT9A 4EQUA 4D55A 5LOHA 3NX8A 4JAJA 5EYKA 4WBBB 2IZRA 5C01A 2GS7A 3GP0A 1SYKA 4I3ZA 4FG7A 3VS4A 1IASA 4M66A 4TYHA 1K3AA 5KMKA 4RVMA 2XUUA 1KUTA 2VTJA 4IDTA 4PMSA 3F7ZA 5FM3A 3EKKA 2HCKA 1XHAA 3GC9A 2P55A 4RQKA 4YZNA 5CSHA 5HO8A 3ZDIA 4ERKA 1A06A 3QTUA 2OJFE 2VO7A 4EH7A 5B0XA 1Q8YA 3D0EA 4EOQA 1OPJA 4ORKA 4O0WA 1QPJA 2V0DA 3FHIA 3PVGA 2BTRA 2SRCA 4NU1A 4PPBA 1P4OA 3BWFA 3MW1A 5HIEA 4IX5A 1IRKA 4MWIA 4C0TA 5IDNA 1REKA 1WBOA 4MNEB 5ACKA 3NVMB 4KA3A 4U8ZA 2CJMA 3HV5A 1BL7A 3HV6A 4JBPA 1RQQA 3V01A 3ZXTA 4BTMA 5ANJA 4PDSA 4U42A 4YC6A 2ZYBA 1JKSA 2IW6A 3DBEA 1KE5A 4IVBA 3BYOA 2BDWA 5CAVA 4MF0A 4YJPA 4A9YA 3FV8A 2J5FA 4WBOA 2JKKA 3LXPA 3R63A 2GFCA 3UC4A 4FV6A 4CYIA 4EWHA 4A9SA 2W5AA 3QQGA 4FTAA 4FT3A 4MXYA 1L8TA 5M06A 5L6PA 3QQUA 4NUSA 4O96A 2WMUA 2RGPA 2J0JA 1YWNA 4O0VA 5DLSA 4FTJA 4USDA 3ZXZA 2F7EE 4EUUA 4TWPA 2QHNA 1CDKA 3FQHA 4YJVA 3DU8A 1RDQE 3VQUA 3KMMA 3KN6A 2R2PA 4K8AA 3PXRA 4O27B 5J9LA 1UNLA 4QQTA 3IOPA 5HGIA 3QRJA 5KMIA 3FMDA 3TUDA 3QRTA 3FLWA 1YWRA 5I4NA 4MBLA 4BCKA 1PXIA 3CIKA 3EL7A 4WNOA 1J7LA 3EN9A 4L46A 4DEEA 4U40A 1JOWB 3KREA 1ZYJA 4RVTA 5HD7A 4ALUA 4BI1A 5EYMA 4F65A 3ORTA 4QD6A 4CV9A 3KB7A 5IQEA 2WZJA 5KO1A 5HE3A 4FL2A 4B8MA 3W2QA 2WIHA 4B6LA 3ORIA 3FI2A 3D83A 3TWJA 2ZVAA 2UZWE 3VVHA 3L8PA 4C34A 3GC8A 4MX9A 3OEFX 5EKOA 3WE8A 4FL3A 4HYHA 4E20A 4X3FC 4W4YA 3SGCA 2X7FA 4G17A 3KK9A 1X8BA 2R3OA 5DHJA 4X2KA 3RPVA 5KMMA 1YQJA 5DR2A 4NM7A 5IQHA 4P90A 4HVDA 5LVNA 4QT1A 4FKWA 3R9NA 2QU5A 4R1YA 1PXKA 3QTRA 2FSMX 2OI4X 5DPVA 2V7AA 3DCVA 4BZNA 4RJ8A 5M4UA 3DFAA 3R6XA 3DB8A
chains in the Genus database with same CATH superfamily
3KL8A 4NZWB 4CNHA 4R5SA 2WMAA 2AC5A 2YJRA 3NYOA 5F4NA 5FTOA 5IA0A 4F78A 4M14A 2VWWA 4W4WA 4CMUA 5EW3A 2A98A 4O0SA 3RCJA 3NGAA 3O8PA 4KIOA 1ZOGA 1F5QA 3OXIA 4RVKA 3TZMA 4YZMA 2GNHA 3AMYA 3NLBA 2Q0BA 3QQJA 4LUDA 3FBVA 3ZDUA 4XRLA 3ZO1A 3ZS5A 3G6HA 5HTBA 4G3EA 3NUPA 3G90X 4FSWA 1APME 2A2AA 4XP2A 2WMRA 2OJJA 5LWNA 5A4LA 2V5QA 2C3KA 5AR3A 3ZZEA 4I6LA 1PYEA 1OUKA 3UOKA 1OPLA 4CLJA 4HGEA 4TY1A 5T68A 3VRYA 4IZ5A 2X39A 4Q5EA 3LQ8A 4I4FA 4IIRA 2VTOA 5JFWA 2G2FA 4TWNA 1G8KA 4UXQA 4GFGA 2XBAA 4EC8A 3NUSA 3QTSA 2GTMA 4CCUA 3ZLWA 2XKDA 1Y57A 2E9NA 3VS1A 3P7BA 3SW4A 2PUIA 3DAEA 1IA8A 2CDZA 4EKLA 3FKNA 5BVFA 1BL6A 3LJ0A 4FT0A 5JT2A 1UU9A 3VUMA 4O4FA 4D1XA 4G6OA 4EK6A 2Z7LA 4FSUA 4ERWA 2AYPA 3GENA 4N70A 5M55A 4Y95A 3OWKA 4YTIA 3E7OA 3KXGA 3F5PA 4YJSA 3KXHA 2YLFA 2BALA 1KE7A 4KINA 3WARA 3W0PA 1Q8ZA 2CLQA 3KIOC 4ANLA 3BYUA 4FZAB 2R7BA 4FL1A 4UALA 2PULA 3MPMA 1WBPA 2QG5A 1R0PA 5LARA 4ARKA 4R78A 2J2IB 2YDKA 4QMQA 3Q53A 4GVJA 1OKWA 5JRQA 3R9OA 4FZ6A 4BWPA 3UZTA 5HKMA 3AC3A 5HQ0A 2BRGA 3ZMMA 2NRYA 2B4SB 2BROA 2PMOX 4E6QA 2C6OA 4BTFA 1ZY4A 5IF1A 3CC6A 5HNIX 1YXVA 3R2YA 3R7GA 4K0YA 3TN8A 2C0IA 5EW8A 5LXMA 4XJ0A 3EYGA 1CKIA 2P2HA 5AV2A 4OTWA 3C50A 4FV3A 4J71A 3K2LA 4ITJA 3Q4CA 3C4FA 1MQBA 3PJ2A 2QONA 2GU8A 3HVCA 4AXAA 4AZEA 5EQPA 3EQCA 4DGOA 4F9YA 5GNKA 5CAQA 5CTPA 3E87A 4AN3A 5E8XA 4ANOA 4KS7A 4AGCA 4KKEA 3FJQE 4NL0A 2C1BA 5HE2A 4RA5A 1FVVA 5AUXA 5CVFA 1GIIA 3ZBFA 5DBXA 5BVDA 2OIQA 3O50A 4Y85A 5E8WA 3FMLA 2J9MA 3W55A 4F0IA 3OBGA 5JEBA 4H3BA 3FZPA 4QMLA 3DA6A 4BCIA 4XG2A 3MSSA 3MIYA 4A9TA 2VN9A 5F20A 4Q5HA 4BKZA 5CSPA 3F69A 2R3PA 4RJ6A 4NH1A 4QTDA 4QYEA 3TKHA 4OAUC 2ZDTA 4RWLA 5AV0A 3DNEA 5CQWA 3BQRA 4HPTE 1Q4LA 2UVXA 2CCHA 3F88A 3F2RA 3L9LA 2YA9A 3AC2A 4K77A 3PVBA 5EDPA 5CAOA 3Q4UA 5KHWA 2J0LA 5DEYA 4CZUA 3E3BX 3IOKA 4TTHB 4AAAA 3ZO4A 4LV7A 4JRVA 2NNWB 1H25A 4QP2A 3NUAA 3DJ6A 5CNOA 4FNYA 4LOPA 4DLIA 2XAOA 2BUJA 1PXJA 4FTOA 2PE0A 4F9WA 3Q6UA 3F61A 5BYZA 4F6SA 4M0ZA 4BYJA 5JGDA 2RF9A 3DPKA 4CFUA 3U4UA 5B2MA 5HOAA 4N57A 5E8VA 4AA0A 3IW8A 3FHRA 4NFNA 2XCKA 4YSJA 4Q2AA 5AP6A 4ACCA 2WOTA 2IWIA 2W1FA 4W4XA 3BWJA 5M44A 3DZOA 2BZHB 4CMTA 4RRVA 1SVGA 4FGRA 4AW2A 5CT0A 3QFVA 4ASDA 4AN9A 4AN2A 3H10A 3OEZA 2RKUA 4PY1A 4TPTA 2P4IA 2IF8A 4ZTNA 4R7BA 4BR3A 4QQ5A 3QLFA 4DGNA 4D2VA 3FQSA 4L67A 2IZSA 4U45A 4QP3A 4TW9A 2GNLA 1A9UA 1PHKA 3OT3A 3CGOA 2XJ1A 5M57A 5AX3A 2E9UA 5I9YA 3FSKA 3KVWA 5F95A 3TTIA 3UO4A 3MY5A 4A4OA 4PNKA 4NTTA 2BHEA 5AEPA 4FTQA 3FZRA 2PPQA 4RQVA 1GZ8A 2C0OA 4BN1A 3JPVA 3JY9A 3CTJA 5HESA 3CCNA 4AXFA 3NMUF 3A4OX 3VBVA 3HGKA 1WVXA 4G6LA 1H24A 3D2KA 5IUGA 2C4GA 2X6EA 3WF9A 4EK5A 2C6IA 2ITXA 2WTDA 3FUPA 3MPTA 3P08A 4I41A 3C4ZA 3TIYA 3DJ5A 4UEUA 3FLZA 2BHHA 4QMWA 3CQWA 2R3HA 2YAKA 4XLVA 3KXZA 1O6LA 3FMNA 4WO5A 4F0FA 2Z2WA 5CU3A 1YHSA 2WFYA 5M07A 4R6VA 4AAYA 4MNEA 4JVGA 2GNGA 3MIAA 2QOIA 4KKGA 4L9IA 4HCTA 4BL1A 4ZTHA 4XG4A 3UO5A 3U87A 4BBMA 5HLWA 4NT4A 4QTBA 4BFMA 2E9VA 5ANDA 4PPAA 3KMUA 4CT2A 5K5NA 3S1HA 3VUTA 4EOPA 5AAFA 3JXWA 4IZYA 1KOBA 4GJ2A 5J79A 3Q96A 4XG6A 2R3JA 4FV0A 4M68A 2LAVA 5IA1A 2PVKA 5C8MA 4U7ZA 3QRIA 4FNZA 4ACMA 4JBQA 4TYHB 5ANEA 5HCXA 4C02A 3ROYA 4G5JA 3FZ1A 3WILA 4JJRA 2XEYA 5AV3A 4EHVA 5HG9A 4AT4A 5CEQA 4QMSA 2XB7A 3ULIA 4EH5A 5L2SA 4H58A 2IEWA 1DI8A 1JQHA 2C3JA 3WOWA 4GG7A 4QTAA 3ZM4A 4FG8A 1XJDA 3FLSA 3A61A 3PWDA 3FLQA 1FOTA 4CKIA 5FXSA 2ITTA 3SOCA 4LOOA 4F4PA 1XBAA 4JNWA 4LGHA 3PXQA 4FV2A 2ERZE 2WMQA 4YSMA 4O22A 3CJFA 5AUUA 1JKLA 3BQCA 5E1SA 3BE2A 3E62A 1DS5A 3D2IA 1ZXEA 4TWCA 4A4LA 4FF8A 4M12A 2R0IA 3OOMA 4RT7A 4U3ZA 3F3ZA 2EXEA 3FLNC 5ACBC 4O7RA 1Q3WA 3OTVA 1G8AA 4L3PA 2CKPA 4IWDA 4DCEA 4DEDA 4J96A 2VGPA 4PP9A 3O0GA 3PWYA 5IQDA 3GU4A 2C5YA 3TNIA 3ZZWA 2ZV9A 5L2QA 4QOXA 3GC7A 3DDPA 3I7BA 2IJMA 2WMXA 4QQJA 4BRXA 4C4HA 5CU4A 3ENHA 3HP2A 3MH3A 3QD0A 3NWWA 4HCVA 3WI6A 2PHKA 3H9FA 3ALOA 5HO7A 4R77A 4FA2A 3OWPA 3COIA 4OUCA 4C3PA 4AZTA 5IEYA 2CN5A 2IN6A 3KCFA 5G6VA 3TCPA 4C8BA 3VUDA 3A4PA 4MTAA 4L44A 4BCJA 3UC3A 2WU7A 4YJTA 3C0IA 4ACGA 4H36A 5F9EA 1JKKA 3AKJA 4HYSA 2Z60A 1Q24A 2FB8A 2J0MB 4BZDA 3CPBA 2YWPA 5H8BA 1YKRA 4O0RA 3KCKA 4ALWA 3DGKA 4KSQA 4FKSA 3EH9A 4KSPA 2CNVA 5C26A 4LYNA 2RFSA 2VTQA 4IADA 4UMTA 2BZJA 2PVNA 4PRJA 5IMXA 1YI4A 2X7OA 3EYHA 3JS2A 3R71A 2VTPA 4II5A 5GZ8A 4TL0A 4BCHA 4YURA 2UW5A 3EFJA 4GUBA 2JD5A 4EH6A 4GYIA 2VWXA 5DGZA 4C36A 3SG8A 2ITYA 3K54A 3RZFA 4CEGA 4GW8A 4QDVA 2YZAA 4Y5QA 3EN5A 3MA6A 5IQFA 5A14A 1ZYSA 2E9PA 2F2UA 4E8AA 5CX9A 4YZ9A 4FNXA 4AT5A 2CN8A 3EB0A 4IC7A 3TUCA 3PTGA 4I94A 4K33A 1F3MC 4JIAA 3TJDA 4PMPA 4NM5A 4YNEA 2X0QA 3VHKA 4MVFA 3RNYA 4DLJA 2CCIA 4IDVA 4JAIA 5LQFA 4YJUA 2PVRA 2CSNA 1TZDA 4EEVA 2B9FA 5M51A 4IW0A 5J1WA 5J1VA 1IR3A 3Q4TA 5E4HA 5T6KA 3I0OA 4QPSA 3E64A 4WD5A 3TEIA 2ETRA 3E8DA 4AOJA 2ZV7A 3BHVA 4DHZA 5ANOA 3MY1A 4XG8A 3BLAA 3ORKA 4QP1A 2XNPA 1S9IA 3N51A 3A8WA 3OZ6A 2F57A 2VTTA 1OL5A 3QBNA 3S3IA 4RBLA 4V05A 4XOZA 2ZB1A 3NUXA 2W99B 1U59A 2BDJA 5DVRA 2X8EA 4FSZA 4O4DA 2C5OA 3S00A 2WTKB 1LP4A 3QX2A 2QHMA 2VWUA 3QZIA 4FTLA 3F2NA 2YHVA 3AG9A 4FZ7A 5JGAA 5HLPA 2OBJA 3BGZA 3CLYA 4D2SA 4R5YA 5CF5A 2WIPA 3FXXA 3PXZA 3H0YA 2ITOA 3F3WA 3NW6A 5DT4A 3ZRKA 1YHVA 1OM1A 2ITZA 3OOGA 3FYKX 3R83A 4EZ3A 4IAFA 3AT2A 4NKSA 2WU6A 4OLIA 2UW8A 4KIPA 3CJGA 4CD0A 1YOJA 2VX3A 3C4EA 4RIXB 3QQFA 4U6RA 4QMNA 4ZZMA 3KF4A 2C1AA 2RSVA 3LPBA 2YDJA 4DG3E 4DFYA 1XWSA 3EZRA 3FPQA 4OTFA 4DDGA 2O5KA 5HCYA 2UVZA 4K18A 4MKCA 3UDBA 3BKBA 3R22A 4Y8DA 5A6NA 3RWPA 4XP3A 1OVEA 4QPMA 5HX8A 5K5XA 5JH6A 2F2CB 5H3QA 3R8MA 3ZSHA 4GU6A 4HCUA 5HIBA 3CR0A 3IW4A 2O64A 3JR1A 3MB6A 4O7ZA 1K2PA 5TR6A 5GZAA 3P5KA 3SC1A 4BWXA 4F09A 2QKWB 2ZFYA 3MJ1A 2BRHA 2IO6A 4F7NA 3VW8A 1H4LA 4HGSA 1BI7A 1PW2A 4D9TA 2OZAB 3ALNA 2JBPA 3QKMA 1NXKA 4L7FA 3W8QA 2HWPA 3OMVA 2PE2A 3CEKA 2ITWA 1O6KA 2R0UA 3IDPA 1YHWA 4X2GA 4Y5HA 1BX6A 5BV3A 4FEXA 1VZOA 3O2MA 4PL5A 3LFFA 2W5HA 5AP3A 3RINA 4RLKA 3A60A 2WQNA 5D9HA 4FSRA 4CMOA 2GNIA 1MRVA 2YIQA 5GJGA 3HZTA 2QODA 2WTKC 4I24A 2UZBA 2EUFB 3VUGA 1ZWSA 4XG9A 4FRFA 3R8PA 2Y6MA 2B9JA 5EW9A 3LM5A 5EOLA 4EBWA 5H8GA 3DKGA 4BY9E 5JMSA 2W1GA 2ITQA 2UZUE 4U79A 3U8WA 2JKQA 5FTGA 2RL5A 2ZM3A 1WVYA 3OROA 5IZFA 2OFUA 2C6TA 2OXYA 1W98A 2GHGA 2IVTA 5EFQA 3W2SA 3I0QA 3V6RA 3W32A 4FTRA 5HO6A 5JFXA 3RVGA 4YZDA 4M13A 5EHYA 5F94A 1IAJA 1U5RA 3C5UA 4C4FA 5AP5A 3R28A 3KVXA 4QMPA 2C5VA 2IVVA 4R3CA 3W0MA 4IAIA 2YWVA 4QP9A 3TV4A 2Y6OA 4U97A 5CF8A 1UWJA 4DITA 1ZYLA 5CI6A 3NR9A 4C61A 3QCSA 4FTMA 3CTHA 3PIYA 4FUYA 2V62A 1JSTA 2YCSA 2O8YA 3G0EA 3SQQA 1TQPA 5A6OA 2H9VA 4JR7A 1Y91A 4KB8A 2GQRA 3O7LD 4O0YA 4DG2E 2PZPA 4WUNA 4LMUA 1JKTA 3LJ1A 4PMMA 1Q99A 3K3JA 3QC4A 4HGTA 1MUOA 2H8HA 3T8OA 4RIYB 3DQXA 3ATTA 1CKJA 4FIIA 4CSVA 2W9FB 3P23A 4FTUA 4MEDA 3OF0A 4QMUA 4HVGA 5CAUA 3FZOA 3LQ5A 2Y8OA 4TWOA 3RHKA 2BKZA 4CRLA 4TYJA 5JFVA 1OI9A 3NNVA 1M2QA 4JG8A 2XIYA 3KC3A 4BKJA 2I7QA 4ZJVA 3PZHA 4O4BB 3G0FA 3FWQA 5C27A 3E92A 2JIUA 3KRJA 4AW0A 3DBCA 4WRSA 3R7VA 4HZSA 3UZRA 3UMXA 3ZEPA 2GFSA 1Y6BA 5LMAA 4ANNA 2XP2A 4BCNA 4P7EA 4YGAA 5FXRA 3THBA 3LIJA 3Q52A 3ET7A 4FOBA 3E88A 4HVHA 1PXOA 3ZRMA 4C33A 4FJVA 1H0VA 1GIJA 4XOYA 3U55A 2OXXA 3HV3A 3K5UA 4TYEA 2XKCA 2OF4A 4FG9A 2QO7A 5AIKA 3MH2A 2HZNA 4OW8A 2JAVA 3O17A 5I3OA 4FV8A 3WZJA 3Q5IA 1W8CA 2YCFA 3MYGA 4E4LA 4M84A 5GIPE 3QTZA 3DS6A 2HY0A 4Z7GA 3FXZA 2YIRA 3AT3A 4BB4A 1SVEA 3PFQA 3M42A 1YVJA 5BVWA 3Q60A 2WD1A 2YIYA 4WRGA 4CYJA 5ETCA 4EHGA 2V7OA 5K4JA 3W16A 2X2MA 3FAAA 4FKGA 4S33A 3FI4A 3WZDA 3NUUA 3F3VA 3QKLA 4X3FB 2VO6A 3VONA 5I0BA 4IAAA 3C5IA 4E7WA 3QTQA 3HA8A 3A7FA 1OKYA 3AC8A 3IDBA 1YI6A 4QTCA 4ZLZA 5CAPA 2JDRA 3GU5A 4LI5A 2B9HA 4RX5A 1OZ1A 3U51A 4AFJA 4B4LA 3SXSA 4ZZOA 3UP2A 5BVEA 4FV4A 2H34A 4MAOA 4BHNA 4C35A 3PY3A 3RP9A 3A7JA 2F49A 4RMZA 2C3LA 4ZJIA 3U4WA 4ANBA 3G33A 4K11A 4B7TA 5EI2A 2OJIA 3QRUA 3L8XA 3GQLA 3O71A 4DYMA 3N4UA 2QKRA 4CZYB 4BDBA 3MJ2A 5B2LA 2VGOA 2B0QA 4E5BA 3VS7A 2VAGA 5J5TA 5KHXA 3ZC6A 3DKFA 3WF6A 5J9ZA 2ZDUA 1M2RA 3Q9XA 3I5NA 4IVCA 2BIYA 4GRBA 3NIEA 4FTNA 4KKHA 4R3RA 3UMWA 4IM2A 4F1TA 4AGDA 2A4LA 4DBXA 1YDRE 4LL0A 2WQEA 3VNTA 4ZSJA 4ZY5A 3UG1A 4PP7A 2ZM4A 2O65A 3QRKA 3R7OA 2VD5A 4TN6A 4EZ7A 3ITZA 4IJPA 1U54B 4CRSA 3R73A 3IS5A 2PWLA 2GNJA 3KXNA 5FBNC 4UWYA 4R7IA 2V55A 1PMVA 3QD2B 2YDIA 2QLQA 4ACDA 4CFVA 5BVOA 5L2IA 2I40A 3QU0A 3QUDA 4J97A 4UMRA 1XH8A 4AFEA 5DYJA 3FC1X 3ZLYA 1ZOHA 2BRMA 4UN0C 4KIQA 2E9OA 3SKCA 4BDAA 3DAKA 3RALA 3KF7A 4D1ZA 2X9EA 4LFIA 5GIOE 3DNDA 4TNDA 2W9ZB 4ACHA 5I9ZA 4LUEA 5D7VA 3PLAE 1OMWA 2UZOA 1RJBA 2UW6A 3MVJA 4GT3A 3FDNA 2JITA 5HX6A 3COMA 3BU3A 1IG1A 5I9UA 1FPUA 4LV8A 2X4FA 3VUKA 3TG1A 2BDFA 3KRLA 2IG7A 1Y8GA 3QX4A 4YU2A 2X8IA 4FIGA 3OFMA 3RKBA 2BRBA 1XH9A 4EHEA 4E73A 5C8KA 4GSBA 4DG0E 1YOLA 5I9VA 2JFLA 2XYNA 4FT9A 3CXWA 1AGWA 2VTLA 3IKAA 2XIZA 4H1JA 4IM3A 4ASXA 2X0OA 1F0QA 1SMHA 4I0TA 4YTCA 4FV1A 2PUNA 1RE8A 3AKKA 3KGAA 4IQ6A 4D5KA 3UVPA 3OC1A 1ZRZA 3H9OA 4AOTA 4GK4A 3ZUUA 2HIWA 4OT6A 3TNHA 3WYXA 2QD9A 2A1AB 4WA9A 4NEUA 3R30A 4MWHA 3V8TA 4CLIA 5HORA 5LCJA 3DKOA 3EZVA 4X0MA 4CTCA 2BRNA 4PUZA 4IHPA 4BDEA 5DT3A 5IQAA 4DGLC 4MXAA 2O0UA 5HI2A 5L8LA 3EQGA 4FZFB 4IJ9A 4XG7A 3JVSA 3ERKA 3RBWA 4EUTA 2VWZA 3OW3A 2GHLA 4DH1A 3HA6A 3MVHA 4IB3A 2HZIA 3V5LA 5HNBA 4WOVA 3D7TB 4EYJA 1PMNA 5CEOA 1WAKA 2W0JA 2B53A 3AMBA 4O21A 4RZVA 4C2WA 4AE6A 3VIDA 4A07A 3W0NA 3PPKA 1WBNA 4XYFA 3EN4A 5IDPA 2IZTA 3MVMA 2YCQA 3MVLA 1WVWA 2OH4A 3W8LA 1HCKA 3A7HA 4TRLA 4TYIA 5HE1A 2VTIA 1PXNA 2PSQA 1LR4A 3NW5A 5GJFA 4BGQA 2QR7A 4FC0A 4N6ZA 1WBVA 3OUKA 4RSSA 5IQIA 3P7AA 3RAWA 4A4XA 4D28A 1OBDA 4EWQA 2X81A 2HW7A 2X9FA 5FM2A 3D5UA 2PMLX 3GI3A 3QL8A 5AV1A 3QD3A 4B8LA 4BDGA 1EH4A 5HCZA 5HHWA 3TKIA 4AACA 3U9NA 5IISA 1OIUA 2C3IB 4DTBA 5BUJA 4O82A 2HXQA 2C47A 4QMMA 3EKNA 4ENYA 1QL6A 4EOKA 3QTIA 4FIJA 4RIXA 4MYGA 2VO0A 4QNYA 4F6UA 3SXRA 4QYHA 2XZSA 4YZBA 5D11A 3FI8A 4BIBA 2WXVA 3OCSA 3ZO3A 4ZJJA 2HZ4A 4EOOA 1VYWA 3C7QA 4ZMFA 2QOHA 1KE9A 1SVHA 1W83A 1B39A 5CALA 2O2UA 4O38A 2OJ9A 1YDSE 2R3MA 3OCBA 4F7LA 2OLCA 3LW0A 4D2TA 4PNIA 3RK9A 4BDIA 3B2WA 4FK3A 1TFFA 4O6LA 2OZAA 1IA9A 2WO6A 3UDSA 4JMQA 4ASEA 2X4ZA 3DXNA 5CNNA 4BZOA 1Q3DA 3I6UA 4F64A 3C0GA 4F9CA 2W7XA 2OG8A 4YC8A 3PPZA 3D7ZA 2ETKA 3RPOA 1VJYA 2W1HA 3HMMA 3A8XA 2Z7QA 4WNPA 5I9WA 4RIWB 4ENXA 3L8VA 2VTHA 3M11A 2R3GA 3SDJA 4ANSA 5HU9A 3NVKI 3PJ1A 1J1BA 1FMKA 2F7XE 5EI6A 2F9GA 1XH7A 1E1VA 4I0RA 3W0RA 5CY3A 2XNOA 4JT3A 2W1EA 3CPCA 2VX1A 2VTMA 1NT2A 3EQPA 3NCZA 3LLTA 2XH5A 2GMXA 3QKKA 4V0GB 1H07A 3EWHA 2B7AA 2FA2A 4RC4A 2I0VA 4YLKA 3REPA 4E4NA 4NSTA 1YI3A 2C68A 4A9UA 3TUBA 4IWOA 5LMKC 3L9MA 4OR5A 3QXOA 3LCTA 4TZRA 4DFBA 1OL1A 4BBFA 2F4JA 2G01A 2IVSA 3DBDA 1JAMA 5EHLA 4EC9A 2PU8A 4P4CA 2RIOA 1J91A 5EM8A 3RCDA 3BU5A 1IEPA 5L8KA 4EJNA 4O86A 3PSDA 4I5PA 5JFSA 4OBQA 4PX6A 4ZTLA 4V04A 2G2IA 4FT5A 4WT6A 2YM3A 2UW3A 4OTIA 5EDQA 4F9BA 5CU2A 4GT4A 2QO2A 5E8ZA 3ZLXA 3AGLA 3HEGA 3R1SA 1DI9A 4FICA 5AIRA 3T3UA 1LUFA 3HUCA 4NYEA 2BIKB 4YJNA 3EQHA 3OXZA 4IB0A 4M15A 2I0EA 2PVFA 4YO4A 3RM7A 4V01A 2XVDA 2PTKA 2WKMA 4RIYA 4W8EA 4MXCA 3S2PA 1FGIA 1FVRA 1T46A 3P78A 3IONA 4OTPA 2OIBA 3WE4A 4KABA 1KOAA 4JBVA 4AP7A 4CKJA 4EOIA 4KAOA 4USEA 4GG5A 2JEDA 3QHRA 3EFKA 4IH8A 3LQ3A 3W2CA 5BQ0A 5J5SA 1NVRA 2OH0E 5T3QA 4U81A 4F0GA 2OWBA 4BCGA 5FEEA 4HW7A 5IA5A 5E8SA 4RGJA 1PRYA 3KFAA 3R8UA 3T9TA 3FXWA 5E91A 5EM7A 4BIEA 3GEQA 3AD5A 4W9WA 2PUPA 2W4OA 4KWPA 5FLFA 5M53A 5DMZA 3COHA 4HZRA 1Q8WA 2GHMA 5CSVA 4MD8E 3QTXA 3MN3A 4FTKA 5HIDA 4XNEA 4F99A 3G51A 3TM0A 4GKIA 5IH5A 2YCRA 3CGFA 2C6EA 5GZ9A 4Z55A 2PZIA 4OBOA 4WNKA 2B55A 2JDOA 1ZOEA 4ZY4A 4DA5A 3SD0A 2CHLA 3KRRA 2XANA 4EONA 3SA0A 3NSZA 5LVPA 3OTUA 3ZFMA 2WTCA 3NFFB 2BVAA 4MXZA 5IQGA 4J8NA 5AAEA 4EOMA 3BELA 4D2PA 4FSMA 3RPYA 4XV3A 5FUTA 5TOZA 3RK5A 5JQ5A 4S34A 1W7HA 5KCVA 2JLDA 4JG7A 2CMWA 4HJOA 5AP2A 4PL4A 2JGZA 4FSTA 1M17A 2YJSA 4X3FA 2UZNA 4JS8A 3DK7A 5C1QB 3HV4A 2QCSA 3C51A 2C30A 3ORPA 5AX9A 3U9CA 3BBTB 3ENMA 2IVUA 3C1XA 2EWAA 3AGMA 2OF2A 3NYNA 4CFXA 3FMHA 2RG6A 1XH6A 3FYJX 2JIVA 4QPAA 3C13A 3ZYAA 3QAME 4BHZA 3Q2JA 3IPHA 2ERKA 1KE6A 5M08A 1OL7A 4E3CA 1WCCA 4FIFA 3VF8A 1Q5KA 2I0HA 2YISA 4Z3VA 5EOBA 1FBNA 2VTAA 2XAMA 2GSFA 2JKMA 4DN5A 3EJ1A 3TNPC 1Y8YA 2BCJA 3ZOSA 3W0QA 1URWA 4RWJA 2ZMCA 5ANKA 3TDVA 2XK3A 3PIZA 2DQ7X 1PY5A 4Z16A 1RW8A 3TNWA 5KBRA 2CKEA 2BKKA 3RZBA 4FYNA 3GXLA 2PY3A 4JQ8A 4O91A 5FEDA 5DN3A 5BYYA 3PP1A 3C4CA 4K1BA 4U41A 4OTDA 3ZM9A 3VS6A 3M1SA 4DTAA 2WEIA 4FKRA 2C5XA 1CMKE 1U54A 1WMKA 3H4JA 1W2FA 3PRFA 4XH6A 5AFVA 4O0XA 3A7GA 3DKCA 2PZ5A 1CKPA 3EL8A 4FV5A 4EL9A 3TZ9A 4EZ5A 2PZRA 3G9NA 1IAHA 2UW9A 1UU8A 5D41A 5LMBA 4FZDB 5TF9A 5EDRA 1G3NA 2XNGA 5A3XA 3O8TA 4ZLYA 1OB3A 1PF8A 4RIOA 4BI2A 3ATSA 5C4LA 4CQGA 3GGFA 2ONLC 4IXPA 3ZEWA 2AEGA 4C38A 5DR9A 3EFWA 4EH4A 4UWCA 3VRZA 4L68A 2Y4IC 3GC0A 3HP5A 3DK3A 3QWKA 4X3JA 5AUWA 4ZK5A 4UBAA 4JR3A 3TXOA 1J7UA 5DIAA 4PPCA 2JDVA 4BJJB 3CE3A 1R0EA 3QTWA 5CT7A 4D1SA 5C4KA 2JFMA 3BX5A 2QOQA 4FUXA 1GJOA 4H39A 4Q9ZA 3BEGA 1UU3A 2Y0AA 4DDIA 5M4IA 4DCAA 4RC2A 3QQKA 5DI1A 2G2HA 2P2IA 3IG7A 4Y72A 1W82A 3LFNA 5HBEA 5B2KA 1GZOA 5M4FA 5ANGA 4O7SA 4J8MA 4FODA 4JIKA 4ZSGA 3G15A 2BZKB 5EK7A 1H8FA 2IW8A 3LFCA 3UZPA 2VWYA 4FV7A 5KZIA 3BYMA 3F2AA 1TVOA 4AW5A 3LZBA 1XO2B 2HELA 3DJ7A 3D5VA 3POZA 1PXMA 3SRVA 4UMUA 4QDEA 4PTEA 1O6YA 3TZ7A 4J7BA 4IFGA 2Q83A 1UWHA 1P4FA 3GFWA 2VWBA 4QTEA 5DR6A 5BX0A 1PKGA 3B8RA 3PUFC 1Q41A 3E3PA 3R1YA 1YXSA 5EQYA 3OY3A 5EKNA 1Q8TA 2RG5A 2Y9QA 3QCXA 3D7TA 3HDNA 4EH2A 4GU9A 5BMMA 2FSLX 4CGAA 5A9UA 4M8TA 4D5HA 3IO7A 4DGGA 3UOJA 4BCOA 3NW7A 3U54A 1NVSA 1ST4A 4IAZA 3ZBXA 3W0SA 1P5EA 4ANQA 1CTPE 4X21A 1GY3A 2VTNA 4IANA 3NYXA 2XRUA 1TQIA 4FT7A 4XBUA 4MQ1A 3HL7A 4MBJA 3V51A 4AA5A 3ML1A 5BYLA 4GEOA 4AQCA 2ZV2A 4XG3A 3NUNA 5FD2A 3BRBA 4QMTA 3RAKA 4NTSA 3D5WA 2XK7A 4MF1A 4W9XA 4MHAA 1SNUA 4IC8A 4BCMA 5AM6A 5CU6A 5HTIA 1H1QA 5D7AA 3CBLA 1YRPA 5CF4A 3I1AA 3OXTA 4QP6A