4DBNA

Crystal structure of the kinase domain of human b-raf with a [1,3]thiazolo[5,4-b]pyridine derivative
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
274
structure length
257
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
publication title Design and synthesis of novel DFG-out RAF/vascular endothelial growth factor receptor 2 (VEGFR2) inhibitors. 1. Exploration of [5,6]-fused bicyclic scaffolds.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 257
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dbnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dbnA01
5IKWA 3OXTA 4P4CA 3VS0A 4D2RA 4U44A 3DB8A 3ORTA 5EG3A 5JZNA 1Q3WA 2Y0AA 2ITOA 2PE1A 3PRFA 4X2FA 3EN9A 3R8PA 3MW1A 3NWWA 2X81A 1V0PA 2O3PA 2EB2A 3UC4A 5CSWA 3MVHA 4CRLA 1PMVA 3KKVA 3H0ZA 2YIWA 3U6JA 3O50A 4PF4A 4LRKA 4AZWA 2QOHA 3QC9A 2W17A 5JFWA 3TZMA 5M53A 1T45A 3BGQA 4AACA 4EBWA 4XEYA 4BBFA 3OWLA 4BDFA 5LMBA 3HX4A 4NZWB 2QHMA 1BLXA 3A60A 3F3WA 3MB7A 1OL1A 3QRIA 3QRJA 5H8GA 4I5CA 3PXYA 2ERZE 2IZSA 4FTIA 4E8AA 4Y8DA 2HZIA 5BYZA 3S4QA 5IQBA 4NKSA 2CCIA 4BZDA 3GXLA 3AT4A 3BGPA 5BMSA 2CKOA 3F3TA 4M13A 4NU1A 5AMNA 2XM8A 2F57A 3FMKA 5KZ0A 2O2UA 5IA1A 3TNHA 1BI7A 4IW0A 4UX9A 3PWYA 2UW4A 4M3QA 4X3FA 1Q4LA 3EFWA 3Q32A 5FBOA 2F9GA 4QRCA 1Q24A 3H9FA 4BBEA 1WVWA 2W5BA 4FSWA 4OTGA 3ZO1A 5BYYA 4FSTA 3OTUA 4BDJA 2ZB1A 2C0IA 3I5NA 1KE5A 2PMOX 2PVJA 3II5A 3PG3A 2GFSA 1YI3A 3UP2A 3E87A 4C4GA 4L67A 4W8EA 3BBTB 5EDRA 2QR8A 4YZMA 3NZ0A 5ACKA 4FEUA 2OK1A 4ZSJA 3VS6A 3I6WA 2WEIA 3VS4A 5L3AA 4XOYA 5D7VA 1H26A 5E8ZA 3KU2A 3NYOA 4FKGA 4Z3VA 5IH6A 1JKLA 3KEXA 3MSSA 2HIWA 4LL0A 3NIZA 3AC1A 1PYEA 2YLFA 3RCJA 5KNJA 4IX4A 3ZSGA 5LVOA 2XK3A 2Y4IC 2V7OA 2FA2A 2BR1A 3M1SA 4KIKA 4PTEA 4J8MA 5EI8A 4O7VA 3GFWA 5FWKK 2BHHA 3HRCA 5DEYA 1TQMA 4PRJA 4KSPA 4FIEA 3LFBA 3FL5A 4I93A 2X7FA 4F70A 4D2WA 4M69A 4PTCA 5F94A 2XJ1A 3UO6A 3AQVA 3L9PA 3TV4A 3DLSA 5K5XA 4Q2AA 2PVYA 3C0HA 1JKTA 1H25A 4EWQA 3OUKA 4NT4A 1PYXA 4CTCA 4O6EA 3PXKA 4CFWA 5KBQA 2P2IA 4J95A 5DR9A 2QODA 1IA8A 3CSVA 4GW8A 3EQFA 4M8TA 4RX9A 1FVVA 4QTCA 2WTJA 4CEGA 5CEOA 3FV8A 2QOCA 5FLFA 4XHKB 2OLCA 5D7AA 2VTIA 3P79A 4K6ZA 3C5IA 2E9OA 4OTIA 3VUDA 4E20A 3R2BA 3H4JA 1UKIA 3I5ZA 3DXQA 2XCKA 2QG5A 3VN9A 4AA4A 4IQ6A 3QGWA 2PZPA 2NNWB 4PP7A 1PMNA 3RNYA 2WB8A 3GC7A 4FEVA 2VD5A 4GS6A 2JKOA 4D9TA 4EK8A 1OIQA 2QONA 4JBOA 3A4OX 5IU2A 2ITPA 2WMBA 5G1XA 4FBXA 4EOKA 1TVOA 2W1GA 1PW2A 5I9ZA 4AT4A 1I44A 2R3JA 5CAUA 2XCHA 3C4CA 3F6XA 3KVXA 4FT9A 3OW3A 5DR2A 4IEBA 5L2WA 3VUMA 2WTKB 3MPTA 4FG8A 4PUZA 3BKBA 5IQDA 3PLAE 4FV0A 1KOBA 4X2KA 3ENHA 3BELA 2CNUA 2JFLA 4USFA 3OT3A 3UNJA 4FUYA 5KO1A 3R8UA 3RWPA 3Q5IA 3HUBA 3EN6A 3QRKA 4P2KA 1OBDA 3SRVB 5CF6A 4M0YA 3TN8A 1B39A 4HNIA 5JGDA 4FZ7A 5TF9A 4BIDA 3V8TA 5L2TA 3FI2A 4RWLA 3KFAA 2C5XA 2R2PA 2VTTA 3PYYA 4JR7A 3E7VA 5EKOA 3F3UA 2YEXA 4FTQA 3PJ3A 4MVFA 2X9EA 4CMTA 3SW7A 1H1RA 3DOGA 5LWMA 1ZMUA 5M4IA 1ZLTA 3ERKA 4XV2A 3IW7A 2Y9QA 4U40A 2UZTA 4NH1A 1LPUA 1PJKA 4TWOA 3QD3A 5TR6A 2BZKB 3VO3A 4FG7A 2C68A 2UZDA 5AP4A 1A48A 3FKOA 3PPKA 5AIRA 3R7EA 2ITYA 3MWUA 2XIRA 5J5SA 4BWXA 3DTCA 1ZWSA 5IEVA 3DJ7A 1MRUA 5D41A 4OUCA 3O51A 2YLEA 4K2RA 5L8JA 3EB0A 5DNRA 4A9RA 2P0CA 4P5QA 4BB4A 3NCZA 4D5HA 1KUTA 5CALA 3FWQA 4NM7A 4LV8A 4BIEA 1YI4A 4G3EA 4X2NA 5BUJA 4O7LA 2C1BA 5AX3A 4EYMA 3HAVA 3MDYA 4FKTA 2WAJA 4QPMA 4UXQA 4FEWA 1VR2A 2VTJA 3D4QA 1PKDA 2W9ZB 1J1BA 3VBTA 3QX2A 1WVXA 3BHTA 4YJPA 1XWSA 1K3AA 3TG1A 1BL6A 2JAVA 5K5NA 4FIIA 2ITVA 3NAYA 4X2GA 5K0KA 5EQEA 1CSNA 3CY3A 2BIKB 5HE3A 3BQRA 3EOCA 2ETRA 2JDRA 4NJDA 5EYKA 3WF8A 5HU9A 5A3XA 2EVAA 1UU9A 3ITZA 2CGWA 5FDXA 4YJSA 2VWIA 4CFMA 3ZLWA 2GQGA 3IG7A 3RHXA 2Q0NA 2J2IB 4OTRA 4A06A 4GYIA 3F66A 2J5FA 4KUJA 4FSQA 3QKKA 3SOAA 3TKIA 2FUMA 1F3MC 2PZIA 2WU6A 4DTBA 5EYCA 2WTCA 2JIUA 4FKWA 1YOJA 3H30A 3ZU7A 5IPJA 4RIWB 3FI8A 3O8UA 1EH4A 1M2QA 2RIOA 4L68A 2YIXA 3ROCA 4MF1A 3HV6A 5BVEA 4L00A 5CT7A 4YNEA 1OM1A 4BKYA 3IS5A 3Q53A 3TCPA 3UDBA 2OH0E 3VBXA 3CPBA 4J97A 5TO8A 4CQEA 4ORKA 2ZOQA 2V0DA 5HX6A 4FNWA 4R6VA 4Z9LA 4DFNA 3U8WA 4MXOA 3COKA 5GIOE 5E1SA 4NW6A 4HVIA 3PTGA 2VWZA 1DAWA 5A4QA 4HZRA 5M51A 4QYYA 4U43A 3HA8A 1Y6BA 4XLIA 1WBNA 1WBOA 3RWQA 4FG9A 3DV3A 1FGIA 3GC8A 4EK5A 4RMZA 4L9IA 4MXYA 4DH7A 3U6HA 4M97A 5CXZA 4EWHA 2YDJA 3PE1A 4RQKA 3HMOA 3ET7A 3W33A 4QMMA 3QWKA 2AUHA 3TWJA 4FYNA 5HIDA 5HU3A 3L9LA 4YC8A 5GNKA 3V51A 2Y7JA 3SX9A 2NRYA 3RZFA 4NIFB 5HIEA 5FP5A 2I0EA 4L3JA 5I0BA 4RA4A 4FOBA 3QZFA 1GZNA 4MBLA 4U3YA 4E6QA 4O0RA 3DCVA 5L6PA 4JG6A 1ATPE 5BX0A 2X7GA 3COIA 5KX8A 1G3NA 2VV9A 4KNBA 4FTUA 4I24A 3QTSA 3RPRA 1W0XC 2I6LA 4FF8A 3FZSA 5JGAA 5LOHA 2H34A 5IA2A 2IWIA 1GY3A 3P7AA 2Y4IB 3NRMA 3WE8A 4H05A 3I79A 2GFCA 3ZZEA 2WMUA 3DK3A 4V0GA 4F9CA 2XNBA 4HVHA 4E6DA 2QVSE 3P23A 4HOKA 3MV5A 4BDHA 3EHAA 3HP5A 3UJGA 1PRYA 3V5QA 3RPVA 3GT8A 2XNPA 1H1SA 4C57A 1M7NA 4PPAA 4BCMA 2ETKA 5A46A 4EQCA 2X2MA 3PSDA 3WZKA 2O63A 2X4ZA 2NRUA 4HYUA 4XG2A 3H0YA 4KINA 4D58A 4OR5A 3TZ7A 2WIHA 5CANA 2WZJA 2YWPA 4YUQA 5IG1A 5KMKA 1Y91A 3N4VA 4DF3A 1XBCA 4IM3A 4RVLA 4H39A 4YPDA 3QQKA 4YMJA 5JT2A 3GOKA 4GV1A 3KGAA 5IA0A 4G2FA 3GCVA 3LMHA 4GJ3A 2UVZA 2PPQA 3Q60A 4XNEA 2YIRA 1MQBA 1QCFA 3FMMA 3LXPA 5CQWA 5HCZA 4NUSA 2G2FA 2WFYA 2PE0A 4LYNA 3FZOA 4F65A 5D11A 3LFQA 3BGZA 5A9UA 3Q4TA 4G31A 3V5TA 4W4XA 2YM5A 4F63A 4TNBA 3R04A 4R1VA 2WTWA 4FL3A 5IH4A 2BFYA 3OHTA 4D4RA 4C3PA 4FV1A 3UQFA 4Y72A 2QO2A 5JSMA 2JKQA 2YCSA 2BFXA 3KULA 5AP2A 4CT2A 3EIDA 2C3IB 4RFZA 3WIKA 4CYJA 3CY2A 2R4BA 3JS2A 4KIQA 4LOPA 4RIYB 4AW2A 4FSUA 1Y57A 3NUPA 2GHMA 1U54B 3GU6A 2UW0A 3BIZA 4ERKA 4EORA 4NCTC 3TT0A 3DS6A 4IZAA 3AMBA 2ZDUA 3A7IA 3H10A 3PIYA 5TKDA 4BTKA 2ZM4A 3LCKA 4ZTLA 3DDQA 4JBVA 1XBBA 2WU7A 4BTFA 3QTXA 2GPHA 3EYHA 2P2HA 2W06A 3FKNA 1PXNA 4AW0A 2VTLA 4YZCA 2RFSA 4BCHA 4H58A 4I23A 4X0MA 3BX5A 5CEPA 3L8PA 2XK8A 2VRXA 4RX7A 4EONA 3CIKA 1YDSE 2PVRA 2FH9A 3KF7A 4U0IA 4MXAA 2PVLA 1FINA 1GIIA 4Y46A 5ICPA 1Q62A 5IA5A 5LCKA 4D1XA 3BPRA 3PZEA 3U87A 4YJOA 1TQPA 1CKIA 3FL4A 4FEQA 1IR3A 3OOMA 4MH7A 4RC4A 4AA5A 4AU8A 4BF2A 5GINE 3DAJA 3BLRA 3NPCA 1Z9XA 2CN8A 3KF4A 3WZUA 3FY0A 4XRJA 4BCIA 1ZMWA 4WNPA 4BTMA 4DEEA 2CKQA 5AR7A 1XH6A 5BNJA 4IFCA 4DEGA 2C6OA 4TL0A 2IW8A 3NIEA 5AP1A 1ZYJA 3COMA 1ZYCA 3C1XA 5CNNA 1WFCA 3JUHA 3LFAA 3DBQA 5IQGA 2VO3A 2W1FA 4ZTQA 3VW6A 3Q9YA 4F7SA 5E8UA 2XBAA 4AZEA 4GCJA 3TUDA 3G0EA 4HW7A 5J5TA 3TL8A 5CX9A 4Y83A 4FNZA 3PXZA 5CNOA 3UOKA 4C34A 3MFRA 4X6RA 3L8VA 5M08A 4DITA 5DEWA 1XHAA 3DJ5A 4I4FA 4JDKA 1KOAA 1XH9A 5FRIA 4FVPA 3SXSA 4D55A 3CP9A 4F99A 5A54A 3UPZA 3SW4A 2Y8OA 2AC3A 4PMPA 2WEVA 4LUDA 4MNEA 4DG0E 3F9NA 2BROA 3HECA 5JK3A 2G2HA 4GKIA 1FOTA 3LCOA 4TYJA 2C6TA 3QWJA 4OT6A 5HICA 2R3HA 1XH4A 5AEPA 5J7BA 4RVTA 3I4BA 4DG2E 2JBOA 3CS9A 4NYEA 3AC4A 3TUCA 4JI9A 5K4JA 3C4XA 2R3MA 2EXMA 4CFNA 3DA6A 3VJOA 5AR4A 4L6QA 3WYYA 4EH6A 4RZVA 1YWRA 3MH2A 5E92A 5DN3A 1E9HA 2UW7A 3AMAA 3NYVA 5CENA 2RL5A 3NUAA 1UA2A 4EOMA 2ZB0A 4DH3A 3K5UA 2J90A 1UNHA 4MKCA 4ZMEA 1YHVA 2XUUA 4TXCA 3LFCA 3ZUUA 4HGSA 3KCKA 3O8TA 2UW6A 4B99A 3TI1A 2XM9A 2XP2A 2H96A 2J0JA 5M09A 4ZZMA 1UNLA 5HTCA 5AM7A 3CQEA 3FMDA 4D28A 3NR9A 4RX8A 4CVAA 4KAOA 2X8EA 2WQNA 4EOPA 2QOOA 4CMUA 3KXZA 4UALA 4GIIA 2QLUA 5DE2A 3GBZA 2VO6A 4ALUA 2OGVA 4BYIA 4DEIA 1WAKA 3QXPA 4U5JA 2CSNA 3MH1A 1V1KA 3K2LA 4N6ZA 4G3FA 4ASZA 5CAPA 2VX3A 3BHYA 2PMIA 4YHJA 1LUFA 2QOKA 5E91A 5A4CA 5M4FA 5C01A 4H36A 4GEOA 5CY3A 3F2AA 4MEDA 3BWJA 4S34A 1H0VA 4ACGA 2BRGA 2DYLA 2VX1A 2BDFA 4E6AA 5AP5A 3POOA 2I1MA 4D4YA 4CKJA 5FEDA 4KSQA 3A2CA 2JBPA 4TRLA 4EJ7A 2PUIA 4D2VA 3TZ9A 3P0MA 2B0QA 3PPJA 3HMIA 1JAMA 3NW6A 2ZM1A 2OKRA 2XF0A 2JAMA 2OU7A 3IO7A 3PFQA 4USEA 4YPSA 4Z7GA 2QLQA 1B38A 4G5PA 4DLJA 4E93A 5LCJA 1IAHA 2HZ4A 4LG4A 4OTFA 1ZMVA 3MIYA 4NK9A 3GP0A 4C33A 4FKRA 4FKQA 5HHWA 4APCA 3DK7A 2UZOA 3JPVA 5FTOA 2R3QA 1PXPA 3UO5A 4FT7A 5JQ8A 5CAVA 2C69A 3BEGA 4RFMA 2C30A 2A1AB 2W5HA 3E3BX 3B8QA 5HO8A 1MRYA 4AN9A 4BI0A 3KRRA 3PE2A 3UYSA 5CEMA 3SG9A 3PJ2A 5K9IA 3MH3A 4YJQA 4EK6A 3T3VA 5GZ8A 5KMNA 2F2UA 2ITUA 4RWJA 3KREA 3FXZA 4JR3A 1YWVA 2OICA 4GYGA 3HUCA 2QOIA 4QMUA 4YC3A 2HZ0A 3R7UA 3I7CA 4XH6A 5GHVA 4ZZOA 2OJFE 1KV2A 3H9RA 3MI9A 3SLSA 3QQHA 5L2SA 3FMEA 4HZSA 3ATSA 4G6LA 3ZDUA 2BVAA 2YISA 5EFQA 5FUTA 3R8VA 3VS2A 2EXEA 5K3YA 2PU8A 4OAUC 2WIPA 3FE3A 4QP4A 4BGQA 4YLLA 3AOXA 3OXIA 4QYFA 3QCXA 3QXOA 4EHVA 5CF5A 3E62A 2IZRA 1OL2A 3L1SA 2BTRA 5HGIA 4C3RA 4K33A 3QKMA 4R7IA 3HP2A 5DVRA 4DHFA 2YHVA 3V8SA 4XS2A 1XH7A 2HENA 3NUNA 1B6CB 2QHNA 3QQGA 5J9YA 3G2FA 3HV4A 4ARKA 3L9MA 2OF2A 4FTMA 4L42A 5JH6A 4L52A 5J7HA 3JXWA 3ZC5A 2I40A 4EKKA 1ZYSA 1UWJA 1KE8A 3EFLA 4DFXE 3A7JA 3GU8A 3OD6X 4I6HA 3JVRA 3SGCA 3GU7A 4E3CA 5FTQA 2VNYA 5EI6A 4I5MA 5FTGA 2R3LA 4QMWA 4MCVA 4DFZE 2W1DA 3SVVA 3LM0A 5FXRA 3QZIA 4ALVA 4AGCA 3S95A 3BEAA 4BKJA 5DWRA 3ZBFA 3BU6A 4ZLZA 3EQDA 3KMWA 4OGRA 3NDMA 2CN5A 4YZBA 4CV9A 1NA7A 3E64A 4J96A 3P9JA 3DKCA 3QCYA 1R0EA 2WTIA 2BALA 2XVDA 3OC1A 2XRWA 4F9AA 4ACHA 5K4IA 5KHXA 3TNQB 2F2CB 4FC0A 3IOKA 3PXFA 4MXXA 5HD7A 3MFTA 3PXRA 3W32A 2UZNA 5FM2A 5BMMA 3R0TA 4O81A 3TKUA 3ULZA 4Y85A 4BL1A 5LWNA 2YA9A 5FEEA 4GG7A 3DKGA 1S9IA 5AUXA 4FEXA 1W7HA 2C5OA 3BQCA 3G9LX 5E8VA 4JVGA 4L3PA 4FIJA 2R7IA 4ITJA 4QMPA 2XA4A 4FL2A 5C26A 4HCVA 3D2IA 3FPQA 5L2QA 3EQRA 3VUHA 3E63A 4Y95A 5CYIA 3RKBA 3FAAA 1H24A 5JFVA 1W84A 3HV7A 3HYHA 1YXSA 4FA2A 3EFJA 4M67A 5ANDA 3RVGA 3NUYA 4ZSGA 1KE6A 1PHKA 3V6RA 4MBJA 4A4OA 4L53A 2VTSA 3TZ8A 3ORPA 3QTQA 1KE9A 3LCSA 4S2ZA 2BAJA 1LEZA 4H3PA 3VWAA 1BKXA 5DGZA 4DGGA 2X39A 2IW9A 3CPCA 3UMXA 3IECA 3PA3A 4CG8A 1H28A 3C0IA 3MFUA 4BCKA 5LMAA 1OKYA 4M14A 3I0QA 1Q8TA 3Q9ZA 2VTMA 4XUFA 5D1JA 1Q99A 1TQIA 3QLFA 4QMXA 1R0PA 4B0GA 5L4QA 3LLAA 1NVQA 2UZWE 1OKVA 2B9JA 3GOPA 1JBPE 3VBQA 3FKLA 3QQFA 4GFOA 4UMPA 4I0RA 3UIXA 1YDRE 4OBPA 4PX6A 4FTTA 5DHJA 4I0SA 5HE0A 4CFFA 2W4JA 4EHEA 4G34A 4K77A 2JITA 2Y4PA 3GQLA 3NUUA 2XNNA 4PDOA 5BVNA 3UVPA 2JDOA 4R78A 4BZOA 4YJNA 4OTQA 2OH4A 1G8SA 4E5WA 2BIYA 3FZTA 4B4LA 2RG5A 2EXCX 3QQLA 3W18A 4HCUA 4KD1A 3TEIA 2YN8A 1V0BA 4PL4A 3EN5A 1VZOA 2WNTA 3FXWA 4FV2A 3SKCA 4XP0A 4IDVA 4MNFA 3QA8A 4Q9ZA 1BX6A 2OW3A 3L8SA 3V5LA 4IVAA 4J98A 1WZYA 3MBLA 4O21A 5H9BA 2I0VA 4FGRA 3UTOA 3QTUA 4G16A 3T3UA 3TV7A 4AW1A 2ETMA 3FLYA 5IQCA 4ITHA 4XBRA 3BYMA 4L7SA 4AW5A 3NNXA 2WQEA 3P7BA 2WQBA 3OW4A 3NCGA 4QMVA 3NYXA 3EFKA 3PG1A 4JNWA 3A8XA 3ZH8A 4AOJA 4YSJA 5GJGA 2GNLA 4JLCA 4HYIA 3ZSHA 4O7ZA 4U79A 3KXXA 4J52A 5C27A 1GIJA 3D7TA 3P5KA 3G33A 2VTPA 2EUFB 5EW9A 3UIMA 4P90A 4G9CA 2RSVA 3OBJA 5H3QA 2JDSA 2PUPA 3DK6A 5CU3A 4BWPA 2C5VA 3EKNA 4IZYA 2GTNA 4CQGA 2IG7A 4R7BA 4C4HA 5AR3A 3PA4A 2WMQA 5FQDC 2DWBA 4TYHA 3R2YA 4XG8A 5CSVA 2X0GA 1T46A 4WSYA 3KK9A 3PWDA 4LGDA 2CDZA 3CJGA 3KMUA 3Q5ZA 4P5ZA 5KE0A 5BVWA 3R83A 3TACA 4IB0A 1CM8A 1J91A 1WBSA 4LV5A 1WBWA 4AA0A 1RE8A 2W4OA 1XO2B 3NW5A 4DEBA 5IQFA 1OMWA 4FKIA 5J95A 4CFVA 2VGOA 3I60A 5B2LA 4O0UA 3SRVA 4JIKA 5HIBA 4NFMA 4B9DA 5BVKA 4JJRA 3DQWA 2YZAA 3R01A 4AT3A 3PZHA 3D2KA 4JIAA 3F61A 2O64A 4DH8A 4LQMA 4EOJA 5E8TA 3R1QA 4MYGA 5KMIA 1R78A 4RGJA 4LI5A 5DRDA 2Z7LA 4U45A 1YVJA 2EB3A 3CR0A 1Q97A 2CGUA 3U4UA 4ZXTA 4WA9A 2H6DA 3PVUA 3RGFA 3QUPA 4FSMA 3V8WA 5AUWA 2GNHA 3W16A 3W2QA 4IX3A 4U42A 3HLLA 2VTOA 4LL5A 4MBIA 2HW7A 4BHNA 4IZ5A 2R3NA 1M14A 1PXMA 3IGGA 4JT3A 4WNMA 1XQZA 3AC3A 4EUTA 4ZTSA 3Q04A 4KIKB 2RGPA 4RFYA 3OTVA 2OI4X 2QNJA 3Q96A 4M66A 3MIAA 5IQIA 5HORA 5JRSA 5AUUA 2SRCA 3LZBA 3T9TA 3ZEPA 5KHWA 1SYKA 2IW6A 2GQSA 3C4EA 4I92A 4QD6A 5EI2A 1QL6A 4MK0A 1Q8UA 4TYEA 4M69B 4Y5QA 1S9JA 2XNOA 3LAUA 3VBVA 3MS9A 4F9YA 1OBGA 2G9XA 3KRWA 1GZOA 2UZBA 2J0KA 3VBYA 4O38A 2UW5A 3DBDA 2F7EE 3IW4A 3OP5A 3QF9A 4BC6A 5KCVA 1OIYA 3FUPA 5CWZA 5AUTA 2C5NA 3ZFXA 2YCQA 4R3PA 2BZIB 2IVSA 3OF0A 3I6UA 3MVMA 2PZ5A 5HTBA 3RP9A 1PF8A 2B9IA 3BE2A 3FI3A 4K18A 2V55A 3RM7A 1OGUA 2J4ZA 3EYGA 1W98A 5CT0A 4O0TA 1H1PA 3LMGA 4EL9A 3FMLA 1YHWA 2CKEA 3OROA 1AD5A 4FV8A 4JDJA 3SDJA 3CTHA 4UWCA 2Z8CA 4QP8A 2YM7A 1F0QA 5JKGA 1SVGA 5LJJA 2PUNA 5CU6A 3VHEA 4YU2A 4YC6A 2PL0A 2CLXA 3KB7A 4PY1A 5ETIA 2XYUA 2R3OA 1YWNA 4H1JA 3LJ0A 4HYHA 4WNKA 4K1BA 4EOIA 3G15A 3QHRA 4YTFA 4O0VA 2IPXA 3W2RA 1F5QA 2XB7A 2R5TA 4EI4A 3QQUA 3QTZA 1OPJA 4KBAA 2BZHB 4FVQA 3QC4A 2BKZA 3N4TA 4R77A 2UZLA 4CG9A 3AGLA 4O1PA 1UU3A 4FZ6A 3LQ3A 3EQBA 5I9YA 2R3RA 5IA4A 5GZ9A 1XBAA 3EQGA 5HG9A 4RIWA 1H08A 2VWWA 4O0XA 3TM0A 5GJDA 2PMNX 3NNUA 4QP7A 5AV2A 4F6WA 2O0UA 4U7ZA 5HI2A 3D83A 3LFEA 4KRCA 5FGKA 3HA6A 1H8FA 3ODZX 4ANMA 4XP3A 4UB7A 4BKZA 1YKRA 4U3ZA 1STCE 3BU3A 3MY1A 4G5JA 3QYZA 3R71A 3R6XA 5E9EA 1CMKE 1IRKA 5T3QA 1UWHA 1FGKA 2I0HA 3NUXA 3B2TA 3GC9A 3OWKA 3Q9WA 3RPSA 4ANBA 4AS0A 4EH3A 3KN6A 3P1AA 4G6NA 4FNXA 3ZO2A 4APPA 1GIHA 5EYDA 3HL7A 4EC9A 2YJSA 5HG8A 2UZEA 2W0JA 3TNIA 4MAOA 3EZRA 4XOZA 3HMPA 4Z16A 5B2KA 4AWIA 3GCUA 4UXLA 2QCSA 5DT4A 3NLBA 3NNWA 5HBHA 3EQHA 3CJFA 1PMUA 1OIUA 3I1AA 5F20A 3MJ2A 3EN4A 4IADA 5IQEA 5AV0A 3FDNA 2Y6OA 4PL3A 4RVMA 2P4IA 4II5A 2UW3A 4J8NA 4E5BA 3NUSA 4IB1A 3E8CA 5DLSA 5AA8A 5EOLA 2XS0A 3R9RA 4FT5A 4IWOA 2AYPA 3BYVA 5AUYA 3DPKA 2E9NA 1H4LA 4E4XA 1JQHA 1Q8YA 2E9VA 2LGCA 3UYTA 3ZXZA 3BHVA 3ZHPC 5DRBA 5ANEA 4AT5A 5CTPA 4R3RA 4R7HA 1Q61A 3QRUA 2Q0BA 5EW8A 3QBNA 3E92A 4I6FA 5D9HA 4UEUA 3ZLYA 4R1YA 3UG2A 1OIRA 3DAEA 2OIDA 4OW8A 4D0WA 4EKLA 3OY3A 4YP8A 2C6DA 4NM5A 4IAIA 3C5UA 4EOQA 3D5WA 2B4SB 4FTRA 4O22A 4BRXA 2QURA 4K0YA 4FNYA 5D10A 2YIQA 4K9YA 3UQGA 2JFMA 4GMYA 4D0XA 4CLIA 5BYLA 2CGVA 4ZK5A 3A62A 2VAGA 3QAME 5KMMA 4QMYA 2WMSA 3G6GA 1XH5A 2XKDA 4QOXA 3VS1A 3C9WA 2C6LA 3IQ7A 2GHLA 5HE2A 4FT3A 4W8DA 3ORKA 1HOWA 2WELA 4GIHA 4RWKA 2ONLA 3TTIA 3VULA 2OBJA 4I5HA 3AT3A 3QQJA 1PXOA 5M56A 5H2UA 5C9CA 3O7LD 3LXLA 4FSRA 3CKWA 3ROYA 1YXTA 4HVDA 4DLIA 3BHUA 4CZYB 4OTPA 2RKUA 3FQEA 4G3DA 4WG3A 3KMMA 2VWVA 3P86A 5BVFA 4FYOA 2JC6A 2JGZA 3RNIA 3WE4A 3C7QA 3OXZA 4HCTA 3LQ5A 2GNFA 4UMQA 3QA0A 3UPXA 4IZ7A 4YLKA 4DGLC 4D4SA 3GU5A 1QPCA 3OS3A 2JDVA 3ZO4A 2ITXA 4FKOA 1Z5MA 4YO4A 2PVFA 3O96A 3HZTA 5AR2A 4G3GA 4GVJA 3MFSA 3QD2B 4CZUA 4IWPA 1OECA 4IX5A 3OFMA 5E8WA 3LXNA 4HVSA 3ODYX 4ENXA 1J7LA 1NY3A 2UUEA 3MY5A 2Q83A 2OO8X 4F1OA 2C6MA 2QU6A 1FMKA 5E7RA 4IAKA 4JQEA 2R3GA 3EL8A 2RFNA 3Q9XA 4IAYA 2ACXA 5HD4A 1ZY4A 2JLDA 4RIXB 2J9MA 3PVGA 5CSXA 3PXQA 1OPKA 4C2WA 5HVKA 4TYIA 5LMKA 2XKFA 2WHBA 4QQJA 4WNOA 3RK5A 4NEUA 4Z55A 3DXNA 4O7TA 5AFVA 4DFBA 2VGPA 2OFVA 4E7WA 3OCSA 1RW8A 2YM4A 3UG1A 3PY1A 1URWA 2BAQA 4MXZA 5C4KA 4HGLA 5E90A 4IM2A 3ORNA 3ZEWA 1J1CA 3C4ZA 4JX3A 1G8AA 2C4GA 3F7WA 3S1HA 3PIXA 3DT1A 4KS8A 4UWBA 2WKMA 2XJ2A 2YM3A 4MF0A 4QMLA 5JFSA 1M2PA 1NXKA 2B55A 4JXFA 4AE9A 3OCTA 4ACCA 4I3ZA 2OFUA 4F7JA 3LPBA 4DEAA 3VIDA 2X7OA 4GUEA 4MX9A 5DIAA 5DR6A 3ZRMA 3PLSA 3Q2MA 4W9WA 1R39A 4ZSAA 3I0OA 4AZSA 5I4NA 3FMJA 1HCLA 4KKGA 2C3LA 2C5YA 1GNGA 3UP7A 5ACBC 5EYMA 3FXXA 4B8MA 4DYMA 2VTNA 5CEKA 1AGWA 2UW9A 2XZSA 3IGOA 2CPKE 1VYWA 3OCGA 3OEZA 3RAKA 4BDBA 3DKOA 1YRPA 4IX6A 2YAKA 3F5PA 4FTNA 2QQ7A 3KL8A 1CDKA 5ANGA 4FSNA 3SQQA 4BGHA 5JN2A 3QZHA 3RINA 5JRQA 5E4HA 4O7SA 4M0ZA 5HESA 2QU5A 2W1IA 3GGFA 4OAVB 3O71A 3UOLA 4FI1A 4ANSA 3VS7A 3EQPA 4XV9A 4EOSA 3UBDA 2W1EA 4IC8A 5T6KA 4KKHA 3ZM4A 4EC8A 3D0EA 4QQTA 3QYWA 2W7XA 4JBQA 5C4LA 4N57A 3FQSA 3OZ6A 3GQIA 5DA3A 3BWFA 2JDTA 3TNPC 4RJ3A 1FVTA 3LHJA 4IB5A 1VJYA 4XYFA 5AR8A 3RPOA 3DBEA 4ZTRA 1SMHA 2P33A 3WYXA 2QC6A 4CTBA 1DAYA 3EN7A 5CF4A 4BN1A 2HK5A 4U81A 3FMHA 4ZEGA 2A2AA 4IAAA 2OG8A 3KCFA 4DGMA 1RDQE 4XLVA 3UNZA 4AFEA 3F2NA 1UU8A 1M2RA 4WHZA 2JKMA 3MPAA 4QNYA 3GB2A 3M2WA 5JEBA 4OT5A 5DI1A 4F6SA 1WBVA 4IANA 5E8SA 2I7QA 3ZDIA 4CFXA 3MVLA 5EHOA 3O17A 4MXCA 3ZC6A 4ZTNA 2B9FA 3CCNA 4OBQA 4C3FA 3G90X 4GFMA 5EH0A 4IVBA 3FHIA 4PPBA 4WG4A 1WBPA 3GVUA 2WOUA 2E2BA 3Q6UA 3QZGA 4BR3A 3BRBA 2HXQA 3QUEA 4I0TA 3OBGA 4CZTA 5KMJA 3UZPA 3AXWA 3RI1A 5EM6A 4FE2A 1FQ1B 5AM6A 4FTOA 5T68A 4FTKA 4WUNA 4GK3A 4Q9SA 2WPAA 4C0TA 5A14A 1IG1A 1L3RE 3H3CA 2B54A 3KQ7A 5HO6A 3VC4A 4BDEA 5JFXA 2VN9A 5I3OA 2FVDA 2G1TA 1FMOE 1P2AA 3OG7A 2G01A 3R9HA 3VVHA 3EWHA 4JX7A 3A8WA 3ACKA 4U6RA 3D5VA 3VNTA 5CXHA 5AUVA 1TKIA 3RAHA 5I9WA 3EL7A 3P78A 1ERKA 2HCKA 3DBFA 5E8XA 3QTWA 4TTHB 1BUHA 5C8NA 2HXLA 3WZJA 4JOAA 4FV5A 1ZOEA 3PA5A 2A19B 1M17A 2IZTA 5CF8A 4ANLA 1QMZA 4E5AX 3E3PA 1X8BA 2PWLA 2YDIA 4FKVA 5J8IA 3VQUA 2BILB 2BHEA 5LVPA 4O0SA 3K3IA 1U59A 2HELA 3PVWA 4XG6A 3GC0A 5A4EA 2RFDA 4F4PA 2QOBA 5L2IA 4W9XA 5AP7A 5FXSA 3CLYA 4U80A 4KB8A 4YO6A 5EK7A 4O0WA 3KXHA 3W8LA 4NKAA 2OSCA 2GMXA 4FL1A 2QOQA 2GS2A 2ITTA 4FZFB 3FLSA 4UN0C 5JMSA 4FV4A 3TIZA 4BBMA 4LMNA 4I1ZA 5DT3A 3AT2A 3PP1A 3HAMA 4UV0A 3FYKX 4RIOA 4X3FC 4XG9A 5AP0A 5A4TA 2J0MB 3WZDA 1YXXA 2UZVA 5BQ0A 3C0GA 3KK8A 1XR1A 5E8YA 5CVGA 4F0FA 1SZMA 4F64A 3F7ZA 3OOGA 3ZUVA 4FK6A 4HGTA 1SVEA 2WQMA 3BCEA 3DGKA 4U97A 4DGNA 4EK3A 4F9BA 4FIGA 4R5SA 5IF1A 3UOHA 4U8ZA 4GKHA 3UNKA 5AV3A 2XK9A 4ZTHA 2ZV9A 4LMUA 2LAVA 2Z60A 3CEKA 4ANQA 4DBXA 4R8QA 4C4EA 3E93A 5HBJA 5EHLA 4TW9A 3LFSA 3R7GA 5AAFA 3ORIA 5AA9A 3U6IA 3Q4CA 4G17A 4AP7A 4FGBA 1W83A 2ZV7A 3CTQA 3MGYA 3ALOA 3JY0A 1JPAA 3HMMA 4GT4A 3IK3A 5EOBA 3REPA 4XRLA 4CCUA 2WMTA 4FKSA 3SC1A 3MB6A 4HYSA 4QP6A 4NL0A 3MVJA 2WTVA 2RG6A 2G2IA 4EOOA 5EKNA 2X9FA 5IA3A 3OUNB 3M11A 5CZHA 3RK9A 2OXDA 2ZV8A 5TE0A 2CGXA 2DQ7X 4GJ2A 4I20A 3TTJA 5AX9A 4I41A 3O8PA 3S3IA 3P08A 5A6NA 5TT7A 5LVNA 3JR1A 3IW8A 4DEHA 4C58A 1MQ4A 2HYYA 5HBEA 4AZVA 3C4FA 1O6YA 2V5QA 4QQCA 4GG5A 2PTKA 5G6VA 5KMOA 3EJ1A 3UOJA 2J6MA 4YJUA 3IKAA 5ITAA 3PRIA 4FTCA 4MD7E 4YZDA 4FVRA 2PYWA 5CEQA 1BI8A 4ZSEA 5CAOA 2FB8A 3MTFA 1ZZ2A 5AADA 5HZNA 2NPQA 3UO4A 3I81A 1KV1A 5IQAA 3IPHA 4PPCA 4ZY4A 4O2ZA 5M4CA 4DT9A 4M7IA 4KS7A 3V04A 5KBRA 3OT8A 4EQUA 4OTWA 3ETAA 5FP6A 4ZP5A 2XK4A 4DTKA 3CKXA 4ZTMA 4AGDA 3OCBA 4F1TA 1ND4A 2CNQA 3F82A 2W5AA 5ETFA 4D2PA 4ZJIA 4AFJA 3KN5A 5M07A 4I94A 2VO0A 3D5XA 4TPTA 4RJ6A 4D4VA 4YZNA 2HWOA 4C61A 1E1VA 2C1AA 3ZO3A 2F7ZE 5F1ZA 4C37A 1Q8WA 3K5VA 2YFXA 2Z7QA 3V6SA 3PP0A 5HKMA 5HG7A 3BBWA 4HPUE 3ZSIA 4YJTA 4S31A 4EJNA 4BY9E 4TT7A 3NAXA 3R22A 4YLJA 2J5EA 4S33A 3U9CA 4FZAB 4ZS0A 4EH2A 2J0IA 2GTMA 3LFNA 4UWYA 5FBNC 5AV4A 4J1RA 3VUTA 3OVVA 3G6HA 5LQFA 3LIJA 4BI1A 2PSQA 1JLUE 1JKSA 5EQYA 1YOLA 5J1VA 3CGOA 4X21A 2VWXA 4L44A 2HW6A 2PK9A 5AV1A 3VUIA 4Q5HA 3SHEA 3UZTA 5IDPA 1A06A 5J79A 2C3KA 2OJ9A 3QX4A 2P55A 4C4FA 2ZV2A 4IDTA 5H8EA 5EW3A 3F5GA 1OKZA 3PY3A 4E6CA 2HZNA 4WG5A 4QYHA 5CSHA 4ASXA 4C02A 4DH1A 2FSLX 3DFCB 2Y6MA 3UGCA 4FTLA 1H1WA 3GCSA 1A9UA 2VU3A 2WOTA 2OZAB 3NGAA 1I09A 2V22A 3PSBA 4G1WA 4WRSA 4AQCA 4Q5EA 4B7TA 3R00A 4BTJA 3KVWA 4OBOA 1IASA 5CEIA 4NJ3A 2YAAA 4WRGA 3CGFA 4WSQA 4YBKA 3EZVA 3PJCA 4FSYA 4F0IA 3WI6A 3FEGA 5ANOA 4IBMA 4IHPA 4YZ9A 3MA3A 4IJ9A 2XBJA 4S32A 4YHFA 5C03A 1R1WA 1FVRA 4Y73A 2IZUA 4TWNA 2BZJA 4QMQA 4D2TA 2ITNA 4WKQA 4EQMA 3DKFA 5M06A 1REKA 3RCDA 2WMVA 3DU8A 2QKWB 4PP9A 2VWBA 3IDPA 3ANQA 3LQ8A 1OKWA 3KA0A 4FIHA 4UZDA 4C35A 2W1HA 3ZFYA 5IZFA 2XEZA 5HNGA 3WILA 4NTTA 4BCPA 2H9VA 2REIA 4CD0A 4DFLA 2GSFA 3FQHA 2A27A 2VWYA 3E88A 4OTHA 3MPMA 3HKOA 1P5EA 3LFFA 5ANIA 5J87A 3S00A 3V5JA 5HE1A 1Q3DA 4ZIMA 4QP2A 1URCA 1OVEA 3LCDA 3RJCA 2PVHA 3LXKA 5FXQA 2A0CX 2WMXA 5HNBA 4WIHA 4ACDA 5AR5A 4BDGA 5C8KA 3V5PA 4FKPA 5FG8A 3DB6A 4ZY6A 5AUZA 2R0UA 3HGKA 4CT1A 4KBCA 4RLKA 5E1EA 4V05A 4PL5A 4ITIA 3KY2A 2O8YA 2PUUA 3QTIA 2CCHA 3DJ6A 4X7QA 4PQNA 4JDIA 2GHGA 2OIBA 3VQHA 2PE2A 4GFGA 4BDKA 2X4FA 2H8HA 4JAJA 3ZFMA 3TDVA 4ACMA 1JSVA 3E5AA 2B52A 5C1QB 5HEZA 3RAIA 1RJBA 5HVYA 4ZOGA 3T8OA 2XMYA 4FKUA 4DE4A 4DC2A 3FYJX 4UZHA 3NYNA 5D12A 4E26A 4FK3A 3TUBA 4RSSA 5AIKA 3U9NA 3CD3A 3N4UA 1CKJA 3O0GA 1YHSA 3LVPA 3WF6A 1IEPA 4DAWA 3WARA 4W4WA 3SXFA 4X3FB 5ETCA 2YERA 3U55A 3DLZA 3S2PA 1M52A 5AWMA 2FO0A 2BRBA 4IIRA 4L3LA 4DCEA 5IQHA 4HJOA 5HX8A 2ZMCA 3AGMA 5DPVA 1XKKA 5HLNA 4F0GA 2YCFA 3NW7A 3A99A 3LLTA 3LKMA 2NO3A 4JBPA 1H0WA 5KKRC 3W2PA 3NVKI 3OWJA 1P4FA 2ITQA 1OZ1A 4X2JA 3DXPA 5AAEA 3FSFA 3P7CA 1K2PA 3LM5A 2A4LA 4RBLA 2XKEA 4E4NA 2PULA 2B9HA 2YM8A 4M68A 4RLLA 4RT7A 2WMRA 1JSUA 4X3JA 5BVDA 3IDBA 2ONLC 3RK7A 1H00A 2YWVA 2IVTA 2FSMX 5DMZA 4AGUA 3RTPA 3ZRKA 5KUPA 4N6YA 4FTAA 1Y8YA 4YHTA 3Q3BA 2ZAZA 1L8TA 4IVDA 3OEFX 4KRDA 3D7TB 4G6OA 3NVMB 2W4KA 4IVCA 5CU4A 5DT0A 1WMKA 3TKHA 4PTGA 2XYNA 4CKIA 4IM0A 4A4LA 4RA5A 3R02A 4QMZA 3NX8A 4UMTA 2R3IA 4BDIA 4DFUA 4TYHB 3F5UA 2IVVA 2VX0A 2GNJA 3EQIA 4J71A 5AJQA 3DNDA 2XNEA 3RALA 3UMWA 5EDQA 3OY1A 4O83A 1ZARA 4QTDA 3R9OA 3PPZA 4WBOA 4A9UA 2QO9A 3IOPA 5CZIA 5M4UA 1ZY5A 5JZJA 4H1MA 3E8DA 5A6OA 3MESA 2YZLA 4UY9A 4PV0A 2VTQA 2PY3A 3JY9A 4IMYA 4C4JA 3OMVA 3IW6A 4AF3A 3QL8A 2BAKA 3QFVA 5B2MA 5LMKC 4QTEA 4YTHA 1E1XA 4O27B 3AD4A 3CD8A 2IVUA 4AUAA 2UW8A 2WGJA 4GT5A 3BLQA 3AD5A 3A7HA 3PVBA 5IMEA 3HNGA 3ZLXA 1SM2A 2B53A 5IUIA 1WVYA 3TXOA 4BDAA 4FKLA 5LVMA 5I5ZA 3TIYA 1UU7A 2OJJA 2XJ0A 3VHKA 3TJCA 4XV1A 4ALWA 4FKJA 4H3QA 3PJ1A 4O2PA 3WIGA 1K9AA 4O84A 5EQPA 2QI8A 5I3RA 3RPYA 3R9NA 2O5KA 4HNFA 5IUHA 4NM0A 4DBNA 3PSCA 2VTHA 4O7YA 1PXJA 3JYAA 3FZ1A 3QGYA 3ZM9A 5A4LA 4Z7HA 2GQRA 1JVPP 4GU9A 3JVSA 4MTAA 4TKSA 4ONAA 2HAKA 2KTYA 3QRTA 4JRVA 3DDPA 4RJ7A 3B2WA 4BCGA 4CRSA 5DYJA 4G3CA 4HPTE 4EH5A 5DH3A 2CLQA 3A4PA 1DI9A 4BFMA 3HRBA 3MTLA 4LRJA 2W9FB 2YM6A 4KIOA 1O6KA 3UE4A 4EHGA 1H01A 4O86A 4J7BA 4U41A 5CLPA 1ZYDA 2WMAA 5BUEA 3GI3A 3ORZA 4FV6A 3RM6A 4H3BA 2QO7A 3WBLA 2HY81 3S0OA 1V0OA 4GUBA 4L43A 4CV8A 2BDWA 4A9SA 1U5QA 4O91A 4JRNA 4QP3A 1NVSA 3SXRA 3E8EA 3GUBA 4PDYA 2C0OA 3CQWA 4A07A 1DM2A 2WQOA 3QLGA 4A7CA 5GIPE 4EK4A 4LOQA 4MD9E 5HNIX 3V01A 4K8AA 4GL9A 3BYSA 2XNGA 4UBAA 2UV2A 2J0LA 5BPYA 4RC2A 5I9XA 2BDJA 1QPDA 4NIFA 2XRUA 3DZOA 4YJRA 1P14A 4D1SA 2X6EA 4KWPA 4K11A 2XNMA 4MWHA 3QKLA 5L6WL 4F08A 3AD6A 2UVYA 3QUDA 4EH8A 3ACJA 1AQ1A 3LOKA 2OZOA 1JNKA 4NW5A 3F2RA 3D7ZA 2HWPA 2VO7A 2XEYA 3CQUA 3G51A 3L9NA 4MQ1A 4QTAA 3KRXA 4WO5A 4O7WA 3CE3A 2XH5A 2ZYBA 2GU8A 4F9WA 1JKKA 3QD0A 3IW5A 4DG3E 2IJMA 4JQ8A 3DTWA 3QTRA 5CAQA 1ZXEA 3HV3A 3LJ2A 4EEVA 4DCAA 5HCXA 5IISA 3BHHA 3VUKA 3LFDA 4MD8E 3HMNA 3R7IA 1OI9A 4O0YA 1YOMA 2OJGA 3WOWA 1YDTE 3D94A 3THBA 4GT3A 5ETAA 3N51A 3R9DA 2R7BA 5CU2A 4DFYA 4PNIA 3Q52A 4AXAA 3AC8A 1QPEA 1PXKA 1BYGA 2J50A 3ZCLA 3FBVA 4C36A 5L8LA 2BKKA 4XG3A 1GZKA 3B8RA 3R21A 5C8MA 2C0TA 4YSMA 3K3JA 4RIXA 4WD5A 3ZOSA 4WT6A 4D2SA 3SD0A 4PMTA 4ZY5A 2X1NA 4LM5A 4I5PA 3FLWA 3D5UA 4QYGA 5M57A 1UVRA 2CHLA 3BI6A 4HGEA 3U51A 2B7AA 2QG7A 4F1MA 2FSTX 2GDOA 1SNUA 3DQXA 3FZRA 4QMOA 3LJ1A 5FEQA 4YURA 4E1ZA 4CNHA 2JIVA 3F88A 4GVAA 4LOOA 1JOWB 4PWNA 4RIYA 4XMOA 1W8CA 5ANKA 4CKRA 4BCNA 4LUEA 1U54A 2X2KA 3W1FA 5IDNA 4FV3A 2RF9A 3LE6A 2Z7RA 2PHKA 3FPMA 4Y5HA 3A61A 2YABA 4IAFA 3CXWA 4FR4A 5CVFA 5FD2A 2HOGA 4J53A 2ESMA 3QCSA 3HRFA 4JQ7A 3KRJA 1OB3A 2FYSA 4R3CA 5I9UA 3VRZA 2RFEA 4C59A 3O2MA 4AOIA 3IONA 4JAIA 3GU4A 2CJMA 4AX8A 2W05A 5IUGA 3ORXA 1ZZLA 2PMLX 4BWKA 3DNEA 4CLJA 3W8QA 4USDA 4RVKA 3NNVA 5J1WA 3RAWA 3EH9A 3VS3A 4EZ5A 4JDHA 1YW2A 1KSWA 2C3JA 4FZDB 4WBBB 5LXMA 4DA5A 3G0FA 3D15A 3MH0A 5KMLA 5EM8A 5KKRB 1H1QA 2ZVAA 4ZLOA 1PMEA 1YXUA 2JKKA 3WF5A 4KBKA 2YITA 4QT1A 3V5WA 4O1OA 5IH5A 4ZJVA 4N0SA 2EU9A 2BCJA 4C2VA 5M44A 4FICA 2WO6A 3Q6WA 3F3ZA 3R1YA 3K54A 3SV0A 4MHAA 5J9ZA 5IEYA 3W10A 3D9VA 4AN3A 3ID6C 4EH7A 4I6QA 2OWBA 3VF9A 3VS5A 1UKHA 1MP8A 2C6IA 4PDSA 4EUUA 4C38A 2ITWA 3CBLA 2GS7A 4EBVA 4LGHA 4LFIA 3Q2JA 3E8NA 3A7FA 2QOLA 2XKCA 4AG8A 3ZMMA 4CSVA 3MYGA 4V0GB 4QNAA 5DOSA 3R8MA 2C6KA 4I22A 2QR7A 4BDDA 4IFGA 1APME 4FSZA 4O6LA 2HY0A 3MN3A 5HOAA 1DI8A 4KKEA 1NVRA 2CMWA 3AC5A 3BU5A 5CI6A 2CNVA 1CKPA 3L8XA 4LGGA 3HVCA 3V3VA 1OL6A 4TY1A 5AP6A 4TNDA 3BYOA 4FUXA 3D14A 5L6OA 3WZEA 4O7NA 5I9VA 2BMCA 2BTSA 4TN6A 3ORLA 4EOLA 3ZZWA 4WOVA 3FHRA 4EYJA 1VYZA 5AAGA 4LRMA 3U54A 2X8DA 3FJQE 4BCQA 4W4VA 3SG8A 3M42A 4AN2A 3COHA 5LARA 4IB3A 1JSTA 3UVQA 3GCPA 3Q4ZA 4XG7A 4ANNA 5JQ5A 4RWIA 1ZYLA 4YBJA 1U5RA 4W4YA 4MWIA 2PVKA 5HG5A 3ZXTA 3RMFA 4S30A 5B7VA 4BHZA 3FZPA 3RHKA 2R3KA 4QTBA 3EQCA 4PMMA 1Q8ZA 3GEQA 4ERWA 3NEWA 2V62A 1OUYA 1SVHA 3ZBXA 4RG0A 2R3PA 5H8BA 2YDKA 3FI4A 2XIZA 1Z57A 4JL9A 3KULB 4EHZA 4D1ZA 5L8KA 1GAGA 5HTIA 2DUVA 2OXYA 3WF9A 3QHWA 4ZS4A 3O23A 3ANRA 1KWPA 2R3FA 4F7LA 3O7LB 4CYIA 4ZMFA 5LVLA 2GCDA 3AMYA 3PY0A 2CKPA 5K0XA 1KE7A 1YXVA 5F4NA 3ATTA 3TDWA 5CU0A 5EDPA 4QQ5A 5IEXA 2Z02A 1Y6AA 3G5DA 3P4KA 4L45A 4DGOA 3LW0A 4X6QC 3R30A 4N4SA 4WUAA 2C47A 3Q4UA 3FY2A 4XP2A 3E7OA 4IWQA 4FIFA 3FC2A 2PVMA 2YIYA 3UVRA 4O7RA 4JG7A 3SOCA 4AZTA 1QPJA 5HLPA 1LR4A 4V01A 3FLNC 5EM5A 3ZRLA 3ZLSA 4RJ8A 2X8IA 1IAJA 2ZJWA 2E9PA 4HVGA 1J3HA 4E4MA 4GK4A 1YI6A 4L46A 5CSPA 4IE9A 1U46A 5DFPA 3RBWA 3NSZA 2EWAA 4BI2A 4CXAA 5IMXA 2XIKA 4KIPA 4GK2A 2WXVA 4XJ0A 4NM3A 5BUIA 3R7OA 4O96A 3HDMA 4BCFA 5F9EA 2UVXA 3VW8A 1BL7A 3GFEA 3BV2A 1U4DA 5GJFA 4ANOA 2ZDTA 3ALNA 4NWMA 4OTDA 3PIZA 4RRVA 2J51A 3VUGA 2E9UA 4TWPA 4C8BA 4I21A 1REJA 4ZJJA 4AZFA 2GNIA 3PUPA 4BYJA 1NT2A 3F3VA 2OF4A 4E4LA 4QO9A 4XV3A 5AP3A 3EMGA 1M7QA 4B8LA 4CFUA 3FC1X 4TWCA 5EM7A 3BYUA 1ZRZA 3MJ1A 1G5SA 1OL7A 3ZYAA 4CCBA 1O9UA 2Z2WA 4GSBA 1OUKA 4FOCA 4N70A 4GU6A 4RQVA 3R8LA 2BPMA 2W1CA 4RPVA 4D5KA 4MQ2A 4RZWA 2B1PA 4ZZNA 4BDCA 3F5XA 4IXPA 4EZ7A 2BRHA 4RJ5A 3UIBA 4B6LA 3ULIA 2W96B 1R3CA 2R0IA 4BCJA 1Q5KA 4C4IA 1LEWA 3QU0A 4TZRA 2R64A 1DS5A 2BUJA 3H9OA 2Z7SA 2QKRA 4AGWA 1FBNA 5HLWA 4KA3A 2OXXA 3UC3A 5HVJA 4L01A 3W2CA 2FGIA 4XCUA 3EKKA 2IO6A 3CC6A 2QOFA 5B0XA 5HO7A 5CI7A 1MUOA 4MNEB 4NFNA 3HDNA 2OIQA 3GCQA 2ERKA 4EH9A 3KXNA 4GRBA 3UODA 2ZMDA 2XK6A 3SA0A 4A9YA 3NS9A 4RJ4A 4BIBA 4XBUA 5DG5A 3QD4A 2VWUA 3G9NA 4NSTA 3ZS5A 5M55A 3LMIA 3UZRA 1RQQA 4JS8A 3FLZA 3TJDA 1Y8GA 2XIXA 3F69A 2JEDA 4QPAA 3R7VA 3LCTA 4QYEA 3DFAA 3R8ZA 4QMSA 2X2LA 2JIIA 3HV5A 3MA6A 2BRNA 4TYGA 2UZUE 2X6DA 3ENMA 5EHYA 5HQ0A 5CASA 1PY5A 4L7FA 3FLQA 1J7UA 1XJDA 4YJVA 4PNKA 3GNIB 1GJOA 3VJNA 4A9TA 5FDPA 3PJ8A 3PDTA 1ZOHA 4FV7A 4PMSA 1GOLA 4KABA 5HCYA 3T9IA 3U4WA 3DY7A 2ITZA 3OWPA 3R1NA 2I0YA 3KRLA 4EH4A 4YTCA 5JGBA 4DH5A 2YJRA 4J99A 3R73A 4ASDA 2VTAA 4G9RA 2YCRA 4PDPA 4AOTA 3R7YA 4I6BA 1JWHA 2JD5A 4XG4A 3RZBA 4BGGA 4NCTA 1WBTA 3W55A 4D9UA 3TV6A 2R9SA 1PKGA 4R5YA 4ENYA 3QALE 3MY0A 3N9XA 4DN5A 4IJPA 4QMTA 4DEDA 2G15A 4BCOA 4FODA 2F7XE 3C50A 5CS6A 3TNWA 2F49A 3DBCA 4UMRA 1XH8A 4NTSA 2VZ6A 2WTKC 1OITA 1MRVA 4UMUA 4M12A 1PXIA 3ZONA 3A7GA 4IH8A 1J7IA 1LP4A 2GS6A 2VUWA 4FT0A 1BMKA 4O82A 3GENA 3QCQA 3BLHA 4F7NA 3UIUA 5GZAA 4QMNA 3KC3A 2P3GX 3C4WA 3SAYA 5CVHA 2W1ZA 5FM3A 4AE6A 1FPUA 2AC5A 4RC3A 3BV3A 2VTRA 4XX9A 1PXLA 4ZSLA 4M84A 4BVUA 1GZ8A 4IWDA 4JG8A 1P4OA 1W82A 1WCCA 3UQCA 3FMNA 3WF7A 2PVNA 3DZQA 3POZA 4YR8A 3ZUTA 3R1SA 2WD1A 3AC2A 2OJIA 1SNXA 4A4XA 4C62A 2DS1A 3KXMA 5TOZA 3ZTXA 4DINA 4I4EA 4ZLYA 3AG9A 4GH2A 3KXGA 1Q41A 4FX3A 4F09A 3I7BA 4UYAA 4CGAA 1ZAOA 4IAZA 4RX5A 3BE9A 2XK7A 4YNOA 1H07A 1H27A 4DT8A 1O6LA 4DTAA 1NW1A 3IDCA 1UNGA 2O65A 1CTPE 2OZAA 5DBXA 3VAPA 2YACA 4FTJA 3VBWA 3HEGA 3ELJA 3CTJA 3VF8A 2PZYA 5J9LA 5BVOA 2NP8A 4YTIA 2IN6A 2QD9A 4BICA 3FSKA 2C6EA 2V7AA 3C13A 2XIYA 3R63A 5CQUA 1IA9A 4P7EA 3W2SA 2FSOX 4BZNA 3ORMA 4YGAA 2F4JA 4FV9A 4QP1A 4V04A 3C51A 3W2OA 4ASEA 5KZIA 2W99B 1VEBA 2GNGA 3BZ3A 1OPLA 2VNWA 4M15A 4UYNA 3R28A 4L8MA 3DAKA 4CMOA 2WMWA 4ZAUA 4IC7A 4U9AA 4E73A 3NMUF 4AAAA 4QP9A 4F6UA 1YQJA 2J7TA 4IACA 3VRYA 1HCKA 4QPSA 4C7TA 4OLIA 2BRMA 2ZM3A 4FMQA 2KULA 1UV5A 1ZOGA 5ANJA 5F95A 1OL5A 2PZRA 2WTDA 4ID7A 4EZ3A
chains in the Genus database with same CATH superfamily
5IKWA 3OXTA 4P4CA 3VS0A 4D2RA 4U44A 3DB8A 3ORTA 5EG3A 5JZNA 1Q3WA 2Y0AA 2ITOA 2PE1A 3PRFA 4X2FA 3EN9A 3R8PA 3MW1A 3NWWA 2X81A 1V0PA 2O3PA 2EB2A 3UC4A 5CSWA 3MVHA 4CRLA 1PMVA 3KKVA 4AXFA 3H0ZA 2YIWA 3U6JA 3O50A 4PF4A 4LRKA 4AZWA 2QOHA 3QC9A 2W17A 5JFWA 3TZMA 5M53A 1T45A 3BGQA 4AACA 4EBWA 4XEYA 4BBFA 3OWLA 4BDFA 5LMBA 3HX4A 4NZWB 2QHMA 1BLXA 3A60A 3F3WA 3MB7A 1OL1A 3QRIA 3QRJA 5H8GA 4I5CA 3PXYA 2ERZE 2IZSA 4FTIA 4E8AA 4Y8DA 2HZIA 5BYZA 3S4QA 5IQBA 4NKSA 2CCIA 4BZDA 3GXLA 3AT4A 3BGPA 5BMSA 2CKOA 3F3TA 4M13A 4NU1A 5AMNA 2XM8A 2F57A 3FMKA 5KZ0A 2O2UA 5IA1A 3TNHA 1BI7A 4IW0A 4UX9A 3PWYA 2UW4A 4M3QA 4X3FA 1Q4LA 3EFWA 3Q32A 5FBOA 2F9GA 4MUQA 4QRCA 1Q24A 3H9FA 4BBEA 1WVWA 2W5BA 4FSWA 4OTGA 3ZO1A 5BYYA 4FSTA 3OTUA 4BDJA 2ZB1A 2C0IA 3I5NA 1KE5A 2PMOX 2PVJA 3II5A 3PG3A 2GFSA 1YI3A 3UP2A 3E87A 4C4GA 4L67A 4W8EA 3BBTB 5EDRA 2QR8A 4YZMA 3NZ0A 5ACKA 4FEUA 2OK1A 4ZSJA 3VS6A 3I6WA 2WEIA 3VS4A 5L3AA 4XOYA 5D7VA 1H26A 5E8ZA 3KU2A 3NYOA 4FKGA 4Z3VA 5IH6A 1JKLA 3KEXA 3MSSA 2HIWA 4LL0A 3NIZA 3AC1A 1PYEA 2YLFA 3RCJA 5KNJA 4IX4A 3ZSGA 5LVOA 2XK3A 2Y4IC 2V7OA 2FA2A 2BR1A 3M1SA 4KIKA 4PTEA 4J8MA 5EI8A 4O7VA 3GFWA 5FWKK 2BHHA 3HRCA 5DEYA 1TQMA 4PRJA 4KSPA 4FIEA 3LFBA 3FL5A 4I93A 2X7FA 4F70A 4D2WA 4M69A 4PTCA 5F94A 2XJ1A 3UO6A 3AQVA 3L9PA 3TV4A 3DLSA 5K5XA 4Q2AA 2PVYA 3C0HA 1JKTA 1H25A 4EWQA 3OUKA 4NT4A 1PYXA 4CTCA 4O6EA 3PXKA 4CFWA 5KBQA 2P2IA 4J95A 5DR9A 2QODA 1IA8A 3CSVA 4GW8A 3EQFA 4M8TA 4RX9A 1FVVA 4QTCA 2WTJA 4CEGA 5CEOA 3FV8A 2QOCA 5FLFA 4XHKB 2OLCA 5D7AA 2VTIA 3P79A 4K6ZA 3C5IA 2E9OA 4OTIA 3VUDA 4E20A 3R2BA 3H4JA 1UKIA 3I5ZA 3DXQA 2XCKA 2QG5A 3VN9A 4AA4A 4IQ6A 3QGWA 2PZPA 2NNWB 4PP7A 1PMNA 3RNYA 2WB8A 3GC7A 4FEVA 2VD5A 4GS6A 2JKOA 4D9TA 4EK8A 1OIQA 2QONA 4JBOA 3A4OX 5IU2A 2ITPA 2WMBA 5G1XA 4FBXA 4EOKA 1TVOA 2W1GA 1PW2A 5I9ZA 4AT4A 1I44A 2R3JA 5CAUA 2XCHA 3C4CA 3F6XA 3KVXA 4FT9A 3OW3A 5DR2A 4IEBA 5L2WA 3VUMA 2WTKB 3MPTA 4FG8A 4PUZA 3BKBA 5IQDA 3PLAE 4FV0A 1KOBA 4X2KA 1OGYA 3ENHA 3BELA 2CNUA 2JFLA 4USFA 3OT3A 3UNJA 4FUYA 5KO1A 3R8UA 3RWPA 3Q5IA 3HUBA 3EN6A 3QRKA 4P2KA 1OBDA 3SRVB 5CF6A 4M0YA 3TN8A 1B39A 4HNIA 5JGDA 4FZ7A 5TF9A 4BIDA 3V8TA 3O5AA 5L2TA 3FI2A 4RWLA 3KFAA 2C5XA 2R2PA 2VTTA 3PYYA 4JR7A 3E7VA 5EKOA 3F3UA 2YEXA 4FTQA 3PJ3A 4MVFA 2X9EA 4CMTA 3SW7A 1H1RA 3DOGA 5LWMA 1ZMUA 5M4IA 1ZLTA 2IEWA 3ERKA 4XV2A 3IW7A 2Y9QA 4U40A 2UZTA 4NH1A 1LPUA 1PJKA 4TWOA 3QD3A 5TR6A 2BZKB 3VO3A 4FG7A 2C68A 2UZDA 5AP4A 1A48A 3FKOA 3PPKA 2X0QA 5AIRA 3R7EA 2ITYA 3MWUA 2XIRA 5J5SA 4BWXA 3DTCA 1ZWSA 5IEVA 3DJ7A 1MRUA 5D41A 4OUCA 3O51A 2YLEA 4K2RA 5L8JA 3EB0A 5DNRA 4A9RA 2P0CA 4P5QA 3W0MA 4BB4A 4LV7A 3NCZA 4D5HA 1KUTA 5CALA 3FWQA 4NM7A 4LV8A 4BIEA 1YI4A 4G3EA 2XANA 4X2NA 5BUJA 4O7LA 2C1BA 5AX3A 4EYMA 3HAVA 3MDYA 4FKTA 2WAJA 4QPMA 4UXQA 4FEWA 1VR2A 2VTJA 3D4QA 1PKDA 2W9ZB 1J1BA 3VBTA 3QX2A 1WVXA 3BHTA 4YJPA 1XWSA 1K3AA 3TG1A 1BL6A 2JAVA 5K5NA 4FIIA 2ITVA 3NAYA 4X2GA 5K0KA 5EQEA 1CSNA 3CY3A 2BIKB 5HE3A 3BQRA 3EOCA 2ETRA 2JDRA 4NJDA 5EYKA 3WF8A 5HU9A 5A3XA 2EVAA 4I6LA 1UU9A 3ITZA 2CGWA 5FDXA 4YJSA 2VWIA 4CFMA 3ZLWA 2GQGA 3IG7A 3RHXA 2Q0NA 2J2IB 4OTRA 4A06A 4GYIA 3F66A 2J5FA 4KUJA 4FSQA 3QKKA 3SOAA 3TKIA 2FUMA 1F3MC 2PZIA 2WU6A 4DTBA 5EYCA 2WTCA 2JIUA 4FKWA 4O4CA 1YOJA 3H30A 3ZU7A 5IPJA 4RIWB 3FI8A 3O8UA 1EH4A 1M2QA 2RIOA 4L68A 2YIXA 3ROCA 4MF1A 3HV6A 5BVEA 4L00A 5CT7A 4YNEA 1OM1A 4BKYA 3IS5A 3Q53A 3TCPA 3UDBA 1XMMA 2OH0E 3VBXA 3CPBA 4J97A 5TO8A 4CQEA 4ORKA 2ZOQA 2V0DA 5HX6A 4FNWA 4R6VA 4Z9LA 4DFNA 3U8WA 4MXOA 3COKA 5GIOE 5E1SA 4NW6A 4HVIA 3PTGA 2VWZA 1DAWA 5A4QA 4HZRA 5M51A 4QYYA 4U43A 3HA8A 1Y6BA 4XLIA 1WBNA 1WBOA 3RWQA 4FG9A 3DV3A 1FGIA 3GC8A 4EK5A 4RMZA 4L9IA 4MXYA 4DH7A 3U6HA 4M97A 5CXZA 4EWHA 2YDJA 3PE1A 4RQKA 3HMOA 3ET7A 3W33A 4QMMA 3QWKA 2AUHA 3TWJA 4FYNA 5HIDA 5HU3A 3L9LA 4YC8A 5GNKA 3V51A 2Y7JA 3SX9A 2NRYA 3RZFA 4NIFB 3BLAA 5HIEA 5FP5A 2I0EA 4L3JA 5I0BA 4RA4A 4FOBA 3QZFA 1GZNA 4MBLA 4U3YA 4E6QA 4O0RA 3DCVA 5L6PA 4JG6A 1ATPE 5BX0A 2X7GA 3COIA 5KX8A 1G3NA 2VV9A 4KNBA 4FTUA 4I24A 3QTSA 3RPRA 1W0XC 2I6LA 4FF8A 3FZSA 5JGAA 5LOHA 2H34A 5IA2A 2IWIA 1GY3A 3P7AA 2Y4IB 3NRMA 3WE8A 4H05A 3I79A 2GFCA 3ZZEA 2WMUA 3DK3A 4V0GA 4F9CA 2XNBA 4HVHA 4E6DA 2QVSE 3P23A 4HOKA 3MV5A 4BDHA 2X0OA 3EHAA 3HP5A 3UJGA 1PRYA 3V5QA 3RPVA 3GT8A 2XNPA 1H1SA 4C57A 1M7NA 4PPAA 4BCMA 2ETKA 5A46A 4EQCA 2X2MA 3PSDA 3WZKA 2O63A 2X4ZA 2NRUA 4HYUA 4XG2A 3H0YA 4KINA 4D58A 4OR5A 3TZ7A 2WIHA 5CANA 2WZJA 2YWPA 4YUQA 5IG1A 5KMKA 1Y91A 1W2FA 3N4VA 4DF3A 1XBCA 4IM3A 4RVLA 4H39A 4YPDA 3QQKA 4YMJA 5JT2A 3GOKA 4GV1A 3KGAA 5IA0A 4G2FA 3GCVA 3LMHA 4GJ3A 2UVZA 2PPQA 3Q60A 4XNEA 2YIRA 1MQBA 1QCFA 3FMMA 3LXPA 5CQWA 5HCZA 4NUSA 2G2FA 2WFYA 2PE0A 4LYNA 3FZOA 4F65A 5D11A 3LFQA 3BGZA 5A9UA 3Q4TA 4G31A 3V5TA 4W4XA 2YM5A 4F63A 4TNBA 3R04A 4R1VA 2WTWA 4FL3A 5IH4A 2BFYA 3OHTA 4D4RA 4C3PA 4FV1A 3UQFA 4Y72A 2QO2A 5JSMA 2JKQA 2YCSA 2BFXA 3KULA 5AP2A 4CT2A 3EIDA 2C3IB 4RFZA 3WIKA 4CYJA 3CY2A 2R4BA 3JS2A 4KIQA 4LOPA 4RIYB 4AW2A 4FSUA 1Y57A 3NUPA 2GHMA 1U54B 3GU6A 2UW0A 3BIZA 4ERKA 4EORA 4NCTC 3TT0A 3DS6A 4IZAA 3AMBA 2ZDUA 3A7IA 3H10A 3PIYA 5TKDA 4BTKA 2ZM4A 3LCKA 4ZTLA 3DDQA 4JBVA 1XBBA 2WU7A 4BTFA 3QTXA 2GPHA 3EYHA 2P2HA 2W06A 3FKNA 1PXNA 4AW0A 2VTLA 4YZCA 2RFSA 4BCHA 4H58A 4I23A 4X0MA 3BX5A 5CEPA 3L8PA 2XK8A 2VRXA 4RX7A 4EONA 3CIKA 1YDSE 2PVRA 2FH9A 3KF7A 4U0IA 4MXAA 2PVLA 1FINA 1GIIA 4Y46A 5ICPA 1Q62A 5IA5A 5LCKA 4D1XA 3BPRA 3PZEA 3U87A 4YJOA 1TQPA 1CKIA 3FL4A 4FEQA 1IR3A 3OOMA 4AXDA 4MH7A 4RC4A 4AA5A 4AU8A 4BF2A 5GINE 3DAJA 3BLRA 3NPCA 1Z9XA 4BJJB 2CN8A 3KF4A 3WZUA 3FY0A 4XRJA 4BCIA 1ZMWA 4WNPA 4BTMA 4DEEA 2CKQA 5AR7A 1XH6A 5BNJA 2AEGA 4IFCA 4DEGA 2C6OA 4TL0A 2IW8A 3TMOA 3NIEA 5AP1A 1ZYJA 3COMA 1ZYCA 3C1XA 5CNNA 1WFCA 3JUHA 3LFAA 3DBQA 5IQGA 2VO3A 2W1FA 4ZTQA 3VW6A 3Q9YA 4F7SA 5E8UA 2XBAA 4AZEA 4GCJA 3TUDA 3G0EA 4HW7A 5J5TA 3TL8A 5CX9A 4Y83A 4FNZA 3PXZA 5CNOA 3UOKA 4C34A 3MFRA 4X6RA 3L8VA 4AAYA 5M08A 4DITA 5DEWA 1XHAA 3DJ5A 4I4FA 2XAMA 4JDKA 1KOAA 1XH9A 5FRIA 4FVPA 3SXSA 4D55A 3CP9A 4F99A 5A54A 3UPZA 3SW4A 2Y8OA 2AC3A 4PMPA 2WEVA 4LUDA 4MNEA 4DG0E 3F9NA 2BROA 3HECA 5JK3A 2G2HA 4GKIA 1FOTA 3LCOA 4TYJA 2C6TA 3QWJA 4OT6A 5HICA 2R3HA 1XH4A 5AEPA 5J7BA 4RVTA 3I4BA 4DG2E 2JBOA 3CS9A 4NYEA 3AC4A 3TUCA 4JI9A 5K4JA 3C4XA 2XAOA 2R3MA 2EXMA 4CFNA 3DA6A 3VJOA 4DHIB 5AR4A 4L6QA 3WYYA 4EH6A 4RZVA 1YWRA 3MH2A 5E92A 5DN3A 1E9HA 2UW7A 3AMAA 3NYVA 5CENA 2RL5A 3NUAA 1UA2A 4EOMA 2ZB0A 4DH3A 3K5UA 2J90A 1UNHA 4MKCA 4ZMEA 1YHVA 2XUUA 4TXCA 4DHJA 3LFCA 3ZUUA 4HGSA 3KCKA 3O8TA 2UW6A 4B99A 3TI1A 2XM9A 2XP2A 2H96A 2J0JA 5M09A 3AKLA 4ZZMA 1UNLA 5HTCA 5AM7A 3CQEA 3FMDA 4D28A 3NR9A 4RX8A 4CVAA 4KAOA 2X8EA 2WQNA 4EOPA 2QOOA 4CMUA 3KXZA 4UALA 4GIIA 2QLUA 5DE2A 3GBZA 2VO6A 4ALUA 2OGVA 4BYIA 4DEIA 1WAKA 3QXPA 4U5JA 2CSNA 3MH1A 1V1KA 3K2LA 4N6ZA 4G3FA 4ASZA 5CAPA 2VX3A 3BHYA 2PMIA 4YHJA 1LUFA 2QOKA 5E91A 5A4CA 5M4FA 5C01A 4H36A 4GEOA 5CY3A 3F2AA 4MEDA 3BWJA 4S34A 1H0VA 4ACGA 2BRGA 2DYLA 2VX1A 2BDFA 4E6AA 5AP5A 3POOA 2I1MA 4D4YA 4CKJA 5FEDA 4KSQA 3A2CA 1TZDA 2JBPA 4TRLA 4EJ7A 2PUIA 4D2VA 3TZ9A 3P0MA 2B0QA 3PPJA 3HMIA 1JAMA 3NW6A 2ZM1A 2OKRA 2XF0A 2JAMA 2OU7A 3IO7A 3PFQA 4USEA 4YPSA 4Z7GA 2QLQA 1B38A 4G5PA 4DLJA 4E93A 5LCJA 1IAHA 2HZ4A 4LG4A 4OTFA 1ZMVA 3MIYA 4NK9A 3GP0A 4C33A 4FKRA 4DHZA 4FKQA 5HHWA 4APCA 3DK7A 2UZOA 3JPVA 5FTOA 2R3QA 1PXPA 3UO5A 4FT7A 5JQ8A 5CAVA 2C69A 3BEGA 4RFMA 2C30A 2A1AB 2W5HA 3E3BX 3B8QA 5HO8A 4JMQA 1MRYA 4AN9A 4BI0A 3KRRA 3PE2A 3UYSA 5CEMA 3SG9A 3PJ2A 5K9IA 3MH3A 4YJQA 4EK6A 3T3VA 5GZ8A 5KMNA 2F2UA 2ITUA 4RWJA 3KREA 3FXZA 4JR3A 1YWVA 2OICA 4GYGA 3HUCA 2QOIA 4QMUA 4YC3A 2HZ0A 3R7UA 3I7CA 4XH6A 5GHVA 4ZZOA 2OJFE 1KV2A 3H9RA 3MI9A 3SLSA 3QQHA 5L2SA 3FMEA 4HZSA 3ATSA 4G6LA 3ZDUA 2BVAA 2YISA 5EFQA 5FUTA 3R8VA 3VS2A 2EXEA 5K3YA 2PU8A 4OAUC 2WIPA 3FE3A 4QP4A 4BGQA 4YLLA 3AOXA 3OXIA 4QYFA 3QCXA 3QXOA 4EHVA 5CF5A 3E62A 2IZRA 1OL2A 3L1SA 2BTRA 5HGIA 4C3RA 4K33A 3QKMA 4R7IA 3HP2A 5DVRA 4DHFA 2YHVA 3V8SA 4XS2A 1XH7A 2HENA 3NUNA 1B6CB 2QHNA 3QQGA 5J9YA 3G2FA 3HV4A 4ARKA 3L9MA 2OF2A 4AXEA 4FTMA 4L42A 5JH6A 4L52A 5J7HA 3JXWA 3ZC5A 2I40A 4EKKA 1ZYSA 1UWJA 1KE8A 3EFLA 4DFXE 3A7JA 3GU8A 3OD6X 4I6HA 3JVRA 3SGCA 3GU7A 4E3CA 5FTQA 2VNYA 5EI6A 4I5MA 5FTGA 2R3LA 4QMWA 4MCVA 4DFZE 2W1DA 3SVVA 3LM0A 5FXRA 3QZIA 4ALVA 4AGCA 3S95A 3BEAA 4BKJA 5DWRA 3ZBFA 3BU6A 4ZLZA 3EQDA 3KMWA 4OGRA 3NDMA 2CN5A 4YZBA 4CV9A 1NA7A 3E64A 4J96A 3P9JA 3DKCA 3QCYA 1R0EA 2WTIA 2BALA 2XVDA 1W2CA 2XRWA 3OC1A 4ACHA 4F9AA 5K4IA 5KHXA 3TNQB 2F2CB 4FC0A 3IOKA 3PXFA 4MXXA 5HD7A 3MFTA 3PXRA 3W32A 2UZNA 5FM2A 5BMMA 3R0TA 4O81A 3TKUA 3ULZA 4Y85A 4BL1A 5LWNA 2YA9A 5FEEA 4GG7A 3DKGA 1S9IA 5AUXA 4FEXA 1W7HA 2C5OA 3BQCA 3G9LX 5E8VA 4JVGA 4L3PA 4FIJA 2R7IA 4ITJA 4QMPA 2XA4A 4FL2A 5C26A 4HCVA 3D2IA 3FPQA 5L2QA 3EQRA 3VUHA 3E63A 4Y95A 5CYIA 3RKBA 3FAAA 1H24A 5JFVA 1W84A 3HV7A 3HYHA 1YXSA 4FA2A 3EFJA 4M67A 5ANDA 3RVGA 3NUYA 4ZSGA 1KE6A 1PHKA 3V6RA 4MBJA 4A4OA 4L53A 2VTSA 3TZ8A 3ORPA 3QTQA 1KE9A 3LCSA 4S2ZA 2BAJA 1LEZA 4H3PA 3VWAA 1BKXA 5DGZA 4DGGA 2X39A 2IW9A 3CPCA 3UMXA 3IECA 3PA3A 4CG8A 4O4EA 1H28A 3C0IA 3MFUA 4BCKA 5LMAA 1OKYA 4M14A 3VONA 3I0QA 1Q8TA 3Q9ZA 2VTMA 4XUFA 5D1JA 1Q99A 1TQIA 3QLFA 4QMXA 1R0PA 4B0GA 5L4QA 3LLAA 1NVQA 2UZWE 1OKVA 2B9JA 3GOPA 1JBPE 3VBQA 3FKLA 3QQFA 4GFOA 4UMPA 4I0RA 3UIXA 1YDRE 4OBPA 4PX6A 4FTTA 5DHJA 4I0SA 5HE0A 4CFFA 2W4JA 1G8KA 4EHEA 4G34A 4K77A 2JITA 2Y4PA 3GQLA 3NUUA 2XNNA 4PDOA 5BVNA 3UVPA 2JDOA 4R78A 4BZOA 4YJNA 4OTQA 2OH4A 1G8SA 4E5WA 2BIYA 3FZTA 4B4LA 2RG5A 2EXCX 3QQLA 3W18A 4HCUA 4KD1A 4O4BB 3TEIA 2YN8A 1V0BA 4PL4A 3EN5A 1VZOA 2WNTA 3FXWA 4FV2A 3SKCA 4XP0A 4IDVA 4MNFA 3QA8A 4Q9ZA 1BX6A 3P5JC 2OW3A 3L8SA 3V5LA 4IVAA 4J98A 1WZYA 3MBLA 4O21A 5H9BA 2I0VA 4FGRA 3UTOA 3QTUA 4G16A 3T3UA 3TV7A 4AW1A 2ETMA 3FLYA 5IQCA 4ITHA 4XBRA 3BYMA 4L7SA 4AW5A 3NNXA 2WQEA 3P7BA 2WQBA 3OW4A 3NCGA 4QMVA 3NYXA 3EFKA 3PG1A 4JNWA 3A8XA 3ZH8A 4AOJA 4YSJA 5GJGA 2GNLA 4JLCA 4HYIA 3ZSHA 4O7ZA 4U79A 3KXXA 4J52A 5C27A 1GIJA 3D7TA 3P5KA 3G33A 2VTPA 2EUFB 5EW9A 3UIMA 4P90A 4G9CA 2RSVA 3OBJA 5H3QA 2JDSA 2PUPA 3DK6A 5CU3A 4BWPA 2C5VA 3EKNA 4IZYA 2GTNA 4CQGA 2IG7A 4R7BA 4C4HA 5AR3A 3PA4A 2WMQA 5FQDC 2DWBA 4TYHA 3R2YA 4XG8A 5CSVA 2X0GA 1T46A 4WSYA 3KK9A 3PWDA 4LGDA 2CDZA 3CJGA 3KMUA 3Q5ZA 4P5ZA 5KE0A 5BVWA 3R83A 3TACA 4IB0A 1CM8A 1J91A 1WBSA 4LV5A 1WBWA 4AA0A 1RE8A 2W4OA 1XO2B 3NW5A 4DEBA 5IQFA 1OMWA 4FKIA 5J95A 4CFVA 2VGOA 3I60A 5B2LA 4O0UA 3SRVA 4JIKA 5HIBA 4NFMA 4B9DA 5BVKA 4JJRA 3DQWA 2YZAA 3R01A 4AT3A 3PZHA 3D2KA 4JIAA 3F61A 2O64A 4DH8A 4LQMA 4EOJA 5E8TA 3R1QA 4MYGA 5KMIA 1R78A 4RGJA 4LI5A 5DRDA 2Z7LA 4U45A 1YVJA 2EB3A 3CR0A 1Q97A 2CGUA 3U4UA 4ZXTA 4WA9A 2H6DA 3PVUA 3RGFA 3QUPA 4FSMA 3V8WA 5AUWA 2GNHA 3W16A 3W2QA 4IX3A 4U42A 3HLLA 2VTOA 4LL5A 4MBIA 2HW7A 4BHNA 4IZ5A 2R3NA 1M14A 1PXMA 3IGGA 4JT3A 4WNMA 1XQZA 3AC3A 4EUTA 4ZTSA 3Q04A 4KIKB 2RGPA 4RFYA 3OTVA 2OI4X 2QNJA 3Q96A 4M66A 3MIAA 5IQIA 5HORA 5JRSA 5AUUA 2SRCA 3LZBA 3T9TA 3ZEPA 5KHWA 1SYKA 2IW6A 2GQSA 3C4EA 4I92A 4QD6A 5EI2A 1QL6A 4MK0A 1Q8UA 4TYEA 4M69B 4Y5QA 1S9JA 2XNOA 3LAUA 3VBVA 3MS9A 4F9YA 1OBGA 2G9XA 3KRWA 1GZOA 2UZBA 2J0KA 3VBYA 4O38A 2UW5A 3DBDA 2F7EE 3IW4A 3OP5A 3QF9A 4BC6A 5KCVA 1OIYA 3FUPA 5CWZA 5AUTA 2C5NA 3ZFXA 2YCQA 4R3PA 2BZIB 2IVSA 3OF0A 3I6UA 3MVMA 2PZ5A 5HTBA 3RP9A 1PF8A 2B9IA 3BE2A 3FI3A 4K18A 2V55A 3RM7A 1OGUA 2J4ZA 3EYGA 1W98A 5CT0A 4O0TA 1H1PA 3LMGA 4EL9A 3FMLA 1YHWA 2CKEA 3OROA 1AD5A 4FV8A 4JDJA 3SDJA 3CTHA 4UWCA 2Z8CA 4QP8A 2YM7A 1F0QA 5JKGA 1SVGA 5LJJA 1XMLA 2PUNA 5CU6A 3VHEA 4YU2A 4YC6A 2PL0A 2CLXA 3KB7A 4PY1A 5ETIA 2XYUA 2R3OA 1YWNA 4H1JA 3LJ0A 4HYHA 4WNKA 4K1BA 4EOIA 3G15A 3QHRA 4YTFA 4O0VA 2IPXA 3W2RA 1F5QA 2XB7A 2R5TA 4EI4A 3QQUA 3W0QA 3QTZA 1OPJA 4KBAA 2BZHB 4FVQA 3QC4A 2BKZA 3N4TA 4R77A 2UZLA 4CG9A 3AGLA 4O1PA 1UU3A 4FZ6A 3LQ3A 3EQBA 5I9YA 2R3RA 5IA4A 2AQXA 5GZ9A 1XBAA 3EQGA 5HG9A 4RIWA 1H08A 2VWWA 4O0XA 3TM0A 5GJDA 2PMNX 3NNUA 4QP7A 5AV2A 4F6WA 2O0UA 4U7ZA 5HI2A 3D83A 3LFEA 4KRCA 5FGKA 3HA6A 1H8FA 3ODZX 4ANMA 4XP3A 4UB7A 4BKZA 1YKRA 4U3ZA 1STCE 3BU3A 3MY1A 4G5JA 3QYZA 3R71A 3R6XA 5E9EA 1CMKE 1IRKA 5T3QA 1UWHA 3W0OA 1FGKA 2I0HA 3NUXA 3B2TA 3GC9A 3OWKA 3Q9WA 3RPSA 4ANBA 4AS0A 4EH3A 3KN6A 3P1AA 4G6NA 4FNXA 3ZO2A 4APPA 1GIHA 5EYDA 3HL7A 4EC9A 2YJSA 3W0NA 5HG8A 2UZEA 2W0JA 3TNIA 4MAOA 3EZRA 4XOZA 3HMPA 4Z16A 5B2KA 4AWIA 3GCUA 4UXLA 2QCSA 5DT4A 3NLBA 3NNWA 5HBHA 3EQHA 3CJFA 1PMUA 1OIUA 3I1AA 5F20A 3MJ2A 3EN4A 4IADA 5IQEA 5AV0A 3FDNA 2Y6OA 4PL3A 4RVMA 2P4IA 4II5A 2UW3A 4J8NA 4E5BA 3NUSA 4IB1A 3E8CA 5DLSA 5AA8A 5EOLA 2XS0A 3R9RA 4FT5A 4IWOA 2AYPA 3BYVA 5AUYA 3DPKA 2E9NA 1H4LA 4E4XA 1JQHA 1Q8YA 2E9VA 2LGCA 3UYTA 3ZXZA 3BHVA 3ZHPC 5DRBA 5ANEA 4AT5A 5CTPA 4R3RA 4R7HA 1Q61A 3QRUA 2Q0BA 5EW8A 3QBNA 3E92A 4I6FA 5D9HA 4UEUA 3ZLYA 4R1YA 3UG2A 1OIRA 3DAEA 2OIDA 4OW8A 4D0WA 4EKLA 3OY3A 4YP8A 2C6DA 4NM5A 4IAIA 3C5UA 4EOQA 3D5WA 2B4SB 4FTRA 4O22A 4BRXA 2QURA 4K0YA 4FNYA 5D10A 4FJVA 2YIQA 4K9YA 3UQGA 2JFMA 4GMYA 4D0XA 4CLIA 5BYLA 2CGVA 4ZK5A 3A62A 2VAGA 3QAME 5KMMA 4QMYA 2WMSA 3G6GA 1XH5A 2IF8A 2XKDA 4QOXA 3VS1A 3C9WA 2C6LA 3IQ7A 2GHLA 5HE2A 4FT3A 4W8DA 3ORKA 1HOWA 2WELA 4GIHA 4RWKA 2ONLA 3TTIA 3VULA 2OBJA 4I5HA 3AT3A 3QQJA 1PXOA 5M56A 5H2UA 5C9CA 3O7LD 3LXLA 4FSRA 3CKWA 3ROYA 1YXTA 4HVDA 4AXCA 4DLIA 3BHUA 4CZYB 4OTPA 2RKUA 3FQEA 4G3DA 4WG3A 3KMMA 2VWVA 3P86A 5BVFA 4FYOA 2JC6A 2JGZA 3RNIA 3WE4A 3C7QA 3OXZA 4HCTA 3LQ5A 2GNFA 4UMQA 3QA0A 3UPXA 4IZ7A 4YLKA 4DGLC 4D4SA 3GU5A 1QPCA 3OS3A 2JDVA 3ZO4A 2ITXA 4FKOA 1Z5MA 4YO4A 2PVFA 3O96A 3HZTA 5AR2A 4G3GA 4GVJA 3MFSA 3QD2B 4CZUA 4IWPA 1OECA 4IX5A 3OFMA 5E8WA 3LXNA 4HVSA 3ODYX 4ENXA 1J7LA 1NY3A 2UUEA 3MY5A 2Q83A 2OO8X 4F1OA 2C6MA 2QU6A 1FMKA 5E7RA 4IAKA 4JQEA 2R3GA 3EL8A 2RFNA 3Q9XA 4IAYA 2ACXA 5HD4A 1ZY4A 2JLDA 4RIXB 2J9MA 3PVGA