2Y4IC

Ksr2-mek1 heterodimer
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
345
structure length
313
Chain Sequence
LLELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCPMAIFELLDYIVNEPPPKLPSAVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KINASE SUPPRESSOR OF RAS 2
publication title A Raf-Induced Allosteric Transition of Ksr Stimulates Ksr and Raf Phosphorylation of Mek
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 79
structure length 313
sequence length 345
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2y4iC02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2y4iC01
2R0UA 3CD3A 3JYAA 4HVSA 5TT7A 4I5PA 3MA3A 2JFMA 4FTJA 3SRVB 2X81A 4JL9A 4OTIA 5CT7A 3ZXTA 1Q3WA 3I7CA 4GT5A 5L8LA 2Y4IB 4APPA 4ZLYA 3O7LD 5DT3A 4YTFA 3DTCA 4BFMA 4JG7A 4D4YA 1QPDA 4EORA 3B8RA 4PDSA 1ND4A 1PMEA 4X2KA 5AX3A 3PSBA 5GJFA 2OLCA 1GNGA 3MFSA 5HU9A 1UNHA 2BROA 4IAYA 4ZJJA 3OWPA 2QOHA 4NTSA 4YU2A 4EWHA 4DFLA 5HG8A 3F66A 3R8LA 3CEKA 4DT9A 2CMWA 4I6HA 3CY3A 4MXZA 3DCVA 5I3OA 4BYJA 3FLSA 5DEYA 1NA7A 1PXIA 2J6MA 3HVCA 2BHHA 5EDQA 4B99A 4FEXA 5IQBA 1CKIA 3MVLA 2GFSA 3ODZX 4FOBA 3HMNA 3PY3A 5EFQA 3WE8A 5CANA 2PY3A 4LQMA 5EOBA 2VWZA 3F2NA 4FV7A 4KSPA 4A07A 3KL8A 3DTWA 3OMVA 3BYOA 4TTHB 3OXTA 1FPUA 3R8UA 2R3HA 3N51A 4Y72A 4MXOA 5CU2A 3NUPA 4D2PA 3R9DA 1H1PA 1B39A 3AD5A 3MYGA 3ZLXA 2PSQA 4RIXA 3MW1A 4I1ZA 5CF5A 2UZWE 3QBNA 3PJCA 4IAKA 4YPSA 1WCCA 2PWLA 4O1OA 2FSTX 4DG0E 4O82A 1NVSA 3OEFX 4XNEA 5HIEA 3LZBA 4YZCA 4YR8A 3Q9WA 5AV4A 4ONAA 4P5ZA 3ULZA 2R3IA 4PDYA 2O64A 5IQCA 4GYIA 2BUJA 4R7IA 1U46A 5EHLA 4BDKA 5A4QA 4ZMFA 5L6WL 3ALNA 1QCFA 1GOLA 1KE8A 2C1AA 3RK7A 2X7OA 4RWKA 2PZRA 3S2PA 4EHZA 4YURA 5KMIA 3ID6C 2GMXA 5L2SA 3KXMA 4FNWA 2PULA 2WXVA 4AZWA 3GU4A 3QRJA 3W2PA 1KE5A 4ZTRA 5LMAA 4PP7A 3O71A 3G15A 4TWOA 1OL2A 3EQIA 4TN6A 4Y73A 3DLZA 4NTTA 2X4ZA 4YJPA 1U54B 2OZAA 2RSVA 4PL4A 4YZDA 3FZPA 3EN6A 4PRJA 4QP9A 5AUYA 5KMMA 2NNWB 1E9HA 2ZAZA 3R1QA 4IFGA 2XK6A 4AT3A 4CYJA 4MXCA 4HW7A 3OCSA 2R5TA 3R30A 3MIAA 4ACMA 5B2MA 2XEZA 1F5QA 3AC8A 2UZOA 3KCKA 4YJQA 1Y57A 1XH6A 4FR4A 2OBJA 3COHA 4X6RA 2W1DA 4QMXA 3LFQA 5CXHA 3ORZA 4M69A 4M7IA 3QQKA 3TNIA 4B8LA 2WIHA 3W8LA 3R73A 1XWSA 3KULA 3RPRA 3VW6A 4E4MA 2VWXA 1Q99A 4X3FB 1UVRA 3R9HA 3RAIA 4JBPA 3DJ7A 3NW6A 1GZ8A 2P55A 3NUAA 3SDJA 5FXRA 4QP8A 4KIKA 4QMYA 3BX5A 4QTBA 3K3JA 5EYDA 3VUGA 2Y6OA 5IMXA 3FYKX 3AMBA 3MIYA 4FKVA 4BDAA 2W96B 3V5WA 1J91A 5K5XA 5DFPA 5ANIA 3A61A 3OW4A 4LGGA 2YWPA 3FI2A 3LAUA 3ROCA 2YCSA 1YDSE 4C57A 4DF3A 1U5RA 2JC6A 4XG9A 3BPRA 2CHLA 3GP0A 4ACGA 5M44A 3C5UA 3Q4CA 3SOCA 4WNOA 3LM0A 3HZTA 3TTIA 3D94A 5LARA 4R6VA 3CLYA 3MV5A 4F7JA 5CAVA 4AOIA 3UO6A 4TXCA 4KA3A 2ZV8A 4WBBB 2PZIA 2XNBA 1H24A 1OBGA 3QTIA 3TUCA 5ETFA 2UZDA 3OCGA 2QG7A 4X2NA 4C4GA 3M1SA 5CSWA 2VO3A 5IUHA 1LR4A 4LM5A 4XG4A 2F2UA 5AAFA 3TNWA 5JRQA 5KMOA 4HOKA 2R3NA 5GZ8A 1J7UA 4AX8A 2CCHA 4E4NA 2QQ7A 5HD7A 2WMBA 3NAXA 2OKRA 4QMPA 4PNKA 4FIEA 5EYCA 1Y8GA 3TWJA 2V5QA 4EJ7A 2W7XA 3VBYA 4EQUA 5IDPA 3F82A 3ORMA 5KO1A 2CSNA 2NP8A 2PHKA 3DJ6A 3HLLA 3K5UA 2WMUA 3DAJA 2J0MB 3R7IA 5CSPA 3A8XA 2QONA 4K6ZA 4RQVA 3FL5A 4FL3A 4DFZE 1Q3DA 4WG4A 4AOTA 4OTQA 2JEDA 3E8CA 5HO6A 4BCKA 2XK7A 3ZRKA 2RFEA 5CF4A 2R3GA 2J50A 4RVLA 3WIGA 1MQ4A 4FKWA 3DKFA 5ETAA 2CNQA 5DLSA 4RC2A 5K9IA 3CGOA 2C3JA 1K3AA 1CKJA 1WMKA 4ZTSA 3DY7A 4IHPA 4TWNA 4TY1A 4GUEA 1YWVA 3TZ8A 5AR4A 1FOTA 3RZFA 1ZWSA 1JVPP 2C6DA 3OY3A 4FIGA 3RK5A 4K0YA 4KNBA 3BYMA 3DXNA 3OUKA 2ZM4A 3UYSA 4KABA 2UZEA 2PMLX 1ZOHA 2GTNA 2UW7A 4XH6A 4ZTNA 2C1BA 5BPYA 4C4IA 2O5KA 4I6QA 1Z57A 4MEDA 4BTKA 4UMPA 3AC4A 4LOQA 3NLBA 4FSQA 4MQ2A 4C02A 4FZDB 2IZUA 4K11A 1OGUA 4F7NA 1H0VA 4CQEA 3L8PA 3UIUA 1YVJA 2J2IB 4AAAA 3NMUF 3TKHA 3QYZA 5IDNA 5HNIX 3QTUA 4I4EA 3P5KA 4P7EA 3V51A 1IA8A 2YCQA 5JGBA 1A48A 5B0XA 4CLJA 2ITTA 2Y8OA 4QQCA 3ZYAA 4FL2A 2W5AA 4KRDA 4PF4A 3RALA 4ZJVA 3BCEA 4EYMA 2GS7A 3VULA 2HXQA 4TW9A 4ZAUA 3VBVA 2J90A 2E9UA 4FZFB 5ANGA 3I7BA 2F49A 4RVMA 2BMCA 3VS5A 3KU2A 4BZDA 3ATTA 1CM8A 1OKVA 2JITA 4M3QA 5J1VA 3UP7A 1YWNA 2GS6A 1ZZLA 5HIBA 4TYJA 2QURA 4O7RA 4FUYA 5HG7A 4NM0A 1Z5MA 2X7FA 4D9UA 3GU8A 4BKZA 1MUOA 3FKLA 4QTDA 3KKVA 3TNQB 5AP6A 2BKKA 2YCFA 5HCXA 2W1GA 3AT2A 3EMGA 4OBOA 4ACHA 3VAPA 1URCA 1JBPE 3SGCA 3MH2A 5AV2A 2C69A 3F7WA 5J7HA 4EK3A 4RC4A 3FMKA 4ANLA 4E6AA 2JKQA 3MH1A 3Q6UA 3KVWA 3TL8A 4Y85A 1H0WA 2C6TA 3TNHA 4EUTA 4D2TA 1GY3A 4O0XA 4AE6A 2VTTA 2W4JA 5KBRA 1LP4A 1XBCA 5HLWA 3DZQA 4EJNA 1E1VA 3TACA 4DT8A 4AP7A 5DRBA 1FVRA 5DYJA 4XP2A 3GU6A 5EI6A 4U44A 2R3KA 5BMMA 4BF2A 4AG8A 3N4UA 4G9RA 3MVJA 4ASDA 4JDJA 3NW7A 4HCTA 2NPQA 3V6RA 2V55A 2VWBA 2XVDA 3LCSA 4NKSA 4X21A 2WZJA 4RT7A 4JAIA 2WMRA 3GFWA 3TKUA 2I7QA 4DFBA 4IZ7A 4YHJA 1WBSA 3IECA 3KXXA 5HNBA 5HX8A 2UW4A 3HUCA 4BIBA 5DN3A 3F2RA 3EIDA 3MFUA 2ZV2A 3QRIA 2GHMA 2RIOA 4IC8A 1S9JA 4S32A 5M07A 5GIPE 3CE3A 3ZRLA 4L52A 3KN5A 2BAQA 5HBEA 4K9YA 3QX4A 4QMVA 4TPTA 4Q2AA 1Q8UA 5T6KA 2JLDA 2XIXA 4N57A 3FDNA 4BKJA 3LFAA 4MK0A 4E6DA 3DV3A 3TXOA 4FT0A 4F7SA 3R7VA 1Q41A 1JSTA 4MHAA 3EYGA 1F0QA 5CALA 3ZM4A 5CU0A 2R2PA 3W2SA 2YM7A 2C6OA 3CQWA 3OROA 5DVRA 1JNKA 3HA6A 5FTQA 3TJCA 1IASA 4X3JA 2RFDA 4OT5A 4GW8A 3AD4A 1XQZA 4PMMA 4F9YA 2WTWA 1GAGA 5HX6A 4JXFA 3EN5A 4UMQA 4EL9A 5JKGA 2PVHA 2A1AB 5E8YA 3RCDA 1QPJA 3TUDA 3DFCB 4MWHA 1Y6AA 4IW0A 3T3VA 3S0OA 2G01A 4AZVA 5C1QB 5EOLA 2XNEA 2Z02A 4EH7A 5EM8A 5H9BA 5E92A 1JOWB 2J0LA 3FQEA 4BHNA 5KMNA 3I6UA 4ITJA 5CVFA 4FSZA 4JLCA 5HTCA 3AC1A 3L8XA 2WD1A 4C35A 5HG5A 2QI8A 2R3QA 2YHVA 2PMIA 4IX4A 4DGOA 3HA8A 1K2PA 2YFXA 5EK7A 4CRSA 3HV4A 3VS2A 3F69A 4BCPA 3SG9A 1TVOA 3QF9A 3ZBXA 2ZDUA 1VEBA 4IX5A 4RJ3A 2ITWA 4RJ5A 1PY5A 4JX3A 1YOLA 4GS6A 3UDBA 2Y4IC 4U0IA 3IDCA 3U6JA 3DKCA 2QLUA 5BVDA 5AR3A 4FV8A 4F65A 2C5YA 4AT4A 4KWPA 4NYEA 1ZMUA 3OW3A 4YJOA 5ANOA 3BHTA 4XV1A 4N0SA 3RWQA 4QMWA 4F6UA 1CMKE 1XKKA 2UZBA 4UEUA 2HELA 5CSVA 2UZUE 5FXSA 2OGVA 3OXIA 2BFXA 1PKGA 5JH6A 4J95A 2QKWB 2W5BA 1OM1A 3ORXA 2W9FB 2PK9A 3QTQA 1ZAOA 4D2WA 5EQEA 2BDWA 2VTNA 3ORTA 4LRMA 3M2WA 1OPLA 4ITHA 2C6MA 4A9RA 4BI2A 4RGJA 3H3CA 4ERKA 5KCVA 2ZV7A 4FKUA 4DITA 1UU3A 4PPAA 5J7BA 4YNOA 2PVNA 5IF1A 2ZB0A 5CYIA 1YWRA 4DH8A 4U7ZA 1PHKA 3FWQA 2IO6A 4A4XA 1P5EA 3JY9A 3WYYA 4RVTA 4FSRA 5LQFA 4GVAA 4FVPA 2C3KA 2WMAA 1BYGA 2XK4A 3GU5A 4PQNA 4ZXTA 2PZ5A 5CZHA 2IW8A 2V7OA 2XNMA 4DEIA 3DNEA 4XRLA 3E87A 4D2SA 2WQBA 2G1TA 2YIXA 3REPA 1YRPA 4UWBA 3V01A 3TTJA 2YN8A 3EJ1A 3K2LA 5CF8A 5LCJA 1REKA 3V5TA 1R39A 3GC8A 5EW8A 5IA4A 3A99A 4L00A 4HVIA 4HGEA 1IA9A 3UG1A 1ZOGA 5J9LA 2FUMA 3HX4A 4JIKA 3CBLA 4EK6A 1Q61A 2WOTA 1PMUA 4UYAA 4DGMA 2OJ9A 3O8UA 3P7BA 3QTRA 4FTLA 3ZEPA 2GS2A 2QO9A 2VV9A 4H3PA 4QMSA 4RFMA 3ORKA 4NW5A 3RKBA 3TDWA 3MY0A 2VTPA 3DQXA 4EQMA 5CX9A 3H9FA 3ZFMA 1PXOA 3DT1A 5TE0A 5AA9A 4BRXA 3UPZA 3V8TA 3R71A 2HZIA 4G3EA 5LMKC 4KSQA 3P0MA 4KIOA 1SVHA 3R83A 3DOGA 3UP2A 1LEZA 4GFMA 4RA5A 3P1AA 3R7GA 3B2WA 1XBAA 2HY0A 2BPMA 2OFVA 2UW3A 4II5A 4E5AX 4CXAA 3PJ1A 4U9AA 3DJ5A 1QPEA 5C27A 2J5EA 1YI4A 4BN1A 3VQHA 4WT6A 3EQPA 3O2MA 4F64A 4Z55A 2GNIA 3LW0A 5KBQA 5BYZA 4Y5HA 4RIXB 3FAAA 5KUPA 3ZO4A 4DEAA 4QQTA 3G33A 2OO8X 2BIYA 2W05A 2XA4A 3QD2B 4FKIA 4OTFA 5BVKA 1OUYA 4RJ8A 4C0TA 5JZNA 3RHKA 4MF1A 4IB5A 2Z7SA 4ASZA 2VTJA 4TYEA 3BGZA 3PIZA 3HMMA 1W84A 4G5JA 4USDA 2ZB1A 4E8AA 5AM7A 4ZY5A 3IOKA 2X6EA 4RLLA 2XUUA 3CTHA 3QYWA 2WTCA 5DRDA 4KS7A 2FO0A 4GT4A 3MVMA 5CAOA 5C03A 2GQSA 2W4OA 2PUIA 3D83A 3JS2A 5HHWA 3O96A 4RG0A 1J3HA 2XNGA 2ZDTA 3CR0A 4JRNA 5CZIA 4UX9A 2ZMDA 4OAUC 3UZPA 3ET7A 1BLXA 5I0BA 3BU6A 2BZIB 2OZAB 3FJQE 3Q9ZA 2OG8A 2OF2A 4PTGA 4MBLA 1FINA 2VX3A 2C3LA 3BEGA 2R3RA 3ZMMA 2NO3A 5FTGA 2P3GX 3ORPA 1JQHA 4RSSA 4BWKA 5L2QA 3QCSA 4M69B 4G3CA 2HCKA 4IVDA 5EM7A 3G6HA 4OTWA 5DT0A 2CCIA 4ZSAA 3KK9A 3KULB 3G0EA 3HECA 5HESA 3R8PA 4FTRA 3UIMA 3VF8A 3FZRA 2AC3A 4I3ZA 4O2PA 1H4LA 1WVYA 4U3YA 4KIKB 2Z7QA 4MAOA 4I20A 4L44A 3TZ9A 3DK3A 1OL5A 4IAIA 4CZYB 4O7WA 3KRRA 3VS0A 4C4JA 1GJOA 1J7IA 4DTAA 4DG2E 3FSFA 3HMOA 3OS3A 4BI0A 4IZYA 1SZMA 4YO6A 4E5BA 3ORNA 4WSQA 3ZFXA 3D7TA 2CKQA 3R22A 3PDTA 3UVRA 4CGAA 3PRFA 4TNDA 2X8EA 3C13A 2ZM3A 4F99A 3MY5A 5HCZA 3DXPA 3IOPA 2WTKB 3QU0A 4A9TA 4BBFA 4C59A 5M09A 2ITUA 4D28A 4CFXA 3EZRA 2BILB 3NYXA 4RFZA 3UGCA 3FMDA 4YPDA 4DN5A 4HVDA 4BGGA 2Y4PA 4HCUA 3QZIA 1V1KA 4CCBA 2W1HA 2QCSA 3BGPA 3H30A 4UMTA 1YDTE 3QZGA 4LGDA 3ENHA 4TYGA 2REIA 3HRCA 1TQPA 4FIHA 1IAHA 4Y46A 5DR6A 3PY0A 3GCPA 3Q52A 5HORA 4MNFA 2OXDA 1PMNA 5E7RA 4GEOA 4MBJA 3SAYA 4ZZNA 3FUPA 4FG9A 1FGIA 4I92A 2EVAA 2BHEA 3C0GA 3FXXA 4RIYA 2QO7A 1JSUA 3BHYA 3P08A 4GRBA 5AR8A 3A4PA 5CTPA 4APCA 4O38A 5E8ZA 3DBEA 4L3PA 3SV0A 5A14A 4Q5HA 2HZ0A 5DHJA 4DTKA 2J51A 3FMMA 4L6QA 5DG5A 2DS1A 4CMUA 1A06A 2W1CA 5F20A 4D55A 4MQ1A 1B6CB 4FBXA 5EKOA 1UKHA 2RL5A 3IO7A 4MD8E 2ZM1A 2QU6A 5AR7A 2YERA 3VHEA 3QWJA 5I9XA 2OW3A 4FNYA 3SG8A 5HKMA 3AD6A 4LFIA 2Y6MA 4ZSEA 3ZUVA 3G9LX 4DFUA 2YWVA 3ORLA 4BCOA 3LVPA 3CXWA 4JR3A 3Q9XA 1UU8A 3KXHA 3QTXA 3VVHA 2QOIA 2WTVA 2XZSA 4KBAA 4M84A 4U45A 2VWYA 3DFAA 5JSMA 3BELA 1AQ1A 2OF4A 3DKGA 5AAEA 4GK2A 3M11A 3GC9A 4JT3A 4AGDA 4WBOA 4FKQA 5AM6A 3AGLA 2F7EE 1RDQE 3BZ3A 4UN0C 3R63A 4JR7A 5IG1A 5ANDA 4DH1A 1H8FA 1CTPE 3D4QA 1WFCA 4V04A 5CU6A 5FEDA 3E62A 1SVGA 4S33A 3PVWA 5FTOA 4F9CA 3UQFA 4F6WA 4S2ZA 3RM7A 3H9OA 4E93A 2VTHA 3RJCA 3SXFA 4G1WA 3BHUA 2QG5A 4YBKA 5LVLA 2B55A 4NCTC 2G2HA 3TI1A 4BI1A 4U40A 3P78A 4R77A 4HVGA 4I5HA 1NVRA 4BVUA 4D5KA 3GCVA 5LVOA 2GPHA 5FM2A 2R3FA 4Y95A 1J1CA 2GQRA 4Y5QA 5LCKA 1AGWA 2I0EA 5BMSA 3CQUA 4H1MA 5FGKA 4FV4A 3SKCA 4RZWA 4YJNA 2BRNA 3QCXA 2PVKA 2PTKA 3RVGA 5IPJA 5BVEA 3V5JA 2QHMA 5ANJA 3OZ6A 1K9AA 2GNLA 4S34A 4CKRA 1A9UA 5CS6A 3BU5A 4EOIA 2QOKA 3EHAA 4HYUA 3R1NA 4F7LA 2OFUA 2YDKA 4ZIMA 4NKAA 3F5PA 3G90X 4RJ7A 5D7VA 4DH7A 1M52A 3Q9YA 5IA1A 3ZLWA 4IZAA 4BTMA 3GBZA 2XYNA 5CI7A 3U9NA 4CEGA 5LWMA 1IEPA 2OJGA 4NWMA 4D2VA 3QQFA 2BRHA 4PX6A 4O7YA 2OICA 2YACA 3FKNA 4XBUA 3TJDA 4W8EA 4I0SA 4Q9SA 4PWNA 3VUIA 3WF7A 3ATSA 4MCVA 4RMZA 3C4EA 4F0IA 2HZNA 4HZRA 4FX3A 5CVHA 1W8CA 5ICPA 5EYKA 4C4HA 4CV9A 3R28A 3NNXA 2F7ZE 3FY0A 4H39A 5I9YA 1M17A 3BLRA 1PXPA 4EOJA 3Q2JA 4LOPA 4ENXA 3EB0A 4UWYA 3ZS5A 4BKYA 2O8YA 2V0DA 4IC7A 4MXXA 4XX9A 4P5QA 5CNNA 4B6LA 1Q97A 4FT5A 4DBXA 3G9NA 4BL1A 3FI3A 4IAFA 2VD5A 2R3LA 3MWUA 3WBLA 4W4XA 1PXLA 1P14A 4RFYA 1G5SA 4NJ3A 4XG7A 4O0TA 3COKA 3ZC5A 4ERWA 4WOVA 4YC8A 4YSJA 1WVXA 2CNVA 3EQHA 3G2FA 4N6ZA 3HRFA 2XKFA 4GFOA 4F4PA 2BIKB 3R6XA 5D10A 5LJJA 4FSWA 4IJ9A 2YM4A 2JAMA 3WZDA 4A7CA 3VS4A 4BDHA 3CSVA 3U6HA 2F4JA 3Q4ZA 2J0JA 1UU9A 2ITZA 3DAEA 3Q96A 2PU8A 1H26A 3R9RA 1R1WA 2J0KA 3D14A 3RTPA 4FT9A 4AACA 4C33A 2WIPA 4TL0A 4EH8A 4OUCA 2ITPA 2E9NA 3QD3A 5DH3A 3LXLA 3MH0A 3QQJA 4XP0A 3FHRA 3R9NA 4O84A 1M7QA 4U41A 2R7BA 3L9NA 4K8AA 5HO8A 3ZC6A 3UJGA 3FMHA 4GJ2A 5I9UA 1WVWA 3KMWA 5IQDA 2GHGA 1CDKA 4WD5A 5DR9A 5C01A 2XJ2A 3UNJA 5M4IA 2BAJA 3WZJA 3MH3A 4AN3A 5HZNA 2XNOA 4EHVA 2WELA 3S95A 4S30A 4FC0A 1JLUE 2WTJA 5A46A 1H27A 4IE9A 3QCQA 4IWOA 3EOCA 4PTCA 4PY1A 4WNMA 2YDIA 2AUHA 4FK6A 4FV6A 3EN4A 3BBWA 3QKKA 4Z3VA 2R3PA 4LOOA 4GYGA 4QTAA 3O8TA 3CKWA 4G3FA 3MBLA 4XOYA 1PJKA 5H8EA 4BCGA 4XMOA 4BCJA 4EQCA 5H2UA 5CEPA 5L6OA 5HI2A 5E4HA 4DINA 2QO2A 4LMNA 4CFFA 4G6LA 3GCSA 2FSOX 3H10A 2JKMA 4BDFA 4BTFA 4DEEA 5A4CA 5B7VA 5CASA 3VS7A 5L8KA 4KUJA 3BGQA 4PDOA 2XIRA 3PE2A 3VC4A 2HIWA 5FLFA 2B9IA 4DLJA 3R00A 4ANSA 1RQQA 1UV5A 2JDVA 3C4WA 5FWKK 2PUNA 3DA6A 1HOWA 4KBCA 3LE6A 4HVHA 5AA8A 3E8EA 4YO4A 3HV3A 5AV3A 3PP0A 1WAKA 3QHRA 3QZHA 1FMKA 5D12A 3A7GA 2DQ7X 3TKIA 5CY3A 5AP5A 4QO9A 3OCBA 4M14A 2UW5A 4H58A 3QWKA 4NU1A 4I5MA 1QMZA 2ONLC 1TKIA 2X4FA 2XBAA 3FQHA 5EYMA 5J8IA 4D0WA 4XYFA 4C7TA 2GDOA 1EH4A 3FZTA 4IXPA 2BZKB 4GU6A 3OD6X 2WMWA 4QQ5A 3VS6A 4ASXA 4EOPA 4CG9A 4BICA 4PDPA 4O7ZA 3AXWA 1IRKA 1OECA 4BDDA 2QOOA 4M68A 4U3ZA 2KTYA 4D1ZA 3RHXA 4GCJA 4JQ7A 3SC1A 4GMYA 2X6DA 4V01A 3RNYA 3W2CA 4C8BA 4AOJA 4J96A 4DA5A 3TZMA 3BIZA 4C62A 4D1XA 4QT1A 2JBPA 2QODA 3Q2MA 4TZRA 2H34A 4G2FA 1L3RE 4G31A 4IVCA 5GJGA 4ZS4A 4U42A 4YZMA 2IVSA 4ALWA 2GNGA 2JDOA 4A9UA 2ITOA 5M57A 4YJSA 4ZTLA 3FLQA 3EFJA 1M2RA 1QL6A 2E9VA 2A2AA 3GGFA 1MP8A 1M2QA 3UIBA 3W10A 3SXRA 3I1AA 3LJ0A 4P90A 5IUIA 4G34A 2XRUA 1NXKA 2YJRA 3ZO2A 2C47A 3LFEA 3GC0A 5JQ8A 3R1SA 4MX9A 4WSYA 3OC1A 3ZFYA 5DNRA 4ZZOA 3ZOSA 5HTBA 3H0YA 3ERKA 2QU5A 4AWIA 3NUXA 4PPBA 5A54A 3NYNA 4QNAA 4YNEA 2BFYA 4RIWB 4FV2A 5F94A 3KREA 5AUXA 3F5UA 2HW7A 4FTNA 4U5JA 2EXMA 3F9NA 5KZ0A 4O22A 3V3VA 3E3PA 4AZTA 2R4BA 4UZDA 4IWQA 3PRIA 3SW4A 4I41A 4OTGA 4DCAA 2J9MA 4O0VA 4BIDA 3GNIB 3GUBA 5JN2A 3BKBA 5AP2A 3GOPA 3AT3A 3T8OA 3CC6A 3DDQA 3G51A 4CTBA 5L3AA 3PIYA 1O9UA 4HGLA 3POOA 3L9PA 1SMHA 3FI4A 2ZVAA 3KRLA 3NUSA 3GFEA 2Q0BA 4ZTHA 1VR2A 4MF0A 5FUTA 4QPAA 1GIHA 4O86A 2XNPA 5JGAA 1FGKA 5BX0A 2W5HA 4FNXA 1OL7A 3PXZA 4QP2A 3COIA 1XH5A 5DBXA 3ZDIA 1LUFA 3PXFA 4O83A 1PKDA 5FRIA 3I81A 3WOWA 4C4FA 3HKOA 3NIZA 2BRGA 2QKRA 3BBTB 3HDMA 5M55A 3KXZA 1JKLA 2W99B 3MY1A 4FG7A 4GT3A 2IVVA 4IFCA 4TKSA 5DGZA 3GB2A 3VQUA 5L2IA 3H4JA 3WF6A 1OITA 3KVXA 4YHTA 4HYHA 4NM3A 4OTRA 4MYGA 5IEVA 3C4ZA 3E8DA 2C3IB 2UW9A 3EFKA 4F6SA 4C34A 3OWKA 5CQWA 4EWQA 4KBKA 5B2LA 2GFCA 3UTOA 2Z7LA 2CGXA 3KA0A 4IJPA 5BVWA 1RJBA 4KS8A 3K54A 4FOCA 1CSNA 3RNIA 4G5PA 5AEPA 3VIDA 3UMXA 1H08A 3HRBA 5CU4A 2XK3A 2VRXA 5IUGA 3KRJA 3DPKA 4X0MA 4CNHA 4PUZA 3GQLA 4Q5EA 5KKRB 4E3CA 4QMNA 5M4CA 5D11A 4ZTMA 3ALOA 3L8SA 2AYPA 2VTLA 4RQKA 4ZSJA 1L8TA 4GK4A 1REJA 3IPHA 4OR5A 4R3RA 4N70A 4GK3A 5DIAA 3WF9A 3AOXA 3F3VA 4HYIA 1VYZA 1OL1A 5AP3A 1X8BA 2RG5A 4DGLC 4C2WA 3IGGA 3D7TB 2HAKA 4IB3A 5IEXA 3VJNA 3HAVA 4M0ZA 5HCYA 1ZARA 3S3IA 2XM8A 4ZP5A 3NS9A 4R7HA 2XJ0A 3Q53A 4FKGA 2YCRA 5E8UA 3EN9A 4XUFA 1V0OA 5A3XA 3BEAA 4ACCA 4F70A 1OIRA 1PXJA 3ZSHA 4IB0A 4LRKA 3LFSA 4NM7A 5JFXA 2C4GA 2Z8CA 1DAYA 3D0EA 2W1FA 3O7LB 2ZOQA 4WNPA 5ETCA 5JFWA 2BVAA 4RA4A 3G0FA 3IG7A 2CN5A 1SM2A 3VO3A 3TN8A 5I9ZA 1NW1A 3VUHA 3OBGA 5FP6A 5LMKA 5HBJA 1M2PA 1P2AA 4YLKA 4D4SA 4L45A 3DAKA 1KE6A 3FMNA 1BL6A 2OJIA 3LCTA 2F2CB 3SLSA 3U9CA 5A9UA 2OI4X 4C36A 3BWFA 5M56A 4FTAA 5FM3A 4ZY6A 1RE8A 4BDIA 1YOJA 3WIKA 3VNTA 2F7XE 4RIYB 5EG3A 2G2IA 5HE3A 3OHTA 4ZZMA 4YJVA 2YM5A 2P2HA 3ZDUA 4HNFA 3OOMA 5CLPA 2O3PA 3AC5A 2PVMA 2C6EA 4XG2A 4X2FA 5HBHA 4CLIA 3PZEA 3I0QA 2GCDA 3R2BA 3HV7A 3JR1A 5HO7A 1UWHA 5J95A 3OTVA 3TIZA 1KOAA 2ETMA 3DBFA 3OBJA 1BI7A 3W33A 1JSVA 3A7JA 2ZV9A 3RK9A 1Q5KA 4BTJA 3P79A 5D7AA 3PJ3A 4AXAA 4D2RA 4X6QC 3A62A 4BWXA 3IW8A 3SW7A 5JK3A 5FG8A 2P4IA 2YITA 3ANQA 3KXNA 4EHGA 3QRTA 1XJDA 4F09A 4O7TA 3SXSA 5IU2A 2OWBA 3PPKA 4J53A 2YZAA 4K77A 2PE2A 4J98A 3WI6A 3OCTA 2ZYBA 4QP6A 3ANRA 4CV8A 4L53A 1H1SA 3H9RA 4AQCA 1O6LA 2OH4A 5EI2A 4H05A 3W8QA 4RRVA 3QLGA 3UC4A 5E8VA 4GIIA 3PSCA 5BUIA 3DBQA 4H3QA 2UW0A 5CSHA 2XRWA 3IDBA 4GL9A 4L67A 2I0YA 2ITQA 2RGPA 1XHAA 2UW6A 2Q83A 1XBBA 4E1ZA 4CT1A 4G6NA 3OY1A 4RWLA 3C4FA 3LCDA 5CVGA 4JRVA 3ZO3A 3PYYA 4CFWA 2WNTA 2YIYA 2DYLA 3O51A 4O96A 5K0XA 2ITNA 2OK1A 3DS6A 4C3RA 3LQ3A 4FVRA 2VNWA 1QPCA 3V04A 4V0GA 3QD0A 5G1XA 1TQMA 5HOAA 2IVTA 5KHWA 2QOCA 1O6YA 1PXKA 3E93A 4UALA 3THBA 3D5UA 5DOSA 4AZSA 1WBPA 3ZZWA 3PA4A 4IDTA 4QMMA 5T3QA 2QR7A 3HL7A 3D9VA 5BNJA 1Y8YA 5BUEA 3H0ZA 4A06A 4FE2A 3MB6A 2V7AA 4F9BA 2VN9A 3W32A 5CAUA 3DK6A 3QD4A 4IM3A 1ZMVA 3VUTA 4BIEA 3CP9A 3FLYA 3OG7A 5E1SA 4ZMEA 4WRGA 3B2TA 3HP2A 3I6WA 1IG1A 4YTHA 1BI8A 2VU3A 5BVFA 1Q24A 2WQOA 3DGKA 4IWDA 3W16A 3SA0A 1OKYA 2V62A 4PNIA 5A6OA 4N6YA 2OIBA 4E4XA 4BCFA 4O7VA 4PMTA 2ERZE 3ENMA 3QZFA 4OTDA 2WEIA 5AJQA 4ZJIA 4AF3A 1APME 4FZAB 2B52A 4EBVA 5HE0A 3FZ1A 4P2KA 3OVVA 2H8HA 4K2RA 3SHEA 5AV1A 4QYHA 3MFTA 2RFNA 2XIKA 3JPVA 3KXGA 5DT4A 2ACXA 2GNJA 3O17A 4OAVB 5ANEA 5AIKA 5TKDA 4AA0A 5FBOA 3FC1X 3A7HA 1YXUA 1PXMA 3PUPA 1O6KA 4O0RA 1ZZ2A 3OEZA 4M15A 3SVVA 4J1RA 3NYOA 1BL7A 3AMYA 4FV0A 4EUUA 4Z7HA 4AFEA 4XCUA 3ROYA 3PG3A 2CNUA 2BRMA 3NCZA 4NM5A 4XV3A 4YTIA 3WILA 3QKMA 4FTQA 1UA2A 5FEEA 2XS0A 3IW4A 4FK3A 3VRZA 4F08A 2XK8A 4X3FC 3I79A 3DBDA 4DH5A 4KINA 3RAWA 3PXRA 4WUAA 4E20A 1OVEA 3EQGA 2GHLA 3EL7A 3GXLA 4FSUA 4X2JA 4JG6A 2WMVA 4NFNA 4UB7A 5HG9A 3TUBA 2V22A 3KB7A 4J97A 2H6DA 2VWWA 3BLQA 3P23A 2C6LA 3Q5ZA 4GKIA 3Q6WA 2BRBA 4ZTQA 4EC8A 1YXVA 4CG8A 3BYSA 3C50A 4FI1A 4YLLA 2WAJA 5HGIA 4CKIA 2Y0AA 4GVJA 5C4KA 5D1JA 2HENA 2ETRA 2FGIA 3FMEA 4C3FA 3MTLA 4L9IA 4U81A 4DC2A 5L2WA 3FI8A 3PIXA 4MXAA 5AP0A 2VTRA 2JIIA 4GUBA 3L9MA 3WZKA 3NRMA 2O2UA 1XR1A 4FTTA 2W4KA 1NT2A 3LFDA 3TV6A 1ZY5A 3LHJA 3DKOA 1H1QA 3IDPA 3F2AA 4GU9A 2VZ6A 3W2OA 2C0IA 3V6SA 3UOLA 4ANQA 3CTJA 4KB8A 4PMPA 1TQIA 3FPQA 1OZ1A 4BB4A 4GFGA 3PVBA 2FB8A 4FZ7A 4I93A 4WHZA 4WKQA 4R3PA 4EOSA 2QD9A 2UV2A 3UVQA 3PY1A 4UZHA 5CAPA 3R7YA 5JMSA 3UYTA 4CMOA 4DEDA 4EH9A 3PP1A 5AAGA 4R5SA 3CS9A 3TZ7A 2VWVA 3R01A 5GINE 3OUNB 3FEGA 2PE1A 2JD5A 4FZ6A 4NCTA 2P2IA 5I5ZA 2QHNA 3IGOA 3C9WA 1W82A 5J87A 4DBNA 4NL0A 1JPAA 2XMYA 3WZUA 3WYXA 5LXMA 3FYJX 1XH9A 2I1MA 2A19B 2JKKA 1YXXA 2GSFA 2UVYA 1W7HA 2WKMA 4G9CA 2F57A 4IDVA 4WG3A 4XLVA 4FICA 4ITIA 5D9HA 5L6PA 3QQGA 1WBTA 2YLFA 3QGYA 1FMOE 2WGJA 4TWCA 1GZKA 1YXTA 1H1RA 3F7ZA 4L3LA 2R3OA 2X8DA 2C0TA 3QALE 4C3PA 4IQ6A 2FH9A 3VN9A 4BDEA 3A8WA 4FGBA 3M42A 4L43A 3LFCA 2CGVA 3PWDA 1KV2A 5BVNA 3R8ZA 3EFWA 3QFVA 3UQGA 1HCLA 3CJFA 3MN3A 2G9XA 3CCNA 4FKOA 4H36A 3GC7A 2SRCA 3NVMB 3PVUA 3PA5A 4CD0A 4A4LA 4CZTA 3UG2A 1JKTA 3V5PA 2WHBA 5IH4A 4ZSLA 5EQYA 4QMTA 1JWHA 4IACA 2OXXA 4CYIA 3ELJA 4IAAA 3FL4A 4C38A 2A27A 4FTMA 5EHOA 3LOKA 3RAKA 3UIXA 2PVYA 4JIAA 1OIYA 4M67A 4FG8A 2XM9A 1OMWA 3BHVA 3GENA 2UZTA 2XJ1A 2HYYA 4XRJA 4BZNA 4CCUA 3VUDA 3LQ8A 3BYUA 2FVDA 3DBCA 1YOMA 2CDZA 4O0UA 4M0YA 3ZBFA 3N9XA 1URWA 4AZEA 3W1FA 4UMUA 5A4TA 4JI9A 4L68A 4JBVA 4QPSA 1ZMWA 3F3ZA 4QMLA 4IX3A 4WNKA 3R7UA 4E5WA 2H96A 2QLQA 4FODA 5EKNA 2EXEA 1V0BA 3LMHA 2PE0A 3E7OA 2G2FA 2PZPA 4ALVA 2G15A 2I0VA 3FSKA 4G6OA 4AT5A 2OU7A 3KQ7A 2C6IA 5IQHA 4I6FA 3TV7A 4D1SA 5IQAA 4AS0A 1ZLTA 3RCJA 3ZLYA 3LKMA 3MVHA 3AC3A 5GHVA 3WE4A 3BWJA 2BTSA 2CN8A 2B1PA 4RPVA 4QMOA 4RX8A 1E1XA 4FMQA 5C8MA 3LPBA 3DB8A 4AW2A 4DFXE 1OKZA 3COMA 5GIOE 4RJ6A 4Z7GA 5CEKA 4YJUA 5KMJA 1GZOA 3RI1A 1FVVA 4AA5A 2QC6A 3FY2A 1G8SA 4X2GA 4XHKB 4L3JA 3VWAA 5A6NA 2BDJA 2XNNA 2A0CX 2EU9A 4QMZA 4EI4A 5J1WA 5AUTA 3OOGA 5K4IA 5CT0A 4AE9A 3QCYA 4CMTA 3PG1A 1U4DA 4AGCA 4O6EA 3MGYA 4MXYA 4EYJA 3CGFA 2VUWA 3A4OX 3NVKI 2CKPA 1J1BA 2YAKA 4TRLA 2NRYA 4FUXA 1NY3A 5CWZA 4FYNA 3UZTA 1YXSA 2JIVA 3HV6A 2I40A 3U8WA 5E90A 5I4NA 1H28A 4L7FA 3CTQA 3LQ5A 3FC2A 2B0QA 2Y7JA 3GEQA 3LFFA 4BYIA 3MDYA 5DI1A 2VTSA 4FGRA 4YTCA 2VX0A 4NH1A 3MESA 3D15A 1UNLA 3N4VA 5KMLA 4J7BA 5H8GA 4YP8A 3RWPA 3TNPC 5JGDA 2OZOA 5AR2A 3BV3A 4C2VA 2FYSA 3BHHA 1IR3A 4L46A 4O21A 4O1PA 4F63A 4FSYA 4FTUA 4QP4A 3IONA 3P7AA 3F5XA 5FDPA 5KKRC 4C4EA 2EUFB 4DHFA 3QL8A 4XP3A 3MI9A 4CSVA 4S31A 4GIHA 4YHFA 2WQMA 3R7OA 4IB1A 1H1WA 3V8WA 3MSSA 3NNUA 3L8VA 1OPJA 3UNZA 1DI9A 2CKEA 1OPKA 3HMPA 3TIYA 4F0GA 3R9OA 4BCNA 4DFNA 1FVTA 3B8QA 2XBJA 4DGGA 4FEVA 3NNWA 5AP1A 2BKZA 3HV5A 3U4UA 3OP5A 3W2QA 2X39A 5EDPA 5J5SA 2PYWA 4FEQA 4QNYA 5CU3A 4EH5A 5H3QA 4IM2A 3KMMA 3P86A 1Q62A 3O50A 5HVKA 3P4KA 5TOZA 3U6IA 2ONLA 4EH2A 2ZJWA 2RG6A 2FSMX 3HMIA 3U4WA 4GG5A 4EBWA 4HNIA 4XJ0A 4I22A 5JFVA 5FEQA 3ULIA 2OJJA 2OSCA 3QQHA 4TYHA 2IPXA 3VBTA 4AW5A 3I5NA 4R7BA 5K3YA 4AN9A 1VYWA 2B9HA 2YAAA 4UY9A 3JY0A 3KEXA 1ZYDA 4EOKA 2YM3A 2I6LA 4O7LA 1H25A 1OI9A 4GH2A 1ZYCA 2QOBA 4HCVA 3ZTXA 4KKEA 4OGRA 2IN6A 1PMVA 3OXZA 4RX9A 4AUAA 4DYMA 1BKXA 1Y91A 2YM6A 4U6RA 4QTEA 2X2LA 3GCQA 5TF9A 4M66A 2UZNA 4IAZA 4KKGA 3FPMA 4QP7A 2HWOA 3JVRA 3MJ1A 4QYFA 4WIHA 2YIWA 4WO5A 1YI3A 3ACJA 2XYUA 4NT4A 3MPMA 4D0XA 4P4CA 5CF6A 4O7SA 2HY81 2BTRA 5AWMA 4MVFA 4I23A 5M4FA 4EK5A 4N4SA 2Z2WA 3VRYA 1PRYA 4QYEA 1UNGA 3QA8A 4RJ4A 3OT8A 5B2KA 4CFMA 2OXYA 3FE3A 4ZLOA 4B8MA 4JX7A 4IWPA 4I24A 4O81A 4U43A 4EHEA 2IW6A 3LLTA 2B7AA 2PVJA 3V5LA 3QXOA 5FP5A 1KE7A 4FT7A 2VTAA 4ALUA 5FDXA 5M51A 5CEMA 5ACBC 1NVQA 2BAKA 2CJMA 3MPTA 3CKXA 4OTHA 4E4LA 2WMXA 3L9LA 3FXWA 1GZNA 1PYEA 5DE2A 1VJYA 4FA2A 4GSBA 2XH5A 1H07A 3U51A 3ITZA 3QLFA 1WBNA 3TDVA 1YKRA 2XCHA 3HEGA 3FLNC 4O27B 3KFAA 3A7IA 3CY2A 4K18A 2WMSA 5F9EA 3S4QA 4F0FA 4ANOA 2ESMA 3E7VA 3O8PA 3PA3A 4FVQA 4J8MA 5L2TA 3NZ0A 2W0JA 3BE9A 4AGWA 4I4FA 2KULA 3HUBA 3BRBA 3GT8A 4U80A 5C4LA 4QMUA 2VAGA 3DZOA 4H3BA 4E7WA 4Z16A 4IMYA 3SD0A 4O0YA 3EYHA 5AV0A 4M8TA 2NRUA 1DS5A 4I0TA 2E9PA 5AUVA 2A4LA 1F3MC 5KX8A 4J8NA 2B54A 4EEVA 4EZ5A 3ZH8A 4BGHA 2CLQA 2UZLA 3NR9A 4NIFA 3ZUTA 4CFNA 2WB8A 4OBPA 5AR5A 5M06A 5D41A 3CPBA 4MNEA 2YLEA 2W9ZB 3MTFA 4LUDA 5AP4A 3UBDA 3ZRMA 3QAME 4BCMA 4OW8A 4PL5A 4CZUA 4DEGA 4AGUA 3NCGA 2F9GA 4DGNA 4EOQA 4ANNA 5AUUA 3C0HA 4FL1A 4IZ5A 2IZRA 1IAJA 1UKIA 3C51A 1U5QA 3UNKA 5CSXA 4D9TA 4E6CA 4D4VA 4XG8A 3DB6A 2XK9A 3PPJA 2CGUA 4FEWA 2RFSA 3QGWA 2GQGA 4QTCA 3UE4A 4Z9LA 1RW8A 4QQJA 2XP2A 1Q8YA 3C4CA 2QOLA 4V0GB 5M53A 3CJGA 4FV5A 3DU8A 3G5DA 5AUWA 2JAVA 3LM5A 4L7SA 1Q8TA 3HYHA 1T45A 3FQSA 4EZ7A 5HVYA 3PSDA 2EXCX 2YIQA 3PLSA 3LCKA 3Q4UA 4QYGA 2VTMA 2W1IA 3LJ2A 2UVXA 3QC9A 3LLAA 1YI6A 3JXWA 4JAJA 5KMKA 5HE1A 1KSWA 3NDMA 3Q32A 5M08A 2PZYA 3C1XA 3IKAA 5GZAA 4LL0A 3HAMA 1I44A 3D7ZA 1MQBA 2RKUA 4RLKA 3MS9A 1KOBA 3ZCLA 1STCE 3RBWA 4U79A 3R21A 3EQFA 4R78A 4U8ZA 4L8MA 4O2ZA 4O6LA 4CFVA 1XO2B 2PMNX 3NPCA 3V5QA 1ZYLA 4QP1A 3EH9A 5IEYA 2PUPA 2WQNA 1V0PA 2EB3A 4FSTA 4W8DA 5HLPA 4PV0A 4JQ8A 2E2BA 1Q8WA 3SOAA 5FXQA 4BGQA 3G6GA 5K4JA 2ITVA 2VO0A 2XKEA 5C8KA 2JBOA 5J9YA 4R1VA 4CT2A 1MRUA 5E8TA 1ZRZA 3I0OA 4JDIA 3IW7A 3QQLA 3K3IA 4NW6A 1WBOA 3ETAA 4MD9E 3P9JA 2Z7RA 2P33A 3LXKA 1JKKA 1SNUA 1PW2A 4MWIA 3F3TA 4IVBA 4AFJA 2UW8A 5AP7A 1HCKA 1UU7A 3A7FA 1ZOEA 3I5ZA 3QUPA 2WEVA 3SRVA 4BBEA 5E9EA 2PMOX 4NZWB 4B9DA 3GVUA 4LV8A 5F1ZA 5JT2A 2BALA 4FKLA 4JS8A 3VBWA 5ITAA 2PPQA 3RPOA 4NEUA 3NSZA 4LRJA 2C68A 3IW5A 2YEXA 2CLXA 3DNDA 1FQ1B 4FTCA 4JOAA 4QYYA 4ZEGA 5LVMA 4FIFA 4RWIA 2YIRA 1ZXEA 2X1NA 4DCEA 3OT3A 5BYLA 1ZYJA 3LFNA 3KF7A 2BZJA 2WTKC 4KRCA 3KRXA 3QX2A 4YZBA 1UWJA 2UZVA 3BYVA 4EKLA 3CIKA 1Q8ZA 5CEQA 2LAVA 1G8AA 4WG5A 4BCQA 2DWBA 4XV9A 3FZSA 2J4ZA 3IQ7A 2IVUA 4HPUE 3GOKA 5AFVA 4FTOA 5LMBA 3VBXA 3TCPA 5G6VA 5HQ0A 4ZK5A 1P4OA 5JFSA 3DK7A 4ACDA 5I9WA 5IA2A 4V05A 3TG1A 3AQVA 4TWPA 4W9XA 5GZ9A 3NGAA 3CQEA 3VBQA 2XIYA 2WOUA 5HVJA 4FKJA 3NAYA 5HLNA 4TYIA 5DMZA 1MRYA 2QNJA 4FYOA 3E63A 1OL6A 4HGTA 4EKKA 4LMUA 3QUDA 4L42A 3NW5A 3OWJA 2WPAA 1VZOA 2XF0A 3GCUA 3O23A 3R1YA 4KIQA 4LYNA 4O0WA 1YHSA 4RIOA 4DH3A 2R0IA 2XB7A 3LIJA 4LL5A 5I3RA 2FSLX 2VTOA 2WMTA 5CI6A 5EI8A 3C7QA 4JQEA 4EH3A 1AD5A 3PZHA 4EOOA 3QRKA 3S00A 4HZSA 1R78A 4O91A 3U54A 3C4XA 1PXNA 1YHWA 4M97A 3BI6A 5AMNA 3Q60A 1JAMA 2Z60A 1DAWA 3NX8A 2B53A 3WF8A 3EQBA 3NNVA 3DDPA 1W0XC 2HW6A 2JIUA 5K5NA 5AUZA 3N4TA 5IQGA 1KWPA 2R3MA 3A2CA 4XS2A 3NWWA 3F3UA 3ORIA 4JBOA 3RINA 4UXLA 4EC9A 4J52A 5CEOA 2HOGA 2VO7A 2H9VA 3F3WA 4J71A 4MBIA 4YJTA 1H00A 2WFYA 3CD8A 3PJ2A 4LG4A 4IH8A 4EH4A 4EK8A 1W98A 1W83A 3OWLA 4R8QA 3RMFA 1U54A 4ZY4A 3RZBA 1KV1A 3EFLA 2C30A 4YGAA 2C5OA 3KRWA 4CRLA 4UWCA 4YLJA 3EL8A 3QRUA 3RAHA 2GU8A 2HXLA 2VTIA 4MTAA 4YBJA 3EQCA 4H1JA 5ACKA 1ERKA 3R8MA 2J5FA 2VWIA 3RP9A 1Q4LA 4AW0A 2CGWA 3RGFA 3ZXZA 2I0HA 5KZIA 1BUHA 4C58A 5LWNA 4BY9E 4X3FA 2VX1A 5EW3A 4BDGA 3PXKA 3VW8A 2ZMCA 4IANA 2YISA 2UUEA 1JKSA 4BR3A 3LFBA 3KK8A 2P0CA 2PVFA 5IA0A 3S1HA 2RF9A 3AMAA 3IW6A 4FIJA 4A9SA 4XEYA 2Y9QA 4GV1A 3FMLA 4XG3A 5AX9A 3I4BA 5IISA 5L4QA 1XH7A 2VO6A 2WQEA 4QPMA 4FKTA 4TT7A 2OIQA 3KC3A 2BCJA 4ASEA 4Q9ZA 3NUUA 3VJOA 3V8SA 3MJ2A 4OTPA 5AADA 4FF8A 4FV3A 2YM8A 1PF8A 4BDJA 5HTIA 2PVRA 2WU6A 1R0EA 5E1EA 5KNJA 3UVPA 3NUYA 2HWPA 3PXYA 5DR2A 5CAQA 2X2MA 3IS5A 4MKCA 4YMJA 3FLWA 4W4VA 4WRSA 5CXZA 2X7GA 2ITXA 3F6XA 3P7CA 4IBMA 4MH7A 2O63A 5HICA 5TO8A 2FA2A 3UZRA 4FKRA 1T46A 3F5GA 3LCOA 2ITYA 3MB7A 2UVZA 3GU7A 3PTGA 2GNHA 4AA4A 2PVLA 3QXPA 2XEYA 5LVNA 4FSMA 1ATPE 3DLSA 1WZYA 5IH6A 5EW9A 4FNZA 4PTEA 4JBQA 5EM5A 4BHZA 3Q04A 2VTQA 1S9IA 4FEUA 1WBVA 2JFLA 4RX7A 4D58A 4BCHA 3JVSA 3VHKA 2WMQA 3MA6A 1Y6BA 5IQFA 4DEHA 4G3GA 4JVGA 3QA0A 5DA3A 3A60A 4NJDA 5CENA 1OIQA 3PLAE 2J7TA 3E5AA 4UBAA 3WARA 4A9YA 2VGPA 3U87A 4ANBA 4CVAA 2XKDA 3O0GA 3Q5IA 2O65A 3PFQA 4C37A 5TR6A 4ARKA 2HZ4A 2QOQA 3DQWA 3FMJA 3HP5A 4XV2A 5HIDA 5HD4A 3ZSIA 4CFUA 4FKPA 3NYVA 4EOLA 2B4SB 5E8XA 3BLHA 1R3CA 4ENYA 2CKOA 4FKSA 3IK3A 1GIIA 5EDRA 5IKWA 3ZU7A 3UOJA 3LMIA 2W17A 3FLZA 1M7NA 2CPKE 2IWIA 3AG9A 3ZZEA 4ORKA 5BUJA 4AU8A 4JDHA 5HNGA 3UQCA 5EH0A 2YDJA 4QOXA 3KCFA 3K5VA 4OLIA 3QC4A 4BCIA 4UMRA 2QVSE 4OBQA 5DEWA 3WF5A 3RM6A 1SVEA 2YA9A 3BQRA 4F1TA 3EN7A 3VS1A 3KF4A 3ZSGA 5BVOA 1CKPA 2X0GA 4RX5A 2GTMA 3D5WA 4IIRA 4L01A 4K1BA 4ZOGA 2WTDA 2R7IA 3EWHA 1YW2A 3R02A 2YJSA 3D5VA 4NK9A 4UXQA 1J7LA 2PL0A 2VWUA 2OJFE 4FIIA 3LMGA 4FSNA 2X9EA 2BR1A 3PPZA 5IZFA 2X9FA 3JUHA 5CNOA 3EQDA 2XCKA 5JQ5A 4RIWA 5IQIA 1YQJA 3E8NA 3ZM9A 1OUKA 4ZSGA 4NUSA 2WU7A 4TYHB 4DLIA 5DWRA 4OT6A 3T9IA 1WBWA 3EKNA 3PE1A 1DI8A 3KY2A 4PP9A 4F9WA 3FHIA 5A4EA 3PJ8A 4K33A 4XLIA 5IA3A 5KE0A 1SYKA 3NUNA 3Q3BA 4BC6A 3VS3A 4I6BA 1OB3A 3KMUA 4W9WA 4YJRA 4JJRA 4RZVA 4HPTE 3ZHPC 4F1MA 5F95A 5IMEA 1GIJA 3NEWA 4USFA 3ZEWA 3BE2A 2AC5A 4JG8A 2IG7A 3DXQA 4KD1A 4W4YA 3T9TA 3AGMA 3W2RA 5JRSA 4ZLZA 4XBRA 4J99A 5DPVA 1OKWA 5FQDC 3QTZA 4O7NA 5CEIA 3F88A 4E26A 4KAOA 4XG6A 4AW1A 5J79A 4DFYA 5JZJA 3NIEA 3ZO1A 2PUUA 3EQRA 3GI3A 2C5XA 4YC6A 4IEBA 1Z9XA 4DG3E 3RPVA 4B4LA 4LUEA 4NFMA 4USEA 5EHYA 4O0SA 4B7TA 4LI5A 2X2KA 3ZONA 4EOMA 3AC2A 4F9AA 4ZS0A 5HEZA 2ETKA 4R1YA 1KE9A 3POZA 4BDCA 5BYYA 3ZUUA 1YHVA 1M14A 3KGAA 2C5NA 3U55A 4IM0A 5E91A 1G3NA 1P4FA 2E9OA 4XOZA 4RBLA 5K0KA 3RPSA 3T3UA 1OIUA 4BBMA 4KKHA 4D5HA 1R0PA 1LPUA 5FD2A 4GG7A 3Q4TA 4G17A 3UPXA 4JNWA 4BDBA 4EONA 2O0UA 3I60A 1ZY4A 1H01A 4HGSA 3BV2A 2C5VA 2C0OA 3E64A 2B9FA 4HYSA 4KIPA 3VUMA 5E8SA 4CQGA 5EQPA 3ODYX 3RPYA 2R3JA 4YSMA 1I09A 2X8IA 3FKOA 5EM6A 1KUTA 4GKHA 2QOFA 4R3CA 2VGOA 2IZTA 4NSTA 2LGCA 3D2KA 5H8BA 2QR8A 3MPAA 2JDSA 2DUVA 5KHXA 4FV9A 3TT0A 4YC3A 3PWYA 2JDRA 3VF9A 4EH6A 4F1OA 4E6QA 4I21A 5HE2A 4G3DA 4I94A 3HNGA 3E3BX 3SX9A 3WZEA 4DEBA 3UC3A 4FT3A 4R5YA 4IX6A 3UOHA 2OIDA 5I9VA 3D2IA 3W55A 3PVGA 4HJOA 4FTKA 4DAWA 4NIFB 3TEIA 4PMSA 5BQ0A 2R9SA 4MNEB 2IZSA 4IVAA 2YABA 5ETIA 2JGZA 4JDKA 5IQEA 4RWJA 2EWAA 4LV5A 2Q0NA 4G16A 3LXPA 3PXQA 3UO5A 4FTIA 5CQUA 5ANKA 1SNXA 4FV1A 4PL3A 1PYXA 2HK5A 3W18A 3QKLA 2WO6A 3QTWA 5L8JA 1XH4A 3E88A 1U59A 2VNYA 4C61A 4W4WA 3FXZA 4DTBA 3ZLSA 3C0IA 4MD7E 3UO4A 3OF0A 3FV8A 3MFRA 3R04A 4ANMA 4QD6A 3ACKA 3II5A 4Y83A 1XH8A 3UODA 3OFMA 3EZVA 4UV0A 1OBDA 2IJMA 4I0RA 4QRCA 5F4NA 4EK4A 3AT4A 4Y8DA 2XKCA 3QQUA 3BU3A 4LGHA 4YZNA 4WUNA 3EKKA 1B38A 2BDFA 4U97A 4WA9A 2YZLA 3BQCA 3TM0A 2XIZA 5AIRA 4YZ9A 3QUEA 5JEBA 4CKJA 2J0IA 1BX6A 4A4OA 3LJ1A 4AN2A 2ERKA 3QHWA 5LOHA 4E73A 2OH0E 5LVPA 5IA5A 2IW9A 4IADA 4ID7A 2W06A 3HDNA 3CPCA 2B9JA 3F61A 3LXNA 3QTSA 1DM2A 3OTUA 4AZFA 5E8WA 3R2YA 2EB2A 4UYNA 3VUKA 1FBNA 2R64A 3FZOA 4PPCA 5FBNC 4BWPA 2BZHB 3L1SA 5T68A 5GJDA 4EZ3A 3D5XA 3GQIA 5J9ZA 2WTIA 2JDTA 4QP3A 3UOKA 4M13A 3C5IA 5GNKA 4DE4A 2W1ZA 1BMKA 4I5CA 4TNBA 5J5TA 5M4UA 5HU3A 3R8VA 4B0GA 2C6KA 1YDRE 3TV4A 3E92A 1LEWA 4BZOA 4CTCA 2JKOA 3R0TA 4X7QA 5C26A 1ZYSA 5C8NA 3FBVA 5IH5A 4RC3A 2GNFA 2W1EA 4YUQA 3UMWA 4M12A 3HGKA 4GJ3A 4RVKA 3R7EA 4QMQA 4D4RA 1MRVA 3KN6A 3SQQA 5C9CA 5A4LA
chains in the Genus database with same CATH superfamily
2R0UA 3CD3A 3JYAA 4HVSA 5TT7A 4I5PA 3MA3A 2JFMA 4FTJA 3SRVB 2X81A 4JL9A 4OTIA 5CT7A 3ZXTA 1Q3WA 3I7CA 3AKKA 4GT5A 5L8LA 2Y4IB 4APPA 4ZLYA 3O7LD 5DT3A 4YTFA 3DTCA 4BFMA 4JG7A 4D4YA 1QPDA 4EORA 3B8RA 4PDSA 1ND4A 1PMEA 4X2KA 5AX3A 3PSBA 5GJFA 2OLCA 1GNGA 3MFSA 5HU9A 1UNHA 2BROA 4IAYA 4ZJJA 3OWPA 2QOHA 4NTSA 4YU2A 4EWHA 4DFLA 5HG8A 4JMQA 3F66A 3R8LA 3UDSA 3CEKA 4DT9A 2CMWA 4I6HA 3CY3A 4MXZA 3DCVA 5I3OA 4BYJA 3FLSA 5BV3A 5DEYA 1NA7A 1PXIA 2J6MA 3HVCA 2BHHA 5EDQA 4B99A 4FEXA 5IQBA 1CKIA 3MVLA 2GFSA 3ODZX 4FOBA 3HMNA 3PY3A 5EFQA 3WE8A 5CANA 2PY3A 4LQMA 5EOBA 2VWZA 3F2NA 4FV7A 4KSPA 4A07A 3KL8A 3DTWA 3OMVA 3BYOA 4TTHB 3OXTA 1FPUA 3R8UA 2R3HA 3N51A 4Y72A 4MXOA 5CU2A 3NUPA 4D2PA 3R9DA 1H1PA 1B39A 3AD5A 3MYGA 3ZLXA 2PSQA 4RIXA 3MW1A 4I1ZA 5CF5A 2UZWE 3QBNA 3PJCA 4IAKA 4YPSA 1WCCA 2PWLA 4O1OA 2FSTX 4DG0E 4O82A 1NVSA 3OEFX 4XNEA 5HIEA 3LZBA 4YZCA 4YR8A 3Q9WA 5AV4A 4ONAA 4P5ZA 3ULZA 2R3IA 4PDYA 2O64A 5IQCA 3W0QA 4GYIA 2BUJA 4R7IA 1U46A 5EHLA 4BDKA 5A4QA 4ZMFA 5L6WL 3ALNA 3UDTA 1QCFA 1GOLA 1KE8A 2C1AA 3RK7A 2X7OA 4RWKA 2PZRA 3S2PA 4EHZA 4YURA 5KMIA 3ID6C 2GMXA 4DDGA 5L2SA 3KXMA 4FNWA 2PULA 2WXVA 4AZWA 3GU4A 3QRJA 3W2PA 1KE5A 4ZTRA 5LMAA 4PP7A 3O71A 3G15A 4TWOA 1OL2A 3EQIA 4TN6A 4Y73A 3DLZA 4NTTA 2X4ZA 4YJPA 1U54B 2OZAA 2RSVA 4PL4A 4YZDA 3FZPA 3EN6A 4PRJA 4QP9A 5AUYA 5KMMA 2NNWB 1E9HA 2ZAZA 3R1QA 4IFGA 2XK6A 4AT3A 4CYJA 4MXCA 4HW7A 3OCSA 2R5TA 3R30A 3MIAA 4ACMA 5B2MA 2XEZA 1F5QA 3AC8A 2UZOA 3KCKA 4YJQA 1Y57A 1XH6A 4FR4A 2OBJA 3COHA 4X6RA 2W1DA 4QMXA 3LFQA 5CXHA 3ORZA 4M69A 4M7IA 3QQKA 3TNIA 4B8LA 2WIHA 3W8LA 3R73A 1XWSA 3KULA 3RPRA 3VW6A 4E4MA 2VWXA 1Q99A 4X3FB 1UVRA 3R9HA 3RAIA 4JBPA 3DJ7A 3NW6A 1GZ8A 2P55A 3NUAA 3SDJA 5FXRA 4QP8A 4KIKA 4QMYA 3BX5A 4QTBA 3K3JA 5EYDA 3VUGA 2Y6OA 5IMXA 3FYKX 3AMBA 3MIYA 4FKVA 4BDAA 2W96B 3V5WA 1J91A 5K5XA 5DFPA 5ANIA 3A61A 3OW4A 4LGGA 2YWPA 3FI2A 3LAUA 3ROCA 2YCSA 1YDSE 4C57A 4DF3A 1U5RA 2JC6A 4XG9A 3BPRA 2CHLA 3GP0A 4ACGA 5M44A 3C5UA 3Q4CA 3SOCA 4WNOA 3LM0A 3HZTA 3TTIA 3D94A 5LARA 4R6VA 3CLYA 3MV5A 4F7JA 5CAVA 4AOIA 3UO6A 4TXCA 4KA3A 2ZV8A 4WBBB 2PZIA 2XNBA 1H24A 1OBGA 3QTIA 3TUCA 5ETFA 2UZDA 3OCGA 2QG7A 4X2NA 4C4GA 3M1SA 5CSWA 2VO3A 5IUHA 1LR4A 4LM5A 4XG4A 2F2UA 5AAFA 3TNWA 5JRQA 5KMOA 4HOKA 2R3NA 5GZ8A 1J7UA 4AX8A 2CCHA 4E4NA 2QQ7A 5HD7A 2WMBA 3NAXA 2OKRA 4QMPA 4PNKA 4FIEA 5EYCA 1Y8GA 3TWJA 2V5QA 4EJ7A 2W7XA 3VBYA 4EQUA 5IDPA 3F82A 3ORMA 5KO1A 2CSNA 2NP8A 2PHKA 3DJ6A 3HLLA 3K5UA 2WMUA 3DAJA 2J0MB 3R7IA 5CSPA 3A8XA 2QONA 4K6ZA 4RQVA 3FL5A 4FL3A 4DFZE 1Q3DA 4WG4A 4AOTA 4OTQA 2JEDA 3W0PA 3E8CA 5HO6A 4BCKA 2XK7A 3ZRKA 2RFEA 5CF4A 2R3GA 2J50A 4RVLA 3WIGA 1MQ4A 4FKWA 3DKFA 5ETAA 2CNQA 5DLSA 4RC2A 5K9IA 3CGOA 2C3JA 1K3AA 1CKJA 1WMKA 4ZTSA 3DY7A 4IHPA 4TWNA 4TY1A 4GUEA 1YWVA 3TZ8A 5AR4A 1FOTA 3RZFA 1ZWSA 1JVPP 2C6DA 3OY3A 4FIGA 3RK5A 4K0YA 4KNBA 3BYMA 3DXNA 3OUKA 2ZM4A 3UYSA 4KABA 2UZEA 2PMLX 1ZOHA 2GTNA 2UW7A 4XH6A 4ZTNA 2C1BA 5BPYA 4C4IA 2O5KA 4I6QA 1Z57A 4MEDA 4BTKA 4UMPA 3AC4A 4LOQA 3NLBA 4FSQA 4MQ2A 4C02A 4FZDB 2IZUA 4K11A 1OGUA 4F7NA 1H0VA 4CQEA 3L8PA 3UIUA 1YVJA 2J2IB 4AAAA 3NMUF 3TKHA 3QYZA 5IDNA 5HNIX 3QTUA 4I4EA 3P5KA 4P7EA 3V51A 1IA8A 2YCQA 5JGBA 1A48A 5B0XA 4CLJA 2ITTA 2Y8OA 4QQCA 1VLRA 3ZYAA 4FL2A 2W5AA 4KRDA 4PF4A 3RALA 4ZJVA 3BCEA 4EYMA 2GS7A 3VULA 2HXQA 4TW9A 4ZAUA 3VBVA 2J90A 2E9UA 4FZFB 5ANGA 3I7BA 2F49A 4RVMA 2BMCA 3VS5A 3KU2A 4BZDA 3ATTA 1CM8A 1OKVA 2JITA 4M3QA 5J1VA 3UP7A 1YWNA 2GS6A 1ZZLA 5HIBA 4TYJA 2QURA 4O7RA 4FUYA 5HG7A 4NM0A 1Z5MA 2X7FA 4D9UA 3GU8A 4BKZA 1MUOA 3FKLA 4QTDA 3KKVA 3TNQB 5AP6A 2BKKA 2XARA 2YCFA 5HCXA 2W1GA 3AT2A 3EMGA 4OBOA 4ACHA 3VAPA 1URCA 1JBPE 3SGCA 3MH2A 5AV2A 2C69A 3F7WA 5J7HA 4EK3A 4RC4A 3FMKA 4ANLA 4E6AA 2JKQA 3MH1A 3Q6UA 3KVWA 3TL8A 4Y85A 1H0WA 2C6TA 3TNHA 4EUTA 4D2TA 1GY3A 4O0XA 4AE6A 2VTTA 2W4JA 5KBRA 1LP4A 1XBCA 5HLWA 3DZQA 4EJNA 1E1VA 3TACA 4DT8A 4AP7A 5DRBA 1FVRA 5DYJA 4XP2A 3GU6A 5EI6A 4U44A 2R3KA 5BMMA 4BF2A 4AG8A 3N4UA 4G9RA 3MVJA 4ASDA 4JDJA 3NW7A 4HCTA 2NPQA 3V6RA 2V55A 2VWBA 2XVDA 3LCSA 4NKSA 4X21A 2WZJA 4RT7A 4JAIA 2WMRA 3GFWA 3TKUA 2I7QA 4DFBA 4IZ7A 4YHJA 1WBSA 3IECA 3KXXA 5HNBA 5HX8A 2UW4A 3HUCA 4BIBA 5DN3A 3F2RA 2NYAA 3EIDA 3MFUA 2ZV2A 3QRIA 2GHMA 2RIOA 4IC8A 3BL9A 1S9JA 4S32A 5M07A 5GIPE 3CE3A 3ZRLA 4L52A 3KN5A 2BAQA 5HBEA 4K9YA 3QX4A 4QMVA 4TPTA 4Q2AA 1Q8UA 5T6KA 2JLDA 2XIXA 4N57A 3FDNA 4BKJA 3LFAA 4MK0A 4E6DA 3DV3A 3TXOA 4FT0A 4F7SA 3R7VA 1Q41A 1JSTA 4MHAA 3EYGA 1G8JA 1F0QA 5CALA 3ZM4A 5CU0A 2R2PA 3W2SA 2YM7A 2C6OA 3CQWA 3OROA 5DVRA 1JNKA 3HA6A 5FTQA 3TJCA 1IASA 4X3JA 2RFDA 4OT5A 4GW8A 3AD4A 1XQZA 2IEWA 4PMMA 2WTWA 1GAGA 4F9YA 5HX6A 4JXFA 3EN5A 4UMQA 4EL9A 5JKGA 2PVHA 2A1AB 5E8YA 3RCDA 1QPJA 3TUDA 3DFCB 4MWHA 1Y6AA 4IW0A 3T3VA 3S0OA 2G01A 4AZVA 5C1QB 5EOLA 2XNEA 2Z02A 4EH7A 5EM8A 5H9BA 5E92A 1JOWB 2J0LA 3FQEA 4BHNA 5KMNA 3I6UA 4ITJA 5CVFA 2IF8A 4FSZA 4JLCA 5HTCA 1XMLA 3AC1A 3L8XA 2WD1A 4C35A 5HG5A 2QI8A 2R3QA 2YHVA 2PMIA 4IX4A 4DGOA 3HA8A 1K2PA 2YFXA 5EK7A 4CRSA 3HV4A 3VS2A 3F69A 4BCPA 3SG9A 1TVOA 3QF9A 3ZBXA 2ZDUA 4QDVA 1VEBA 4IX5A 4RJ3A 2ITWA 4RJ5A 1PY5A 4JX3A 1YOLA 4GS6A 3UDBA 2Y4IC 4U0IA 3IDCA 3U6JA 3DKCA 2QLUA 5BVDA 5AR3A 4FV8A 4F65A 2C5YA 4AT4A 4KWPA 4NYEA 1ZMUA 3OW3A 4YJOA 5ANOA 3BHTA 4XV1A 4N0SA 3RWQA 4QMWA 4F6UA 1CMKE 1XKKA 2UZBA 4UEUA 2HELA 5CSVA 2UZUE 5FXSA 2OGVA 3OXIA 2BFXA 3BL7A 1PKGA 5JH6A 4J95A 2QKWB 2W5BA 1OM1A 3ORXA 2W9FB 2PK9A 3QTQA 1ZAOA 4D2WA 5EQEA 2BDWA 2VTNA 3ORTA 4LRMA 3M2WA 1OPLA 4ITHA 2C6MA 4A9RA 4BI2A 4RGJA 3H3CA 3W0NA 4ERKA 5KCVA 2ZV7A 4FKUA 4DITA 1UU3A 4PPAA 5J7BA 4YNOA 2PVNA 5IF1A 2ZB0A 5CYIA 1YWRA 4DH8A 4U7ZA 1PHKA 3FWQA 2IO6A 1G8KA 4A4XA 2XANA 1P5EA 3JY9A 3WYYA 4RVTA 4FSRA 5LQFA 4GVAA 4FVPA 2C3KA 2WMAA 1BYGA 2XK4A 3GU5A 4PQNA 4ZXTA 2PZ5A 5CZHA 2IW8A 2V7OA 2XNMA 4DEIA 3DNEA 4XRLA 3E87A 4D2SA 2WQBA 2G1TA 2YIXA 3REPA 1YRPA 4UWBA 3V01A 3TTJA 2YN8A 3EJ1A 3K2LA 5CF8A 5LCJA 1REKA 3V5TA 3UDZA 1R39A 3GC8A 5EW8A 5IA4A 3A99A 4L00A 4HVIA 4HGEA 1IA9A 3UG1A 1ZOGA 5J9LA 2FUMA 3HX4A 4JIKA 3CBLA 4EK6A 1Q61A 2WOTA 1PMUA 4UYAA 4DGMA 2OJ9A 3O8UA 3P7BA 3QTRA 4FTLA 3ZEPA 2GS2A 2QO9A 2VV9A 4H3PA 4QMSA 4RFMA 3ORKA 4NW5A 3RKBA 3TDWA 4AXFA 3MY0A 2VTPA 3DQXA 4EQMA 5CX9A 3H9FA 3ZFMA 1PXOA 3DT1A 5TE0A 5AA9A 4BRXA 3UPZA 3TMOA 3V8TA 3R71A 2HZIA 4G3EA 5LMKC 4KSQA 3P0MA 4KIOA 1SVHA 3R83A 3DOGA 3UP2A 1LEZA 4GFMA 4RA5A 3P1AA 3R7GA 3B2WA 1XBAA 2HY0A 2BPMA 3AKLA 2OFVA 2UW3A 4II5A 4E5AX 4CXAA 3PJ1A 4U9AA 3DJ5A 1QPEA 5C27A 2J5EA 1YI4A 4BN1A 3VQHA 4WT6A 3EQPA 3O2MA 4F64A 4Z55A 2GNIA 3LW0A 5KBQA 5BYZA 4Y5HA 4RIXB 3FAAA 5KUPA 3ZO4A 4DEAA 4QQTA 3G33A 2OO8X 2BIYA 2W05A 2XA4A 3QD2B 4FKIA 4OTFA 5BVKA 1OUYA 4RJ8A 4C0TA 5JZNA 3RHKA 4MF1A 4IB5A 2Z7SA 4ASZA 2VTJA 4TYEA 3BGZA 3PIZA 3HMMA 1W84A 4G5JA 4USDA 2ZB1A 4E8AA 5AM7A 4ZY5A 3IOKA 2X6EA 4RLLA 2XUUA 3CTHA 3QYWA 2WTCA 5DRDA 4KS7A 2FO0A 4GT4A 3MVMA 5CAOA 5C03A 2GQSA 2W4OA 2PUIA 3D83A 3JS2A 5HHWA 3O96A 4RG0A 1J3HA 2XNGA 2ZDTA 3CR0A 4JRNA 5CZIA 4UX9A 2ZMDA 4OAUC 3UZPA 3ET7A 1BLXA 5I0BA 3BU6A 2BZIB 2OZAB 3FJQE 3Q9ZA 2OG8A 2OF2A 4PTGA 4MBLA 1FINA 2VX3A 2C3LA 3BEGA 2R3RA 3ZMMA 2NO3A 5FTGA 2P3GX 3ORPA 1JQHA 4RSSA 4BWKA 5L2QA 3QCSA 4M69B 4G3CA 2HCKA 4IVDA 5EM7A 3G6HA 4OTWA 5DT0A 2CCIA 4ZSAA 3KK9A 3KULB 3G0EA 3HECA 5HESA 3R8PA 4FTRA 3UIMA 3VF8A 2X0PA 3FZRA 2AC3A 4I3ZA 4O2PA 1H4LA 1WVYA 4U3YA 4KIKB 2Z7QA 4MAOA 4I20A 4L44A 3TZ9A 3DK3A 4QEBA 1OL5A 4IAIA 4CZYB 4O7WA 3KRRA 3VS0A 4C4JA 1GJOA 1J7IA 4DTAA 4DG2E 3FSFA 3HMOA 3OS3A 4BI0A 4IZYA 1SZMA 4YO6A 4E5BA 3ORNA 4WSQA 3ZFXA 3D7TA 2CKQA 3R22A 3PDTA 3UVRA 4CGAA 3PRFA 4TNDA 2X8EA 3C13A 2ZM3A 4F99A 3MY5A 5HCZA 3DXPA 3IOPA 2WTKB 3QU0A 4A9TA 4BBFA 4C59A 5M09A 2ITUA 4D28A 4CFXA 3EZRA 2BILB 3NYXA 4RFZA 3UGCA 3FMDA 4YPDA 4DN5A 4HVDA 4BGGA 2Y4PA 4HCUA 3QZIA 1V1KA 4CCBA 2W1HA 2QCSA 3BGPA 3H30A 4UMTA 1YDTE 3QZGA 4LGDA 3ENHA 4TYGA 2REIA 3HRCA 1TQPA 4FIHA 1IAHA 4Y46A 5DR6A 3PY0A 3GCPA 3Q52A 5HORA 4MNFA 2OXDA 1PMNA 5E7RA 4GEOA 4MBJA 3SAYA 4ZZNA 3FUPA 4FG9A 1FGIA 4I92A 2EVAA 2BHEA 3C0GA 3FXXA 4RIYA 2QO7A 1JSUA 3BHYA 3P08A 4GRBA 5AR8A 3A4PA 5CTPA 4APCA 4O38A 5E8ZA 3DBEA 4L3PA 3SV0A 5A14A 4Q5HA 2HZ0A 5DHJA 4DTKA 4AXDA 2J51A 3FMMA 4L6QA 5DG5A 2DS1A 4FRFA 4CMUA 1A06A 2W1CA 5F20A 4D55A 4MQ1A 1B6CB 4FBXA 5EKOA 1UKHA 2RL5A 3IO7A 4MD8E 2ZM1A 2QU6A 5AR7A 2YERA 3VHEA 3QWJA 5I9XA 2OW3A 4FNYA 3SG8A 4O4EA 3AD6A 4LFIA 5HKMA 2Y6MA 4ZSEA 3ZUVA 3G9LX 4DFUA 2YWVA 3ORLA 4BCOA 3LVPA 3CXWA 4JR3A 3Q9XA 1UU8A 3KXHA 3QTXA 3VVHA 2QOIA 2WTVA 2XZSA 4KBAA 4M84A 4U45A 2VWYA 3DFAA 5JSMA 3BELA 1AQ1A 2OF4A 3DKGA 5AAEA 4GK2A 3M11A 3GC9A 4JT3A 4AGDA 4WBOA 4FKQA 5AM6A 3AGLA 2F7EE 1RDQE 3BZ3A 4UN0C 3R63A 4JR7A 5IG1A 5ANDA 4DH1A 1H8FA 1CTPE 3D4QA 1WFCA 4V04A 5CU6A 5FEDA 3E62A 1SVGA 4S33A 3PVWA 5FTOA 4F9CA 3UQFA 4F6WA 4S2ZA 3RM7A 3H9OA 4E93A 2VTHA 3RJCA 3SXFA 4G1WA 3BHUA 2QG5A 4YBKA 5LVLA 2B55A 4NCTC 2G2HA 3TI1A 4BI1A 4U40A 3P78A 4R77A 4HVGA 4I5HA 1NVRA 4BVUA 4D5KA 3GCVA 5LVOA 2GPHA 5FM2A 2R3FA 4Y95A 1J1CA 2GQRA 4Y5QA 5LCKA 1AGWA 2I0EA 5BMSA 3CQUA 4H1MA 5FGKA 4FV4A 3SKCA 4RZWA 4YJNA 2BRNA 3QCXA 2PVKA 2PTKA 3RVGA 5IPJA 5BVEA 3V5JA 2QHMA 5ANJA 3OZ6A 1K9AA 2GNLA 4S34A 4CKRA 1A9UA 5CS6A 3BU5A 4EOIA 2QOKA 3EHAA 4HYUA 3R1NA 4F7LA 2OFUA 2YDKA 4ZIMA 4NKAA 3F5PA 3G90X 4RJ7A 5D7VA 4DH7A 1M52A 3Q9YA 5IA1A 3ZLWA 4IZAA 4BTMA 3GBZA 2XYNA 5CI7A 3U9NA 4CEGA 5LWMA 1IEPA 2OJGA 4NWMA 4D2VA 3QQFA 2BRHA 4PX6A 4O7YA 2OICA 2YACA 3FKNA 4XBUA 3TJDA 4W8EA 4I0SA 4Q9SA 4PWNA 3VUIA 3WF7A 3ATSA 4MCVA 4RMZA 3C4EA 4F0IA 2HZNA 4HZRA 4FX3A 5CVHA 1W8CA 5ICPA 5EYKA 4C4HA 4CV9A 3R28A 3NNXA 2F7ZE 3FY0A 4H39A 5I9YA 1M17A 3BLRA 1PXPA 4EOJA 3Q2JA 4LOPA 4ENXA 3W0SA 3EB0A 4UWYA 3ZS5A 4BKYA 2O8YA 2V0DA 4IC7A 4MXXA 4XX9A 4P5QA 5CNNA 4B6LA 1Q97A 4FT5A 4DBXA 3G9NA 4BL1A 3FI3A 4IAFA 2VD5A 2R3LA 3MWUA 3WBLA 4W4XA 1PXLA 1P14A 4RFYA 1G5SA 4NJ3A 4XG7A 4O0TA 3COKA 3ZC5A 4ERWA 4WOVA 4YC8A 4YSJA 4I6LA 1WVXA 2CNVA 3EQHA 3G2FA 4N6ZA 3HRFA 2XKFA 4GFOA 4F4PA 3W0MA 2BIKB 3R6XA 5D10A 5LJJA 4FSWA 4IJ9A 2YM4A 2JAMA 3WZDA 4A7CA 3VS4A 4BDHA 3CSVA 3U6HA 2F4JA 3Q4ZA 2J0JA 1UU9A 2ITZA 3DAEA 3Q96A 2PU8A 1H26A 4O4CA 1R1WA 2J0KA 3R9RA 3D14A 3RTPA 4FT9A 4AACA 4C33A 2WIPA 4TL0A 4DHIB 4EH8A 4OUCA 2ITPA 2E9NA 3QD3A 5DH3A 3LXLA 3MH0A 3QQJA 4XP0A 3FHRA 3R9NA 4O84A 1M7QA 4U41A 2R7BA 3L9NA 4K8AA 5HO8A 3ZC6A 3UJGA 3FMHA 4GJ2A 5I9UA 1WVWA 3KMWA 5IQDA 2GHGA 1CDKA 4WD5A 5DR9A 5C01A 2XJ2A 3UNJA 5M4IA 2BAJA 3WZJA 3MH3A 4AN3A 5HZNA 2XNOA 1W2FA 4EHVA 2WELA 3S95A 4S30A 4FC0A 1JLUE 2WTJA 5A46A 1H27A 4IE9A 3QCQA 4IWOA 3EOCA 4AXEA 4PTCA 4PY1A 4WNMA 2YDIA 2AUHA 4FK6A 4FV6A 3EN4A 3BBWA 3QKKA 4Z3VA 2R3PA 4LOOA 4GYGA 4QTAA 4AAYA 3O8TA 3CKWA 4G3FA 3MBLA 4XOYA 1PJKA 5H8EA 4BCGA 4XMOA 4BCJA 4EQCA 5H2UA 5CEPA 5L6OA 5HI2A 5E4HA 4DINA 2QO2A 4LMNA 4CFFA 4G6LA 3GCSA 2FSOX 3H10A 2JKMA 4BDFA 4BTFA 4DEEA 5A4CA 5B7VA 5CASA 3VS7A 5L8KA 4KUJA 4LV7A 3BGQA 4PDOA 2XIRA 3PE2A 3VC4A 2HIWA 5FLFA 4BJJA 2B9IA 4DLJA 3R00A 4ANSA 1RQQA 1UV5A 2JDVA 3C4WA 5FWKK 2PUNA 3DA6A 1HOWA 4KBCA 3LE6A 4HVHA 5AA8A 3E8EA 4YO4A 3HV3A 5AV3A 3PP0A 1WAKA 3QHRA 4O4FA 3QZHA 3BLAA 1FMKA 5D12A 3A7GA 2DQ7X 3TKIA 5CY3A 5AP5A 4QO9A 3OCBA 4M14A 2UW5A 4H58A 3QWKA 4NU1A 4I5MA 1QMZA 2ONLC 1TKIA 2X4FA 2XBAA 3FQHA 5EYMA 5J8IA 4D0WA 4XYFA 4C7TA 2GDOA 1EH4A 3FZTA 4IXPA 2BZKB 4GU6A 3OD6X 2WMWA 4QQ5A 3VS6A 4ASXA 4EOPA 4CG9A 4BICA 4PDPA 4O7ZA 3AXWA 1IRKA 1OECA 4BDDA 2QOOA 4M68A 4U3ZA 2KTYA 4D1ZA 3RHXA 4GCJA 4JQ7A 3SC1A 4GMYA 2X6DA 4V01A 3RNYA 3W2CA 4C8BA 4AOJA 4J96A 4DA5A 3TZMA 3BIZA 4C62A 4D1XA 4QT1A 2JBPA 2QODA 3Q2MA 4TZRA 2H34A 4G2FA 1ST4A 1L3RE 4G31A 4IVCA 5GJGA 4O4BB 4ZS4A 4U42A 4YZMA 2IVSA 4ALWA 2GNGA 2JDOA 4A9UA 2ITOA 5M57A 4YJSA 4ZTLA 3FLQA 3EFJA 1M2RA 1QL6A 2E9VA 2A2AA 3GGFA 1MP8A 1M2QA 3UIBA 3W10A 3SXRA 3I1AA 3LJ0A 4P90A 5IUIA 4G34A 2XRUA 1NXKA 2YJRA 3ZO2A 2C47A 3LFEA 3GC0A 5JQ8A 3R1SA 4MX9A 4WSYA 3OC1A 3ZFYA 5DNRA 4ZZOA 3ZOSA 5HTBA 3H0YA 3ERKA 2QU5A 4AWIA 3NUXA 4PPBA 5A54A 3NYNA 4QNAA 4YNEA 2BFYA 4RIWB 4FV2A 5F94A 3KREA 5AUXA 3F5UA 2HW7A 4FTNA 4U5JA 2EXMA 3F9NA 5KZ0A 1TFFA 4O22A 3V3VA 3E3PA 4AZTA 2R4BA 4UZDA 4IWQA 3PRIA 3SW4A 4I41A 4OTGA 4DCAA 2J9MA 4O0VA 4BIDA 2AEGA 3GNIB 3GUBA 5JN2A 3BKBA 5AP2A 3GOPA 3AT3A 3T8OA 3CC6A 3DDQA 3G51A 4CTBA 5L3AA 3PIYA 1O9UA 4HGLA 3POOA 3L9PA 1SMHA 3FI4A 2ZVAA 3KRLA 3NUSA 3GFEA 2Q0BA 4ZTHA 1VR2A 4MF0A 5FUTA 4QPAA 1GIHA 4O86A 2XNPA 5JGAA 1FGKA 5BX0A 2W5HA 4FNXA 1OL7A 3PXZA 4QP2A 3COIA 1XH5A 5DBXA 3ZDIA 1LUFA 3PXFA 4O83A 1PKDA 5FRIA 3I81A 3WOWA 4C4FA 3HKOA 3NIZA 2BRGA 2QKRA 3BBTB 3HDMA 5M55A 3KXZA 1JKLA 2W99B 3MY1A 4FG7A 4GT3A 2IVVA 4IFCA 4TKSA 5DGZA 3GB2A 3VQUA 5L2IA 3H4JA 3WF6A 1OITA 3KVXA 4YHTA 4HYHA 4NM3A 4OTRA 4MYGA 5IEVA 3C4ZA 4QDEA 3E8DA 2C3IB 2UW9A 3EFKA 4F6SA 4C34A 3OWKA 5CQWA 4EWQA 4KBKA 5B2LA 2GFCA 3UTOA 2Z7LA 2CGXA 3KA0A 4IJPA 5BVWA 1RJBA 4KS8A 3K54A 4FOCA 1CSNA 2ZFYA 3RNIA 4G5PA 5AEPA 3VIDA 3UMXA 1H08A 3HRBA 5CU4A 2XK3A 2VRXA 5IUGA 3KRJA 3DPKA 4X0MA 4CNHA 4PUZA 3GQLA 4Q5EA 5KKRB 4E3CA 4QMNA 5M4CA 5D11A 4ZTMA 3ALOA 3L8SA 2AYPA 2VTLA 4RQKA 4ZSJA 1L8TA 4GK4A 1REJA 3IPHA 4OR5A 4R3RA 4N70A 4GK3A 5DIAA 3WF9A 3AOXA 3F3VA 4HYIA 1VYZA 1OL1A 5AP3A 1X8BA 2RG5A 4DGLC 4C2WA 3IGGA 3D7TB 2HAKA 4IB3A 5IEXA 3VJNA 3HAVA 4M0ZA 5HCYA 1ZARA 3S3IA 2XM8A 4ZP5A 3NS9A 4R7HA 2XJ0A 3Q53A 4FKGA 2YCRA 5E8UA 3EN9A 4XUFA 1V0OA 5A3XA 3BEAA 4ACCA 4F70A 1OIRA 1PXJA 3ZSHA 4IB0A 4LRKA 3LFSA 4NM7A 5JFXA 2C4GA 2Z8CA 1DAYA 3D0EA 2W1FA 3O7LB 2ZOQA 4WNPA 5ETCA 5JFWA 2BVAA 2A98A 4RA4A 3G0FA 3IG7A 2CN5A 1SM2A 3VO3A 3TN8A 5I9ZA 1NW1A 3VUHA 3OBGA 5FP6A 5LMKA 5HBJA 1W2CA 1M2PA 1P2AA 4YLKA 4D4SA 4L45A 3DAKA 1KE6A 3FMNA 1BL6A 2OJIA 3LCTA 2F2CB 3SLSA 3U9CA 5A9UA 2OI4X 4C36A 3BWFA 5M56A 4FTAA 5FM3A 4ZY6A 1RE8A 4BDIA 1YOJA 3WIKA 3VNTA 2F7XE 4RIYB 5EG3A 2G2IA 5HE3A 3OHTA