2Y4IC

Ksr2-mek1 heterodimer
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
345
structure length
313
Chain Sequence
LLELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCPMAIFELLDYIVNEPPPKLPSAVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords KINASE SUPPRESSOR OF RAS 2
publication title A Raf-Induced Allosteric Transition of Ksr Stimulates Ksr and Raf Phosphorylation of Mek
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 313
sequence length 345
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2y4iC02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2y4iC01
4A7CA 2ZYBA 3SG9A 3FV8A 1JLUE 3LFDA 3RWPA 3VS0A 3F69A 4FGBA 5HO7A 2G2FA 2G2IA 3I6UA 3BEGA 3UYTA 2BR1A 5IQIA 4C3PA 2HW6A 4FTCA 4K18A 4EQCA 2XNNA 4I5CA 4L53A 3GQIA 4LQMA 4LRMA 3IS5A 2ETKA 3RZBA 4F1OA 4UMRA 5E1EA 1DM2A 1E1VA 3EQPA 4IVBA 2P0CA 4P90A 4UMPA 2E9VA 2VWYA 3GCPA 4EKKA 4UBAA 5CZHA 3KREA 5D7VA 3I79A 5L2TA 4ZK5A 3MIYA 3TZ9A 3TUDA 5AP5A 1DS5A 2OJJA 3CPCA 5AUVA 5IH6A 2F4JA 3OCTA 4EZ7A 5BVNA 4H58A 3OCBA 2CKOA 5CALA 3MFTA 3R04A 5EHYA 4XG9A 3PZHA 3KB7A 2I1MA 3ANRA 3Q32A 2UVXA 3T9TA 5BNJA 1OIRA 4MAOA 4AN2A 3R8MA 4LL0A 1XWSA 3W33A 4BWPA 4IB1A 4H3PA 5CLPA 5A46A 3LIJA 4J8MA 4IC7A 3UZRA 2UZWE 4L6QA 5DNRA 4ASEA 3CTQA 4CRLA 4KIOA 2EXEA 2WTWA 4FKTA 2PZYA 5IA3A 3L8XA 1QPEA 4HYUA 4GYIA 4KBAA 3R8UA 1W83A 3EFJA 4MD8E 3BYOA 5C4LA 2XBJA 3QD3A 4CLJA 5CSHA 2X7GA 1TVOA 3KU2A 3DV3A 4USDA 3WE8A 4F9BA 5F95A 2OI4X 2Z7QA 3LE6A 4RWKA 3TKHA 4QMUA 4BZOA 2C3KA 4QTBA 4WNOA 4DE4A 4JJRA 5EYDA 4CFUA 2O8YA 5HO8A 4ASXA 1OKWA 4D4SA 4DEIA 1J91A 3JPVA 3E8CA 3A8WA 5LWMA 4O0VA 4XP3A 5BYZA 3ZH8A 3COIA 4PDYA 5CVHA 4F0IA 2J0KA 3OF0A 3ANQA 4HGEA 4QPSA 5ANOA 5TKDA 4BCMA 2GNHA 4DA5A 1CSNA 3F2AA 3PIYA 3E8NA 4FTUA 2WQBA 4L42A 4TWOA 3UVPA 4A06A 3UO5A 1WFCA 3TACA 4FV7A 3KRXA 4CZTA 4U8ZA 3D83A 3DK6A 4DGOA 3FZPA 4QYYA 2VU3A 3S3IA 2HXQA 1STCE 3HGKA 5J7HA 3UMXA 4QP1A 4EJNA 3IKAA 3EN6A 5CF8A 3ENHA 4AGWA 4PL3A 4USFA 2PWLA 3FLNC 2YDJA 3RK9A 3SD0A 4AE9A 4LL5A 5ANIA 4L9IA 2PMIA 2VWZA 4DEEA 3ZRKA 4NM0A 4CRSA 4BKJA 1RJBA 2WNTA 3OVVA 5HVYA 4OT5A 4JLCA 2JDTA 3PP1A 3RK5A 2UW3A 3DXPA 4GK2A 2VV9A 2W9FB 4G9CA 4NSTA 2WMXA 2GNLA 3VIDA 4QMPA 2QOHA 2UVZA 1ZOEA 4IC8A 4YPSA 3TN8A 3U6JA 4BDFA 2P3GX 3DLZA 4G31A 3RHKA 4D4VA 3P1AA 4RVMA 2WD1A 1FVRA 5EM7A 4FVQA 5KZIA 4MX9A 4JRVA 4TWPA 2XK8A 5FGKA 3RGFA 5B7VA 4FKGA 4IWOA 4ZY5A 5CSWA 4D1SA 5DMZA 5EYMA 4KKGA 1H27A 4YTFA 4ZJIA 1DI8A 1JVPP 2V55A 3U9CA 3KCFA 3L8SA 3OXIA 3R30A 3R02A 5AMNA 3PPKA 4GUBA 2RFSA 5FUTA 1ZMWA 3VS3A 3ZHPC 4M68A 3D5WA 3WARA 4AAAA 1KV2A 5BVKA 4K33A 1PY5A 3W2CA 4CZUA 3RBWA 1OL7A 4CQEA 5C8NA 3R7VA 5D11A 3DBQA 4AU8A 3OWLA 4FV6A 4YNEA 5ITAA 2F57A 4Y8DA 4M7IA 1PXMA 4JG7A 4KA3A 4LFIA 1OPLA 1MRVA 3QUEA 4IFGA 3TNHA 4FSTA 4H05A 4AE6A 2NO3A 2QNJA 1ATPE 3QWKA 4YSJA 4GK3A 3LW0A 4RFMA 5EG3A 3W2SA 3F5XA 2A0CX 3LMGA 3Q4CA 4OTRA 4ZSAA 3F3WA 4FT3A 5LVMA 4FG8A 4Y95A 4JBQA 5CAVA 3DK7A 4IJ9A 4O1PA 5AV4A 3IONA 4BZDA 2VTTA 1J1CA 3EOCA 3EQCA 4O86A 2R3FA 2BAKA 1UV5A 2C6DA 4C2VA 3GUBA 3ELJA 5IQCA 4QP2A 2YIRA 5BUIA 4OAVB 2ZB0A 3I81A 3CS9A 4QYHA 3SG8A 2HZNA 2VGPA 4A9UA 4MBLA 1GOLA 5CT7A 2PVYA 3FZ1A 2ETRA 3F82A 5E92A 5C01A 4CYIA 4D2SA 1A48A 2VX0A 5L6PA 3ITZA 5T3QA 3DJ6A 3PP0A 4BCHA 2CJMA 1B38A 1PKGA 3PRFA 1REKA 4ZSGA 4FIIA 1QPDA 1UU7A 5DEYA 4GFMA 4ASZA 4Z7GA 4YMJA 2ZMDA 3Q9XA 2RF9A 5AUYA 2ZOQA 3VS4A 1HOWA 3BHHA 4BL1A 3CKWA 3FQEA 3TTJA 2XEYA 2W5HA 3W8QA 5DR6A 3VUDA 4M84A 4ZXTA 2O2UA 1BMKA 3CPBA 4CMOA 2WB8A 3CJGA 3WZUA 5J1WA 3T8OA 4I1ZA 1J1BA 5CAOA 5ETFA 4A07A 2OFVA 3GXLA 1UNLA 5HNGA 4EHVA 5AAEA 3A8XA 4YZCA 3SAYA 5CU6A 3ZDIA 2C5NA 2GNIA 4UMTA 5CZIA 3ORMA 1YDTE 2B53A 4PL4A 2WZJA 4CLIA 2QODA 3UIMA 3MTFA 4D4YA 1PW2A 3AD5A 4FF8A 2J5FA 4IVAA 3HX4A 4XBRA 3ZFXA 3DK3A 3WE4A 3VHEA 4JAIA 3TNIA 2WTJA 4O0TA 4W4VA 5J9ZA 4C02A 5FM3A 3U55A 5I4NA 3MWUA 4NYEA 3OW3A 3Q9WA 4R77A 2XKCA 4FV8A 3R7OA 3RI1A 4E5BA 4E3CA 1LEWA 3EYGA 2X2LA 3R2YA 3HRCA 5C4KA 4HGLA 4R8QA 3D2KA 4F63A 4IADA 4EOLA 5FP5A 4FTTA 4RJ6A 3Q4ZA 3TI1A 4FTRA 3ZM9A 3UVQA 4CD0A 2C1AA 4EK8A 4DEGA 5AFVA 3W2OA 1OIUA 4CFFA 2XMYA 3R0TA 2G15A 3K5UA 2VTNA 4ITIA 4MH7A 5HGIA 5LMKA 3P86A 2JBPA 5AUZA 4EONA 3H3CA 5HX8A 3UIXA 3VS7A 3VBVA 4RFYA 1WVXA 3W32A 4QD6A 2VTQA 3RAIA 3WZJA 1MUOA 2IVUA 1GIHA 2ZV9A 1H4LA 4NT4A 1IASA 1ZYSA 3DFCB 4KAOA 4O21A 3VBTA 3QTIA 4DTAA 3QBNA 4FMQA 2ITTA 3IW7A 2Z7RA 4EH7A 4TYIA 3BWFA 1Y6BA 2JKMA 3CQWA 3PXFA 5JKGA 1OVEA 4G5PA 4EH8A 3RCJA 4E4XA 2DWBA 2C4GA 4C59A 1GIJA 1REJA 4QMLA 5EHLA 1H1PA 3E64A 3ZSHA 3VHKA 1HCKA 3DJ5A 5DHJA 3JR1A 2XVDA 4QTDA 4IVDA 5AP4A 2PVRA 3EZVA 3VNTA 2BRMA 4GS6A 2EXCX 4JVGA 3VF8A 4FIEA 4E26A 4F09A 5CF4A 4O6LA 5HICA 3WIKA 4DGMA 3FAAA 4DH7A 5FD2A 3R9NA 4Q9ZA 5CXZA 5IU2A 1XKKA 3DBFA 3DPKA 1YXUA 2R5TA 5E8TA 2WOTA 2DQ7X 4PTGA 3DS6A 4FVPA 5A4QA 5CNNA 3AG9A 4EK3A 2JFMA 5DPVA 2BDJA 3Q96A 4FZ6A 3FL5A 3GU6A 4I41A 5EDPA 3GT8A 2BRGA 2E9NA 5BYLA 5FWKK 2VTPA 3UGCA 4DH1A 5EQYA 2E9PA 5HNBA 4O7YA 3FZSA 2QO7A 4IMYA 3MY0A 3QTZA 3GI3A 4H36A 4RLLA 3A61A 4L7SA 3KULA 3WILA 3QX4A 2IW6A 4U44A 2XK6A 4IACA 3QTWA 3QTUA 3CKXA 3RNYA 3F7WA 3I0QA 2AC3A 2XIXA 4YPDA 3KFAA 4AA0A 2B1PA 5LMBA 2HWOA 3EH9A 2YAKA 3NR9A 3CBLA 3PYYA 4Q5EA 4UY9A 4CG8A 4M13A 3FJQE 4TW9A 1S9JA 2XEZA 1GZ8A 3D5VA 3COMA 3PA3A 4FZDB 4FV4A 2ZB1A 4NUSA 5HBJA 1VYWA 3HRBA 1SZMA 1LR4A 4RSSA 3NCGA 4XV1A 4BF2A 3NVMB 1G5SA 5JRSA 4CT2A 3TDWA 4NTTA 2GTNA 3QHRA 5CEMA 3BGQA 4J95A 5D9HA 1A9UA 2X2MA 3AGMA 4EWQA 3ZXTA 3W2PA 3QGYA 5M4FA 4GT5A 3C0HA 4LG4A 4GIIA 2QOOA 2WTCA 3UC4A 5FDPA 4LV5A 3QRIA 3L9PA 4RG0A 3DT1A 3HV4A 3AC3A 5CEIA 1KSWA 2XNGA 5K3YA 3Q6WA 3WF7A 3I0OA 5KBRA 4PUZA 3BELA 3DDQA 3KN5A 3QUPA 4RA4A 1OUYA 5LVLA 4B99A 4C4FA 3C4XA 3LCOA 4OBPA 4M0ZA 4A9RA 2GMXA 3MA6A 3UIUA 4XBUA 3MV5A 1PMNA 2BAJA 4IJPA 3UODA 3SGCA 4FNZA 4NCTC 3QCQA 4WG4A 3FEGA 5CSVA 2HENA 4TYHA 5ETAA 3NEWA 3HL7A 3F6XA 4EHGA 3G5DA 5IQBA 4ZTMA 3Q4UA 2XP2A 4EH2A 2ITWA 1JSVA 2B55A 3PXKA 1OBDA 4FSWA 4RJ7A 5BX0A 5IF1A 3Q2JA 1UU9A 5D7AA 3G2FA 4XOZA 4DG3E 2QO9A 3A99A 3QQJA 2EWAA 3PXZA 3UYSA 4I24A 2GFCA 2OXDA 2QU6A 3FQSA 3DKCA 4L3JA 3AMAA 2GQRA 1W82A 3CTJA 4S30A 3BQCA 3HAVA 4H39A 5JQ8A 3BV2A 5C9CA 2WEIA 5AR5A 2OJ9A 2BFYA 3MFUA 4O7ZA 5E8WA 2OSCA 3FC2A 1I09A 1NVQA 3O7LD 5H8GA 4ORKA 1OUKA 4HYIA 5CASA 3MSSA 5AR4A 3LXPA 3JVRA 4EBVA 4DGLC 3EHAA 3VVHA 2VTSA 3OWJA 4QOXA 5A3XA 3ZO1A 2E2BA 1ND4A 2XNMA 3ORIA 1BI7A 5KKRC 4R7BA 4I20A 4XG7A 4GSBA 4A9TA 1VZOA 2UZTA 4O27B 3VF9A 3WF8A 1H08A 4BTKA 5HTCA 4TRLA 5KMJA 4L52A 2R0IA 3EQGA 2WIHA 2QOQA 3FSKA 3P78A 4YHTA 2A27A 2UW6A 2OWBA 4ZLZA 4I6QA 4LGDA 4FKIA 1JAMA 5FXSA 4A9YA 5I9XA 4PMMA 3RAHA 5BMSA 5CY3A 2QO2A 3PXRA 4IDTA 3W18A 2CKPA 2WELA 1UVRA 3HMPA 4BBEA 3PY3A 1FGKA 3A7JA 2VZ6A 4GT3A 4MWIA 3REPA 2NPQA 3O17A 4I0RA 4X3FB 4F1MA 4YHFA 2UW0A 4XP2A 1JQHA 1P4FA 2F7ZE 4RJ8A 3KMUA 2X9FA 3VULA 4RPVA 3LLTA 2CCHA 4FK3A 3LMHA 5EOLA 4FEUA 1I44A 3UP2A 2OIBA 4ERKA 4IM0A 5HD7A 2OJFE 4FSQA 3JS2A 1H8FA 4U6RA 1OITA 2XIKA 2VRXA 3LVPA 4MYGA 3EL8A 5TR6A 2IZUA 2XA4A 3PSCA 1URCA 2KTYA 3SOAA 3WZEA 3OCGA 4DFNA 5EI6A 3VUIA 4RQKA 4DT8A 1L8TA 1FOTA 3BEAA 3HV7A 3MY1A 4FUXA 3HA6A 4CCUA 4V01A 3QQFA 5AX3A 2P55A 1NW1A 1OL2A 3RPYA 4C34A 5EH0A 4ZMFA 3LFFA 4JOAA 4LGGA 5ANEA 4HGTA 4XMOA 4U7ZA 4RZWA 5I9YA 5F9EA 1Q8UA 3AOXA 5BVOA 2YISA 3O2MA 2BZKB 3ZM4A 3FWQA 4BDEA 1XH9A 3R1NA 3GQLA 4X2NA 5HIBA 1IRKA 3TZMA 5EYCA 4OTQA 3F7ZA 5LCJA 2PVMA 3F9NA 4AW5A 5HNIX 2R3NA 3TZ7A 2YJSA 3IDPA 1HCLA 1UNGA 3VW6A 3GFEA 4ANOA 4U41A 3D5UA 5HO6A 2OW3A 4PQNA 4YJUA 5AIRA 4BR3A 1BL6A 2HY0A 3M2WA 1OPJA 4QMNA 4DEAA 3CJFA 4Q2AA 3KEXA 2GHMA 2XCKA 3BI6A 2PMNX 4FKLA 4NKAA 4ZOGA 3SDJA 4L67A 4JBPA 4M3QA 4D55A 2B54A 2XUUA 1BI8A 5CU2A 3MGYA 4FYOA 4KKEA 4FVRA 5EI8A 4B7TA 4TL0A 3LQ8A 3LJ2A 1PXJA 4MEDA 3VS1A 2DYLA 3ZCLA 4I5MA 5E8YA 2PVLA 3ET7A 3PY1A 5BMMA 2E9OA 4ZTLA 2OXXA 3VQUA 4ZZOA 5HEZA 5HQ0A 4FOCA 4AS0A 3W8LA 4FEXA 3LQ5A 4XG8A 4YLLA 3LFNA 4FKPA 5E7RA 3QTQA 3OMVA 2YDIA 2PUPA 2CPKE 2R3GA 4E7WA 3CP9A 3QA0A 4N6ZA 5CXHA 5TE0A 4DAWA 4HW7A 4FX3A 5AADA 3S1HA 5IKWA 4BY9E 3FYJX 4EL9A 1BLXA 2W1IA 3PZEA 2QOCA 4CQGA 1WCCA 2WTVA 3QWJA 4MF0A 4AWIA 5IQFA 3OTVA 3DKOA 3G51A 2XRWA 5CSPA 1AD5A 3F61A 3HUCA 4OR5A 4FIFA 4WRSA 2Y0AA 4QP9A 4UZDA 5EK7A 5E9EA 2F7EE 5FEQA 4FT9A 3ZC5A 3GC8A 4G3EA 4RVTA 1M2PA 2JKQA 4FKVA 4EK4A 4FE2A 2JAMA 5HLPA 3NYVA 2QLUA 1KV1A 4L8MA 3POZA 3GCUA 1MRYA 3C5IA 4CV9A 2Y7JA 3PJCA 3SKCA 3NW7A 2BRNA 4RWJA 2ZAZA 2W1ZA 4KSPA 2PSQA 4E6CA 4F9CA 2C3LA 2QVSE 5JQ5A 2PUNA 4C38A 4CGAA 3CEKA 5GIOE 3KK8A 4EBWA 4C33A 3DB8A 1GZOA 3PFQA 1UWHA 5BVDA 4XLVA 5DFPA 2G01A 2PE2A 3C9WA 2BPMA 4FTQA 3SXFA 3Q3BA 1JBPE 3KKVA 2V0DA 2C6KA 3UPZA 3DAEA 2ERKA 2OO8X 4X7QA 4I6FA 4QRCA 4RIOA 3NWWA 4E4LA 5DWRA 2BROA 4YBJA 5F4NA 4ITHA 5IQEA 2QU5A 4TYHB 2ETMA 2FSTX 2ITXA 4QMSA 1P4OA 4MF1A 5AIKA 2WTDA 3FLWA 5AX9A 3OBGA 3R1QA 5C8KA 2PZ5A 4LOQA 5ICPA 4TNBA 3LOKA 3L9NA 2X6DA 3LFAA 4HYHA 1OGUA 5AM7A 5AV1A 3QD2B 4L7FA 3HDNA 3TKIA 3HLLA 4QTAA 3KGAA 5LMAA 3NNUA 3ORZA 4DFBA 2V7OA 1K3AA 4MXZA 4GV1A 4QQ5A 2BHEA 2G9XA 1JSUA 2PHKA 2BILB 2Q0BA 3FXWA 4XG4A 3QQHA 5DT0A 1MQ4A 5KZ0A 3GCVA 3ZLXA 1M17A 4C4IA 4WUAA 4TNDA 3FKNA 5K4JA 4PMPA 2X4ZA 4K2RA 1ZARA 3FLZA 2XKFA 3DOGA 3N4TA 3NNWA 3MI9A 2R3HA 2X8IA 3PLAE 3PE2A 3KN6A 3D0EA 4RZVA 3LLAA 3QRKA 5DRDA 4J7BA 2ITNA 3TV4A 4HVSA 5HG5A 1Q61A 1A06A 2BZJA 4GJ3A 2WO6A 5DVRA 3RPVA 2JBOA 2X7OA 1IAJA 2REIA 3NUSA 5IDNA 4XYFA 3ZLSA 3NYXA 4XRJA 5EYKA 3VUMA 2OG8A 5I9VA 2XS0A 4X2JA 2OKRA 4U80A 5I3OA 5K4IA 2OIQA 4OUCA 1G3NA 3FPMA 3GCQA 4ARKA 4J52A 3U6IA 4CMUA 4RIXA 4FG9A 1Z9XA 3QZHA 3EMGA 4O22A 4OT6A 4QP7A 2R3LA 4QT1A 4BVUA 4D2VA 4PDOA 3TKUA 1DI9A 3DFAA 3OC1A 3Q5IA 4JQEA 1KUTA 4EH4A 2GS6A 4Y85A 2ZV8A 5IG1A 3RM6A 1ZMVA 3UDBA 3E7OA 5I3RA 2I0YA 2HK5A 4D1XA 3IDBA 3M42A 5L8JA 4USEA 5J5SA 1W84A 3LFQA 3KRWA 3OP5A 1H1QA 4YUQA 2X1NA 1W8CA 3MPTA 3WOWA 2YLFA 5DN3A 1PMVA 5TT7A 3UIBA 4F7LA 3ROYA 5L2WA 1E1XA 4U9AA 4HVGA 2W0JA 4HVDA 4O0UA 4XV9A 4J99A 4CSVA 4JX7A 2R64A 4A4XA 4BCQA 4PV0A 2B9HA 1PYXA 4XHKB 2BKZA 2O65A 2PZRA 2YIXA 5ETCA 2R4BA 2YIQA 4CVAA 3GGFA 3HUBA 4LMNA 4WUNA 4IX6A 3OZ6A 3MJ1A 4YZMA 3A4OX 2UZOA 2C5OA 2DS1A 4UEUA 2YM5A 2A19B 3BHUA 2G2HA 3T3VA 2ZJWA 2PVJA 5BPYA 3BU5A 1H0WA 1NVSA 2YJRA 2Z7LA 4F0GA 2OLCA 2Y6OA 4E5AX 2C6EA 5HOAA 3ZRLA 2PVFA 5AA9A 3TG1A 4I5HA 1U4DA 3VWAA 4EHEA 4CTBA 5I5ZA 5AV0A 3OHTA 4NW5A 3ATTA 5CU4A 3ZOSA 3FSFA 3E5AA 3IG7A 2Y4IB 3D9VA 1XH8A 4C0TA 4WG3A 2PMLX 1IA8A 5KMOA 1M52A 2XIYA 3UOKA 3VRZA 5K0XA 4F65A 5CVFA 2IJMA 3OCSA 4JDIA 2LGCA 3UE4A 3I6WA 5DH3A 3JXWA 4PY1A 5CU3A 4E4NA 1NVRA 1B39A 3OWPA 2QR8A 3QA8A 4S31A 3RZFA 4FL3A 3ZRMA 2IPXA 3OWKA 3ORXA 3AD4A 2WGJA 4KKHA 4CKRA 4IVCA 3EN4A 5AR2A 4MBIA 1CKJA 5BQ0A 1GIIA 4I6BA 1GAGA 1YOMA 4EUUA 3P7CA 3N9XA 4M67A 3TJCA 4PF4A 3B8QA 3R71A 4HOKA 4U3ZA 2YA9A 5IEXA 1QCFA 2P2IA 1JPAA 1H0VA 4FTIA 1BUHA 4KS7A 2H6DA 2EVAA 4BBMA 4D2TA 4IQ6A 2HOGA 3LJ0A 3LFSA 4U81A 2C6OA 3MVLA 4A9SA 3LXNA 3BV3A 1B6CB 4AOIA 3EQBA 3EJ1A 4OBOA 2YEXA 4CYJA 3D15A 3QXPA 4BDJA 3GC9A 2VO6A 4WRGA 4FT5A 1XJDA 4S34A 2Y8OA 2RG6A 4GIHA 5DE2A 4EQUA 4O81A 4DCAA 3QC9A 3EFLA 4UWYA 1OB3A 2Q0NA 1AQ1A 1ZY5A 5K5NA 3MVHA 2JDOA 3ZS5A 2J0MB 2EB3A 5HG8A 4IBMA 4WT6A 3U8WA 4U3YA 3GC7A 3ALNA 1UKHA 3MS9A 4RMZA 4YC3A 3AQVA 2WQOA 2B52A 3O8UA 4YNOA 5AV3A 3EQIA 3RVGA 3KRRA 2J6MA 3VBWA 2XYNA 4FC0A 2XKEA 3E88A 4TT7A 4RC4A 4DHFA 3ROCA 3NIZA 4C61A 4LYNA 4S2ZA 2FSLX 3QD4A 3VQHA 2A2AA 3FMEA 4O6EA 3NYNA 4NH1A 4L44A 3E87A 4YJQA 3JVSA 3Q9YA 3LFBA 3R9DA 3VUTA 2YM3A 2ZVAA 4RC3A 5JGAA 3LHJA 3UQFA 4AXAA 4DFUA 5FTQA 3VS2A 4APCA 4P4CA 4O0RA 3ODYX 4BGQA 3RJCA 4TY1A 4ZY4A 1YDRE 2ONLC 3C0GA 5J9LA 3EZRA 4EZ3A 3COKA 3D7ZA 3HMMA 2X0GA 4DF3A 1J7IA 2OK1A 1U5RA 3OXZA 3DJ7A 3QCXA 4QO9A 4D9UA 3O51A 3QQUA 2NRYA 1RDQE 2GHLA 4MXOA 4PDSA 5E91A 2X81A 5EDRA 4ERWA 1SNXA 4LUDA 2BRHA 1LUFA 1SYKA 4BCNA 4ZMEA 2C47A 3AC5A 3C50A 3V51A 3CE3A 2IVVA 5BUJA 3MPAA 5EDQA 4BICA 4Z7HA 4FKJA 1LPUA 3R73A 3JY0A 4G3GA 1H26A 4P7EA 5JH6A 3QALE 3GU8A 3R21A 4G3FA 5LMKC 2X8DA 3QQLA 3R7IA 4OGRA 4E6QA 4D2RA 3WYXA 4E4MA 2GFSA 3P08A 4FV9A 3FBVA 4XV3A 4I4FA 4EHZA 1H25A 1M7QA 4IB5A 3SXRA 4XNEA 3AMYA 1JWHA 3DA6A 3VS5A 4ZZMA 4IWDA 1RE8A 1WBWA 5A9UA 5GIPE 1CTPE 5D10A 2VO3A 3R7GA 1XHAA 3TIYA 2QOIA 4MXAA 1TQPA 4QYGA 5AP1A 5AUXA 2RSVA 2WHBA 2GNFA 3EQFA 3P7AA 3ZO3A 2OGVA 2RFEA 1IG1A 3FMKA 3NAYA 3UC3A 3ORTA 1YHSA 4EC9A 3QL8A 4RIXB 2ONLA 3UQGA 4JG8A 3KC3A 2O5KA 3AC1A 4FA2A 3ATSA 4ZS4A 2WMWA 4R3RA 5ANKA 3TNQB 4BDKA 3DY7A 5HORA 1XH4A 1OL1A 1AGWA 4X6RA 5F1ZA 2C6MA 3HDMA 2BDFA 3II5A 3R83A 1NY3A 1H1RA 4BGHA 2JITA 5TF9A 3WZDA 3TZ8A 3EWHA 4QMXA 3NMUF 4NJDA 3EQHA 4X3FA 3T9IA 1ZLTA 4GJ2A 4ZJJA 4IZYA 3R6XA 4YO6A 3UOHA 4GVAA 5CQWA 1Y6AA 3NNXA 5E90A 4QMYA 2WAJA 3OOGA 1CMKE 4IAZA 5FTOA 4DGGA 2QR7A 3LFEA 3P79A 4WSQA 5FG8A 4YTCA 2UZEA 4F9YA 5CAPA 5IDPA 3LCDA 3KY2A 3VAPA 4AN3A 2I40A 2W9ZB 4FZ7A 3BHVA 5LVOA 3EFKA 4AF3A 5A6OA 4KIPA 3QZFA 3H4JA 4YGAA 4EOSA 3OFMA 3I60A 4K0YA 3BHYA 5A14A 3I4BA 4KB8A 4U45A 5CU0A 1X8BA 2YM8A 3NSZA 4J71A 2OJIA 4YJPA 3RM7A 2PPQA 1U59A 4U5JA 1H00A 4N0SA 4R5YA 1ZWSA 3ZMMA 5B2LA 3QTSA 5IMEA 5FXQA 2WMAA 3P5KA 1Q3WA 4O84A 1UU8A 2PZPA 3OW4A 4JG6A 3QZGA 2CGUA 4QMVA 1UU3A 1OIQA 3G90X 4OLIA 3BU3A 3SA0A 4O7LA 2HW7A 4PPAA 5HU3A 3NDMA 5BYYA 2I7QA 5IA1A 2BUJA 2QHMA 4R3PA 1ZZLA 5IEYA 3H0ZA 3FLYA 5AR8A 4IAFA 4W9WA 5J7BA 5HG7A 2ITYA 4LRJA 5M09A 5FLFA 3V5PA 2XJ0A 2XYUA 4K11A 4F9WA 1K9AA 1H1WA 2B7AA 3A7IA 3OD6X 3P23A 4KSQA 4S32A 3U9NA 3UTOA 1JKSA 4ZZNA 3TUBA 3SV0A 3RWQA 1WBVA 5G1XA 2OZAB 4AZVA 2VTMA 2WMTA 3Q6UA 4QMTA 5KX8A 3NUUA 5HTBA 3DDPA 3FXZA 4AZFA 2XK4A 4ITJA 4D1ZA 3MN3A 1YDSE 3H9OA 2R7BA 2UZUE 3BZ3A 3MW1A 3FQHA 3Q53A 4ZS0A 5C8MA 4B9DA 2CGXA 3MH1A 3DXQA 4D0WA 3DBCA 2PUUA 2BKKA 4NM3A 3ERKA 3ZU7A 5L6OA 5M56A 1OPKA 4FKRA 4MCVA 3QKLA 5EW9A 2J9MA 4FBXA 4Y5QA 2J4ZA 2C0IA 2X2KA 3KF4A 3KVXA 3PG1A 4CT1A 5BVWA 3ZDUA 5M4IA 5CS6A 3PPJA 1R3CA 3UZPA 5AUWA 5DEWA 3OROA 3L8PA 1H07A 2E9UA 3NZ0A 4FTKA 4RVKA 1YHWA 3IK3A 4FI1A 3ZSIA 3CY3A 3SOCA 2J0IA 1F0QA 4RX9A 3R7EA 1PYEA 2P2HA 4O2PA 4FTMA 1G8SA 2WTKC 4BCGA 5DA3A 3MB7A 5F94A 3VBQA 2VX3A 4GRBA 1DAWA 3RKBA 5IQAA 3ZLWA 4O0XA 4BCJA 4JBVA 3BIZA 3IW6A 2VAGA 4C4JA 3KXHA 5I9UA 2QC6A 3THBA 4XS2A 3I7BA 4BWKA 5L6WL 2W7XA 5DOSA 2ZM3A 2QHNA 4NEUA 2GQSA 5HBEA 2ITPA 2W1CA 3BYUA 1RW8A 5BVFA 3UOJA 5JGDA 3UBDA 4U42A 1G8AA 4KD1A 5A6NA 4XRLA 5AWMA 3U54A 4FGRA 4PPBA 5EFQA 1FMOE 2WIPA 2QOLA 3LXKA 3TIZA 4BKZA 4IZ7A 4GG7A 4QYEA 4AW1A 4CKIA 3Q04A 3ZUVA 4EOKA 3PDTA 3FI8A 5FQDC 1PHKA 3HMIA 4HVIA 2YCSA 3LAUA 5GHVA 3D14A 3IW4A 5EQPA 5AR3A 1JSTA 5J9YA 1ZRZA 2YWPA 4BCKA 4IB3A 2WTIA 2QKRA 2PMOX 4I3ZA 4F1TA 1PXIA 4V0GB 4AP7A 3PE1A 2CDZA 4M8TA 1OKVA 4EOJA 1PXOA 2YCRA 2KULA 3BCEA 4LRKA 4S33A 4GG5A 4UZHA 4YZNA 2BFXA 4YLKA 3W1FA 4FSNA 3EQDA 5IA2A 2YERA 4ID7A 4EH3A 2GDOA 4QP3A 3KXGA 5DG5A 2ZV2A 2R3RA 3HV5A 2WXVA 4AZSA 4FR4A 3ORKA 2FSMX 4D9TA 2I0EA 2V7AA 4NM7A 4A4OA 4E1ZA 5JFSA 4MNFA 5IQDA 2H34A 4IX4A 2WQMA 2BALA 4Y72A 4IE9A 4K1BA 3W2RA 3PIXA 4OTHA 4BIEA 5J8IA 5H2UA 4C37A 3ENMA 4FODA 2FSOX 3AC2A 3QGWA 2UW5A 4ZLOA 3I7CA 3BBTB 3CY2A 4G3DA 4YJTA 4DEBA 2VWIA 3C4FA 3O23A 3U4WA 4TWCA 3HMOA 4Y83A 4MBJA 3NPCA 3P4KA 2PUIA 1PF8A 4B8MA 5DYJA 4APPA 4C3RA 2PZIA 3NAXA 3PWDA 4OTIA 3TNPC 5LARA 3E3BX 3COHA 5B2KA 2NP8A 5B0XA 4E8AA 4DLJA 2NRUA 3A7FA 4RRVA 1UA2A 2FB8A 1XBCA 2ESMA 4LM5A 2XK3A 4BKYA 4AT4A 2QG7A 3PIZA 3H9RA 4DH3A 4YZDA 3PSDA 5EM8A 3R28A 2WMBA 5CVGA 2XK7A 3HKOA 3E3PA 3IW5A 3LCKA 2Y4IC 3C51A 3UNJA 5J1VA 4EOIA 2HELA 4BI2A 2WQEA 5EKNA 2PULA 5E8XA 4BCPA 2A4LA 4MVFA 5T6KA 5HD4A 3GVUA 3BHTA 1TQIA 4RQVA 2XK9A 2W4KA 3HEGA 2QD9A 2VTAA 3LJ1A 1MQBA 4GU6A 3FMDA 4P2KA 1OM1A 4C58A 2CKEA 1BYGA 4BTMA 2QQ7A 3D5XA 5CYIA 4RFZA 4B6LA 4DG0E 3PVBA 3K3JA 2R3IA 4M66A 4QP8A 4ALWA 5JRQA 2R2PA 3F66A 4CTCA 4NW6A 4IXPA 4DCEA 1P5EA 2W1GA 2C3JA 3R7YA 4C57A 4ZY6A 4EZ5A 3A4PA 3ZZEA 3MESA 1YHVA 3F3TA 4UYAA 2O3PA 4QPMA 4D5HA 3DNDA 4X0MA 4ZLYA 3R8PA 1PRYA 1JKLA 1XH5A 4QPAA 2W06A 3RINA 5CEQA 1URWA 1YOJA 3PG3A 5IH4A 4JAJA 2BHHA 2YFXA 4JI9A 5CQUA 3O71A 4JR7A 4AOJA 3TCPA 4K9YA 1KE6A 4FTLA 3ACKA 4C62A 3C4ZA 4Y5HA 4YO4A 3G15A 4U0IA 4AZEA 4FIHA 4M15A 3ALOA 2ITZA 3P9JA 2A1AB 3PXYA 2HAKA 2XNEA 4KINA 4RIWA 5M51A 3MH3A 5EW8A 3CC6A 1CKPA 4CG9A 3LZBA 4PTEA 3LQ3A 2VGOA 2ZV7A 4RVLA 4A4LA 4AQCA 3CGOA 5EM6A 2VTIA 3FDNA 3MB6A 3ZFYA 3NNVA 4F7NA 1FBNA 2X6EA 3N51A 4KRCA 2C5XA 4LV8A 2IW8A 4RWLA 5HU9A 4DFYA 4FEWA 5EQEA 2ZDUA 2I0HA 2YZAA 1YI3A 2BTRA 3AT4A 1J7UA 5E8UA 4CV8A 4EOMA 3EL7A 3PXQA 4M12A 3FMNA 2GNGA 3EYHA 1XH7A 3NUPA 5HE0A 4QTEA 4NIFB 2Z60A 3JUHA 4I23A 5IA0A 2WQNA 2ERZE 5G6VA 5E4HA 3NRMA 4RWIA 4ZTHA 5I9WA 2ZM1A 4O7NA 3IW8A 5AUUA 4TN6A 4BCIA 3FHIA 4DINA 2OF2A 3ZYAA 2O0UA 3OT3A 4UMQA 2F2UA 4UYNA 1Q24A 3V6RA 5AP0A 1Q5KA 4RX8A 2Q83A 4BDIA 3HV3A 4EJ7A 3MTLA 3S00A 2X4FA 3E62A 3DLSA 3RP9A 1OIYA 2JC6A 2PE0A 5HLWA 2V5QA 3QLFA 3A2CA 2XBAA 4MK0A 4ZSLA 3AGLA 3V5LA 4DC2A 4I4EA 4J96A 5HX6A 1GY3A 4II5A 4F7JA 3ZONA 5HE3A 5JZJA 2CCIA 2W17A 5HHWA 1FQ1B 4BIDA 4W4WA 2R3JA 5IZFA 3QUDA 1SVGA 3VS6A 3C4WA 3IGGA 4JL9A 3LCSA 2CKQA 2CGVA 4MNEB 3FYKX 4O7RA 4AZTA 5E8ZA 3DZQA 4QTCA 3LM5A 4Q5HA 4DEDA 5KMNA 5CEOA 4FT0A 5CF5A 3DAKA 4TTHB 4IHPA 4EYMA 3V6SA 1WZYA 2FVDA 3F5UA 3FI2A 3GU4A 3S0OA 4QMWA 4ACDA 2PU8A 4PWNA 3RPOA 5AAGA 2XH5A 4E6DA 4FTAA 1M2QA 3BYSA 3R8VA 1ZYDA 3IGOA 1ZY4A 4G6LA 5ANJA 4IZAA 2OXYA 3RHXA 1P2AA 4XEYA 1T46A 3VN9A 3ZBFA 4PX6A 4DT9A 1PXKA 3IO7A 4RBLA 1Q8TA 1Y8GA 2UZBA 4FSUA 4J98A 4TYGA 4YP8A 5HBHA 4HVHA 2YLEA 5CEPA 1YXXA 3HNGA 2R3QA 3QYZA 5L8LA 4YJNA 4G9RA 2R9SA 2RFDA 4HJOA 5KUPA 4FIGA 4DEHA 2WU7A 3EB0A 1WVYA 1Y91A 2VTOA 2PK9A 4NL0A 2W05A 3A7HA 4D2PA 3TNWA 4BBFA 4EH5A 3TM0A 4ONAA 5IMXA 2QOFA 4O0SA 3U6HA 5KE0A 1GJOA 1ZAOA 2JLDA 3ZO2A 3IECA 3V8WA 3DB6A 4FTOA 4KIQA 3SRVB 3DBDA 4QNAA 3E92A 3I5ZA 4IAKA 4W9XA 3GEQA 1OKZA 2GSFA 3MH0A 5HZNA 4HZRA 3KXNA 4QMZA 2HWPA 2AYPA 3R1SA 4P5ZA 4FKUA 2WPAA 4QMMA 5H3QA 4L46A 4IM2A 1H28A 3PA4A 5A54A 2HIWA 4TYJA 3RAWA 4DFZE 5M53A 4PP9A 2ITQA 2IG7A 3KF7A 1T45A 2J7TA 4IB0A 4QYFA 1YI4A 4NM5A 1TQMA 1YWVA 3IQ7A 1CDKA 4NU1A 3EKKA 4IH8A 1P14A 5C27A 4FG7A 1R0PA 4RX5A 3D7TB 4HGSA 4MQ2A 3TV7A 4DGNA 2WEVA 3QRUA 5K5XA 5IQHA 4I92A 3E8DA 1S9IA 2HZ4A 4FL1A 3FPQA 4FK6A 3V5WA 3VW8A 4AGUA 1WBNA 1Y8YA 4UXQA 2B4SB 5FEEA 5LWNA 3GENA 1VEBA 5JN2A 3BBWA 5J87A 1FMKA 4KBCA 3TXOA 3KA0A 4KRDA 3FKOA 4CFWA 3DU8A 3HA8A 1QPJA 2R3KA 4G2FA 1ZOHA 3BKBA 4GFOA 2C6TA 4CFNA 1PXPA 3MA3A 3ULIA 3HECA 3B8RA 3ZXZA 4FSMA 1XH6A 3VUKA 4F99A 3FUPA 5HESA 1KWPA 1FGIA 4O96A 2C3IB 3CSVA 3PJ8A 4MWHA 1YXSA 3ZTXA 4ACMA 4CFXA 3C1XA 5CEKA 3O8PA 4GKHA 5GJDA 2QKWB 4BHZA 4Z55A 1ZMUA 3EKNA 3KXXA 4U79A 4BCFA 5H9BA 2WKMA 3WZKA 1PXLA 2W99B 4FKSA 3VRYA 1MRUA 4DBXA 3AT3A 4FICA 4FSRA 3DTCA 3G9LX 3MVJA 3NW5A 4LGHA 3UMWA 2JKKA 2UUEA 4FOBA 1VJYA 2GPHA 4F70A 3KRJA 3TJDA 1JKTA 2J2IB 4D0XA 5A4EA 2FUMA 4FEVA 3ULZA 1YXVA 3IDCA 2FYSA 4FNWA 5M4UA 3PTGA 2G1TA 4C4GA 1WMKA 4G16A 1XQZA 2BMCA 3MYGA 4H1MA 2GNJA 1XR1A 2O64A 3OEFX 3NW6A 4ASDA 3EN7A 4ZTSA 3VO3A 4PPCA 1NA7A 5ACKA 5KBQA 4WOVA 5KKRB 3FMMA 5FP6A 3JY9A 3NUAA 5D41A 4RIWB 3QX2A 4F08A 1J7LA 3FZOA 4RT7A 5FDXA 1SVEA 1WVWA 4JT3A 1VR2A 5F20A 1O9UA 3GB2A 3QYWA 4G3CA 5CI6A 2GS2A 2UVYA 4P5QA 3ZUTA 3M1SA 5CANA 2C6LA 2IZTA 4H1JA 3D4QA 3BQRA 4OW8A 2P33A 4C4EA 2Y9QA 2OZAA 5CT0A 4D4RA 4YURA 1WBOA 1XBAA 4WNPA 5DGZA 3Q5ZA 4UB7A 3POOA 4R7IA 4AZWA 4ACGA 2CN8A 3OT8A 4DFLA 5M4CA 3H9FA 3F3VA 2YWVA 4HPUE 3FI3A 3HRFA 3Q4TA 4WNKA 3VC4A 4DLIA 2EUFB 2OH4A 5LXMA 4MTAA 4MXXA 1GZNA 2OF4A 4LI5A 4F7SA 2FH9A 1Z57A 1ZXEA 4DN5A 4YSMA 1TKIA 2UV2A 4GH2A 3ZLYA 3P0MA 3KQ7A 4O38A 5FBOA 3FLSA 4XG2A 4WNMA 4ACCA 4FL2A 4IIRA 4G5JA 4KUJA 5LVNA 4CEGA 4NZWB 1OL5A 4M69B 3OUKA 3RTPA 4JNWA 1OBGA 2CSNA 2HYYA 2VWXA 3U4UA 4LOPA 3PJ2A 4FT7A 2Z2WA 4AA5A 2X8EA 4R78A 5KHXA 3BLQA 4TYEA 1Q8ZA 2YABA 3FMJA 2H8HA 2W4JA 2R0UA 3W16A 1Z5MA 5HG9A 2Z02A 2YDKA 4BTJA 2GCDA 3BX5A 3I1AA 4RIYB 1PXNA 3DTWA 2IZSA 3FXXA 4TXCA 5KHWA 3U87A 4N57A 2J0JA 2UZNA 4YZ9A 1H24A 2QLQA 3TT0A 4C7TA 5K0KA 2VO7A 1KE7A 3H10A 2NNWB 4GK4A 1YW2A 3SXSA 3FLQA 4MXCA 4O91A 3R22A 4OAUC 1GNGA 3IOKA 4WO5A 3AMBA 2XIZA 2UW7A 3QQKA 5FBNC 5IA5A 4RJ4A 4JX3A 3GNIB 4YTHA 4ZEGA 4UN0C 5BUEA 3E8EA 3QU0A 5CF6A 3MPMA 4KWPA 2C5VA 3PVWA 2Y6MA 3C4CA 5EHOA 4O0YA 3ZUUA 3BLRA 3K3IA 4KIKB 5AUTA 3CIKA 5E8VA 2AC5A 1MP8A 2YAAA 1GZKA 1Q41A 1PMUA 3DAJA 4G6OA 4WD5A 5DRBA 5HCYA 4EK5A 4XX9A 4QP4A 4BYJA 3PA5A 4BI0A 3LKMA 4FNYA 1DAYA 2QOKA 2RIOA 4EEVA 2Y4PA 5A4LA 3TWJA 3F5PA 2W5BA 1KOAA 3DZOA 4OBQA 4TWNA 4W8EA 3WF9A 3QRJA 1YOLA 5ANGA 4ZP5A 1JNKA 2HZIA 5TO8A 4GCJA 4V0GA 3CD3A 4N70A 1ZYLA 2JD5A 4BDCA 4F0FA 3OXTA 4DTKA 4X3FC 4AFEA 2OU7A 4GFGA 4EI4A 2CNQA 2UW8A 2IO6A 3D94A 4XH6A 1BKXA 3PLSA 5JEBA 2YACA 3HVCA 4ANLA 5I0BA 2RGPA 4G6NA 4FV5A 1ERKA 4EC8A 4PP7A 3LFCA 2RFNA 2VTRA 3K54A 3GU5A 4L00A 3UZTA 5DIAA 2GTMA 2XJ1A 2YITA 3EFWA 5GJGA 3CD8A 5ACBC 3FL4A 4BN1A 2BDWA 4EWHA 4I93A 5AV2A 3QF9A 4JXFA 1JKKA 1YRPA 5LQFA 4O7TA 3F3ZA 4UWCA 4YC6A 5E8SA 5JFWA 3NCZA 2F2CB 3HAMA 3H30A 5HIEA 2ZMCA 3LPBA 4IDVA 3HV6A 4MHAA 3UVRA 3GU7A 4RGJA 4E20A 3L8VA 3LXLA 4I21A 5DR9A 3EN9A 3D2IA 4NKSA 4B4LA 1ZYCA 2R3OA 3PPZA 1K2PA 3BYVA 4UV0A 2OIDA 4G17A 1Q62A 3HMNA 5HVJA 2W96B 3R2BA 5L2QA 2VNWA 4QMQA 1OECA 4WBBB 4J8NA 1XO2B 3NUYA 4U43A 3BRBA 5JFVA 4OTDA 4GVJA 4ANQA 1IA9A 5KO1A 3S95A 4BZNA 3V5TA 3QAME 4X2GA 4ZTNA 4NJ3A 4TZRA 4GMYA 1H01A 2XNOA 4LMUA 3S2PA 4YLJA 3EQRA 5K9IA 4EORA 3R01A 3AXWA 3BGZA 2ACXA 4GU9A 4ZSJA 2VD5A 1Q99A 5IISA 4JRNA 4C4HA 4MXYA 2JIUA 2F9GA 2VWVA 3CGFA 1SVHA 4OTPA 4B0GA 2JIIA 4ENXA 5E1SA 3V3VA 2GU8A 2H96A 4IAYA 4PL5A 3UOLA 3C13A 3BGPA 3ORNA 1Y57A 4V05A 4ANNA 2W1FA 2BAQA 3RCDA 2OICA 1XBBA 3V04A 1QMZA 4RA5A 3L9MA 2PL0A 4BGGA 3UO4A 4EKLA 2JGZA 4G1WA 4YJVA 2PVHA 5M55A 5HTIA 4ENYA 3PVGA 4FKOA 4J97A 4IW0A 4W4YA 3LMIA 2CMWA 3C5UA 3BE9A 4YJOA 4XG6A 1LEZA 3FMLA 4Q9SA 3Q9ZA 5IUHA 4JR3A 1O6YA 2RKUA 3O96A 4QQCA 4M14A 4GT4A 4JS8A 2J0LA 4TPTA 3GCSA 2QI8A 4I94A 4YC8A 5M07A 4FV1A 4O7WA 3GP0A 4U97A 3WF5A 5BVEA 1IR3A 2HXLA 2VO0A 2BVAA 4BIBA 3NUNA 5GINE 2JAVA 4HZSA 4GYGA 1R0EA 5FRIA 3CCNA 3V5JA 3TEIA 1V0OA 2GQGA 3SLSA 5M08A 5C26A 2QURA 2PVNA 1OKYA 2EB2A 2SRCA 4W4XA 2AUHA 2IZRA 3Q2MA 2VTLA 4IEBA 4I0SA 3FY2A 4CKJA 3G0FA 3DBEA 3WI6A 3QC4A 4HYSA 5L2IA 1ZZ2A 5JGBA 3FI4A 4D5KA 5IPJA 3CQUA 1W7HA 2C1BA 4KNBA 1WBPA 3ZFMA 3CR0A 4IX5A 4JDJA 5HLNA 4XUFA 3OTUA 4TKSA 4ANMA 2WMUA 2PE1A 1O6KA 2VTHA 4IX3A 1F3MC 4C8BA 4IANA 3UG2A 3UJGA 4JDHA 4R1VA 2B0QA 4H3BA 4W8DA 4NFNA 3KMWA 4HCVA 4YZBA 3R9OA 4GKIA 4MD7E 5HCXA 3ZEWA 5AEPA 2CN5A 4NIFA 4D58A 1WBSA 3OBJA 4BDAA 3GOKA 4R1YA 4MKCA 4KABA 4UXLA 3HYHA 4FZFB 2FO0A 2XF0A 2OBJA 3NS9A 4ZSEA 5B2MA 5JFXA 3SVVA 2YZLA 5AM6A 1L3RE 2EXMA 1FVVA 2QCSA 2WU6A 3EIDA 3R63A 4KS8A 5GJFA 4IFCA 5LJJA 3TL8A 3ZBXA 5AA8A 3KL8A 3DKFA 3T3UA 4RC2A 4UALA 1V0BA 4R3CA 3SX9A 3MFRA 4J53A 5LOHA 4AUAA 2OJGA 4UWBA 1APME 4WA9A 5M06A 4IM3A 4I5PA 1M14A 4GEOA 3MY5A 4O7VA 4HNFA 4FUYA 1JOWB 4Z9LA 2ITVA 4FNXA 4IWQA 2W1DA 2YN8A 3BYMA 3MJ2A 2Z7SA 5DBXA 3LCTA 5J5TA 1VYZA 5IEVA 3KVWA 2BCJA 3TTIA 4G34A 3GBZA 4DYMA 5FM2A 1PKDA 2YM7A 2OH0E 1U5QA 4MNEA 3E7VA 3P7BA 4N6YA 4K6ZA 4YTIA 3VBXA 5KNJA 2O63A 4DTBA 4C36A 4RX7A 1PMEA 4FSZA 1UNHA 3UQCA 4AX8A 3L9LA 3NGAA 4NFMA 5LVPA 3QRTA 3FHRA 2ZDTA 5JT2A 3UO6A 4QMOA 4V04A 2XZSA 3SW4A 3TDVA 2YCQA 5ANDA 5D12A 2R3MA 2WFYA 1Q3DA 5C03A 4NK9A 3OY3A 3BPRA 3V01A 4FEQA 3QXOA 2PTKA 2UW4A 2BTSA 4CNHA 4WKQA 4C3FA 2YM4A 1YI6A 2VWUA 2ITOA 2C0OA 1QL6A 4BFMA 5HE2A 3QKKA 2WMVA 5DT4A 2EU9A 3QLGA 2X9EA 1J3HA 1UKIA 4FSYA 3WBLA 2V62A 2YIWA 3LM0A 3PWYA 4I6HA 2PY3A 4YBKA 3C7QA 4EOQA 4DBNA 3AC4A 2XB7A 3DQWA 4L3LA 4AACA 5JSMA 3SW7A 2YM6A 3PSBA 3R9RA 2UZVA 5CAUA 2CLQA 5CX9A 2XM9A 5IH5A 5EM5A 2Z8CA 1IEPA 1U54A 3DNEA 2VTJA 4K8AA 3WYYA 4ALUA 4L3PA 5CAQA 3UP7A 4RJ5A 1ZYJA 4OTWA 3V8SA 3AC8A 4JDKA 2RL5A 5FEDA 2W1EA 3EN5A 1Q8WA 5HI2A 3SQQA 2C30A 1YWRA 4K77A 3SRVA 4F9AA 1O6LA 4O7SA 3MH2A 1YQJA 4O2ZA 2IW9A 4DITA 3OS3A 5L3AA 4NTSA 2JIVA 2VX1A 4BCOA 4GW8A 4BDDA 1CM8A 3PJ1A 2VWBA 4NWMA 4EYJA 2QG5A 3A7GA 3BWJA 4I0TA 4F64A 5A4CA 5KMIA 1YWNA 2W5AA 4L68A 4QNYA 4O1OA 1R1WA 3OY1A 4JQ7A 4LOOA 4UX9A 3SC1A 3B2TA 1W0XC 2UW9A 3NLBA 4FZAB 4GUEA 4XLIA 4AA4A 4AT5A 4M97A 5JK3A 2QONA 3Q52A 2J50A 2J51A 3G6HA 2JDVA 3D7TA 4C2WA 4ZJVA 1UWJA 4JBOA 1SM2A 4FTNA 4PTCA 3V5QA 4BYIA 4IAAA 2C68A 3BU6A 3R7UA 3ZC6A 3ETAA 4ACHA 3IPHA 1OL6A 4YJSA 4E5WA 3ZSGA 3CXWA 3O7LB 2BRBA 4PNKA 5EW3A 2H9VA 2VNYA 3FC1X 3N4UA 5HKMA 4WG5A 4BDGA 4XJ0A 5AP6A 5AP3A 3O8TA 4WSYA 2IN6A 4ZTQA 4F4PA 4YU2A 1QPCA 4IWPA 2W1HA 5I9ZA 3ODZX 5A4TA 3QCYA 4QP6A 4LUEA 5CNOA 1EH4A 1OZ1A 4U40A 4EH6A 4AN9A 4NCTA 1CKIA 4XOYA 3RAKA 3N4VA 5KCVA 2HY81 3A60A 3JYAA 3QTRA 3W10A 1Q8YA 3ZEPA 2F7XE 5IA4A 4X6QC 5HVKA 2VUWA 4CFVA 4X3JA 4XV2A 4Y46A 3DXNA 4HNIA 2B9JA 3UPXA 2HZ0A 4MQ1A 4O82A 3H0YA 5DLSA 3KK9A 4HCUA 2I0VA 5CTPA 3QKMA 4FV0A 3OG7A 4XP0A 3AT2A 3SHEA 4JIAA 3B2WA 4FV3A 2XRUA 3KCKA 3NIEA 1R39A 2WMSA 4YR8A 3F5GA 5L8KA 2CNUA 5FTGA 4R6VA 2XCHA 3NVKI 3R9HA 2BIKB 2BZIB 3W55A 4PRJA 1IAHA 1YXTA 1V0PA 2VWWA 3FKLA 4XG3A 5ETIA 4DG2E 5KMKA 4N4SA 1FINA 2OZOA 3TUCA 5JZNA 5IQGA 5D1JA 4FKWA 1ZOGA 4WHZA 1BX6A 2CNVA 4EUTA 1OI9A 1KE9A 3K2LA 2UZLA 3ZO4A 4ZIMA 4PMTA 3U51A 4B8LA 3VBYA 4AGCA 4E73A 3PUPA 3PVUA 3R8LA 4BI1A 2R3PA 1WBTA 1H1SA 3VJNA 4FKQA 4CZYB 3RPSA 5C1QB 3DKGA 4ZAUA 5GZAA 5IUGA 2JKOA 1PJKA 1Q4LA 5CENA 2YHVA 3DQXA 4AOTA 2W4OA 3HZTA 3IOPA 3KRLA 4EK6A 5J95A 3QD0A 2B9FA 3DGKA 1M2RA 3TV6A 2RG5A 5AR7A 3CTHA 4BWXA 3QCSA 5HCZA 3OEZA 3GOPA 3K5VA 2FGIA 2WOUA 3QTXA 3CLYA 4E6AA 1YKRA 4AG8A 5AP2A 3UNZA 1WAKA 5KMLA 5L2SA 1YVJA 3KXZA 3QZIA 3FY0A 4X2KA 1OMWA 4IAIA 3AD6A 3FMHA 3M11A 5HE1A 4EQMA 4Z16A 5L4QA 3UNKA 3RPRA 4AFJA 2F49A 2CGWA 3R1YA 4CMTA 4RJ3A 2FA2A 2XNPA 2P4IA 3RK7A 1FVTA 4BHNA 3MDYA 3F3UA 2LAVA 4BRXA 5HIDA 4ALVA 2BZHB 5DI1A 4DH8A 4YJRA 5LCKA 2XM8A 4DFXE 3VJOA 2UZDA 4QQTA 1M7NA 2DUVA 5IUIA 4BDHA 1SMHA 4M69A 3HP5A 4X2FA 5KMMA 4AT3A 1R78A 4FV2A 1BL7A 4PDPA 4CXAA 3DCVA 4X21A 2GHGA 4KBKA 4Y73A 3GFWA 4ANSA 3ID6C 2PVKA 4C35A 2CHLA 3KULB 3WF6A 4O83A 3BE2A 4RLKA 4AW2A 3FZTA 4FTJA 2XIRA 5DT3A 4FIJA 4EH9A 1NT2A 4ANBA 4RIYA 5GNKA 5FXRA 1E9HA 5CI7A 5GZ9A 4L45A 5GZ8A 2IVSA 3RALA 3QHWA 3ZZWA 4F6UA 2XJ2A 5JMSA 5TOZA 5M44A 3NYOA 2YCFA 2WMQA 3MVMA 4AGDA 3ORPA 1KE8A 2I6LA 2JFLA 4OTFA 3MIAA 1Q97A 4EOPA 4F6WA 2B9IA 2C0TA 4J1RA 4R5SA 4WBOA 5EOBA 4BTFA 4UMUA 3OOMA 3O0GA 1F5QA 3PRIA 3Q60A 2J90A 4R7HA 4CFMA 5AJQA 3C4EA 2C69A 4YHJA 4L43A 2OFUA 3MFSA 4EOOA 2PYWA 3G33A 3G9NA 4KIKA 3I5NA 4OTGA 3KXMA 4BDBA 4E93A 2JDRA 2QOBA 1SNUA 4PMSA 3A62A 2GS7A 2BIYA 4HCTA 2IWIA 3NX8A 3R8ZA 3C0IA 4I22A 4D2WA 4XCUA 5AP7A 4PNIA 3BLHA 4H3QA 3MBLA 1KE5A 5T68A 1RQQA 1NXKA 5EI2A 4F6SA 1FPUA 4Z3VA 3E93A 1W98A 3RMFA 4ZTRA 3G0EA 3FE3A 2IVTA 5J79A 2J5EA 4FYNA 2ITUA 3HP2A 2C5YA 1U54B 2ZM4A 5M57A 3WIGA 5H8EA 3F2RA 3O50A 4JIKA 3F2NA 3L1SA 4AW0A 4QQJA 4WIHA 3OUNB 3W2QA 3VUGA 4DH5A 3NUXA 2WMRA 3R00A 2CLXA 4BC6A 5CWZA 4M0YA 3V8TA 2VN9A 3FZRA 3KMMA 5AAFA 3RNIA 2R7IA 2YIYA 4GL9A 2JDSA 1KOBA 4HPTE 2JEDA 5EKOA 1LP4A 3G6GA 2XKDA 2HCKA 2X7FA 4IZ5A 1V1KA 2V22A 3S4QA 3UG1A 4JQ8A 4D28A 3E63A 4O0WA 2WTKB 3F88A 3ORLA 3PY0A 5CSXA 5DR2A 3VUHA 4BB4A 3GC0A 3CQEA 3QFVA 4CCBA 4MD9E 2X39A 1U46A 2C6IA 4L01A 5H8BA 3PJ3A 2XNBA 3QQGA 3ACJA
chains in the Genus database with same CATH superfamily
4A7CA 2ZYBA 3SG9A 3FV8A 1JLUE 3LFDA 3RWPA 3VS0A 3F69A 4FGBA 5HO7A 2G2FA 2G2IA 3I6UA 3BEGA 3UYTA 2BR1A 5IQIA 4C3PA 2HW6A 4FTCA 4K18A 4EQCA 2XNNA 4I5CA 4L53A 3GQIA 4LQMA 4LRMA 3IS5A 2ETKA 3RZBA 4F1OA 4UMRA 5E1EA 1DM2A 1E1VA 3EQPA 4IVBA 2P0CA 4P90A 4UMPA 2E9VA 2VWYA 3GCPA 4EKKA 4UBAA 5CZHA 3KREA 5D7VA 3I79A 5L2TA 4ZK5A 3MIYA 3TZ9A 3TUDA 5AP5A 1DS5A 2OJJA 3CPCA 5AUVA 5IH6A 2F4JA 3OCTA 4EZ7A 5BVNA 4H58A 3OCBA 2CKOA 5CALA 3MFTA 3R04A 5EHYA 4XG9A 3PZHA 3KB7A 2I1MA 3ANRA 3Q32A 2UVXA 3T9TA 5BNJA 1OIRA 4MAOA 4AN2A 3R8MA 4LL0A 1XWSA 3W33A 4BWPA 4IB1A 4H3PA 5CLPA 5A46A 4BJJA 3LIJA 4J8MA 4IC7A 3UZRA 2UZWE 4L6QA 5DNRA 4ASEA 3CTQA 4CRLA 4KIOA 2EXEA 2WTWA 4FKTA 2PZYA 5IA3A 3KIOC 3L8XA 1QPEA 4HYUA 4GYIA 4KBAA 3R8UA 4FJVA 1W83A 3EFJA 4MD8E 3BYOA 5C4LA 2XBJA 3QD3A 4CLJA 5CSHA 2X7GA 1TVOA 3KU2A 3DV3A 4USDA 3WE8A 4F9BA 5F95A 2OI4X 2Z7QA 3LE6A 4RWKA 3TKHA 4QMUA 3PUFC 4BZOA 1OGYA 2C3KA 4QTBA 4WNOA 4DE4A 4JJRA 5EYDA 4CFUA 2O8YA 5HO8A 4ASXA 1OKWA 4D4SA 4DEIA 1J91A 3JPVA 3E8CA 3A8WA 5LWMA 4O0VA 4XP3A 5BYZA 3ZH8A 3COIA 4PDYA 5CVHA 4F0IA 2J0KA 3OF0A 3ANQA 4HGEA 4QPSA 5ANOA 5TKDA 4BCMA 2GNHA 4DA5A 1CSNA 3F2AA 3PIYA 3E8NA 4FTUA 2WQBA 4L42A 4TWOA 3UVPA 4A06A 3UO5A 1WFCA 3TACA 4FV7A 3KRXA 4CZTA 4U8ZA 3D83A 3DK6A 4DGOA 3FZPA 4QYYA 2VU3A 3S3IA 2HXQA 1STCE 4LV7A 3HGKA 5J7HA 3UMXA 4QP1A 4EJNA 3IKAA 3EN6A 5CF8A 3ENHA 4AGWA 4PL3A 4USFA 2PWLA 3FLNC 2YDJA 3RK9A 3SD0A 4AE9A 4LL5A 5ANIA 4L9IA 2PMIA 2VWZA 4DEEA 3ZRKA 4NM0A 4CRSA 4BKJA 1RJBA 2WNTA 3OVVA 2NYAA 5HVYA 4OT5A 4JLCA 2JDTA 3PP1A 3RK5A 2UW3A 3DXPA 4GK2A 2VV9A 2W9FB 4G9CA 4NSTA 2WMXA 2GNLA 3VIDA 4QMPA 2QOHA 2UVZA 1ZOEA 4IC8A 4YPSA 3TN8A 3U6JA 4BDFA 2P3GX 3DLZA 4G31A 3RHKA 4D4VA 3P1AA 4RVMA 2WD1A 1FVRA 5EM7A 4FVQA 5KZIA 4MX9A 4JRVA 4TWPA 2XK8A 5FGKA 3RGFA 5B7VA 4FKGA 4IWOA 4ZY5A 4DHJA 5CSWA 4D1SA 5DMZA 3W0OA 5EYMA 4KKGA 1H27A 4YTFA 4ZJIA 1DI8A 1JVPP 2V55A 3U9CA 3KCFA 3L8SA 3OXIA 3R30A 3R02A 5AMNA 3PPKA 4GUBA 2RFSA 3AKJA 5FUTA 1ZMWA 3VS3A 3ZHPC 4M68A 3D5WA 3WARA 4AAAA 1KV2A 5BVKA 4K33A 1PY5A 3W2CA 4CZUA 3RBWA 1OL7A 4CQEA 5C8NA 3R7VA 5D11A 3DBQA 4AU8A 3OWLA 4FV6A 4YNEA 5ITAA 2F57A 4Y8DA 4M7IA 1PXMA 4JG7A 4KA3A 4LFIA 1OPLA 1MRVA 3QUEA 4IFGA 3TNHA 4FSTA 4H05A 4AE6A 2NO3A 2QNJA 1ATPE 3QWKA 4YSJA 4GK3A 3LW0A 4RFMA 5EG3A 3W2SA 3F5XA 2A0CX 3LMGA 3Q4CA 4OTRA 4ZSAA 3F3WA 4FT3A 5LVMA 4FG8A 4Y95A 4JBQA 5CAVA 3DK7A 4IJ9A 4O1PA 5AV4A 3IONA 4BZDA 2VTTA 1J1CA 3EOCA 3EQCA 4O86A 2R3FA 2BAKA 1UV5A 2C6DA 4C2VA 3GUBA 3ELJA 5IQCA 4QP2A 2YIRA 5BUIA 4OAVB 2ZB0A 3I81A 3CS9A 4QYHA 3SG8A 2HZNA 2VGPA 4A9UA 4MBLA 1GOLA 1W2FA 5CT7A 2PVYA 3FZ1A 2ETRA 3F82A 5E92A 5C01A 4CYIA 4D2SA 1A48A 2VX0A 5L6PA 3ITZA 5T3QA 3DJ6A 3PP0A 4BCHA 2CJMA 1B38A 1PKGA 3PRFA 1REKA 4ZSGA 4FIIA 1QPDA 1UU7A 5DEYA 4GFMA 4ASZA 4Z7GA 4YMJA 2ZMDA 3Q9XA 2RF9A 5AUYA 2ZOQA 3VS4A 1HOWA 3BHHA 4BL1A 3CKWA 3FQEA 3TTJA 2XEYA 2W5HA 3W8QA 5DR6A 3VUDA 4M84A 4ZXTA 2O2UA 1BMKA 3CPBA 4CMOA 2WB8A 3CJGA 3WZUA 5J1WA 3T8OA 4I1ZA 1J1BA 5CAOA 5ETFA 4A07A 2OFVA 3GXLA 1UNLA 5HNGA 4EHVA 5AAEA 3A8XA 4YZCA 3SAYA 5CU6A 3ZDIA 2C5NA 2GNIA 4UMTA 5CZIA 3ORMA 1YDTE 4O4FA 2B53A 4PL4A 2WZJA 4CLIA 2QODA 3UIMA 3MTFA 4D4YA 1PW2A 3AD5A 4FF8A 2J5FA 4IVAA 3HX4A 4XBRA 3ZFXA 3DK3A 3WE4A 3VHEA 4JAIA 3TNIA 2WTJA 4O0TA 4W4VA 5J9ZA 4C02A 5FM3A 3U55A 5I4NA 3MWUA 4NYEA 3OW3A 3Q9WA 3ML1A 4R77A 2XKCA 4FV8A 3R7OA 3RI1A 4E5BA 4E3CA 1LEWA 3EYGA 2X2LA 3R2YA 3HRCA 5C4KA 4HGLA 4R8QA 3D2KA 4F63A 4IADA 4EOLA 5FP5A 4FTTA 4RJ6A 3Q4ZA 3TI1A 4FTRA 3ZM9A 3UVQA 4CD0A 2C1AA 4EK8A 4DEGA 5AFVA 3W2OA 1OIUA 4CFFA 2XMYA 3R0TA 2G15A 3K5UA 2VTNA 4ITIA 4MH7A 5HGIA 5LMKA 3P86A 2JBPA 5AUZA 4EONA 3H3CA 5HX8A 3UIXA 3VS7A 3VBVA 4RFYA 1WVXA 3W32A 4QD6A 2VTQA 4JMQA 3RAIA 3WZJA 2XARA 1MUOA 2IVUA 1GIHA 2ZV9A 3UDZA 1H4LA 4NT4A 1IASA 1ZYSA 3DFCB 4KAOA 4O21A 3VBTA 3QTIA 4AXDA 4DTAA 3QBNA 4FMQA 2ITTA 3IW7A 2Z7RA 4EH7A 4TYIA 3BWFA 1Y6BA 2JKMA 3CQWA 3PXFA 5JKGA 1OVEA 4G5PA 4EH8A 3RCJA 4E4XA 2DWBA 2C4GA 4C59A 1GIJA 1REJA 4QMLA 5EHLA 1H1PA 3E64A 3ZSHA 3VHKA 1HCKA 3DJ5A 5DHJA 3JR1A 2XVDA 4QTDA 4IVDA 5AP4A 2PVRA 3EZVA 3VNTA 2BRMA 4GS6A 2EXCX 4JVGA 3VF8A 4FIEA 4E26A 4F09A 5CF4A 4O6LA 5HICA 3WIKA 4DGMA 3FAAA 4DH7A 5FD2A 3R9NA 4Q9ZA 5CXZA 5IU2A 1XKKA 3DBFA 3DPKA 1YXUA 2R5TA 5E8TA 2WOTA 3W0PA 2DQ7X 4PTGA 3DS6A 4FVPA 5A4QA 5CNNA 3AG9A 4EK3A 2JFMA 5DPVA 2BDJA 3Q96A 4FZ6A 3FL5A 3GU6A 4I41A 5EDPA 3GT8A 2BRGA 2E9NA 5BYLA 5FWKK 2VTPA 3UGCA 4DH1A 5EQYA 2E9PA 5HNBA 4O7YA 3FZSA 2QO7A 4IMYA 3MY0A 3QTZA 3GI3A 4H36A 4RLLA 3A61A 4L7SA 3KULA 3WILA 3QX4A 2IW6A 4U44A 2XK6A 4IACA 3QTWA 3QTUA 3CKXA 3RNYA 3F7WA 3I0QA 2AC3A 2XIXA 4YPDA 3KFAA 4AA0A 2B1PA 5LMBA 2HWOA 3EH9A 2YAKA 3NR9A 3CBLA 3PYYA 4Q5EA 4UY9A 4CG8A 4M13A 3FJQE 4TW9A 1S9JA 2XEZA 1GZ8A 3D5VA 3COMA 3PA3A 4FZDB 4FV4A 2ZB1A 4NUSA 5HBJA 1VYWA 3HRBA 1SZMA 1LR4A 4RSSA 3NCGA 4XV1A 4BF2A 3NVMB 1G5SA 5JRSA 4CT2A 3TDWA 4NTTA 2GTNA 3VONA 3QHRA 5CEMA 3BGQA 4J95A 5D9HA 1A9UA 2X2MA 3AGMA 4EWQA 3ZXTA 3W2PA 3QGYA 5M4FA 4GT5A 3C0HA 4LG4A 4GIIA 2QOOA 2WTCA 3UC4A 5FDPA 4LV5A 3QRIA 3L9PA 4RG0A 3DT1A 3HV4A 3AC3A 5CEIA 1KSWA 2XNGA 5K3YA 3Q6WA 3WF7A 3I0OA 5KBRA 4PUZA 3BELA 3DDQA 3KN5A 3QUPA 4RA4A 1OUYA 5LVLA 4B99A 4C4FA 3C4XA 3LCOA 4OBPA 4M0ZA 4A9RA 2GMXA 3MA6A 3UIUA 4XBUA 3MV5A 1PMNA 2BAJA 4IJPA 3UODA 2X0OA 4FNZA 3SGCA 4NCTC 3QCQA 4WG4A 3FEGA 5CSVA 2HENA 4TYHA 5ETAA 3NEWA 3HL7A 3F6XA 4EHGA 3G5DA 5IQBA 4ZTMA 3Q4UA 2XP2A 4EH2A 2ITWA 1JSVA 2B55A 3PXKA 1OBDA 4FSWA 4RJ7A 5BX0A 5IF1A 3Q2JA 1UU9A 5D7AA 3G2FA 4XOZA 4DG3E 2QO9A 3A99A 3QQJA 2EWAA 3PXZA 3UYSA 4I24A 2GFCA 2OXDA 2QU6A 3FQSA 3DKCA 4L3JA 3AMAA 2GQRA 1W82A 3CTJA 4S30A 3BQCA 3HAVA 4H39A 5JQ8A 3BV2A 5C9CA 2WEIA 5AR5A 2OJ9A 2BFYA 3MFUA 4O7ZA 5E8WA 2OSCA 3FC2A 1I09A 1NVQA 3O7LD 5H8GA 4ORKA 1OUKA 4HYIA 5CASA 3MSSA 5AR4A 3LXPA 3JVRA 4EBVA 4DGLC 3EHAA 3VVHA 2VTSA 3OWJA 4QOXA 5A3XA 3ZO1A 2E2BA 1ND4A 2XNMA 3ORIA 1BI7A 5KKRC 4R7BA 4I20A 4XG7A 4GSBA 4A9TA 1VZOA 2UZTA 4O27B 3VF9A 3WF8A 1H08A 4BTKA 5HTCA 4TRLA 5KMJA 4L52A 2R0IA 3EQGA 2WIHA 2QOQA 3FSKA 3P78A 4YHTA 2A27A 2UW6A 2OWBA 4ZLZA 4I6QA 4LGDA 4FKIA 1JAMA 5FXSA 4A9YA 5I9XA 4PMMA 3RAHA 5BMSA 5CY3A 2QO2A 3PXRA 4IDTA 3W18A 2CKPA 2WELA 1UVRA 3HMPA 4BBEA 3W0NA 3PY3A 1FGKA 3A7JA 2VZ6A 4GT3A 4MWIA 3REPA 2NPQA 3O17A 4I0RA 4X3FB 4F1MA 4YHFA 3W0MA 2UW0A 4XP2A 1JQHA 1P4FA 2F7ZE 4RJ8A 3KMUA 2X9FA 3VULA 4RPVA 3LLTA 2CCHA 4FK3A 3LMHA 5EOLA 4FEUA 1I44A 3UP2A 2OIBA 4ERKA 4IM0A 5HD7A 2OJFE 4FSQA 3JS2A 1H8FA 4U6RA 1OITA 2XIKA 2VRXA 3LVPA 4MYGA 3EL8A 5TR6A 2IZUA 2XA4A 3PSCA 1URCA 2KTYA 3SOAA 3WZEA 3OCGA 4DFNA 5EI6A 3VUIA 4RQKA 3BL9A 4DT8A 1L8TA 1FOTA 3BEAA 3HV7A 3MY1A 4FUXA 3HA6A 4CCUA 4V01A 3QQFA 5AX3A 2P55A 4QDVA 1NW1A 1OL2A 3RPYA 4C34A 5EH0A 4ZMFA 3LFFA 4JOAA 4LGGA 5ANEA 4HGTA 4XMOA 4U7ZA 4RZWA 5I9YA 5F9EA 1Q8UA 3AOXA 5BVOA 2YISA 3O2MA 2BZKB 3AKLA 3ZM4A 3FWQA 4BDEA 1XH9A 3R1NA 3GQLA 4X2NA 5HIBA 1IRKA 3TZMA 5EYCA 4OTQA 3F7ZA 5LCJA 2PVMA 3F9NA 4AW5A 5HNIX 2R3NA 3TZ7A 2YJSA 3IDPA 1HCLA 1UNGA 3VW6A 3GFEA 4ANOA 4U41A 3D5UA 5HO6A 2OW3A 4PQNA 4YJUA 5AIRA 4BR3A 1BL6A 2HY0A 3M2WA 1OPJA 4QMNA 4DEAA 3CJFA 4Q2AA 3KEXA 2GHMA 2XCKA 3BI6A 2PMNX 4FKLA 4NKAA 4ZOGA 3SDJA 4L67A 4JBPA 4M3QA 4D55A 2B54A 2XUUA 1BI8A 5CU2A 3MGYA 4FYOA 4KKEA 4FVRA 5EI8A 4B7TA 4TL0A 3LQ8A 3LJ2A 1PXJA 4MEDA 3VS1A 5BV3A 2DYLA 3ZCLA 4I5MA 5E8YA 2PVLA 3ET7A 3PY1A 5BMMA 2E9OA 4ZTLA 2OXXA 3VQUA 4ZZOA 5HEZA 5HQ0A 4FOCA 4AS0A 3W8LA 4FEXA 3LQ5A 4XG8A 4YLLA 3LFNA 4FKPA 5E7RA 3QTQA 3OMVA 2YDIA 2PUPA 2CPKE 2R3GA 4E7WA 3CP9A 3QA0A 4N6ZA 5CXHA 5TE0A 4DAWA 4HW7A 4FX3A 5AADA 3S1HA 5IKWA 4BY9E 3FYJX 4EL9A 1BLXA 2W1IA 3PZEA 2QOCA 4CQGA 1WCCA 2WTVA 3QWJA 4MF0A 4AWIA 5IQFA 3OTVA 3DKOA 3G51A 2XRWA 5CSPA 1AD5A 3F61A 3HUCA 4OR5A 4FIFA 4WRSA 2Y0AA 4QP9A 4UZDA 5EK7A 5E9EA 2F7EE 5FEQA 4FT9A 3ZC5A 3GC8A 4G3EA 4RVTA 1M2PA 2JKQA 4FKVA 4EK4A 4FE2A 2JAMA 5HLPA 3NYVA 2QLUA 1KV1A 4L8MA 3POZA 3GCUA 1MRYA 3C5IA 4CV9A 2Y7JA 3PJCA 3SKCA 3NW7A 2BRNA 4RWJA 2ZAZA 2W1ZA 4KSPA 2PSQA 4E6CA 4F9CA 2C3LA 2QVSE 5JQ5A 2PUNA 4C38A 4CGAA 3CEKA 5GIOE 3KK8A 4EBWA 4C33A 3DB8A 1GZOA 3PFQA 1UWHA 5BVDA 4XLVA 5DFPA 2G01A 2PE2A 3C9WA 2BPMA 4FTQA 3SXFA 3Q3BA 1JBPE 3KKVA 2V0DA 2C6KA 3UPZA 3DAEA 2ERKA 2OO8X 4X7QA 4I6FA 4QRCA 4RIOA 3NWWA 4E4LA 5DWRA 2BROA 4YBJA 5F4NA 4ITHA 4QDEA 5IQEA 2QU5A 4TYHB 2ETMA 2FSTX 2ITXA 4QMSA 1P4OA 4MF1A 5AIKA 2WTDA 3FLWA 5AX9A 3OBGA 3R1QA 5C8KA 2PZ5A 4LOQA 5ICPA 4TNBA 3LOKA 3L9NA 2X6DA 3LFAA 4HYHA 1OGUA 5AM7A 5AV1A 3QD2B 4L7FA 3HDNA 3TKIA 3HLLA 4QTAA 3KGAA 5LMAA 3NNUA 3ORZA 4DFBA 2V7OA 1K3AA 4MXZA 4GV1A 4QQ5A 2BHEA 2G9XA 1JSUA 2PHKA 2BILB 2Q0BA 3FXWA 4XG4A 3QQHA 5DT0A 1MQ4A 5KZ0A 3GCVA 3ZLXA 1M17A 4C4IA 4WUAA 4TNDA 3FKNA 5K4JA 4PMPA 2X4ZA 4K2RA 1ZARA 3FLZA 2XKFA 3DOGA 3N4TA 3NNWA 2X0PA 3MI9A 2R3HA 2X8IA 3PLAE 3PE2A 3KN6A 3D0EA 4RZVA 3LLAA 3QRKA 5DRDA 4J7BA 2ITNA 3TV4A 4HVSA 5HG5A 1Q61A 1A06A 2BZJA 4GJ3A 4DHIB 2WO6A 5DVRA 3RPVA 2JBOA 2X7OA 1IAJA 2REIA 3NUSA 5IDNA 4XYFA 3ZLSA 3NYXA 4XRJA 5EYKA 3VUMA 2OG8A 5I9VA 2XS0A 4X2JA 2OKRA 4U80A 5I3OA 5K4IA 2OIQA 4OUCA 1G3NA 3FPMA 3GCQA 4ARKA 4J52A 3U6IA 4CMUA 4RIXA 4FG9A 1Z9XA 3QZHA 3EMGA 4O22A 4OT6A 4QP7A 2R3LA 4QT1A 4BVUA 4D2VA 4PDOA 3TKUA 1DI9A 3DFAA 3OC1A 3Q5IA 4JQEA 1KUTA 4EH4A 2IF8A 2GS6A 4Y85A 2ZV8A 5IG1A 3RM6A 1ZMVA 3UDBA 3E7OA 5I3RA 2I0YA 2HK5A 4D1XA 3IDBA 3M42A 5L8JA 4USEA 5J5SA 1W84A 3LFQA 3KRWA 3OP5A 1H1QA 4YUQA 2X1NA 1W8CA 3MPTA 3WOWA 2YLFA 5DN3A 1PMVA 5TT7A 3UIBA 4F7LA 3ROYA 5L2WA 1E1XA 4U9AA 4HVGA 2W0JA 4HVDA 4O0UA 4XV9A 4J99A 4CSVA 4JX7A 2R64A 4A4XA 4BCQA 4PV0A 2B9HA 1PYXA 4XHKB 2BKZA 2O65A 2PZRA 2YIXA 5ETCA 2R4BA 2YIQA 4CVAA 3GGFA 3HUBA 4LMNA 4WUNA 4IX6A 3OZ6A 3MJ1A 4YZMA 3A4OX 2UZOA 2C5OA 2DS1A 4UEUA 2YM5A 2A19B 3BHUA 2G2HA 3T3VA 2ZJWA 2PVJA 5BPYA 3BU5A 1H0WA 1NVSA 2YJRA 2Z7LA 4F0GA 2OLCA 2Y6OA 4E5AX 2C6EA 5HOAA 3ZRLA 2PVFA 5AA9A 3TG1A 4I5HA 1U4DA 3VWAA 4EHEA 4CTBA 5I5ZA 5AV0A 3OHTA 4NW5A 3ATTA 5CU4A 3ZOSA 3FSFA 3E5AA 3IG7A 2Y4IB 3D9VA 1XH8A 4C0TA 4WG3A 2ZFYA 4AXEA 2PMLX 1IA8A 5KMOA 1M52A 2XIYA 3UOKA 3VRZA 5K0XA 4F65A 5CVFA 2IJMA 3OCSA 4JDIA 2LGCA 3UE4A 3I6WA 5DH3A 3JXWA 4PY1A 5CU3A 4E4NA 1NVRA 1B39A 3OWPA 2QR8A 3QA8A 4S31A 3RZFA 4FL3A 3ZRMA 2IPXA 3OWKA 3ORXA 3AD4A 2WGJA 4KKHA 4CKRA 4IVCA 3EN4A 5AR2A 4MBIA 1CKJA 5BQ0A 1GIIA 4I6BA 1GAGA 1YOMA 4EUUA 3P7CA 3N9XA 4M67A 3TJCA 4PF4A 3B8QA 3R71A 4HOKA 4U3ZA 2YA9A 5IEXA 1QCFA 2P2IA 1JPAA 1H0VA 4FTIA 1BUHA 4KS7A 2H6DA 2EVAA 4BBMA 4D2TA 4IQ6A 2HOGA 3LJ0A 3LFSA 4U81A 2C6OA 3MVLA 4A9SA 3LXNA 3BV3A 1B6CB 4AOIA 3EQBA 3EJ1A 4OBOA 2YEXA 4CYJA 3D15A 3QXPA 4BDJA 3GC9A 2VO6A 4WRGA 4FT5A 1XJDA 4S34A 2Y8OA 2RG6A 4GIHA 5DE2A 4EQUA 4O81A 4DCAA 3QC9A 3EFLA 4UWYA 1OB3A 2Q0NA 1AQ1A 1ZY5A 5K5NA 3MVHA 2JDOA 3ZS5A 2J0MB 2EB3A 5HG8A 4IBMA 4WT6A 3U8WA 4U3YA 3GC7A 3ALNA 1UKHA 3MS9A 4RMZA 4YC3A 3AQVA 2WQOA 2B52A 3O8UA 4YNOA 5AV3A 3EQIA 3RVGA 3KRRA 2J6MA 3VBWA 3AKKA 2XYNA 4FC0A 2XKEA 3E88A 4TT7A 4RC4A 4DHFA 3ROCA 3NIZA 4C61A 4LYNA 4S2ZA 2FSLX 3QD4A 3VQHA 2A2AA 3FMEA 4O6EA 3NYNA 4NH1A 4L44A 3E87A 2AEGA 4YJQA 3JVSA 3Q9YA 3LFBA 3R9DA 3VUTA 2YM3A 2ZVAA 4RC3A 5JGAA 3LHJA 3UQFA 4AXAA 4DFUA 5FTQA 3VS2A 4APCA 4P4CA 4O0RA 3ODYX 4BGQA 3RJCA 4TY1A 4ZY4A 1YDRE 2ONLC 3C0GA 5J9LA 3EZRA 4EZ3A 3COKA 3D7ZA 3HMMA 2X0GA 4DF3A 1J7IA 2OK1A 1U5RA 3OXZA 3DJ7A 3QCXA 4QO9A 4D9UA 3O51A 3QQUA 2NRYA 1RDQE 2GHLA 4MXOA 4PDSA 5E91A 2X81A 5EDRA 4ERWA 1SNXA 4LUDA 2BRHA 1LUFA 1SYKA 4BCNA 4ZMEA 2C47A 3AC5A 3C50A 3V51A 3CE3A 2IVVA 5BUJA 3MPAA 5EDQA 4BICA 4Z7HA 4FKJA 1LPUA 3R73A 3JY0A 4G3GA 1H26A 4P7EA 5JH6A 3QALE 3GU8A 3R21A 4G3FA 5LMKC 2X8DA 3QQLA 3R7IA 4OGRA 4E6QA 4D2RA 3WYXA 4E4MA 2GFSA 3P08A 4FV9A 3FBVA 4XV3A 4I4FA 4EHZA 1H25A 1M7QA 4IB5A 3SXRA 4XNEA 3AMYA 1JWHA 3DA6A 3VS5A 4ZZMA 4IWDA 1RE8A 1WBWA 5A9UA 3O5AA 5GIPE 1CTPE 5D10A 2VO3A 3R7GA 1XHAA 3TIYA 2QOIA 4MXAA 1TQPA 4QYGA 5AP1A 5AUXA 2RSVA 2WHBA 2GNFA 3EQFA 3P7AA 3ZO3A 2OGVA 2RFEA 1IG1A 3FMKA 3NAYA 3UC3A 3ORTA 1YHSA 4EC9A 3QL8A 4RIXB 2ONLA 3UQGA 4JG8A 3KC3A 2O5KA 3AC1A 4FA2A 3ATSA 4ZS4A 2WMWA 4R3RA 5ANKA 3TNQB 4BDKA 3DY7A 5HORA 1XH4A 1OL1A 1AGWA 4X6RA 5F1ZA 2C6MA 3HDMA 2BDFA 3II5A 3R83A 1NY3A 1H1RA 4BGHA 2JITA 5TF9A 3WZDA 3TZ8A 3EWHA 4QMXA 3NMUF 4NJDA 3EQHA 4X3FA 3T9IA 1ZLTA 3NFGB 4GJ2A 4ZJJA 4IZYA 3R6XA 4YO6A 3UOHA 4GVAA 5CQWA 1Y6AA 3NNXA 5E90A 4QMYA 2WAJA 3OOGA 1CMKE 4IAZA 5FTOA 4DGGA 2QR7A 3LFEA 3P79A 4WSQA 5FG8A 4YTCA 2UZEA 4F9YA 5CAPA 5IDPA 3LCDA 3KY2A 3VAPA 4AN3A 2I40A 2W9ZB 4FZ7A 3BHVA 5LVOA 3EFKA 4AF3A 5A6OA 4KIPA 3QZFA 3H4JA 4YGAA 4EOSA 3OFMA 3I60A 4K0YA 3BHYA 5A14A 3I4BA 4KB8A 4U45A 5CU0A 1X8BA 2YM8A 3NSZA 4J71A 2OJIA 4YJPA 3RM7A 2PPQA 1U59A 4U5JA 1H00A 4N0SA 4R5YA 1ZWSA 3ZMMA 5B2LA 3QTSA 5IMEA 5FXQA 2WMAA 3P5KA 1Q3WA 1ST4A 1UU8A 2PZPA 3OW4A 4JG6A 4O84A 3QZGA 2CGUA 4QMVA 1UU3A 1OIQA 3G90X 1TFFA 4OLIA 3BU3A 3SA0A 1XMLA 2HW7A 4PPAA 5HU3A 4O7LA 3NDMA 5BYYA 2I7QA 5IA1A 2BUJA 2QHMA 4R3PA 1ZZLA 5IEYA 3H0ZA 3FLYA 5AR8A 4IAFA 4W9WA 5J7BA 5HG7A 2ITYA 4LRJA 5M09A 5FLFA 3V5PA 2XJ0A 2XYUA 4K11A 4F9WA 1K9AA 1H1WA 2B7AA 3A7IA 3OD6X 3P23A 4KSQA 4S32A 3U9NA 3UTOA 1JKSA 4ZZNA 3TUBA 3SV0A 3RWQA 1WBVA 5G1XA 2OZAB 4AZVA 2VTMA 2WMTA 3Q6UA 4QMTA 5KX8A 3NUUA 5HTBA 3DDPA 3FXZA 4AZFA 2XK4A 4ITJA 4D1ZA 3MN3A 1YDSE 3H9OA 2R7BA 2UZUE 3BZ3A 3MW1A 3FQHA 3Q53A 4ZS0A 5C8MA 4B9DA 2CGXA 3MH1A 3DXQA 4D0WA 3DBCA 2PUUA 2BKKA 4NM3A 4DHZA 3ERKA 3ZU7A 5L6OA 5M56A 1OPKA 4FKRA 4MCVA 3QKLA 5EW9A 2J9MA 4FBXA 2IEWA 2J4ZA 2C0IA 4Y5QA 2X2KA 3KF4A 3KVXA 3PG1A 4CT1A 5BVWA 3ZDUA 5M4IA 5CS6A 3PPJA 1R3CA 3UZPA 5AUWA 5DEWA 3OROA 3L8PA 1H07A 2E9UA 3NZ0A 4FTKA 4RVKA 1YHWA 3IK3A 4FI1A 3ZSIA 3CY3A 3SOCA 2J0IA 1F0QA 4RX9A 3R7EA 1PYEA 2P2HA 4O2PA 4FTMA 1G8SA 2WTKC 4BCGA 4AXFA 5DA3A 3MB7A 5F94A 3VBQA 2VX3A 4GRBA 1DAWA 3RKBA 5IQAA 3ZLWA 4O0XA 4BCJA 4JBVA 3BIZA 3IW6A 2VAGA 4C4JA 3KXHA