3ZBFA

Structure of human ros1 kinase domain in complex with crizotinib
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
281
Chain Sequence
IENLPAFPREKLTLRLLLGSGEVYEGTAVDILGVGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYIILELMEGGDLLTYLRKARMATFYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVKIGDFGLARDIYLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQLQLFRNFFLNSIYKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ROS
publication title Acquired Resistance to Crizotinib from a Mutation in Cd74-Ros1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 281
sequence length 296
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zbfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zbfA01
5JQ5A 1W8CA 1YXSA 3O96A 3DBDA 3IPHA 5D10A 3UQGA 3NUPA 3FHIA 4CV8A 4AW2A 5KHWA 3LHJA 3ZSHA 1R1WA 2VUWA 4ZJIA 3ZSGA 3KREA 2CHLA 5EHOA 1UU8A 3WI6A 2ZAZA 4RJ5A 1ZLTA 2XIYA 2VZ6A 1RJBA 4H58A 3UDBA 5A4LA 5KHXA 1Q99A 2PMIA 4U45A 4AUAA 4FGRA 4FT9A 4XS2A 5IEYA 1H4LA 4DEGA 2OJFE 2F9GA 4I41A 4O0RA 3UNJA 4BWXA 3SKCA 4YUQA 3QD3A 4DF3A 4FSYA 5IQCA 1OECA 1URCA 4AG8A 2BZKB 1ZZ2A 3FC1X 5ACBC 4E73A 2QG5A 3D2KA 2C6IA 4KNBA 3TM0A 2X6DA 3Q6WA 3QHWA 4BB4A 4EUTA 2P3GX 4TXCA 2WQMA 4UYAA 3GFWA 4YHTA 2R0UA 2BDJA 5L6PA 2RGPA 4IVBA 2C6KA 3EQHA 5FTOA 4E4XA 2UZNA 4EOKA 4PPAA 2PY3A 2PUPA 2FGIA 4PDSA 3NZ0A 4EZ3A 3R8PA 1G5SA 2V7AA 3MJ1A 3OFMA 4IDTA 3POOA 4NM5A 4B8MA 4XRLA 4BWPA 4C62A 2PYWA 1STCE 3O50A 2HAKA 3EH9A 2JITA 4ACHA 4X3FC 4PF4A 5KMNA 5HOAA 3FJQE 4FEQA 5DRBA 3W1FA 4Q9SA 3BU5A 5GZ9A 2ITPA 3ZC6A 4HVIA 4FNZA 4ZSJA 3QZHA 4ZJJA 3UVPA 5TF9A 3BGQA 3E7OA 3NRMA 4O38A 5K0KA 4R78A 1CDKA 3RZBA 3OTVA 3OF0A 2AYPA 4G5JA 5DT3A 4E6DA 1GIJA 2CLXA 4DEBA 3R7IA 4XUFA 2XK6A 3IQ7A 4FSWA 3POZA 3HUCA 4H39A 3VUGA 2OO8X 4IZAA 1IG1A 3HGKA 4IAYA 4O0VA 4WHZA 1YKRA 2GPHA 3IDBA 1Q8ZA 3FY2A 2VTIA 3R02A 4FX3A 4GJ3A 3QZFA 5ANJA 3DPKA 4BTFA 3R1QA 4B99A 3FZTA 3PA5A 2IZRA 4ASDA 4BIEA 1UKHA 5FGKA 5KMLA 5AFVA 4NU1A 2WXVA 3KB7A 4EK5A 4B0GA 1VZOA 3QZIA 4QMXA 2VWXA 2XK4A 4RQKA 2BR1A 3VUTA 2XJ1A 2R7IA 3BEGA 3FI3A 3NLBA 4G3GA 2I40A 4FEWA 2X8DA 5IDPA 2XF0A 2C69A 3HV7A 2X8EA 4V04A 3W32A 3KULB 2WMAA 4RRVA 1R39A 2GHMA 2VGPA 5DT0A 2VX1A 4HYHA 3UNZA 2VTSA 5C03A 3C5IA 4ZY4A 3MB6A 1WBOA 1ZMWA 2R3NA 1BLXA 5AM7A 1UWJA 4ACMA 3OUNB 3ANQA 4C4EA 2G01A 2R0IA 1BMKA 2V7OA 5FM2A 3VBTA 4DINA 2PUNA 4ZSLA 2G15A 5HGIA 3H9RA 1ZY4A 3K3IA 2J9MA 3D83A 1HCLA 2VO6A 3HEGA 4GT3A 1K2PA 4IVCA 5AP5A 2V22A 1HOWA 4XP3A 2KULA 1YXVA 4DH3A 4RC3A 4FTIA 4RMZA 5IA4A 4I0TA 4BFMA 4EOJA 2YIYA 3O23A 3P79A 1J91A 3PE1A 3HV3A 4XG7A 4OTHA 3PPKA 4MHAA 2CNVA 4GV1A 2HXQA 3PSCA 3PIXA 3VNTA 3PJ3A 3TUCA 5M07A 2VWYA 3KC3A 4UXLA 1GZNA 3HECA 2FSTX 4M69B 1XH4A 5CVFA 2BILB 3F69A 3MPAA 1E1XA 3V6SA 2Q0BA 3KKVA 4ZLYA 4TPTA 3BKBA 3LKMA 3R28A 4L3PA 3HL7A 5AUZA 4BN1A 3UMXA 3PWDA 4QD6A 3EQPA 4ZP5A 1KWPA 3MH2A 1XH9A 4B8LA 3PP1A 5B7VA 4RX9A 1WAKA 4EOPA 4GK3A 1YI4A 4C2WA 3B2TA 2BRHA 2BTSA 3PXZA 3LVPA 4ERWA 1O6YA 3AXWA 3FV8A 2R7BA 1OPLA 3PIYA 3TZMA 4QNAA 2ETKA 3FAAA 3IECA 2XNOA 2H9VA 3K5VA 5KBRA 4WKQA 2WNTA 3GU7A 3QA8A 2HZIA 2YITA 2VWIA 3FQSA 4I22A 4XP0A 3WOWA 4DE4A 3MH0A 4PMTA 5JN2A 5BVEA 5EQPA 4R3RA 4S32A 3O7LB 1PXLA 1OBGA 5EKOA 5HO7A 5AP7A 4APPA 3IW5A 4MF0A 2Y9QA 3EB0A 4RIOA 3W2QA 3EZVA 3O0GA 4I1ZA 4FKVA 1XQZA 4J95A 3SAYA 3UC4A 4FKGA 3MVMA 2WTIA 5CVGA 5B2KA 1DAYA 5JKGA 4L53A 2QOLA 3QTUA 2BALA 2HY0A 4QPMA 5L8JA 5CENA 4ASEA 5BPYA 2OXXA 3HRCA 4I3ZA 3PVGA 3OBJA 4ZAUA 2R3KA 3KCKA 5M4UA 2F7XE 3KY2A 5K0XA 5IA1A 2UW3A 1PHKA 4WSQA 3MFRA 4I0RA 4AACA 4BC6A 3L8PA 2CKPA 2J4ZA 2J5FA 4UBAA 2IZSA 3TN8A 3LQ5A 2VTJA 1ZYLA 5FD2A 2UW4A 4M97A 4RIYB 4IC7A 4RJ3A 5M4IA 2X6EA 2QKRA 4FG9A 1OPKA 3VBWA 1PKGA 4EHGA 4JQ8A 4BDIA 4FMQA 2XKFA 5ETIA 3U8WA 4X2KA 3EN9A 3MH1A 3BWFA 4AE6A 1NVRA 5HCZA 5F20A 5IMXA 4G9RA 3NNUA 4FBXA 4LOPA 3ORXA 5EHLA 5IKWA 2J0KA 4CT1A 3QBNA 3FI4A 4U3YA 3VS2A 3QU0A 4I24A 2R3MA 3FLNC 4J98A 5EFQA 2Z7SA 2C3IB 4MNEB 4BZNA 2OWBA 2JEDA 5CAOA 2C47A 5HORA 5IH4A 5TE0A 3MESA 2C3JA 3VQHA 1BKXA 3NDMA 2HZ4A 3TDVA 1H00A 1BL6A 2VTRA 3FXWA 3PG3A 4NKAA 2OICA 2OZAA 3R2YA 4K11A 1Q61A 2Z7QA 3BU3A 3E7VA 5KO1A 4DH8A 2HWOA 4PPCA 5DN3A 2WOTA 4W4YA 4GIHA 3TUBA 4I6QA 4JAIA 4IJPA 5FDXA 2EUFB 4FK6A 4V01A 3H4JA 3EOCA 3QAME 4IZ7A 2YIRA 3Q9XA 3P7CA 4EI4A 3CY3A 4KRDA 4MXCA 5BUEA 5EYKA 3NNVA 3OHTA 1XKKA 1REKA 4D9TA 1A9UA 2XRUA 3BBTB 3CBLA 2BIYA 4QO9A 5AP1A 4FZ7A 5AP3A 4O2ZA 3SVVA 4IWQA 4P2KA 1Y6BA 2CLQA 2ZMDA 5AEPA 3RKBA 3VVHA 4EUUA 4ZOGA 2B1PA 2C1BA 4L9IA 2PMNX 4YHFA 3DNDA 5HU9A 2WTKB 1Z9XA 3TV7A 4Z3VA 2H6DA 1M52A 4RPVA 2FH9A 2HCKA 3DS6A 4IBMA 2QONA 1SNUA 2X9FA 4G6OA 3PXFA 3ANRA 2KTYA 4O7RA 4I0SA 3JPVA 4TKSA 2EB2A 2YCRA 3EN7A 3LOKA 4XG2A 3NGAA 3OUKA 4IAZA 4H1MA 3ZM9A 4X6RA 3AC5A 5HZNA 3BU6A 3COIA 5J7HA 2BMCA 4E6CA 3IGGA 4C37A 4F08A 5HD7A 2ITOA 3EN4A 5EYCA 3RP9A 4BKZA 4YURA 4L7FA 3UTOA 4ZTMA 5JQ8A 4EK4A 1SM2A 4IAIA 5CLPA 2YIXA 4FKRA 1M2RA 3W33A 3BELA 3DZQA 4FT3A 5IUGA 3DLSA 5T68A 2BAKA 3Q6UA 5IQDA 2I1MA 1UKIA 4C58A 1IASA 5AA9A 5KCVA 4O7WA 4YJRA 3HP5A 3MBLA 3L8XA 3NUYA 3QCSA 4ZS0A 4GT5A 2J7TA 4YLLA 3FZ1A 5HNIX 3UODA 5CU4A 3DBCA 5JMSA 4EOSA 3D14A 2CCHA 1H0VA 3V3VA 3RM7A 3UC3A 5I4NA 5CNNA 4BDHA 2YA9A 4TY1A 1GOLA 1OVEA 2NRUA 2YN8A 5HE3A 3CQEA 4C8BA 4DITA 2F4JA 2QR7A 3E3PA 3P23A 2BDWA 4X3FA 4FV4A 4FIGA 3HMNA 3U55A 4WBBB 3KK8A 2WTCA 3MA3A 3UOLA 4GT4A 3H3CA 3TWJA 4FV2A 3MY1A 4HGEA 4IFGA 5A9UA 3E64A 5CF8A 1MRVA 2NP8A 2C6DA 4KB8A 2YERA 2ETMA 4D2TA 5LMBA 5HI2A 2OIQA 3R83A 3QX4A 3ROYA 1CM8A 3R7GA 5DEYA 2UV2A 5KE0A 3EFJA 1L8TA 1G3NA 3ENMA 3OC1A 3TG1A 2OH0E 4UMUA 4WNOA 3LXPA 3W2OA 3KXXA 4F4PA 1GNGA 3SQQA 1P5EA 4O81A 4CZTA 4E5AX 3HRFA 2A4LA 4FZAB 4R8QA 4F65A 5J9YA 4D4SA 4YO4A 4M7IA 3EQDA 4YBJA 4ANMA 4GVJA 2DQ7X 3A7HA 3EQFA 3FZRA 3PSBA 2NNWB 4AZSA 4YNOA 2VTTA 4AZEA 4USDA 1YDTE 2W17A 4BBEA 4BY9E 4N70A 2W9ZB 5AV3A 2QOHA 5LCJA 1OITA 4DG0E 4ZTQA 3DGKA 3QQUA 5CU2A 4KAOA 5I5ZA 4AGDA 3HUBA 2W9FB 1W84A 4CQGA 3PUPA 4S31A 2WQNA 5HD4A 2IVTA 4W4WA 1W0XC 3GC9A 4BGGA 2ITUA 4XYFA 3BYUA 1UNGA 4YJNA 5LMKC 4X2JA 5CSVA 5EW3A 5IUIA 4BBFA 3MB7A 2BRNA 2V5QA 3PYYA 4QMVA 4ZLZA 3RWQA 5IEVA 4AA5A 3MI9A 4F6UA 2IWIA 3WARA 1KE7A 3EKKA 3FSKA 4ZS4A 3M11A 3DT1A 3VUMA 4KIPA 4BI1A 3Q5ZA 5E4HA 2YAKA 5CQWA 2DS1A 2JDTA 4J8MA 2RKUA 3F3VA 5HTIA 4KIKA 2C5VA 3G0EA 3E88A 5AIKA 2GQGA 1PW2A 2WTKC 4AU8A 4CMTA 4PWNA 4DGGA 3P9JA 4DH1A 1JAMA 3QD4A 3AMYA 2JIIA 2QG7A 4OR5A 4DT8A 4FL3A 1TVOA 4F9AA 2UW9A 3UOHA 2ZM3A 3GQIA 3FYJX 3JY0A 5IQEA 2BRMA 4H3PA 1A06A 5CS6A 3UIUA 4AA4A 4TYEA 3VN9A 2Y0AA 3FWQA 4FTLA 4OTWA 2GFSA 5CU3A 5HTCA 4RLLA 5K9IA 3P86A 3PXRA 4J99A 3P78A 4Z16A 5BUIA 4QP3A 4QMOA 5HG7A 4AQCA 3NVMB 2HOGA 4HCUA 5TR6A 1FINA 5HEZA 4E6QA 4L3JA 5HNBA 1YI3A 5CAQA 4ZIMA 4E5BA 1YOJA 4LRKA 5BMSA 1A48A 4JJRA 3P0MA 5HE0A 1PXPA 4CRSA 5LWNA 1GJOA 1XHAA 2X7GA 3RCJA 1IA9A 2WU6A 5I9XA 3EHAA 3OT8A 4RWIA 4CTCA 3GC8A 3DBEA 4OTQA 4YC3A 5EHYA 5HBHA 4CLIA 3VJNA 4FTAA 4O0UA 4RJ7A 5FDPA 4MX9A 3KN5A 2QO7A 3LCTA 4O7SA 5HG9A 1I09A 1QPJA 3KK9A 2PZYA 2QOCA 5ETAA 5FWKK 3VO3A 3HMIA 4X6QC 4F1TA 5DA3A 3CD8A 3FI8A 3R8ZA 4TL0A 1OKYA 2QI8A 3PFQA 4YJUA 5AAEA 3LFAA 3TJCA 4BRXA 3GCVA 5HE1A 3JYAA 5IH5A 4E93A 4G31A 5LVPA 5BX0A 3PVBA 3GC0A 3LFQA 3UIBA 3HZTA 2BFYA 4YTIA 2CCIA 2ITQA 1YDSE 4RC2A 3QUPA 4QP2A 2XVDA 4FV8A 4RZVA 4PV0A 4ZZOA 5HESA 2B9FA 4OAVB 3NR9A 2RFDA 2ETRA 2J90A 4J52A 2QCSA 4QMLA 4CKJA 3QXOA 3LMHA 3ZBXA 1ATPE 2O8YA 3V8SA 5AJQA 4ZK5A 4QRCA 3LJ1A 5HO6A 3UP7A 3G51A 4D9UA 4RVMA 5M06A 3EQRA 2JKOA 1XBCA 2J5EA 3D2IA 3GCPA 3Q2MA 4AF3A 5CAVA 4CMOA 5JFVA 5IQFA 3UMWA 2Q83A 5EOBA 2ZDUA 3WF5A 3HV4A 1YWVA 4NL0A 1XH8A 2X81A 4A9RA 3RCDA 4NZWB 4P4CA 2PVKA 4AZVA 1OUYA 3A4OX 5FXQA 2GDOA 3CSVA 3KULA 1ZYSA 3GP0A 3Q9WA 2R3RA 1J7LA 3F3UA 3VJOA 3PPZA 4BDGA 3BEAA 5EG3A 3T9TA 4BR3A 3DA6A 4QYGA 2ITYA 3W8QA 3LFNA 3U51A 3M42A 2ITTA 4APCA 3HDNA 2HXLA 5DOSA 5DMZA 4GMYA 3QLGA 4NEUA 4JDIA 4OGRA 4DH5A 5IA0A 1RE8A 5B0XA 3GCSA 1ZXEA 3A8WA 3GU8A 3PVUA 5AUUA 3NAXA 2OW3A 3GENA 5I9UA 4EH5A 3QC4A 4PTGA 3HA8A 5A46A 3I81A 3ATTA 3VUIA 2ERKA 3WZDA 3R8LA 2YCFA 4RWJA 4ASXA 4BCKA 4KINA 3R00A 2W1ZA 3DBFA 4EK6A 2HY81 5I3OA 1ZMVA 3BYSA 5M53A 3M2WA 2W1GA 2Y6MA 3TNWA 3QFVA 4JRVA 2JDSA 4FSTA 4CFFA 2XJ2A 3QTIA 3PLAE 4ID7A 4DFZE 5CY3A 4DLIA 3SOAA 4WG4A 2O63A 4JI9A 2GS2A 3KVWA 3VRZA 5TO8A 2WQBA 2XM9A 3KXHA 4F9WA 3ORLA 4PTEA 5CQUA 4UMTA 4OBQA 4HNFA 1Q8UA 1KUTA 4FYNA 4DTKA 4YZCA 5LQFA 1J1CA 3F6XA 2F57A 3HV5A 4LUEA 3IOKA 4DEAA 4PY1A 2W4KA 1IR3A 1H1WA 1OIUA 5CXHA 4DTBA 4HPTE 4WRSA 5K4IA 5GJFA 4EWHA 4H3QA 4C36A 2VTHA 3PIZA 2XKEA 3CQUA 3F3TA 4UWYA 5D9HA 4E3CA 2WMQA 1U46A 1URWA 1UV5A 3I0QA 1RW8A 3ORIA 4FR4A 4IB0A 4W9XA 4D1XA 4DFYA 4F9BA 4O1PA 4BDFA 3FC2A 4O96A 1EH4A 3ORTA 4FV0A 1IA8A 4FV3A 2YFXA 2WTWA 2R3IA 4BZDA 3C0HA 3KRRA 4CGAA 2OK1A 4J7BA 2AC5A 3B8RA 2B4SB 2R3PA 4YC8A 4I5PA 4WNMA 3U6JA 1DS5A 4UN0C 3QHRA 3QTXA 5A4EA 1ZYCA 2BHHA 2VNWA 1YWNA 3EKNA 4ZTSA 1UVRA 1R0EA 5JH6A 5A6NA 2ESMA 3CJGA 5K4JA 3WYYA 4ACGA 4BTKA 3PRFA 2BPMA 4RX5A 4Y46A 4WA9A 4Y8DA 3BV2A 4I6BA 2JLDA 4O21A 5JFXA 2PVYA 5JRQA 3DLZA 5M4FA 4RVLA 4XG4A 1WVXA 4UXQA 4D1SA 2VU3A 2QO2A 1KE6A 5JSMA 3SLSA 2P0CA 4O0YA 1QMZA 3TNIA 2WMRA 4FSNA 4I94A 3HP2A 3RPOA 4AWIA 5HX8A 4CFNA 5KMKA 2XNEA 3TDWA 3OCGA 5KKRC 3TV4A 3CJFA 4EWQA 3SXSA 4BIBA 2P4IA 2Y4PA 3PPJA 1J3HA 1Q24A 4MXYA 4L67A 4AW0A 2W05A 4XG6A 4C7TA 5LJJA 3ORPA 2Z60A 3GOPA 2A1AB 4MVFA 3FL4A 4RIYA 5AWMA 4AXAA 4K18A 5EDRA 4ZEGA 4YZNA 5AR3A 3O8PA 2Z7LA 5H8GA 4XOZA 1H8FA 1GZOA 4NTSA 3RGFA 3S00A 3QQJA 5CF6A 1UWHA 3C50A 1REJA 1PXOA 2P2HA 3ACKA 3CXWA 3UPXA 2GNIA 4PMMA 5JEBA 1O6LA 4K8AA 5J9LA 5M44A 4DEHA 4MNEA 5LVOA 2QOQA 4E4MA 1OKWA 4FTJA 4AZWA 3CGFA 2PSQA 3VS4A 5FUTA 3PWYA 2WEVA 5BVDA 3MFUA 3G5DA 4WT6A 4XH6A 2C0IA 2QURA 4WNKA 2Q0NA 3ZLYA 3NCGA 3FSFA 3VHKA 4LYNA 4XCUA 2OFUA 4AW5A 2WTDA 3CIKA 2PVJA 5CNOA 2LAVA 3UJGA 3LM0A 3V8TA 3GQLA 4FTRA 3HA6A 3ZBFA 3W2SA 3V6RA 3ZO2A 4F6WA 1YHSA 4FICA 5GJGA 2YHVA 3ERKA 3OZ6A 4PX6A 5LMKA 2XEZA 3CQWA 2XRWA 2ZOQA 3D4QA 3AQVA 3D5XA 4RBLA 3ZRLA 2ZM4A 4YMJA 1Y6AA 1R0PA 2G2IA 4QYHA 4A4LA 5IDNA 4FSQA 5E91A 2BROA 2CSNA 5DHJA 2XCHA 2XJ0A 3ORNA 4UZDA 4E1ZA 3SW4A 3N4TA 4ACDA 1GY3A 4CCUA 2V0DA 4XMOA 2QC6A 1ZOGA 3P4KA 4FL2A 1KOBA 2PE1A 3RAIA 5FLFA 5EM7A 3C1XA 3CC6A 2CGWA 4DN5A 1RDQE 4RJ6A 2X7FA 2OH4A 3FZOA 3MPMA 3E62A 3RNIA 4L43A 4R5SA 4G5PA 4BHZA 2YM4A 4A4XA 3TZ9A 3RWPA 5J1WA 1TKIA 4IX5A 1Z5MA 3VS7A 4UMPA 4DFXE 3U9NA 3Q9ZA 2P33A 3H0ZA 1ZZLA 2UVYA 2YISA 4FZDB 1Z57A 4UY9A 3LAUA 3FPQA 4DHFA 3JR1A 4M68A 3VBVA 1VYZA 3E87A 4LUDA 4NSTA 4YJSA 3R7UA 3K54A 4EH6A 4OTFA 4QMWA 2B9IA 4HVGA 2H8HA 4G3CA 4F0GA 4F7LA 3BV3A 3VQUA 4R7HA 4F09A 2YEXA 2EVAA 2YDIA 2IG7A 3ZLXA 1XWSA 4ONAA 1NY3A 3FMMA 2BRBA 2G9XA 5A54A 1PXJA 3QWKA 4DFLA 3QQHA 3FQEA 4USFA 2WPAA 2O0UA 3H30A 3HMOA 4JT3A 3FXZA 3FKOA 5DT4A 3CE3A 5CYIA 3CGOA 5CTPA 4QMUA 4B6LA 4CKRA 4ANLA 4QT1A 3QQLA 4DT9A 1DI8A 4FTKA 4OBOA 3UQFA 4K0YA 1QPCA 1AD5A 2O2UA 4K9YA 4MXXA 3QX2A 3LIJA 4QMTA 4RGJA 4RVKA 3RK7A 4NW5A 3OTUA 2QODA 2R3GA 5CI6A 4ARKA 5B2MA 4ZTLA 5I0BA 4L52A 2E9PA 2W5AA 2QU5A 4OBPA 1P2AA 2GTMA 3LW0A 2R3JA 3G2FA 3NYVA 4FSRA 4FZ6A 3LXKA 5DIAA 4A06A 5AV2A 4ALVA 4FTOA 2XNMA 3BYVA 1NA7A 4CVAA 2PUIA 4FG7A 3CPBA 2HIWA 1F5QA 3DKGA 4Z9LA 2W96B 4IAFA 4DTAA 4ANNA 1ZY5A 3A8XA 3I6UA 3JVRA 2OXYA 2G1TA 1AQ1A 2WZJA 3TZ8A 4NH1A 4OT6A 4FSUA 4YBKA 4O27B 4BCOA 3UG2A 1CKPA 3R7YA 3FMDA 5IEXA 3AG9A 3NCZA 3NYNA 2C0TA 3IOPA 4CFXA 3C0IA 4O7TA 3FDNA 2QU6A 2QKWB 5M55A 5M51A 5DR6A 1QPDA 3KGAA 4CFVA 3R7EA 2C5YA 3BQRA 3HKOA 3RPSA 4L68A 4Y5QA 3ZFYA 1B39A 2G2HA 4LM5A 4EH4A 3O2MA 2RIOA 4IX6A 2V55A 4W4XA 5EOLA 2XH5A 2CGVA 4EOIA 3A62A 5AR7A 1M2QA 3A4PA 3UQCA 4QP7A 1XO2B 4BCNA 5DYJA 4O7YA 2W1HA 3MIYA 1AGWA 5BVWA 3W10A 3U9CA 3Q3BA 4MXZA 3RTPA 2XYUA 5AR8A 1WBSA 4AFJA 3AMBA 1MRUA 3RZFA 5AP2A 3WE4A 2CN8A 4R7IA 3TNHA 3OEFX 1KSWA 1YI6A 1Q8TA 3F66A 2R5TA 2XS0A 3GGFA 5DRDA 4PL5A 1YOMA 4EH7A 3ROCA 5AR5A 3GNIB 1LEZA 1PXMA 1SVEA 1RQQA 2WU7A 4UALA 4CNHA 4U40A 4YNEA 4EK3A 1FQ1B 1KOAA 3VW6A 2HYYA 3U87A 5BYZA 3PVWA 4XBRA 4CT2A 5BVFA 4ERKA 2QOFA 1GIIA 4IWOA 4UYNA 2YZAA 4JXFA 4IX4A 4JR3A 3EFLA 1SMHA 4MF1A 4IEBA 5EYDA 5F1ZA 1JVPP 2X1NA 1JQHA 4O86A 3DNEA 2X8IA 3EL7A 4FVPA 4UMQA 2Y6OA 5CI7A 5ETCA 5L2SA 2VN9A 2R64A 1FOTA 3I4BA 4BDKA 4DGMA 3V5TA 4FODA 2YIWA 3F88A 5HKMA 3CEKA 4HCTA 3R9RA 2PMOX 3QALE 2CJMA 3VUDA 4IFCA 2O65A 4KS8A 1H25A 3ALNA 3VS3A 2J51A 2X4FA 4FT7A 2ITZA 3R1YA 3C4EA 4RX7A 4M15A 4EQCA 4W8DA 1P14A 2SRCA 4FEUA 4FUXA 3PDTA 2PVNA 4F70A 3BHUA 3FMNA 3I6WA 4N6YA 4P5ZA 4TZRA 5ANKA 2O3PA 4U42A 5E92A 4AGUA 2UZWE 3OOGA 3K5UA 5E1SA 2F2UA 3FPMA 3F2RA 3LCOA 4GG7A 4JIKA 4IIRA 4JR7A 5T6KA 1ZARA 5KZIA 2I7QA 1IAJA 1BI8A 3NS9A 1ZRZA 3V5PA 1M7QA 2WGJA 1ZMUA 4RQVA 5AUXA 3R9DA 4J71A 5KNJA 3QTRA 4FOCA 3UO5A 3KRXA 3TKUA 3B2WA 4CFMA 1V0OA 4CCBA 1KE8A 3S95A 4TWPA 5IUHA 4FGBA 4FNYA 1UU7A 2OIBA 3CTHA 4NFNA 4ZZNA 2WTVA 5AUTA 2XM8A 2XKCA 3GCUA 3FMHA 4G1WA 2ACXA 2HZNA 3U6IA 2VWUA 3OCTA 3IKAA 5EM5A 2YM6A 4YO6A 4X3JA 4FNXA 3QUEA 5E9EA 5L6OA 5CZHA 1JNKA 5CAPA 5IQGA 5J9ZA 4EK8A 4PMPA 3FY0A 3MY5A 4AOJA 5FXRA 2E2BA 2YM8A 4I5CA 3C4CA 1WBTA 4RLKA 4FV9A 3O7LD 5HNGA 5A3XA 2YCSA 3ZSIA 3LLAA 4KRCA 4AX8A 3ZM4A 4FEVA 3FUPA 3UPZA 4JLCA 4XG9A 4A9UA 1QPEA 1SZMA 3DKCA 3CCNA 2W1IA 4IWPA 4QTDA 1FVRA 1VR2A 3ZFMA 2EWAA 3PLSA 4G6LA 5CEQA 3F5GA 5D7AA 1U59A 5HICA 1PMEA 3SRVB 5EKNA 4CLJA 4WSYA 5LMAA 1CMKE 3MYGA 3P5KA 4IM3A 5D1JA 4IB1A 4DEEA 3AD6A 3CP9A 2YM5A 5JGBA 3PA4A 4M0YA 4MWHA 3SA0A 4ENYA 2I0YA 2DYLA 3MV5A 4EHEA 2HENA 4S33A 2W99B 4QYFA 4F64A 4GUEA 3CY2A 5L4QA 3NYOA 4GG5A 4E7WA 1T45A 4WOVA 4XEYA 2ZV7A 2OBJA 3MA6A 4GJ2A 4OTRA 5EYMA 5CEKA 4RWKA 5AV1A 4BKJA 3SHEA 4IVAA 4BDAA 4GKHA 3R04A 4XG8A 4F1MA 2PPQA 3BLQA 2X39A 4FSMA 1CKIA 2VO3A 4MBJA 2VO0A 4YC6A 4GU6A 4ANBA 2QOIA 1MUOA 3NUUA 3NYXA 5BMMA 3GI3A 2ZDTA 4HVDA 3GC7A 4O83A 5CSPA 5C4KA 3QGYA 5AMNA 3VRYA 4FTCA 2R3QA 4YJPA 3UZTA 5M08A 1APME 4AN2A 1LR4A 4NM3A 4LL5A 4JDJA 5DNRA 2XK8A 3NIZA 3FI2A 5DVRA 4WG5A 3BZ3A 3DCVA 4MNFA 5IA2A 5L2TA 3G33A 4HCVA 5L8LA 3BHHA 5ICPA 1V0BA 4X0MA 1GAGA 3WE8A 5G6VA 2JKQA 3MTFA 1E9HA 5BNJA 3R0TA 5TKDA 3ZOSA 4PL3A 4RJ8A 4U5JA 3HAVA 3QRKA 3DQWA 1PYEA 2QOOA 4C4GA 4A9TA 1U5RA 4OTDA 2VTAA 5ANGA 4F7JA 3RMFA 4IANA 1YRPA 4HNIA 1FPUA 4ZLOA 2GFCA 3DFAA 3C5UA 3P08A 4ENXA 4IM0A 1H0WA 1Q41A 2X7OA 4JDHA 2FYSA 4QP1A 4GFOA 2H34A 4FL1A 4G17A 4D5KA 2BFXA 4EEVA 1YOLA 4J53A 2XBAA 1YQJA 4G3EA 3QTQA 2GTNA 2ZV2A 4QP8A 4BTJA 4FIEA 3DJ5A 5DGZA 4GCJA 5LVMA 4BCFA 4YLJA 1U54B 4JS8A 4GU9A 1WBPA 4C61A 3AT2A 5ANIA 1IEPA 3A7FA 4FZFB 4QOXA 1XH5A 4DEDA 2JAMA 4K33A 4QYEA 4D28A 4ZMFA 4U7ZA 4EQUA 1JKKA 2W1EA 3TKIA 3FZSA 1FMKA 4ZXTA 2W5HA 4FKUA 1GZKA 3KQ7A 4GUBA 3DBQA 4MBLA 2E9UA 5LARA 5JK3A 3ACJA 3HMMA 4V0GB 4D1ZA 4D2WA 2RFSA 4UEUA 1JLUE 1PMUA 4U79A 3SXRA 3TIYA 2WB8A 2JDOA 5HBJA 4A7CA 3PXYA 2UW8A 5J8IA 3M1SA 3I1AA 3S2PA 4ZY6A 4X2FA 3LFSA 3DK3A 5KMJA 3IGOA 3ETAA 3R8MA 1OL1A 5FRIA 3UIXA 4K6ZA 5F9EA 3C4FA 5A4CA 5HU3A 1Q62A 3DDPA 4DCEA 3COKA 3VUHA 4AT4A 4X2NA 2GNLA 3IO7A 4XNEA 5L2QA 1JWHA 2RFNA 3SV0A 2P2IA 4MKCA 3L9MA 3QKKA 2BAQA 5HTBA 3GXLA 2XUUA 5EI2A 2UZEA 5IQHA 4L00A 5KUPA 2YWPA 4JX3A 1NXKA 3GEQA 4RC4A 2GHLA 4TYJA 1P4OA 3AGLA 2QQ7A 3LLTA 2NRYA 3Q4UA 3QF9A 4GW8A 5E1EA 2C0OA 2WAJA 4XLVA 5AR2A 2CNUA 3R71A 4AT3A 4JDKA 2UZLA 2J0MB 4C35A 4Y85A 4EBVA 3ZEWA 3L8SA 2XK9A 3QTSA 4QTAA 4TNBA 3UE4A 2JBOA 4NUSA 5EM6A 4PDOA 4U6RA 3TI1A 5K5XA 4Z7HA 3ZZWA 4G6NA 4DGOA 4BYJA 4II5A 3QRIA 4LOQA 4Y5HA 3R8VA 5KMMA 2R3LA 4QPAA 1T46A 3QUDA 2XA4A 5FM3A 3NW5A 3AT3A 4I23A 2QR8A 3OS3A 5B2LA 2BKKA 3VS6A 4M12A 5GIPE 3NNXA 3CLYA 4FKWA 4OAUC 2O64A 2OGVA 2OJGA 3KFAA 5IMEA 2YDJA 2BRGA 4G3FA 2IZUA 1F0QA 3AC4A 4QQCA 3VULA 3C4WA 3NAYA 4E5WA 2I0HA 2NPQA 2UVXA 3AD5A 1UNHA 2XK7A 4D4YA 2CKQA 3DXQA 3ZZEA 4GVAA 3GU5A 5M09A 3V51A 2JDVA 4ZSAA 2ONLC 5M56A 3W2CA 4NW6A 4AN9A 3IG7A 3QA0A 3TZ7A 2ITXA 4FVRA 2B9JA 5AUYA 4EH8A 3EN5A 2X4ZA 4BCJA 2PE2A 4BIDA 1G8AA 4IM2A 3F5UA 4QNYA 4NJDA 3RBWA 2W4JA 2BAJA 3HYHA 2FB8A 2ZYBA 3KXZA 5A14A 4I4FA 1BUHA 3QKMA 3BIZA 5DG5A 4LRMA 3NMUF 4KSPA 1V0PA 4BZOA 5BYYA 2PVHA 2FO0A 3BX5A 3GUBA 3JVSA 3KA0A 4BVUA 3Q2JA 4K1BA 4R3CA 2HZ0A 1H01A 3R01A 5H3QA 5C8KA 4O7LA 4YHJA 5KKRB 3UVRA 1TQMA 5J87A 3T8OA 1E1VA 4FF8A 3F3ZA 4V05A 3IK3A 5FTQA 5FP6A 2B55A 5G1XA 5GHVA 4J8NA 4JQ7A 5I9ZA 4OTIA 4G2FA 3TKHA 4EJ7A 3TNPC 3VW8A 2R9SA 3E8CA 3ZFXA 2CN5A 4HGTA 2GNHA 3VF9A 5I9VA 4WO5A 3QCQA 5GJDA 4E26A 2W5BA 5J5SA 4GKIA 5D7VA 4E20A 3BGZA 4MWIA 3VBXA 2BIKB 2BZIB 4M66A 3E3BX 5AP0A 3ZLWA 4C4IA 4RVTA 2HELA 4PRJA 3VS0A 3QQKA 4WUAA 4YZBA 5CU6A 2WMWA 2VV9A 4L7SA 2R3FA 4LV8A 3GB2A 4M8TA 1Y91A 3A7GA 4QP4A 1OMWA 1DI9A 4FTMA 5ANDA 3TTJA 5FEDA 5AUWA 5FTGA 3OWPA 4R1VA 1PY5A 4O1OA 3HV6A 4UX9A 2ZV8A 3AD4A 3OXZA 3N4VA 4LGHA 3LCDA 4FIIA 4KIOA 5C27A 3LJ0A 2WMXA 2UUEA 3EIDA 3NW6A 3T3VA 3EFWA 4YTHA 3TJDA 4Z7GA 4FIFA 3FZPA 4C4HA 1FGKA 2GNJA 2OIDA 3HLLA 5FBNC 4D0WA 5E8YA 4YJOA 4TWOA 5J7BA 4U8ZA 2C1AA 3QL8A 3RAWA 3UP2A 4A9SA 4EOLA 5LWMA 2UZBA 1H1QA 3QRJA 4LOOA 4XV2A 5LCKA 1M2PA 5CT7A 3F2NA 4E8AA 5C8NA 3ZRMA 4NYEA 4EYJA 4EKLA 3Q32A 5TOZA 3KMUA 3KVXA 3GU4A 4F9YA 4I93A 3VS5A 3DAKA 1OPJA 3HMPA 5ITAA 3SDJA 3BWJA 4TW9A 5CEIA 2E9VA 1LP4A 4M69A 2V62A 2UW0A 1DM2A 5E8UA 3W2PA 1NVSA 1H08A 5CEMA 4RZWA 2X2KA 3D7ZA 4W4VA 1XBBA 4GH2A 2B0QA 2CKOA 3V8WA 2JDRA 4XLIA 5FXSA 4E4NA 5HO8A 5EW8A 4KA3A 3BE2A 2GMXA 4DG3E 2C5XA 4FEXA 3G9NA 1K9AA 4RA5A 5F94A 2WHBA 3ULZA 5LOHA 1JBPE 3S0OA 3NEWA 2YABA 4K2RA 2ZV9A 1YHVA 3G6HA 2A27A 4AP7A 3DXPA 1ZOEA 3WBLA 3BGPA 4C3RA 1Q4LA 2YZLA 5IF1A 2GCDA 2PVRA 1Q8WA 4BTMA 4WUNA 3ZTXA 4DGNA 1WBVA 4IB5A 3SD0A 2R4BA 5JZNA 3ZU7A 3TIZA 3WIKA 1KE5A 2PL0A 4FTUA 2UZVA 3QQGA 1JSUA 4O7NA 3NWWA 4O0TA 3ZHPC 2GQSA 3NUAA 1KE9A 2A19B 3KRLA 3WZKA 2WMBA 3FLWA 3LFEA 2VTOA 3PP0A 4YPDA 2C6OA 3SGCA 2QNJA 3FMKA 5DPVA 4EORA 3H9OA 3S1HA 2X0GA 3AC3A 2UW7A 4C3FA 4F63A 4P7EA 1CTPE 3A2CA 1IAHA 1OKZA 4MYGA 3O8UA 3R21A 4FKLA 4O22A 3NNWA 3UVQA 1Y57A 3D15A 2BHEA 3G90X 3RAHA 3C0GA 2B7AA 2Y4IB 4X7QA 3TXOA 1P4FA 3ENHA 4IZYA 4L45A 4Y73A 2XYNA 4AAAA 1UU9A 4FV7A 4M67A 4GK4A 5I3RA 3QD0A 3GCQA 2RF9A 3EL8A 2DWBA 3ZRKA 5I9WA 3R7VA 3ZYAA 4E6AA 2BZJA 4MH7A 3ELJA 4I5HA 4PDPA 3A7JA 3HNGA 4DBNA 4CG9A 4BI0A 4S34A 2RG6A 3RHXA 3OY1A 2ZM1A 2VWWA 4YTFA 2UZOA 3KMMA 4BCMA 3L9PA 1GZ8A 1OIYA 4EOOA 3NUNA 4HYSA 4CQEA 5EM8A 3RVGA 3OOMA 2VX0A 4JIAA 3KRJA 2PVMA 2JFMA 2XIZA 3ORKA 4GFMA 3QQFA 2ZVAA 1XH6A 5CEPA 2XNGA 3BCEA 1WVYA 5CAUA 1H24A 5IPJA 3HX4A 4RIWB 5F95A 1XR1A 5GINE 4FIHA 4QQ5A 2ITWA 1JPAA 1PKDA 4IDVA 4OTPA 4TRLA 1Y8YA 3N4UA 3I60A 1YXTA 2VTQA 4JRNA 4YPSA 4QQTA 3RK9A 3BLRA 4B7TA 2OFVA 3IDCA 4BDJA 2GQRA 3F2AA 4ZZMA 5JT2A 4NCTC 4O0WA 1ZWSA 1CSNA 2JD5A 4KIQA 5J1VA 2RG5A 1W7HA 2W1DA 4YP8A 4EC8A 5TT7A 3IDPA 1G8SA 4I5MA 5IISA 4RIXB 3ZDIA 2WELA 4XV9A 1R78A 2UW6A 4U43A 3PJ2A 4IXPA 2EB3A 3KCFA 5CALA 4EZ5A 3A99A 2HK5A 4ANOA 1FVVA 3GFEA 4M84A 1M17A 2VTPA 3QD2B 3SRVA 5FBOA 2B9HA 4H3BA 4QTCA 4DFUA 4DC2A 4CTBA 5AP6A 4UB7A 3PY3A 4DCAA 3JXWA 3TUDA 2J6MA 2XP2A 3QTWA 4KBAA 4RSSA 3QWJA 1PF8A 4MAOA 4DFNA 1PMVA 4EH9A 4UWCA 3MWUA 3UO6A 3BHYA 3MN3A 3VIDA 4C38A 4RWLA 4LRJA 5BVNA 4AN3A 3S3IA 4FT0A 2AC3A 2XKDA 4BHNA 1TQPA 1YHWA 3I7CA 3IW7A 2BUJA 3ATSA 5HCYA 3SW7A 2YDKA 3BHTA 4QMSA 4TYHB 4DAWA 2ITVA 4XOYA 5IA3A 3VBYA 4LFIA 2OZOA 4YSMA 2PWLA 5DFPA 3LCSA 4C33A 4AS0A 4YGAA 3BBWA 2EXEA 3W18A 4BCPA 3ZLSA 4CG8A 5HX6A 5HIBA 3F61A 1WBWA 3UYSA 3C9WA 4ITJA 4L8MA 3MIAA 3QTZA 3VHEA 3FLSA 1VEBA 3G9LX 3O71A 4I4EA 4QP6A 2B52A 5AAFA 4ACCA 5HHWA 4F7NA 5IZFA 2PVFA 3WF9A 4A07A 3VC4A 3EN6A 3VF8A 3G15A 4YJQA 4ANQA 3LMIA 2Y4IC 3QRUA 3MVJA 4XHKB 2YIQA 2ONLA 2XNPA 3LFFA 2PHKA 3D0EA 4LMNA 5L8KA 3C4XA 3T3UA 4MEDA 1H1RA 2XZSA 4M13A 3EQCA 3WYXA 4IB3A 5LXMA 2PU8A 1OZ1A 2JGZA 4JVGA 3TCPA 1PYXA 4HVHA 5HIEA 3F82A 4CV9A 4USEA 4U3ZA 4IX3A 4ALWA 4EC9A 2F7ZE 2OG8A 3D7TB 3DB8A 2VTMA 2CPKE 2QO9A 3SOCA 4L44A 4Y72A 3FLYA 2BDFA 5AV4A 3D5VA 4JX7A 1U54A 2JBPA 4NIFB 3RM6A 5KMOA 4H05A 1PXIA 1YXUA 5HVYA 3FKLA 3E8NA 3QLFA 4QMZA 4D58A 2YWVA 1U5QA 3DZOA 4EKKA 4MQ1A 3DOGA 4D55A 4DYMA 1UNLA 1S9JA 4U41A 5HQ0A 3GT8A 2UW5A 4YJTA 1S9IA 1QL6A 3D5UA 4QPSA 5DI1A 4NM0A 4TNDA 1J7IA 4I92A 4JG8A 4V0GA 3G6GA 5DR2A 3ITZA 3L9NA 4RFYA 5FG8A 4BCHA 3BE9A 2IPXA 4L46A 1GIHA 3HAMA 3SX9A 3KU2A 2JIVA 3C7QA 4ZTHA 4FNWA 4AGCA 4KUJA 1OKVA 4ASZA 2VO7A 3GOKA 5CANA 4AT5A 1JSVA 5CT0A 4CEGA 3FL5A 3R30A 2VAGA 1O9UA 3AGMA 3BLHA 2R3HA 3PY1A 1WMKA 3FBVA 3DAEA 4XV1A 3JY9A 2C6LA 3DQXA 4RG0A 1KV1A 3W2RA 4FIJA 4UZHA 2IN6A 2UVZA 3CTJA 1WZYA 2XIXA 1OL7A 2XIKA 3QGWA 4IADA 4QTBA 2VNYA 1NVQA 3MJ2A 4N0SA 3GU6A 2X2LA 2WMVA 2I0VA 4XP2A 5JGAA 4L3LA 3C51A 3WZEA 3Q9YA 2XBJA 2BZHB 2C6TA 4EHZA 3QRTA 2XCKA 5IQAA 4B9DA 5H8EA 1B38A 2IVVA 4BDCA 4U44A 4WIHA 1W98A 3V01A 2B54A 5FQDC 2F49A 4OW8A 1V1KA 5EDPA 3K3JA 3NSZA 4I6HA 4JL9A 4KSQA 5CWZA 3EYHA 4C4FA 2XNBA 5C01A 3LFCA 4HYUA 3UOKA 3WF6A 5A6OA 1JKTA 5IU2A 3A60A 4MBIA 2JKKA 4YSJA 3TT0A 2FSOX 3ZCLA 4L01A 4G3DA 5EI6A 2RSVA 4CFWA 5EW9A 5AP4A 4Q5EA 4PNIA 3TNQB 2ZMCA 4IW0A 3TL8A 3WIGA 4HGSA 3RNYA 2HW7A 3ZONA 4D2SA 5JFSA 4IE9A 5ACKA 3JS2A 3UO4A 4O7VA 2C3KA 5CEOA 2GU8A 2UZUE 3FMJA 4GEOA 3NVKI 3RALA 4D2RA 3OWKA 4F99A 4R7BA 4M3QA 3F5PA 3SG9A 3I5ZA 3U4WA 3U54A 2ERZE 3MS9A 4BDBA 1QCFA 3KXNA 2R3OA 2PK9A 5I9YA 2OI4X 5DE2A 3VAPA 5A4TA 1PXNA 2QOBA 4BCIA 4IC8A 4YZMA 1WFCA 5C1QB 4EZ7A 2WIPA 1CKJA 3W8LA 4CD0A 3F7WA 3E63A 4IWDA 4F6SA 4L42A 1OL6A 3JUHA 2C6MA 3PZHA 3BQCA 3FQHA 4D0XA 5E8XA 4EOQA 4EONA 5H8BA 5T3QA 3NIEA 3SG8A 5EK7A 3CS9A 3UG1A 4EHVA 1DAWA 3QC9A 5AM6A 1NW1A 3A61A 4D4RA 3W55A 2FSMX 5IA5A 1H28A 4P90A 5BVKA 3FLQA 4WG3A 3NX8A 4GYIA 1OIRA 1FVTA 2RL5A 4XV3A 5HG8A 5L6WL 4XJ0A 4BYIA 1PRYA 4O6EA 1MQ4A 3RPRA 2W06A 2WTJA 2W0JA 3ZH8A 3C4ZA 4XRJA 3OW3A 4AOTA 4GSBA 2IJMA 5BVOA 2UZTA 3BHVA 3DTWA 1H1PA 3ODYX 4HZSA 4F0FA 1FGIA 5M4CA 3KF7A 3R73A 4R6VA 3R1SA 2XMYA 2ZJWA 4M0ZA 3DKFA 3COMA 3IW6A 2HWPA 5HLNA 2FUMA 3KRWA 4O84A 1FMOE 2PZIA 4QQJA 3BRBA 3HRBA 4MCVA 4D2VA 5DH3A 5CASA 1IRKA 4O82A 1UU3A 2QLQA 2C4GA 5DEWA 4O2PA 2WD1A 4JG6A 4ZSGA 3EQIA 4ZTNA 4FV6A 4NCTA 3V5LA 2IW6A 3DJ6A 4FKTA 3FXXA 4MD8E 4KS7A 4WD5A 3QCXA 3FHRA 4K77A 5CX9A 3ZXTA 5KBQA 5D12A 3RI1A 3U6HA 2W1FA 2VRXA 4FOBA 4Y95A 3PJ8A 4X2GA 3A7IA 3R1NA 2X9EA 4YLKA 5DLSA 2EXMA 1B6CB 2JAVA 3TTIA 2PULA 1YXXA 3PA3A 3PG1A 3Q53A 4X21A 5AR4A 1BI7A 4Q9ZA 4HZRA 1XBAA 3P7AA 4LI5A 4LG4A 3OWJA 4BDDA 2BKZA 3VS1A 4DH7A 2QVSE 4OTGA 3UNKA 2WMSA 3TACA 2VWVA 3RAKA 4N4SA 2VGOA 3H10A 3SC1A 3MH3A 4NK9A 4EQMA 4CKIA 3OP5A 2VD5A 3WZUA 3KEXA 3MFTA 3LXLA 4ANSA 4QMMA 3I0OA 1R3CA 3Q52A 4FSZA 4IHPA 4XBUA 4TWCA 3WZJA 5KMIA 3AC2A 4I20A 3OWLA 3ZO1A 2Z8CA 3FLZA 5JRSA 4FV5A 3ZUUA 4CFUA 4IAKA 4IVDA 4H36A 4DBXA 5AX9A 2BVAA 2IO6A 2QHNA 4BI2A 4EYMA 1JOWB 4Z55A 5E8VA 5C9CA 3EFKA 4PL4A 4PP9A 3FEGA 3ZMMA 4JOAA 2CDZA 4YR8A 1ZAOA 2OF2A 3OXIA 1UA2A 4NKSA 3HVCA 4MXOA 3LJ2A 3RINA 3EWHA 3DK6A 2EXCX 4AZTA 3WF8A 2VWZA 3DJ7A 4E4LA 1WBNA 1Q3WA 2LGCA 2HW6A 3OW4A 2BTRA 3AC1A 3F3WA 4IZ5A 5A4QA 4JQEA 3E8EA 5FEQA 4AGWA 4IJ9A 3OD6X 4U81A 3DAJA 3LQ3A 2C68A 4U97A 3ZEPA 2R2PA 2FSLX 1X8BA 5HCXA 4BL1A 5KZ0A 3ULIA 3CTQA 1MQBA 2XEYA 4KD1A 4DEIA 4LGGA 3BYMA 3EJ1A 3UIMA 1OUKA 1SVGA 4NJ3A 4RFMA 5CSXA 3TEIA 5IH6A 1OIQA 2GNFA 3R63A 3LE6A 3D94A 3MPTA 3PZEA 4HYIA 4MD9E 4P5QA 3IS5A 2OJIA 3CKWA 3DXNA 4O6LA 1H1SA 4XX9A 4ZY5A 3PJCA 5KX8A 4FI1A 4DG2E 2Y8OA 5E8WA 4QYYA 2QLUA 5J79A 4ALUA 3Q4CA 5BQ0A 2YJSA 2E9OA 3P7BA 4J1RA 4LQMA 3QYZA 3L9LA 1SYKA 3FMLA 1SNXA 4KBKA 5E8TA 1PJKA 2O5KA 3VUKA 2VTLA 4CYJA 2PUUA 3QCYA 4KWPA 3MFSA 4FTNA 2WQOA 3R9HA 4AE9A 4CMUA 3ZC5A 3LCKA 3UOJA 4M14A 4O0XA 2UZDA 2F7EE 3GVUA 4JG7A 3E5AA 2WMTA 4NM7A 1YW2A 4UV0A 3O51A 4J96A 5CU0A 3TV6A 4RIWA 2GNGA 1WCCA 2ZB1A 1VJYA 3V04A 2AUHA 3ZO4A 4QMNA 3WF7A 3VBQA 1YVJA 5EQEA 4PPBA 3BI6A 3UZPA 2ITNA 3GBZA 5AV0A 3R9OA 3EMGA 3Q5IA 2GSFA 3DDQA 3I5NA 5HBEA 4Y83A 4IH8A 3BPRA 3O8TA 4IACA 3ZUTA 1ZYJA 3KF4A 4R1YA 2IVUA 2PZRA 3Q4TA 4PQNA 4PTCA 3K2LA 2W7XA 3OXTA 3OCBA 5IQBA 5AIRA 3D5WA 4LL0A 5J5TA 2NO3A 4PP7A 3OROA 2IZTA 1I44A 1OL2A 3DU8A 3LFDA 4H1JA 4RFZA 3ZDUA 4AW1A 1LPUA 4FYOA 4RIXA 5AADA 2OLCA 5CVHA 5GIOE 3Q96A 2W1CA 4Q2AA 4FV1A 4RT7A 4FC0A 4L6QA 4QTEA 3ALOA 5K3YA 3IW8A 5AUVA 2YLFA 4FK3A 3MY0A 2CNQA 2W4OA 4O0SA 4R5YA 3W16A 4EBWA 3L8VA 4U9AA 2OXDA 1OL5A 2XNNA 5H9BA 4CZUA 2OJ9A 5BYLA 4XG3A 5L2IA 4TT7A 4TYIA 2BCJA 2WMUA 4GS6A 4N6ZA 4Q5HA 2J0LA 2P55A 3QYWA 4QMQA 1HCKA 4ZMEA 3MDYA 3CPCA 1ERKA 3EQBA 4W8EA 4KABA 5CF4A 3LPBA 3MVHA 3O17A 5CSHA 3E8DA 4C2VA 4DLJA 4F9CA 2Z2WA 4GL9A 5IQIA 4BWKA 4F7SA 4TWNA 5EI8A 4CZYB 5D11A 5E8ZA 3Q60A 2C30A 4MXAA 2Z7RA 4GFGA 1M14A 3B8QA 1VYWA 4WRGA 4TYHA 3LM5A 1BX6A 4FUYA 4PUZA 1OGUA 4AOIA 4O7ZA 3DK7A 4LGDA 3CD3A 2PVLA 1U4DA 3L1SA 2PTKA 5HIDA 5HVKA 1H27A 1FBNA 3UZRA 2C5OA 3ODZX 4HGLA 2J0IA 5EQYA 1Q3DA 4C0TA 3NW7A 3H0YA 4NT4A 5E90A 2J0JA 3KN6A 3MTLA 3ORMA 2RFEA 2B53A 5J95A 2A0CX 4J97A 2Z02A 3ET7A 2ZB0A 3OT3A 3T9IA 2VWBA 4BCGA 3E92A 4FKPA 3OEZA 5E7RA 4BBMA 3EYGA 3ORZA 3RJCA 1XH7A 4LMUA 2DUVA 3LQ8A 3Q4ZA 3Q04A 4C4JA 3MGYA 3PRIA 5GZAA 5C4LA 4ITIA 4C59A 4CRLA 2JKMA 4RX8A 4UWBA 5HE2A 3EZRA 4BICA 3RPYA 4I6FA 4ZSEA 1Q8YA 3II5A 3UGCA 5CXZA 4QMPA 4JNWA 5M57A 3KXMA 3DY7A 3R2BA 4IAAA 3SXFA 4HVSA 2OF4A 4EL9A 2XB7A 2I6LA 3AOXA 3REPA 1NT2A 3FMEA 4WBOA 2QHMA 4F0IA 2CGXA 1M7NA 2YJRA 5E8SA 3DFCB 2H96A 4ZJVA 1TQIA 3D7TA 5L3AA 3MSSA 2FVDA 2WFYA 2WIHA 4GK2A 4NTTA 1H07A 1MP8A 3KMWA 4GIIA 4A4OA 3BYOA 3FE3A 2WOUA 4JBQA 4YJVA 4NIFA 4I21A 3PXQA 3D9VA 1O6KA 3C13A 3N9XA 4S30A 2OZAB 3AT4A 2FA2A 3NPCA 3CR0A 5DR9A 4KBCA 5LVNA 1J1BA 2OKRA 4AA0A 4HPUE 4CSVA 4ORKA 4FKJA 2YAAA 1JSTA 3OBGA 2G2FA 4BCQA 4KKHA 3R8UA 1W83A 4BDEA 1KV2A 4FKOA 1BL7A 3H9FA 4O91A 3OMVA 3V5JA 4IQ6A 3RPVA 1PMNA 4U80A 3IONA 3QKLA 3R7OA 2QD9A 3PTGA 1PXKA 5C26A 3V5WA 1LUFA 5H2UA 1ND4A 5JZJA 3ZXZA 3RK5A 4JBPA 3UYTA 4DFBA 3EQGA 4HJOA 4ZTRA 5K5NA 1JKSA 3MVLA 4FTTA 3WILA 1XJDA 2Y7JA 4FTQA 4QMYA 4R77A 1W82A 1WVWA 2X2MA 3OVVA 4ITHA 1ZYDA 2JFLA 3NUXA 5DBXA 3ID6C 3I79A 2PMLX 5HVJA 1ZOHA 2YCQA 5ETFA 5GZ8A 4QP9A 2F2CB 3KXGA 4PMSA 3PY0A 2WEIA 2YACA 3CKXA 1Q97A 1L3RE 3MW1A 4EH2A 3AC8A 1YDRE 4MD7E 2QOKA 3THBA 2OU7A 5FP5A 4YZDA 2PZ5A 2C6EA 3OCSA 3DTCA 3LMGA 2J2IB 2E9NA 3G0FA 3HDMA 4HW7A 4R3PA 4UMRA 2GS6A 4NFMA 2OSCA 2WO6A 3NUSA 3P1AA 3OY3A 5CSWA 5F4NA 5AX3A 3R6XA 4C02A 4AZFA 4G34A 4TN6A 3QXPA 4NWMA 3OG7A 4TTHB 4YU2A 4YTCA 5ANEA 4CYIA 2WQEA 4BGHA 5D41A 2GS7A 5C8MA 4BKYA 2JC6A 3DV3A 2XK3A 4FE2A 1BYGA 3FYKX 4MTAA 3RHKA 3UBDA 2IVSA 4BF2A 4YZ9A 5ANOA 2J50A 4FG8A 3PE2A 4X3FB 2IW9A 5IG1A 4LV5A 1LEWA 3LFBA 4D5HA 4RA4A 2A2AA 3PSDA 1H26A 2YM3A 3N51A 4TYGA 5HG5A 4PDYA 4AFEA 3PJ1A 3KL8A 4OT5A 5GNKA 3V5QA 2IW8A 4U0IA 4W9WA 2C5NA 2I0EA 4JBVA 4KKEA 2CKEA 3I7BA 4FKIA 5DWRA 2CGUA 3LZBA 3U4UA 2OJJA 2CMWA 3IW4A 3R22A 4BGQA 4C57A 2JIUA 5CF5A 1OBDA 3DKOA 1K3AA 2PZPA 1J7UA 2VTNA 1MRYA 1OM1A 5LVLA 3ZUVA 4B4LA 4S2ZA 4CXAA 5EH0A 4KKGA 1OB3A 3S4QA 4FVQA 4RJ4A 4EJNA 4D4VA 4N57A 3AMAA 3R9NA 4D2PA 2YLEA 4FA2A 4OLIA 2REIA 3QZGA 5CZIA 5JGDA 2YM7A 4IMYA 4MK0A 5L2WA 4MQ2A 2GHGA 5HLWA 4G9CA 4C34A 3F7ZA 3F9NA 2XIRA 3PXKA 1YWRA 4GYGA 2PE0A 4EOMA 4FKSA 1Y8GA 4JAJA 5BUJA 3E93A 4A9YA 3DB6A 5JFWA 5HLPA 4DA5A 4G16A 2C3LA 1OI9A 3F5XA 5FEEA 4WNPA 4C3PA 3ZO3A 4GRBA 4FT5A 2EU9A 5AAGA 3FKNA 4HOKA 5EDQA 4EH3A 2WKMA 4F1OA 4DGLC 2VX3A 3COHA 4FKQA 1JKLA 3LXNA 4JBOA 5AA8A 1SVHA 4PNKA 1Q5KA 4KIKB 4OUCA 3ZS5A 1F3MC 3VWAA
chains in the Genus database with same CATH superfamily
5JQ5A 1W8CA 1YXSA 3O96A 3DBDA 3IPHA 5D10A 3UQGA 3NUPA 3FHIA 4CV8A 4AW2A 5KHWA 3PUFC 3LHJA 3ZSHA 1R1WA 2VUWA 4ZJIA 3ZSGA 3KREA 2CHLA 5EHOA 1UU8A 3WI6A 2ZAZA 4RJ5A 1ZLTA 2XIYA 2VZ6A 1RJBA 3ML1A 4H58A 3UDBA 5A4LA 5KHXA 1Q99A 2PMIA 4U45A 4AUAA 4FGRA 4FT9A 4XS2A 5IEYA 1H4LA 4DEGA 2OJFE 2F9GA 4I41A 4O0RA 3UNJA 4BWXA 3SKCA 4YUQA 3QD3A 4DF3A 4FSYA 5IQCA 1OECA 1URCA 4AG8A 2BZKB 1ZZ2A 3FC1X 5ACBC 4E73A 2QG5A 3D2KA 2C6IA 4KNBA 3TM0A 2X6DA 3Q6WA 3QHWA 4BB4A 4EUTA 2P3GX 4TXCA 2WQMA 4UYAA 3GFWA 4YHTA 2R0UA 2BDJA 5L6PA 2RGPA 4IVBA 2C6KA 3EQHA 5FTOA 4E4XA 2UZNA 4EOKA 4PPAA 2PY3A 2PUPA 2FGIA 4PDSA 3NZ0A 4EZ3A 3R8PA 1G8JA 1ST0A 1G5SA 2V7AA 3MJ1A 3OFMA 4IDTA 3POOA 4NM5A 4B8MA 4XRLA 4BWPA 4C62A 2PYWA 1STCE 3O50A 2HAKA 3EH9A 1W2DA 3W0MA 2JITA 4ACHA 4X3FC 4PF4A 5KMNA 5HOAA 3FJQE 4FEQA 5DRBA 3W1FA 4Q9SA 3BU5A 5GZ9A 2ITPA 3ZC6A 4HVIA 4FNZA 4ZSJA 3QZHA 4ZJJA 3UVPA 5TF9A 3BGQA 3E7OA 3NRMA 4O38A 5K0KA 4R78A 1CDKA 3RZBA 3OTVA 3OF0A 2AYPA 4G5JA 5DT3A 4E6DA 1GIJA 2CLXA 4DEBA 3R7IA 4XUFA 2XK6A 3IQ7A 4FSWA 3POZA 3HUCA 4H39A 3VUGA 2OO8X 4IZAA 1IG1A 3HGKA 4IAYA 4O0VA 4WHZA 1YKRA 2GPHA 3IDBA 1Q8ZA 3FY2A 2VTIA 3R02A 4FX3A 4GJ3A 3QZFA 5ANJA 3DPKA 4BTFA 3R1QA 4B99A 3FZTA 3PA5A 2IZRA 4ASDA 4BIEA 1UKHA 5FGKA 5KMLA 5AFVA 4NU1A 2WXVA 4AXCA 3KB7A 4EK5A 4B0GA 1VZOA 3QZIA 4QMXA 2VWXA 2XK4A 4RQKA 2BR1A 3VUTA 2XJ1A 2R7IA 3BEGA 3FI3A 3NLBA 4G3GA 2I40A 4FEWA 2X8DA 3VONA 5IDPA 2XF0A 2C69A 3HV7A 2X8EA 4V04A 3W32A 3KULB 2WMAA 4RRVA 1R39A 2GHMA 2VGPA 5DT0A 2VX1A 4HYHA 3UNZA 2VTSA 5C03A 3C5IA 4ZY4A 3MB6A 1WBOA 1ZMWA 2R3NA 1BLXA 5AM7A 1UWJA 4ACMA 3OUNB 3ANQA 4C4EA 2G01A 2R0IA 1BMKA 2V7OA 5FM2A 3VBTA 4DINA 2PUNA 4ZSLA 2G15A 5HGIA 3H9RA 1ZY4A 3K3IA 2J9MA 3D83A 1HCLA 2VO6A 3HEGA 4GT3A 1K2PA 4IVCA 5AP5A 2V22A 1HOWA 4XP3A 2KULA 1YXVA 4DH3A 4RC3A 4FTIA 4RMZA 5IA4A 4I0TA 4BFMA 4EOJA 3AKLA 2YIYA 3O23A 3P79A 1J91A 3PE1A 3HV3A 4XG7A 4OTHA 3PPKA 4MHAA 2CNVA 4GV1A 2HXQA 3PSCA 3PIXA 3VNTA 3PJ3A 3TUCA 5M07A 2VWYA 3KC3A 4UXLA 1GZNA 3HECA 2FSTX 4M69B 1XH4A 5CVFA 2BILB 3F69A 3MPAA 1E1XA 3V6SA 2Q0BA 3KKVA 4ZLYA 4TPTA 3BKBA 3LKMA 3R28A 4L3PA 3HL7A 5AUZA 4BN1A 3UMXA 3PWDA 4QD6A 3EQPA 4ZP5A 1KWPA 3MH2A 1XH9A 4B8LA 3PP1A 5B7VA 4RX9A 1WAKA 4EOPA 4GK3A 1YI4A 4C2WA 3B2TA 2BRHA 2BTSA 3PXZA 3LVPA 4ERWA 1O6YA 3AXWA 3FV8A 2R7BA 1OPLA 3PIYA 3TZMA 4QNAA 2ETKA 3FAAA 3IECA 2XNOA 2H9VA 3K5VA 5KBRA 4WKQA 2WNTA 3GU7A 3QA8A 2HZIA 2YITA 2VWIA 3FQSA 4I22A 4XP0A 3WOWA 4DE4A 3MH0A 4PMTA 5JN2A 5BVEA 5EQPA 4R3RA 4S32A 3O7LB 1PXLA 1OBGA 5EKOA 5HO7A 5AP7A 4APPA 3IW5A 4MF0A 2Y9QA 3EB0A 4RIOA 4BJJA 3W2QA 3EZVA 3O0GA 4I1ZA 4FKVA 1XQZA 4J95A 3SAYA 3UC4A 4FKGA 3MVMA 2WTIA 5CVGA 5B2KA 1DAYA 4LDTA 5JKGA 4L53A 3AKKA 2QOLA 3QTUA 2BALA 2HY0A 4QPMA 5L8JA 5CENA 4ASEA 5BPYA 2OXXA 3HRCA 4I3ZA 3PVGA 3OBJA 4ZAUA 2R3KA 3KCKA 5M4UA 2F7XE 3KY2A 5K0XA 5IA1A 2UW3A 1PHKA 4WSQA 3MFRA 4I0RA 4AACA 4BC6A 3L8PA 2CKPA 2J4ZA 2J5FA 4UBAA 2IZSA 3TN8A 3LQ5A 2VTJA 1ZYLA 5FD2A 2UW4A 4M97A 4RIYB 4IC7A 4RJ3A 5M4IA 2X6EA 2QKRA 4FG9A 1OPKA 3VBWA 1PKGA 4EHGA 4JQ8A 4BDIA 4FMQA 2XKFA 4DHJA 5ETIA 3U8WA 4X2KA 3EN9A 3MH1A 3BWFA 4AE6A 1NVRA 5HCZA 5F20A 5IMXA 4G9RA 3NNUA 4FBXA 4LOPA 3ORXA 5EHLA 5IKWA 2J0KA 4CT1A 3QBNA 3FI4A 4U3YA 2AQXA 3VS2A 3QU0A 4I24A 2R3MA 3FLNC 4J98A 5EFQA 2Z7SA 2C3IB 4MNEB 4BZNA 2OWBA 2JEDA 5CAOA 2C47A 5HORA 5IH4A 5TE0A 3MESA 2C3JA 3VQHA 1BKXA 3NDMA 2HZ4A 3TDVA 1H00A 1BL6A 2VTRA 3FXWA 3PG3A 4NKAA 4QDEA 2OICA 2OZAA 3R2YA 4K11A 1Q61A 2Z7QA 3BU3A 3E7VA 4FRFA 5KO1A 4DH8A 2HWOA 4PPCA 5DN3A 2WOTA 4W4YA 4GIHA 3TUBA 4I6QA 4JAIA 4IJPA 5FDXA 2EUFB 4FK6A 4V01A 3H4JA 3EOCA 3QAME 4IZ7A 2YIRA 3Q9XA 3P7CA 4EI4A 3CY3A 4KRDA 4MXCA 5BUEA 5EYKA 3NNVA 3OHTA 1XKKA 1REKA 4D9TA 1A9UA 2XRUA 3BBTB 3CBLA 2BIYA 4QO9A 5AP1A 4FZ7A 5AP3A 2AEGA 4O2ZA 3SVVA 4IWQA 4P2KA 1Y6BA 2CLQA 2ZMDA 5AEPA 3RKBA 3VVHA 4EUUA 4ZOGA 2B1PA 2C1BA 4L9IA 2PMNX 4YHFA 3DNDA 5HU9A 2WTKB 1Z9XA 3TV7A 4Z3VA 2H6DA 1M52A 4RPVA 2FH9A 2HCKA 3DS6A 4IBMA 2QONA 1SNUA 2X9FA 4G6OA 3PXFA 3ANRA 2KTYA 4O7RA 4I0SA 3JPVA 4TKSA 4DHZA 2EB2A 2YCRA 3EN7A 3LOKA 4XG2A 3NGAA 3OUKA 4IAZA 4H1MA 3ZM9A 4X6RA 3AC5A 5HZNA 3BU6A 3COIA 5J7HA 2BMCA 4E6CA 3IGGA 4C37A 4F08A 5HD7A 2ITOA 3EN4A 5EYCA 3RP9A 4BKZA 4YURA 4L7FA 3UTOA 4ZTMA 5JQ8A 4EK4A 1SM2A 4IAIA 5CLPA 2YIXA 4FKRA 1M2RA 3W33A 3BELA 3DZQA 4FT3A 5IUGA 3DLSA 5T68A 2BAKA 3Q6UA 5IQDA 2I1MA 1UKIA 4C58A 1IASA 5AA9A 5KCVA 4O7WA 4YJRA 3HP5A 3MBLA 3L8XA 4AQKA 3NUYA 3QCSA 4ZS0A 4GT5A 2J7TA 4YLLA 3FZ1A 5HNIX 3UODA 5CU4A 3DBCA 5JMSA 4EOSA 3D14A 2CCHA 1H0VA 3V3VA 3RM7A 3UC3A 5I4NA 5CNNA 4BDHA 2YA9A 4TY1A 1GOLA 1OVEA 2NRUA 2YN8A 5HE3A 3CQEA 4C8BA 4DITA 2F4JA 2QR7A 3E3PA 3P23A 2BDWA 4X3FA 4FV4A 4FIGA 3HMNA 3U55A 4WBBB 3KK8A 2WTCA 3MA3A 3UOLA 4GT4A 3H3CA 3TWJA 4FV2A 3MY1A 4HGEA 4IFGA 5A9UA 3E64A 5CF8A 1MRVA 2NP8A 2C6DA 4KB8A 2YERA 2ETMA 4D2TA 5LMBA 5HI2A 2OIQA 3R83A 3QX4A 3ROYA 1CM8A 3R7GA 5DEYA 2UV2A 5KE0A 3EFJA 1L8TA 1G3NA 3ENMA 3OC1A 3TG1A 2OH0E 4UMUA 4WNOA 3LXPA 3W2OA 3KXXA 4F4PA 1GNGA 3SQQA 1P5EA 4O81A 4CZTA 4E5AX 3HRFA 2A4LA 4FZAB 4R8QA 4F65A 5J9YA 4D4SA 1W2CA 4YO4A 4M7IA 3EQDA 4YBJA 4ANMA 4GVJA 2DQ7X 3A7HA 3EQFA 3FZRA 3PSBA 2NNWB 4AZSA 4YNOA 2VTTA 4AZEA 4USDA 1YDTE 2W17A 4BBEA 4BY9E 4N70A 2W9ZB 5AV3A 2QOHA 3UDZA 5LCJA 1OITA 4DG0E 4ZTQA 3DGKA 3QQUA 5CU2A 4KAOA 5I5ZA 4AGDA 3HUBA 2W9FB 1W84A 4CQGA 3PUPA 4S31A 2WQNA 5HD4A 2IVTA 4W4WA 1W0XC 3GC9A 4BGGA 2ITUA 4XYFA 3BYUA 1UNGA 4YJNA 5LMKC 4X2JA 5CSVA 5EW3A 5IUIA 4BBFA 3MB7A 2BRNA 2V5QA 3PYYA 4QMVA 4ZLZA 3RWQA 5IEVA 4AA5A 3MI9A 4F6UA 2IWIA 3WARA 1KE7A 3EKKA 3FSKA 4ZS4A 3M11A 3DT1A 3VUMA 4KIPA 4BI1A 3Q5ZA 5E4HA 2YAKA 5CQWA 2DS1A 2JDTA 4J8MA 2RKUA 3F3VA 5HTIA 4KIKA 2C5VA 3G0EA 3E88A 5AIKA 2GQGA 1PW2A 2WTKC 4AU8A 4CMTA 4PWNA 4DGGA 3P9JA 4DH1A 1JAMA 3QD4A 3AMYA 2JIIA 2QG7A 4OR5A 4DT8A 4FL3A 1TVOA 4F9AA 2UW9A 3UOHA 2ZM3A 3GQIA 3FYJX 3JY0A 5IQEA 2BRMA 4H3PA 1A06A 5CS6A 3UIUA 4AA4A 4TYEA 3VN9A 2Y0AA 3FWQA 4FTLA 4OTWA 2GFSA 5CU3A 5HTCA 4RLLA 5K9IA 3P86A 3PXRA 4J99A 3P78A 4Z16A 5BUIA 4QP3A 4QMOA 5HG7A 4AQCA 3NVMB 2HOGA 4HCUA 5TR6A 1FINA 5HEZA 4E6QA 4L3JA 5HNBA 1YI3A 5CAQA 4ZIMA 4E5BA 1YOJA 4LRKA 5BMSA 1A48A 4JJRA 3P0MA 5HE0A 1PXPA 4CRSA 5LWNA 1GJOA 1XHAA 2X7GA 3RCJA 1IA9A 2WU6A 5I9XA 3EHAA 3OT8A 4RWIA 4CTCA 3GC8A 3DBEA 4OTQA 4YC3A 5EHYA 5HBHA 4CLIA 3VJNA 4FTAA 4O0UA 4RJ7A 5FDPA 4MX9A 3KN5A 2QO7A 3LCTA 4O7SA 5HG9A 1I09A 1QPJA 3KK9A 2PZYA 2QOCA 5ETAA 5FWKK 3VO3A 3HMIA 4X6QC 4F1TA 5DA3A 3CD8A 3FI8A 3R8ZA 4TL0A 1OKYA 2QI8A 3PFQA 4YJUA 5AAEA 3LFAA 3TJCA 4BRXA 3GCVA 5HE1A 3JYAA 5IH5A 4E93A 4G31A 5LVPA 5BX0A 3PVBA 3GC0A 3LFQA 3UIBA 3HZTA 2BFYA 4YTIA 2CCIA 2ITQA 1YDSE 4RC2A 3QUPA 4QP2A 2XVDA 4FV8A 4RZVA 4PV0A 4ZZOA 5HESA 2B9FA 4OAVB 3NR9A 2RFDA 2ETRA 2J90A 4J52A 2QCSA 4QMLA 4CKJA 3QXOA 3LMHA 3ZBXA 1ATPE 2O8YA 3V8SA 5AJQA 4ZK5A 4QRCA 3LJ1A 5HO6A 3UP7A 3G51A 4D9UA 4RVMA 5M06A 3EQRA 2JKOA 1XBCA 2J5EA 3D2IA 3GCPA 3Q2MA 4AF3A 5CAVA 4CMOA 5JFVA 5IQFA 3UMWA 2Q83A 5EOBA 2ZDUA 3WF5A 3HV4A 1YWVA 4NL0A 1XH8A 2X81A 4A9RA 3RCDA 4NZWB 4P4CA 2PVKA 4AZVA 1OUYA 3A4OX 5FXQA 2GDOA 3CSVA 3KULA 1ZYSA 3GP0A 3Q9WA 2R3RA 1J7LA 3F3UA 3VJOA 3PPZA 4BDGA 3BEAA 5EG3A 3T9TA 4BR3A 3DA6A 4QYGA 2ITYA 3W8QA 3LFNA 3U51A 3M42A 2ITTA 4APCA 3HDNA 2HXLA 5DOSA 5DMZA 4GMYA 3QLGA 4NEUA 4JDIA 4OGRA 4DH5A 5IA0A 1RE8A 5B0XA 3GCSA 1ZXEA 3A8WA 3GU8A 3PVUA 5AUUA 3NAXA 2OW3A 3GENA 5I9UA 4EH5A 3QC4A 4PTGA 3HA8A 5A46A 3I81A 3ATTA 3VUIA 2ERKA 3WZDA 3R8LA 2YCFA 4RWJA 4ASXA 3PFYA 4BCKA 4KINA 3R00A 2W1ZA 3DBFA 4EK6A 2HY81 5I3OA 1ZMVA 3BYSA 5M53A 3M2WA 2W1GA 2Y6MA 3TNWA 3QFVA 4JRVA 2JDSA 4FSTA 4CFFA 2XJ2A 3QTIA 3PLAE 4ID7A 4DFZE 5CY3A 4DLIA 3SOAA 4WG4A 2O63A 4JI9A 2GS2A 3KVWA 3VRZA 5TO8A 2WQBA 2XM9A 3KXHA 4F9WA 3ORLA 4PTEA 5CQUA 4UMTA 4OBQA 4HNFA 1Q8UA 1KUTA 4FYNA 4DTKA 4YZCA 5LQFA 1J1CA 3F6XA 2F57A 3HV5A 4LUEA 3IOKA 4DEAA 4PY1A 2W4KA 1IR3A 1H1WA 1OIUA 5CXHA 4DTBA 4HPTE 4WRSA 5K4IA 5GJFA 4EWHA 4H3QA 4C36A 2VTHA 3PIZA 2XKEA 3CQUA 3F3TA 4UWYA 5D9HA 4E3CA 2WMQA 1U46A 1URWA 1UV5A 3I0QA 1RW8A 3ORIA 4FR4A 4IB0A 4W9XA 4D1XA 4DFYA 4F9BA 4O1PA 4BDFA 3FC2A 4O96A 1EH4A 3ORTA 4FV0A 1IA8A 4FV3A 2YFXA 2WTWA 2R3IA 4BZDA 3C0HA 3KRRA 4CGAA 2OK1A 4J7BA 2AC5A 3B8RA 2B4SB 2R3PA 4YC8A 4I5PA 4WNMA 3U6JA 1DS5A 4UN0C 3QHRA 3QTXA 5A4EA 1ZYCA 2BHHA 2VNWA 1YWNA 3EKNA 4ZTSA 1UVRA 1R0EA 5JH6A 5A6NA 2ESMA 3CJGA 5K4JA 3WYYA 4ACGA 4BTKA 3PRFA 2BPMA 4RX5A 4Y46A 4WA9A 4Y8DA 3BV2A 4I6BA 2JLDA 4O21A 5JFXA 2PVYA 5JRQA 3DLZA 5M4FA 4RVLA 4XG4A 1WVXA 4UXQA 4D1SA 2VU3A 2QO2A 1KE6A 5JSMA 4AXEA 3SLSA 2P0CA 4O0YA 1QMZA 3TNIA 2WMRA 4FSNA 4I94A 3HP2A 3RPOA 4AWIA 5HX8A 4CFNA 5KMKA 2XNEA 3TDWA 3OCGA 5KKRC 3TV4A 3CJFA 4EWQA 3SXSA 4BIBA 2P4IA 2Y4PA 3PPJA 1J3HA 1Q24A 4MXYA 4L67A 4AW0A 2W05A 4XG6A 4C7TA 5LJJA 3ORPA 2Z60A 3GOPA 2A1AB 4MVFA 3FL4A 4RIYA 5AWMA 4AXAA 4K18A 5EDRA 4ZEGA 4YZNA 5AR3A 3O8PA 2Z7LA 5H8GA 4XOZA 1H8FA 1GZOA 4NTSA 3RGFA 3S00A 3QQJA 5CF6A 1UWHA 3C50A 1REJA 1PXOA 2P2HA 3ACKA 3CXWA 3UPXA 2GNIA 4PMMA 5JEBA 1O6LA 4K8AA 5J9LA 5M44A 4DEHA 4MNEA 5LVOA 2QOQA 4E4MA 1OKWA 4FTJA 4AZWA 4DDGA 3CGFA 2PSQA 3VS4A 5FUTA 3PWYA 2WEVA 5BVDA 3MFUA 3G5DA 4WT6A 4XH6A 2C0IA 2QURA 4WNKA 2Q0NA 3ZLYA 3NCGA 3FSFA 3VHKA 4LYNA 4XCUA 2OFUA 4AW5A 2WTDA 3CIKA 2PVJA 5CNOA 2LAVA 3UJGA 3LM0A 3V8TA 3GQLA 4FTRA 3HA6A 3ZBFA 3W2SA 3V6RA 3ZO2A 4F6WA 1YHSA 4FICA 5GJGA 2YHVA 3ERKA 3OZ6A 4PX6A 5LMKA 2XEZA 2XRWA 3CQWA 2ZOQA 3D4QA 3AQVA 3D5XA 4RBLA 3ZRLA 2ZM4A 4YMJA 1Y6AA 1R0PA 2G2IA 4QYHA 4A4LA 5IDNA 4FSQA 5E91A 2BROA 2CSNA 5DHJA 2XCHA 2XJ0A 3ORNA 4UZDA 4E1ZA 3SW4A 3N4TA 4ACDA 1GY3A 4CCUA 2V0DA 4XMOA 2QC6A 1ZOGA 3P4KA 4FL2A 1KOBA 2PE1A 3RAIA 5FLFA 5EM7A 3C1XA 3CC6A 2CGWA 4DN5A 1RDQE 4RJ6A 2X7FA 2OH4A 3FZOA 3MPMA 3E62A 3RNIA 4L43A 4R5SA 4G5PA 4BHZA 2YM4A 4A4XA 3TZ9A 3RWPA 5J1WA 1TKIA 4IX5A 1Z5MA 3VS7A 4UMPA 4DFXE 3U9NA 3Q9ZA 2P33A 3H0ZA 1ZZLA 2UVYA 2YISA 4FZDB 1Z57A 4UY9A 3LAUA 3FPQA 4DHFA 3JR1A 4M68A 3VBVA 1VYZA 3E87A 4LUDA 4NSTA 4YJSA 3R7UA 3K54A 4EH6A 4OTFA 4QMWA 2B9IA 4HVGA 2H8HA 4G3CA 4F0GA 4F7LA 3BV3A 3VQUA 4R7HA 4F09A 2YEXA 2EVAA 2YDIA 2IG7A 3ZLXA 1XWSA 4ONAA 1NY3A 3FMMA 2BRBA 2G9XA 5A54A 1PXJA 3QWKA 4DFLA 3QQHA 3FQEA 4USFA 2WPAA 2O0UA 3H30A 3HMOA 4JT3A 3FXZA 3FKOA 5DT4A 3CE3A 5CYIA 3CGOA 5CTPA 1VLRA 4QMUA 4B6LA 4CKRA 4ANLA 4QT1A 3QQLA 4DT9A 1DI8A 4FTKA 4OBOA 3UQFA 4K0YA 1QPCA 1AD5A 2O2UA 4K9YA 4MXXA 3QX2A 3LIJA 4QMTA 4RGJA 4RVKA 3RK7A 4NW5A 3OTUA 2QODA 2R3GA 5CI6A 4ARKA 5B2MA 4ZTLA 5I0BA 4L52A 2E9PA 2W5AA 2QU5A 4OBPA 1P2AA 2GTMA 3LW0A 2R3JA 3G2FA 3NYVA 4FSRA 4FZ6A 3LXKA 5DIAA 4A06A 5AV2A 4ALVA 4FTOA 2XNMA 3BYVA 1NA7A 4CVAA 2PUIA 4FG7A 3CPBA 2HIWA 1F5QA 3DKGA 4Z9LA 2W96B 4IAFA 4DTAA 4ANNA 1ZY5A 3A8XA 3I6UA 3JVRA 2OXYA 2G1TA 1AQ1A 2WZJA 3TZ8A 4NH1A 4OT6A 4FSUA 4YBKA 4O27B 4BCOA 3UG2A 3BL9A 1CKPA 3R7YA 3FMDA 5IEXA 3AG9A 3NCZA 3NYNA 2C0TA 3IOPA 4CFXA 3C0IA 4O7TA 3FDNA 2QU6A 2QKWB 5M55A 5M51A 5DR6A 1QPDA 3KGAA 4CFVA 3R7EA 2C5YA 3BQRA 3HKOA 3RPSA 4L68A 4Y5QA 3ZFYA 1B39A 2G2HA 4LM5A 4EH4A 3O2MA 2RIOA 4IX6A 2V55A 4W4XA 5EOLA 2XH5A 2CGVA 4EOIA 3A62A 3NFGB 5AR7A 1M2QA 3A4PA 3UQCA 4QP7A 1XO2B 4BCNA 5DYJA 4O7YA 2W1HA 3MIYA 1AGWA 5BVWA 2X0OA 3U9CA 3W10A 3Q3BA 4MXZA 3RTPA 2XYUA 5AR8A 1WBSA 4AFJA 3AMBA 1MRUA 3RZFA 5AP2A 3WE4A 2CN8A 4R7IA 3TNHA 3OEFX 1KSWA 1YI6A 1Q8TA 3F66A 2R5TA 2XS0A 3GGFA 5DRDA 4PL5A 1YOMA 4EH7A 3ROCA 5AR5A 3GNIB 1LEZA 1PXMA 1SVEA 1RQQA 2WU7A 4UALA 4CNHA 4U40A 4YNEA 4EK3A 1FQ1B 1KOAA 3VW6A 2HYYA 3U87A 5BYZA 3PVWA 4XBRA 4CT2A 5BVFA 4ERKA 2QOFA 1GIIA 4IWOA 4UYNA 2YZAA 4JXFA 4IX4A 4JR3A 3EFLA 1SMHA 4MF1A 4IEBA 5EYDA 5F1ZA 1JVPP 2X1NA 1JQHA 4O86A 3DNEA 2X8IA 3EL7A 4FVPA 4UMQA 2Y6OA 5CI7A 5ETCA 5L2SA 2VN9A 2R64A 1FOTA 3I4BA 4BDKA 4DGMA 3V5TA 4FODA 2YIWA 3F88A 5HKMA 3CEKA 4HCTA 3R9RA 2PMOX 3QALE 2CJMA 3VUDA 4IFCA 2O65A 4KS8A 1H25A 3ALNA 3VS3A 2J51A 2X4FA 4FT7A 2ITZA 3R1YA 3C4EA 4RX7A 4M15A 4EQCA 4W8DA 1P14A 2SRCA 4FEUA 4FUXA 4F78A 3PDTA 2PVNA 4F70A 3BHUA 3FMNA 3I6WA 4N6YA 4P5ZA 4TZRA 5ANKA 2O3PA 4U42A 5E92A 4AGUA 2UZWE 3OOGA 3K5UA 5E1SA 2F2UA 3FPMA 3F2RA 3LCOA 4GG7A 4JIKA 4IIRA 4JR7A 5T6KA 1ZARA 5KZIA 2I7QA 1IAJA 1BI8A 3NS9A 1ZRZA 3V5PA 1M7QA 2WGJA 1ZMUA 4RQVA 5AUXA 3R9DA 4J71A 5KNJA 3QTRA 4FOCA 3UO5A 3KRXA 3TKUA 3B2WA 4CFMA 1V0OA 4CCBA 1KE8A 3S95A 4TWPA 5IUHA 4FGBA 4FNYA 1TZDA 1UU7A 2OIBA 3CTHA 4NFNA 2WTVA 4ZZNA 5AUTA 2XM8A 2XKCA 3GCUA 3FMHA 4G1WA 2ACXA 2HZNA 3U6IA 2XARA 2VWUA 3OCTA 3IKAA 5EM5A 2YM6A 4YO6A 4X3JA 4FNXA 3QUEA 5E9EA 5L6OA 5CZHA 1JNKA 5CAPA 5IQGA 5J9ZA 4EK8A 4PMPA 3FY0A 3MY5A 4AOJA 5FXRA 2E2BA 2YM8A 4I5CA 3C4CA 1WBTA 4RLKA 4FV9A 3O7LD 5HNGA 5A3XA 2YCSA 3ZSIA 3LLAA 4KRCA 4AX8A 3ZM4A 4FEVA 3FUPA 3UPZA 4JLCA 4XG9A 4A9UA 3O5AA 1QPEA 1SZMA 3DKCA 3CCNA 2W1IA 4IWPA 4QTDA 1FVRA 1VR2A 3ZFMA 2EWAA 3PLSA 4G6LA 5CEQA 3F5GA 5D7AA 1U59A 5HICA 1PMEA 3SRVB 5EKNA 4CLJA 4WSYA 5LMAA 1CMKE 3MYGA 3P5KA 4IM3A 5D1JA 4IB1A 4DEEA 3AD6A 3CP9A 2YM5A 5JGBA 3PA4A 4M0YA 4MWHA 3SA0A 4ENYA 2I0YA 2DYLA 3MV5A 4EHEA 2HENA 4S33A 2W99B 4QYFA 4F64A 4GUEA 3CY2A 5L4QA 3NYOA 4GG5A 4E7WA 1T45A 4WOVA 4XEYA 2ZV7A 2OBJA 3MA6A 4GJ2A 4OTRA 5EYMA 5CEKA 4RWKA 5AV1A 4BKJA 3SHEA 4IVAA 4BDAA 4GKHA 3R04A 4XG8A 4F1MA 2PPQA 3BLQA 2X39A 4FSMA 1CKIA 2VO3A 4MBJA 2VO0A 4YC6A 4GU6A 4ANBA 2QOIA 1MUOA 3NUUA 3NYXA 5BMMA 2IEWA 3GI3A 2ZDTA 4HVDA 3GC7A 4O83A 5CSPA 5C4KA 3QGYA 5AMNA 3VRYA 4FTCA 2R3QA 4YJPA 3UZTA 5M08A 1APME 4AN2A 1LR4A 4NM3A 4LL5A 4JDJA 5DNRA 2XK8A 3NIZA 3FI2A 5DVRA 4WG5A 3BZ3A 3DCVA 4MNFA 5IA2A 5L2TA 3G33A 4HCVA 5L8LA 3BHHA 5ICPA 1V0BA 4X0MA 1GAGA 3WE8A 5G6VA 2JKQA 3MTFA 1E9HA 5BNJA 3R0TA 5TKDA 3ZOSA 4PL3A 4RJ8A 4U5JA 3HAVA 3QRKA 3DQWA 1PYEA 2QOOA 4C4GA 4A9TA 1U5RA 4OTDA 2VTAA 5ANGA 4F7JA 3RMFA 4IANA 1YRPA 4HNIA 1FPUA 4ZLOA 2GFCA 3DFAA 3C5UA 3P08A 4ENXA 4IM0A 1H0WA 1Q41A 2X7OA 4JDHA 2FYSA 4QP1A 4GFOA 2H34A 4FL1A 4G17A 4D5KA 2BFXA 4EEVA 1YOLA 4J53A 2XBAA 1YQJA 4G3EA 3QTQA 2GTNA 2ZV2A