3ZBFA

Structure of human ros1 kinase domain in complex with crizotinib
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
281
Chain Sequence
IENLPAFPREKLTLRLLLGSGEVYEGTAVDILGVGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYIILELMEGGDLLTYLRKARMATFYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVKIGDFGLARDIYLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQLQLFRNFFLNSIYKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ROS
publication title Acquired Resistance to Crizotinib from a Mutation in Cd74-Ros1
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 281
sequence length 296
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zbfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zbfA01
2RF9A 3Q9ZA 1DI9A 3IECA 4NUSA 2PUUA 2HCKA 4ACCA 4OLIA 3R7GA 1NT2A 5BVWA 4AX8A 4EH9A 3WIGA 2EXEA 2I0VA 2X2LA 4W4YA 3UP2A 3UZTA 3MJ2A 3SQQA 4I94A 5DT4A 2NRYA 3DJ6A 2UZBA 4RJ3A 3LFQA 4WUNA 4LV5A 3IDCA 4LUEA 1LEWA 4TWCA 5EI8A 2C5OA 5HCYA 5BVNA 4PDOA 3Q6UA 3IK3A 4UXLA 3JVSA 4ORKA 5GIOE 2OFUA 4DITA 3LIJA 4EWQA 2Z2WA 4GK3A 4CRLA 4O91A 5KUPA 3FKOA 4OBOA 1NY3A 3R9NA 4BDCA 3GENA 3UMXA 2R3LA 5E92A 3LFEA 3RWPA 3UYTA 3LXNA 3MWUA 1P14A 4QQJA 1F0QA 4C61A 4AGCA 2QOQA 4S32A 2ESMA 4DCAA 5BVEA 4ZK5A 2YM7A 4ACHA 3TNPC 1J1CA 4J97A 4HZRA 4R6VA 4G9CA 5AUZA 3OBJA 2H8HA 4CKRA 1PF8A 4RT7A 3I5ZA 2C6MA 3OC1A 4C3PA 4UMPA 3PY1A 3MH2A 2EXCX 2O3PA 4G3DA 2PE0A 3VBWA 2VNWA 2PVNA 1OIYA 2OBJA 1WBNA 4QMLA 3FZ1A 4LRKA 1IA8A 2IW6A 4IM3A 3R1SA 4J96A 2H34A 5HOAA 4AE6A 3I7CA 3O8UA 4Q2AA 4U41A 3PXFA 3VJOA 2W96B 4QTCA 1IEPA 1QPCA 5FEQA 1IA9A 5DWRA 3LCTA 3P9JA 5E8WA 2BIKB 4O0XA 2FGIA 2PWLA 3KU2A 3VW6A 5AUUA 5I3OA 5J1VA 4R78A 2UZTA 5AX9A 4UALA 3NGAA 5ICPA 3V3VA 1H28A 3HV4A 4GL9A 2WQEA 2FO0A 4ASDA 1JSUA 5FTOA 5HORA 2X6DA 4V0GA 3AD4A 4F6WA 5AV1A 4I6HA 5E7RA 4B8MA 5DI1A 1Z5MA 3UNJA 4UYAA 3SA0A 5FLFA 5DRDA 5DVRA 4IAZA 3RM7A 4FT5A 1NVSA 3WF5A 5AA8A 1M2RA 4YJVA 2XNGA 1OI9A 3KN5A 2SRCA 4FODA 1CKIA 2X2MA 4CQGA 2VRXA 2BZJA 3NUPA 4DGNA 1SYKA 3AQVA 5AP2A 1PXKA 3NSZA 5CT7A 3MH1A 4N0SA 4AZFA 3PVWA 5CQUA 4A4OA 3QTIA 1YRPA 2XM9A 4U3ZA 4IZAA 4ZIMA 2UW8A 5CWZA 2WHBA 5CU4A 5EW3A 4IM0A 3PJCA 3ORIA 4XP3A 2X6EA 5G1XA 3ZRLA 3ZSHA 3PIYA 2BFYA 3QYZA 3BZ3A 4IW0A 3TJDA 1W84A 3W32A 2IN6A 4W8DA 4NYEA 3ZTXA 1WMKA 3MFTA 3Q3BA 1JOWB 2PVRA 4M7IA 5FD2A 1Q8UA 5FTGA 2YFXA 3IW7A 3KVXA 5GHVA 3QTZA 2PZPA 4CKIA 3LW0A 4IAAA 3TV4A 2FUMA 4DEHA 3VUKA 4O7WA 3DXNA 4RIYA 1OL6A 3Q4TA 3EQGA 4X3FC 4HVDA 4ZY4A 3VBTA 2W5AA 1XWSA 3NZ0A 4Q9ZA 4AGDA 2HIWA 4ZZNA 5K3YA 1H1QA 5ITAA 4L3LA 4RZWA 2WTKB 5ANIA 4I92A 1SVGA 4YHFA 1H1WA 2E2BA 5KX8A 2I40A 3UC4A 3EKNA 4YLKA 1LEZA 5JGAA 5LMKC 3F2NA 1XH6A 2B1PA 4I5HA 4MBJA 3NYVA 2YN8A 4R5YA 4WG3A 4XLIA 4QPMA 5J9LA 1URCA 4MD7E 5EDRA 2IWIA 4AW2A 1FVVA 2O5KA 3IKAA 1FBNA 2P2HA 2CHLA 3HAMA 4AW1A 4BRXA 5EK7A 4BTMA 4MD8E 3QTRA 5H8GA 3OFMA 5H8BA 3UIMA 3ZZEA 4YPSA 1YXVA 4NTTA 1GNGA 1UWHA 4PTCA 2XIRA 4P5ZA 1Q97A 3KB7A 5LVLA 2W1CA 4JAJA 3TL8A 5CSHA 5BUJA 4M66A 4FKTA 2BHEA 4G5PA 1NA7A 4NCTC 1ZLTA 5HI2A 4B4LA 4KAOA 2VN9A 4LGDA 1M2PA 3DTWA 1PXPA 3QRUA 5J9YA 4X7QA 3LFAA 3PSDA 4O7LA 2BRMA 3SLSA 3BLQA 3FLWA 3VS1A 2VX3A 2I0YA 3AT3A 1M7QA 4F6SA 1BKXA 3VULA 1OIUA 3HUBA 5JFWA 4M84A 5K4IA 5IA5A 3GVUA 1WBVA 1OPLA 4U44A 3VBVA 4XG8A 2ETMA 4RQKA 4IWPA 2XKDA 4HNFA 3CTQA 2WD1A 4X21A 4GKIA 4RX8A 5FTQA 1XR1A 2DQ7X 4O27B 2WOTA 1PYXA 3EOCA 3TTJA 4CCUA 2VTRA 4X3JA 1YXUA 2E9PA 4F63A 2WQMA 3FKLA 3GFEA 4GFMA 4QYFA 3HZTA 4DFBA 1VR2A 3E8NA 1W8CA 3RAHA 4Z3VA 3JUHA 2BRBA 1F5QA 2PY3A 2QODA 3DJ7A 3KCKA 4ZMEA 4BGQA 4PL4A 4MBIA 4D0XA 3KF4A 1J7IA 3ZZWA 4XEYA 2FVDA 2VO3A 3H30A 1STCE 1U54B 2XUUA 4A07A 2YCQA 4X2FA 5AM7A 3DKGA 4L8MA 3DBDA 3EQHA 2GQGA 2Q0NA 2XCKA 4QPSA 4RC2A 4G1WA 2GHLA 3DAKA 3F5GA 3HRCA 4RRVA 3OG7A 5M08A 4WNOA 4J8NA 2QOCA 2BALA 4OAVB 3LCDA 3OBGA 2VO0A 3EQDA 1APME 4EQUA 1J3HA 1Y8YA 4FV7A 3UMWA 4DEDA 5LJJA 2O2UA 2C0TA 5CANA 3NAXA 4MF0A 2YCSA 1R39A 4U9AA 5KMLA 3Q4UA 2X7GA 4G3CA 3KFAA 3PRIA 4MKCA 3WZUA 3DA6A 3TUDA 2YM5A 3E64A 2IJMA 4BF2A 4E73A 4FOCA 1GIIA 2PVKA 3KULB 3FZPA 2X1NA 2QO7A 3A8WA 3QX2A 4UYNA 3IGOA 3GXLA 4IANA 5AWMA 5K5NA 5C01A 3H9FA 5BYYA 4DEEA 4L67A 2C6EA 3COIA 3QF9A 3W1FA 5JQ8A 2XBJA 3F6XA 4RC4A 4IADA 4YHTA 4IXPA 5TE0A 2W5BA 5DR2A 4FYNA 4ACMA 4EKKA 3VS5A 2Z7LA 3TIYA 1Q41A 1ZARA 4Q5EA 3UOHA 3NUSA 1CMKE 3ZO3A 1H25A 1M7NA 3LZBA 3HV5A 4ZSGA 5DHJA 3L8SA 4BWPA 3H3CA 3RZBA 4LV8A 3C4XA 4FT7A 5AV2A 4KIOA 1PW2A 1ZXEA 4F7NA 3F3ZA 3QD2B 4M15A 1OKYA 2QOFA 4ZS0A 5M53A 4F9WA 4OTWA 2VTMA 4V05A 2VWXA 3S0OA 4O6EA 2GMXA 3ENMA 3ORLA 5ANEA 1JVPP 4AZSA 4F9CA 2ITWA 3L8XA 3VS2A 2WOUA 3BGPA 3C9WA 3LCSA 1GZNA 3OCSA 4D2WA 5HIEA 2QG5A 3R83A 4FSZA 4ZAUA 3HNGA 3R7OA 5CNNA 3S95A 4EOOA 5JKGA 4GUBA 2QU6A 3KK8A 4KIPA 4O2PA 4E3CA 2JKKA 3BV2A 3EN7A 2PE1A 1IAJA 3GU8A 4DH3A 2XK7A 3II5A 1OM1A 1S9JA 1MRVA 3LAUA 3VIDA 5I0BA 4PL5A 5KO1A 3HDNA 4F1TA 4U5JA 2REIA 5HX6A 5HZNA 3Q2MA 3RP9A 4AGUA 4ZTLA 3R9DA 2CCHA 4C2WA 4XP2A 3R7VA 3CKWA 1OUYA 1QPJA 1SZMA 3OW3A 1Y57A 2H6DA 3D2KA 4L6QA 2YERA 4TPTA 4GJ3A 5TKDA 4FKSA 1UKIA 3UTOA 4FEVA 3TM0A 2QR8A 5CSPA 5IF1A 4RX5A 4J95A 4KA3A 3ORXA 1ZMUA 3TJCA 2PVJA 4FNWA 1ZMWA 2YLFA 4OGRA 4PPCA 5CSXA 3F2AA 1OKVA 2C69A 3BHVA 4IH8A 4RMZA 4ZTQA 4DBNA 3BHYA 4YJPA 1KE6A 3HECA 2B55A 3BE9A 3GNIB 3MY1A 5D11A 5D41A 3TEIA 1UNHA 5IA2A 2B9IA 2PZIA 3PXKA 4H36A 4BIEA 4H05A 2R3QA 3DK6A 1G5SA 1M2QA 2GU8A 3U9CA 4EKLA 1KUTA 3Q2JA 5AR3A 4J99A 1U4DA 1P2AA 1WBSA 2WZJA 2J0KA 3NX8A 5ANGA 2XNOA 1PMVA 2J5EA 5G6VA 4M14A 2C6LA 4GV1A 5TO8A 4AFJA 4V0GB 2CGVA 2B53A 4X6RA 2G2HA 4OAUC 3GCSA 4QMTA 3LKMA 2OXYA 4O7RA 3C5IA 2QCSA 1P4OA 3ZOSA 2I0EA 2WMSA 1YI3A 4IAFA 2PUPA 2O65A 5DR6A 5EYDA 3CS9A 3EQIA 5L2IA 3UE4A 1RW8A 5M57A 4XMOA 2QHMA 2ZJWA 3R2YA 2JBPA 3DAJA 4CGAA 3E3BX 4IZ7A 4BCGA 2CGUA 2PTKA 2PULA 4IWQA 1KE7A 5AAFA 3K3JA 3MTLA 4C38A 5E1SA 4O22A 3GU6A 2WEIA 2BDFA 5F20A 3A4PA 2JFMA 3T3UA 3ACKA 2C5XA 3KN6A 4JIAA 4RBLA 4ZZMA 3TV7A 4BDBA 2IZSA 3W2OA 4BBMA 4FEUA 4EONA 2UVXA 5IEXA 4FG9A 4RGJA 5DBXA 2HY0A 1OBGA 3KCFA 5D9HA 2QOLA 3C4CA 2YWVA 3K2LA 3G0FA 4D1ZA 4EOKA 4EOQA 5HG5A 2J6MA 5HEZA 4D4VA 1XH8A 4EOJA 2RSVA 3MA6A 1J91A 2VU3A 5DT0A 2OLCA 3FC2A 4WRGA 5GNKA 4QMPA 2RG5A 3CJFA 4RIYB 3DS6A 1A06A 1CSNA 2X0GA 3V5PA 5IMEA 4DF3A 3TZ9A 4ANBA 4GK2A 4ALWA 3PXQA 2QURA 2WIHA 4GG7A 4IJPA 2XKCA 4RA4A 4ZSJA 5GJGA 4WIHA 2OGVA 4FTIA 1XH7A 4IB5A 5HICA 4E6CA 4PP9A 3QGYA 3BHTA 2OIQA 4I21A 4I6QA 5AP3A 1XHAA 3ZH8A 3IW4A 4BKYA 4K8AA 2A0CX 3W55A 1Q8WA 4NM5A 4BCPA 4C4IA 3UQGA 3O71A 4EBWA 3TG1A 3VAPA 5J95A 4LMNA 3QC4A 3RNYA 3F5PA 3LXLA 5C1QB 3NNUA 4XX9A 3BU3A 4KD1A 3KXHA 2HXQA 5M4UA 4DFLA 3FZSA 2R9SA 3OCBA 4EC8A 4HPUE 4JRNA 3DDPA 3V5QA 3U8WA 4XUFA 2JIVA 4Y5QA 4OBPA 5LCJA 4JOAA 1M14A 4FSYA 3W10A 1YXSA 3NAYA 3NLBA 3UOKA 3FMHA 5B7VA 2QONA 2JLDA 4I4EA 4YZBA 2R0IA 4OTQA 1B6CB 4RA5A 5IUHA 4IACA 1W83A 4BDFA 2OICA 1UU3A 4TYEA 1XH4A 4GW8A 2W4JA 4AOTA 2JAVA 1WBPA 4FBXA 4MWHA 2P33A 4WSQA 4DLIA 4M68A 4K11A 2EWAA 4IMYA 1XBAA 3FQSA 4BCOA 1JWHA 5F95A 2VV9A 3QZFA 3UBDA 4E5BA 3PLAE 4QMSA 3VJNA 1R3CA 5DFPA 2R3JA 4FTRA 4L52A 3WE8A 2ONLA 4RFYA 5LARA 2ZB1A 4ANSA 5IQGA 3OXTA 2XMYA 4JI9A 4WBOA 5DGZA 1OKZA 3R71A 2WTVA 5FXQA 4EC9A 4EH6A 5EDQA 4PMPA 1ZYDA 1U5QA 2WB8A 3FJQE 1YDRE 3D83A 3QCYA 4G34A 2XK3A 3PJ3A 4MNEA 4BC6A 3WARA 2ZMDA 4YLLA 5L8JA 3ORKA 1OGUA 4QNYA 3VHEA 3RAIA 5DEWA 2W99B 2W9ZB 1SVHA 4GU9A 4HYSA 3C51A 3F61A 3LFBA 4C36A 3NMUF 4UMRA 3KXZA 4APPA 4BYJA 4CFWA 4NW6A 3ATTA 3NUYA 4RX9A 5DEYA 4O7ZA 5HE3A 5IA3A 5HGIA 3PPJA 2XIXA 2PK9A 4R5SA 3TNWA 3UNKA 4BTFA 1YWNA 4W4WA 2WMTA 1MRUA 4FZ6A 4QMVA 3AGMA 3UZRA 2YISA 4FIHA 4XLVA 3PSBA 4FKOA 4ANOA 4EH4A 1YKRA 2W1ZA 3VQHA 1H8FA 3ZXZA 3VWAA 2PMOX 3R8ZA 1PXIA 2ZOQA 4M3QA 2I7QA 3DZQA 4D4RA 2J50A 3KRLA 3WYXA 3KXNA 3EMGA 3DLSA 1NVRA 1UU8A 4H3BA 4BTJA 3GEQA 3A99A 3E93A 1J1BA 1SMHA 1FVRA 2HOGA 4FSMA 2OFVA 4AP7A 4GSBA 4N70A 3RCDA 3HDMA 2W05A 5I9XA 4ERKA 3VUHA 2YHVA 5I9VA 3DZOA 2B4SB 4FIGA 3DBFA 4TWPA 5HG9A 3CJGA 3N4TA 3FQHA 2NPQA 4LGGA 4TYGA 4DH8A 4LGHA 3HMOA 3ALOA 3VRYA 3ZU7A 4RWLA 1PXNA 2OJ9A 2YIRA 4BDHA 2PYWA 5I9UA 4DFUA 3CLYA 3E92A 1WBTA 3ERKA 4XG2A 1UNLA 4MCVA 4UWCA 3UVPA 3WBLA 4OT5A 3EJ1A 3L8PA 3WI6A 1H24A 4BZOA 4QP3A 5T6KA 1Q3WA 3ETAA 3ALNA 4IDVA 4E93A 2FSTX 2C6TA 2YDIA 3A62A 2C3KA 4YTHA 2Y4PA 4IBMA 3GFWA 3KMMA 3FE3A 2XYNA 3C4EA 3FZRA 3QKMA 1LR4A 4AZTA 1PXLA 2ACXA 4C4EA 3NCGA 4EQMA 2R3PA 4EK8A 3W18A 2J0IA 3FL5A 3R2BA 4I5PA 2YJRA 1SNXA 5HQ0A 3PJ1A 3UC3A 3A2CA 3DGKA 3LFFA 1FINA 2WTWA 5CVFA 4UWYA 3U9NA 4BDIA 4Z7GA 3D4QA 3FPQA 5HG8A 1HOWA 1UVRA 3G0EA 3GT8A 3D14A 4AS0A 4CFNA 1H4LA 2R3HA 5AX3A 2E9VA 3HV3A 3NIZA 4FT9A 3IS5A 2XNPA 4F64A 5J87A 3DNDA 4KSQA 3QHRA 2YABA 4PX6A 4FKPA 4DGGA 4FV6A 4DFXE 2JDOA 3B2WA 2R7IA 3QGWA 5BVFA 4XBRA 1CKPA 2NO3A 1FGKA 4AACA 5M56A 4YUQA 4RWJA 5BVDA 2CNQA 2WMAA 1OL2A 4FNYA 4MXXA 5CI6A 4MXOA 3N4VA 2W06A 1WCCA 4EUTA 5IUIA 2J9MA 4K77A 4I5CA 1ZZ2A 3T3VA 4KRDA 4ZSAA 3TKIA 3LXKA 4LFIA 1P4FA 4ANQA 4BGGA 5LVOA 2XBAA 2DUVA 3AG9A 3PIZA 3H9RA 2I0HA 5A4LA 3HKOA 3ENHA 4JXFA 4CZUA 2WMVA 4EWHA 4TWNA 4OUCA 3POOA 4D0WA 2X7FA 3O7LB 5GJFA 2Z7RA 2A1AB 4NWMA 3F3TA 4JNWA 5EM6A 4CT1A 2Z60A 3S2PA 2X9FA 4XG4A 4ZTHA 2QOBA 2OW3A 2RKUA 2YEXA 3MFSA 3PVBA 4L7FA 5EH0A 3FXWA 3OWKA 4Y5HA 3AMBA 4G3EA 3ZUUA 4YU2A 5BQ0A 4JLCA 2C5NA 4LMUA 2YIWA 3U6IA 3ORTA 2QHNA 2XNNA 5DPVA 3I4BA 5AP5A 2XK4A 5ANOA 2X4ZA 4CFUA 5C4KA 3FLQA 4JDKA 4LRMA 4WA9A 5F4NA 4D55A 4XV3A 3WYYA 4IX4A 2AUHA 5ANDA 4G5JA 2VO6A 4D2TA 5HTBA 2BROA 4QP2A 3VUGA 4FSUA 4USDA 4M97A 3TACA 3SOAA 3D5UA 3HX4A 3OWPA 3WF9A 4PRJA 5GIPE 4DBXA 3MTFA 4TTHB 1Y6AA 5CSWA 1ZYCA 4RLKA 3DB8A 4IX3A 1PXOA 3FHIA 2QD9A 4HVIA 5CEPA 2X81A 4D28A 2PVHA 4C58A 4QP8A 3FI8A 3PXRA 4RX7A 3LFDA 3CXWA 3GC9A 2ZMCA 3HEGA 4F9YA 5AP4A 4JT3A 2JEDA 4E7WA 3MVMA 2H96A 5DOSA 1OUKA 3MPMA 3Q4ZA 4EHGA 4AQCA 5I9YA 5A54A 1FMOE 3ROCA 2HK5A 2BAJA 3AT2A 4BWXA 1CKJA 4PMTA 2BR1A 4DINA 1U5RA 1YOJA 5CAQA 3RKBA 3SD0A 3V5JA 4FKVA 5E9EA 2R3OA 1O6KA 2UZDA 4M0ZA 1O6LA 3F5XA 5IPJA 4G3GA 4U45A 2CKQA 5C03A 5HLNA 4O7NA 2ZM3A 3VRZA 3NW6A 4TKSA 2BIYA 2OWBA 2XRWA 2WO6A 2UW0A 5CZHA 2A2AA 2G2FA 4B6LA 2YACA 4ID7A 1XH5A 2C6OA 5LMKA 3KEXA 3PP1A 4D58A 2ZAZA 3GCUA 3BWFA 5AAEA 2ZVAA 5AP6A 5JT2A 4JBOA 4ZJVA 3Q04A 4EI4A 3JXWA 4ZTNA 3BYVA 3VBYA 4DE4A 3DU8A 5CQWA 1I44A 5T68A 4X2KA 4ZTRA 5CALA 4AA0A 3RPYA 1ERKA 4D2PA 3VS7A 4O0SA 2OK1A 4FV9A 4QYYA 2W1EA 3FI4A 4EZ3A 4ZJJA 3PZHA 3G9NA 3UODA 4XOZA 5LCKA 3AD5A 1FPUA 4IJ9A 3RPRA 3G5DA 2GHGA 4CZTA 3Q5ZA 3MN3A 5DIAA 2GSFA 4X6QC 2V55A 4QMNA 4Z16A 4USEA 4FKLA 1AD5A 4QOXA 4RVMA 2UV2A 2I1MA 3WF8A 3GU4A 4QMUA 3MH0A 1OB3A 4R8QA 4NKSA 4FE2A 2VGPA 2PU8A 3TKUA 2FA2A 3HLLA 4YSJA 5CF8A 3I79A 1OIQA 2UW4A 2VAGA 2XJ0A 3G6GA 3L9PA 5EHLA 4IVAA 4EOSA 2PUIA 2Y6OA 5HE1A 2JC6A 1FMKA 1ZYLA 4A9SA 1KOBA 2B7AA 2ZDTA 5FDXA 1BI7A 2YM8A 3QRKA 5IQFA 4MNEB 4Z9LA 2O63A 4MXCA 3PTGA 2PVLA 2XK8A 4FF8A 4LG4A 5EKOA 5HU3A 5IQEA 1BL7A 3FMDA 3WOWA 4JX7A 1ZWSA 2IPXA 3CQEA 4F09A 3OT8A 1QMZA 1RE8A 5CLPA 5HBJA 5EHOA 3CPBA 3EN5A 5E1EA 5HLWA 3OS3A 3IW6A 4LUDA 3R7YA 3NVKI 3R63A 1FQ1B 4FNXA 4FKUA 3QQFA 3OVVA 1KV1A 4JQEA 2GNHA 5EQYA 3RVGA 4IX5A 3FWQA 4V01A 3Q53A 4DTKA 2YDKA 5EQEA 2PE2A 4FTMA 4C4JA 1J7LA 2FYSA 2GTNA 2PVMA 5E8YA 5BVKA 1E1XA 2Q0BA 2UZEA 2VX1A 3EFWA 3P7CA 4WBBB 5BYZA 3EZRA 1ZYJA 2OU7A 2WIPA 4Z55A 4FSRA 3A7IA 1DAWA 2XK6A 5J5SA 3C0GA 3KL8A 2I6LA 3SG9A 4CG8A 4YGAA 4ZP5A 3ZC6A 2R3IA 1UKHA 3KGAA 5TOZA 3LM0A 4QP6A 2XVDA 1WBWA 3PJ8A 4A4XA 3AXWA 5AUYA 3NWWA 3F69A 3SAYA 1JKKA 3MA3A 4YNEA 1J7UA 4FEXA 3MPTA 2AC5A 5LXMA 1KSWA 4E4MA 1R1WA 3E62A 3ZDIA 5CT0A 4BZNA 3F66A 3QQKA 4HGSA 1WVWA 2BTSA 3Q96A 1W0XC 5L2SA 4DH1A 3ANQA 3TUBA 3CY2A 3N51A 3COMA 5L6WL 3WZEA 3ZO4A 3OEFX 1WBOA 4QQ5A 3RZFA 3A8XA 4FTOA 4BCFA 4C37A 1YWVA 2R3KA 2HELA 2XZSA 3EL7A 2XRUA 3MVJA 1PYEA 5JGBA 3E87A 3DXQA 1UNGA 3D94A 2W1GA 5D10A 2UZVA 3QZGA 4FYOA 5DT3A 4CYIA 2JDSA 4NW5A 4AA5A 4BCMA 4FOBA 4ZXTA 3P4KA 2C5YA 4FG7A 4BKJA 4EL9A 2WMQA 1MUOA 4KKEA 4MVFA 5KHXA 4M13A 5HE2A 3PVGA 4L9IA 3LE6A 4UXQA 4V04A 3JVRA 1FVTA 4PP7A 1YI4A 2UW9A 1YDSE 3R7EA 5LVNA 2VTIA 3LJ2A 4G3FA 4J52A 2EXMA 5CAUA 4FX3A 1JBPE 5AJQA 5F9EA 1L8TA 1BMKA 1GY3A 3EYGA 5IQDA 5AUXA 3Q5IA 4ASZA 3ITZA 4O0RA 2W1IA 5HESA 3VUIA 3KK9A 2QOHA 4F4PA 4LYNA 5KBQA 2RGPA 4ASXA 4F9AA 4O0TA 3ZMMA 3HA6A 4FK3A 4PDSA 4C4GA 5CVHA 1BUHA 3KVWA 5HO8A 3LCKA 2X4FA 4PPAA 4RWKA 2R0UA 3Q32A 4DG0E 5EM7A 2ITPA 4MD9E 3C4WA 2RG6A 2IO6A 4IB0A 3NUXA 4TNBA 2WKMA 3FMKA 1AQ1A 3UG1A 2WEVA 2QO9A 2ITNA 2Y8OA 2E9UA 3OTUA 4XJ0A 3ATSA 1PXJA 5AUVA 1Q61A 3IDBA 3NS9A 4GU6A 4UMTA 2XJ1A 4BHNA 2G1TA 4G9RA 2IZUA 4AOIA 2QLQA 2RFEA 4W4XA 3KXXA 1V0PA 4LOQA 4GYIA 4TW9A 3ZS5A 4BKZA 5C9CA 4GFOA 5LOHA 3ODZX 4BI2A 4DH7A 3KRJA 3NYXA 1GOLA 3EN6A 3KXMA 3FXXA 2XH5A 4TRLA 4Y46A 3ZHPC 2OJGA 4FSWA 2UZOA 4JIKA 3MSSA 5DA3A 3VUTA 1TQMA 5KMIA 5C27A 5AR5A 2VD5A 2O0UA 3MPAA 4BCKA 5IA4A 5CI7A 3SDJA 3FZTA 4AT3A 4YJQA 3QZHA 3H4JA 4DHFA 4FUYA 2GQSA 3PVUA 3I1AA 4HZSA 3PFQA 3WF7A 5LVMA 3OCTA 2QR7A 3OROA 3QYWA 3QTQA 4UV0A 4Y85A 3RK9A 4KSPA 3GUBA 3SKCA 4CTCA 4DEAA 4FC0A 4E6QA 4MNFA 4JL9A 1R0EA 3I0OA 4O21A 1BI8A 2YCFA 4JDHA 5HTCA 3R1YA 3VC4A 4BCIA 3ID6C 3UOLA 4P7EA 4APCA 2R2PA 3P5KA 3EQCA 4QTDA 5BYLA 4ZMFA 4X2JA 4YURA 1GZ8A 1UV5A 2GFSA 1YHVA 3KC3A 3GI3A 5D12A 2HAKA 4BWKA 3PYYA 3DFAA 3QKKA 4B8LA 1LP4A 5BPYA 4MF1A 1WVYA 4QP1A 5AIRA 2OO8X 2Y4IB 4FTTA 4FZAB 2W4KA 3QRTA 4YC3A 1UU7A 2PL0A 5AMNA 3FEGA 3FL4A 2W1HA 4EBVA 3CGFA 3M11A 4A7CA 3SV0A 5KBRA 2J51A 2CCIA 2OF4A 4A9TA 4DLJA 4YP8A 4E5AX 4CNHA 3COHA 1BYGA 3DAEA 3MVHA 2C6IA 3PSCA 3QWJA 4EOMA 3LMHA 4RC3A 3NYNA 4U43A 3QRJA 3EIDA 3EHAA 3RPOA 3FYKX 1H27A 2PZYA 3VUDA 4I4FA 4RG0A 2P2IA 3CEKA 2ZV9A 2V7AA 4FTUA 5H3QA 5TF9A 4AGWA 4XRLA 3SRVA 3ZYAA 4R7HA 4EH5A 3VN9A 4AZWA 2ZM1A 4MX9A 4QRCA 4JQ7A 5IH5A 4KABA 4OTDA 3A7FA 5JRSA 5JRQA 3DK7A 4OBQA 5GJDA 3HGKA 4FK6A 5KCVA 3LCOA 4L53A 2VWUA 3MY0A 3QWKA 4DFZE 3IW5A 5E8TA 4IFGA 1H07A 3FZOA 4MK0A 4FTQA 2C47A 4MHAA 3P08A 5CX9A 4I41A 3R9RA 1H01A 3R8UA 4PMMA 5HKMA 2XKFA 3FSKA 3HP5A 4RFMA 2YM3A 5ANJA 5F94A 4DA5A 3FLNC 4XG7A 5CF5A 2KTYA 4IM2A 5EG3A 4KB8A 4DT9A 4YJSA 3ZXTA 4FSQA 5L4QA 4L3PA 3PE2A 3HRBA 4EH7A 3UIBA 2DS1A 3KA0A 3DPKA 3OF0A 1BX6A 3D5WA 3R73A 4MXAA 4WNPA 5EW8A 3OEZA 5HHWA 5IQIA 2QKRA 4DEBA 3F88A 3AMYA 3KRRA 3ORMA 3V04A 3ZLWA 5KMKA 5AAGA 4BIDA 4I22A 1F3MC 2ITXA 3D7TA 3V8SA 4RJ7A 3JR1A 4P5QA 5BUIA 4BZDA 5EOBA 4S34A 3EH9A 4F0FA 2UZWE 4LOPA 4ZLYA 1L3RE 4F7JA 4C35A 3TIZA 2BMCA 2UVZA 4O96A 4ZY5A 5AA9A 3QCXA 3W8QA 3QC9A 4H39A 2PVYA 2YIXA 1V0BA 4YNOA 4D2RA 4KBCA 3B2TA 3OUKA 4HCUA 3OTVA 3R9HA 3TZ7A 4AXAA 3GGFA 4FV2A 2PSQA 3HMNA 4L44A 4UMQA 4BDDA 3UYSA 5CEMA 2YM6A 5IA1A 4AFEA 4H3PA 3QUPA 3G15A 3TZ8A 1GZKA 3TWJA 3A7JA 5JEBA 2PVFA 4MYGA 4NKAA 3KQ7A 2VTLA 4ITHA 5FBOA 3MS9A 5CEKA 3MFUA 1OKWA 3NNVA 3BEAA 4NFMA 5HNIX 1ND4A 2ITUA 3QKLA 3ZO1A 2ITYA 2BTRA 2OXDA 4CQEA 5HBEA 3RM6A 1YI6A 1LPUA 2B9JA 5FM3A 3TI1A 3VS6A 3KY2A 2WQBA 3PY3A 2X9EA 4U79A 4BHZA 3TV6A 3CC6A 2CPKE 2WPAA 3BI6A 3NNXA 3I0QA 3TTIA 4QYGA 4KIQA 3FY0A 4N6ZA 4PDPA 2C0OA 2JKOA 5AUWA 5H2UA 5CEIA 4CMUA 1KV2A 3RPSA 3PP0A 4G31A 3A7GA 4RVLA 2WMWA 4AT4A 5F1ZA 4L7SA 5BMMA 3KMUA 3N9XA 2HZ4A 3MB7A 3NUUA 3OY1A 4F7LA 4CFFA 4LI5A 3U4WA 5C4LA 4IC8A 2G15A 2GHMA 2JBOA 3C5UA 3PXYA 3U6HA 5FEDA 4XH6A 1Z57A 5EQPA 5HU9A 2JAMA 2OXXA 5I3RA 1B39A 1R0PA 3CE3A 4CCBA 3LLTA 3R30A 5GZ8A 2OH0E 2GNLA 2XJ2A 4ZLOA 2X7OA 4U0IA 2XCHA 2B9HA 3DKFA 3VNTA 2W4OA 4FSTA 4RVTA 4YLJA 4F70A 4IVBA 4HJOA 3QQHA 4XRJA 2CKEA 3IO7A 2O64A 4EOIA 3HMIA 4GVJA 3UDBA 4N4SA 2YM4A 4HGLA 2VTHA 4ZJIA 1VEBA 3ORNA 4WRSA 5KNJA 2JDTA 4BI0A 4O7SA 1WAKA 2GNFA 3K3IA 4R1YA 3TXOA 4MAOA 4QQCA 5KHWA 3R7IA 3ZRMA 5A3XA 5CVGA 5FP5A 4J53A 4AAAA 1SM2A 4QMXA 3UJGA 3GOKA 5CF6A 4YJRA 4J7BA 2EB2A 3RMFA 5A6OA 4O0VA 4K9YA 4RVKA 5J9ZA 5M4FA 2VGOA 3PA3A 1VYWA 3G90X 5TT7A 1OECA 5CENA 5KMOA 3ULZA 4I5MA 4IAIA 3R1QA 5HO7A 5AR8A 4G6OA 4HGTA 1JAMA 4QMZA 5L8LA 2C1BA 1PHKA 3ANRA 4CG9A 3QA0A 4KBKA 1U46A 4FEQA 5J7HA 1U59A 5K9IA 5CEQA 5FQDC 4ERWA 2WQNA 3DFCB 3F5UA 3F82A 4ONAA 4YHJA 2VWWA 1H0VA 4JBVA 4QYHA 4WT6A 4WD5A 3NR9A 4C8BA 3DTCA 2OG8A 3IG7A 3ZCLA 4UMUA 4CRSA 2BAQA 4XG3A 5E8UA 2XB7A 3PA5A 4L42A 4NK9A 3LOKA 5CEOA 4NH1A 2AYPA 3CD8A 3F3VA 4Q9SA 2B52A 3U51A 3KF7A 2VWIA 3JYAA 3O8TA 4OTGA 4LQMA 4W8EA 3R28A 3W2PA 4HCTA 2IVVA 2WTJA 3V8WA 3PXZA 4BCJA 3UO4A 2QQ7A 2HWPA 4TY1A 4C3RA 3OMVA 2X8DA 2UW7A 2FSLX 4FKRA 2CN5A 4JDJA 5ETAA 3ET7A 3MI9A 3R02A 4L45A 4PWNA 4WNKA 1PY5A 3JY9A 3M2WA 3Q9WA 5D7AA 4FEWA 5IISA 1VJYA 4MH7A 3VS4A 1IR3A 4BBEA 4ZZOA 2PHKA 3ZC5A 5LVPA 3EQBA 4NIFA 2HYYA 4RIXA 4L00A 1XO2B 2QC6A 5AFVA 1DAYA 4BDKA 4FV4A 4RJ6A 3BX5A 4RIWA 3BCEA 4RZVA 1OPKA 1R78A 1ZOHA 2WMBA 4ZTSA 3ZSGA 4ASEA 3MYGA 5C8NA 4IIRA 1T45A 4D2SA 2YCRA 4TNDA 4KS7A 1CDKA 2VUWA 2VWZA 3QTSA 4EORA 5GZAA 2ZM4A 3IQ7A 2UUEA 4XG6A 3UP7A 4C59A 3FI3A 4XYFA 3W2QA 3QHWA 4FG8A 1YDTE 4XHKB 3PY0A 3U4UA 4MQ1A 5ACKA 1NW1A 1ZZLA 3G33A 5BNJA 3FLZA 5A4EA 3Q9XA 4Y83A 5FUTA 3VVHA 5JZJA 1VYZA 5KZ0A 3TNIA 5JFXA 3NEWA 2CNVA 3QL8A 5JMSA 3HL7A 4FTNA 4M12A 3BYOA 3EZVA 4R3RA 3U54A 5AR4A 4I1ZA 3NCZA 3L8VA 1KE5A 2VTAA 3MY5A 3VW8A 3DXPA 3C1XA 4KBAA 3DQWA 4NFNA 3VBQA 5L6PA 3H9OA 5E4HA 1P5EA 4JG8A 3EYHA 3UVRA 5CS6A 3A4OX 4YPDA 3ZLXA 4AUAA 2VWYA 1SVEA 4EH8A 3QUDA 1OL5A 5DH3A 3EFLA 3GU7A 3LVPA 4ITIA 1XH9A 4HVHA 3SRVB 5EM8A 1IRKA 4IVDA 5BX0A 5KKRB 4H58A 2F9GA 5A9UA 4D2VA 4MXZA 1Q24A 5AADA 2ONLC 1MRYA 3NPCA 2C3JA 4G16A 4I23A 4ALVA 2VZ6A 5AIKA 5M4CA 4O0YA 2QVSE 3U87A 4DTBA 4DG2E 3R00A 5AM6A 3L9NA 3MIYA 4ZOGA 2JIIA 5CU0A 1PJKA 4KUJA 2GPHA 2F57A 4OTHA 4PY1A 1ZY4A 3MVLA 2UZLA 3ZUTA 4J98A 3QD4A 3AC1A 3RK7A 3F7ZA 2XYUA 3C0IA 3R8VA 4RFZA 4FTAA 3DY7A 3IOPA 4U7ZA 2WTIA 3THBA 4O81A 2IW9A 3P86A 1PMNA 5A4CA 3BHHA 4FKIA 4KWPA 3LJ0A 2WMUA 4YC6A 4O6LA 4L3JA 3I7BA 2IG7A 5IH6A 5BUEA 3QQUA 1YQJA 2ITOA 4CT2A 1OL1A 2PMIA 3EQFA 3D7TB 4CFXA 4AU8A 2R4BA 2ZYBA 3PG3A 1K3AA 3BRBA 3RALA 4QPAA 5IA0A 5IQBA 4GJ2A 2A4LA 3PUPA 4QMWA 5ETIA 5IDNA 3UO5A 2J4ZA 4FMQA 4IC7A 4PQNA 5AV4A 2WTKC 4F08A 2NNWB 4X2NA 3ZRKA 4CD0A 3ZLYA 1RJBA 1YHWA 4YJNA 4U6RA 2VTOA 4ANNA 3UG2A 5EKNA 5HIDA 4FIIA 1TKIA 1XBCA 4EQCA 4U81A 3COKA 4I20A 4DTAA 4DG3E 5JFVA 2XNMA 4L46A 3ZFMA 3OXZA 3NYOA 3PDTA 4XBUA 3PPZA 2C3LA 4ZTMA 4EH3A 3R04A 1ZOGA 4PNKA 2R3RA 4EHVA 3E3PA 4IAKA 3JY0A 3DQXA 5FXRA 2OJFE 3VS3A 3KULA 1ZY5A 5M06A 3LLAA 4QD6A 3R9OA 3OW4A 3F9NA 3TNQB 2OF2A 2W7XA 3WIKA 3JPVA 4Y8DA 2WMXA 4KIKA 4XS2A 2W9FB 3R6XA 2W1FA 2F7EE 4TZRA 4WNMA 3GC8A 5DE2A 2E9NA 1W7HA 2WGJA 4WG4A 5IU2A 4PL3A 3P23A 1O9UA 3M1SA 2CSNA 3CBLA 3TUCA 1XKKA 3E5AA 3N4UA 3MGYA 4PF4A 4GS6A 4FSNA 4FUXA 2WTCA 5EM5A 2IVTA 5HNGA 3ZDUA 4C4HA 4MQ2A 1IAHA 3KRWA 3L1SA 1JKLA 2V62A 3FAAA 3GC0A 5EOLA 5CAPA 4AW5A 3FI2A 4A9YA 4H3QA 4QTEA 2CKOA 3MJ1A 4X3FA 3BPRA 4QMQA 3GBZA 3FLYA 3P7AA 4K18A 1W98A 3NIEA 2Y6MA 2Z02A 3G2FA 1JKTA 5L6OA 3PZEA 1HCLA 2R3GA 2GS2A 4LM5A 2YAKA 4LRJA 2QKWB 2WMRA 4WG5A 3DJ5A 3UZPA 2QOIA 3UOJA 4AG8A 4FIEA 2GTMA 3HMPA 2G9XA 4AF3A 3RNIA 4BL1A 4TYIA 3O50A 4CEGA 4DEIA 3ELJA 4CFVA 3DKOA 5DG5A 5C26A 2IVUA 3CKXA 3LJ1A 5CXHA 5H9BA 3SXRA 3VF9A 1SNUA 4OTFA 3P79A 4FVQA 3A7HA 1V0OA 4E5WA 3E7OA 3QUEA 4Q5HA 1QL6A 4UBAA 2A27A 2YAAA 1REJA 1IASA 4FL1A 4FTKA 1PKDA 4TYHA 5IMXA 4RQVA 5ACBC 5AV3A 3DBCA 3QA8A 4RWIA 4HCVA 4O7VA 5LMAA 2F4JA 4NCTA 3HMMA 3FLSA 5EW9A 4YBJA 5IUGA 1YWRA 2ERZE 3OZ6A 2F2CB 3QD0A 3AC5A 3HV6A 2BRNA 2WQOA 2UZUE 3QQLA 3DK3A 5FXSA 3R8LA 4KRCA 3F3UA 5DMZA 1JLUE 4EK5A 4GIHA 2BDJA 2QI8A 5L8KA 5FDPA 3ZUVA 2XA4A 3U6JA 4R3CA 5B0XA 5CYIA 2GS6A 5E8SA 2WELA 3MDYA 5LWMA 3VBXA 3FUPA 1PMUA 4DN5A 4RIOA 3F3WA 5E90A 4F7SA 3D9VA 2WNTA 4FT3A 4K33A 3VUMA 4AN9A 4BDAA 3QX4A 1O6YA 2XEZA 3ZONA 4OTRA 3LFSA 4IHPA 4AE9A 4DGOA 3FYJX 2PPQA 3RINA 4R3PA 1KWPA 4BDEA 3LMGA 3R22A 5K4JA 4ZSLA 1URWA 3IW8A 3GCVA 3QBNA 4EK3A 1XJDA 3TDVA 1B38A 4W9WA 3GCPA 4FV8A 3I81A 3E88A 1GJOA 2J0JA 3GB2A 2HXLA 4HGEA 4PV0A 4MTAA 2OIBA 2Y4IC 1ZRZA 3Q60A 1W82A 2WXVA 3BBWA 4JR3A 4D1SA 2ZDUA 3GQIA 4BBFA 4UX9A 4FKQA 4WSYA 4YO6A 3SC1A 4DGMA 4E26A 2X2KA 3HYHA 4BICA 4D1XA 4LOOA 4W9XA 4GKHA 2ITVA 1UU9A 4JAIA 5CU2A 5FP6A 3B8QA 1BL6A 3W2CA 3AOXA 2PMNX 3D2IA 3BU5A 3E8EA 4NIFB 3EB0A 4J1RA 4RIXB 5KMJA 4AZEA 4U8ZA 1I09A 3VF8A 2F49A 3C0HA 1JPAA 3CP9A 4NM0A 5JGDA 2C3IB 4RIWB 5HD4A 1M17A 4EHEA 1G3NA 2YJSA 3DOGA 3B8RA 3OD6X 4EYJA 3FXZA 3FPMA 3OWLA 3QTUA 2R7BA 4ARKA 3AC3A 4M69A 4CXAA 3SW4A 3BEGA 3OUNB 3G51A 3VS0A 3FBVA 3T8OA 3QLGA 4AT5A 5JN2A 2VWVA 2BKKA 4YMJA 4IAYA 4AZVA 2VTJA 4AWIA 5DN3A 1E1VA 4GG5A 2FSMX 2C68A 2P3GX 4GH2A 2J0LA 2VX0A 2R3MA 3S1HA 1JNKA 4EUUA 4EOLA 3CSVA 3NNWA 1FOTA 3GU5A 1JSTA 2JD5A 5CSVA 2PMLX 1OIRA 3DT1A 3OCGA 4JRVA 4S2ZA 3VQUA 3CTHA 4ZSEA 4CLJA 4H1JA 5JFSA 1V1KA 2JIUA 3C50A 2OI4X 5HIBA 4I24A 5HE0A 3WILA 4BN1A 3WF6A 4TT7A 1KE9A 4Y73A 4C62A 2BZIB 3R0TA 4FV3A 4HNIA 1H1RA 4RLLA 2YZAA 3OWJA 2VTQA 4GUEA 5IQCA 2UW6A 2WU6A 4NT4A 3EWHA 5B2MA 3QAME 5AV0A 2OZAA 4NM3A 5EYCA 4GCJA 4B7TA 4MEDA 3MH3A 3TN8A 3BE2A 2X39A 3BKBA 4GVAA 3FQEA 2VO7A 5J79A 3I6WA 4DEGA 1NVQA 2C6KA 3R21A 3CGOA 5EYKA 5DYJA 3TCPA 5B2LA 5LWNA 4L68A 4R77A 2BKZA 4F1MA 4CVAA 3AC4A 4I93A 2W17A 5CY3A 4Y72A 5ETCA 3IDPA 2CNUA 3EN9A 3VHKA 1JKSA 3MIAA 3NUAA 3R8MA 3O17A 4FGBA 4J8MA 3AGLA 2P55A 3ZEWA 1YXXA 4FICA 4EOPA 4F1OA 1FGIA 4D5HA 5HCXA 3KREA 4P4CA 2CGWA 5A46A 1K2PA 4BCQA 3CD3A 4EJNA 3HAVA 3SGCA 4RJ4A 4LL5A 4YZNA 3TNHA 4XG9A 3HVCA 3LHJA 2XIYA 3I5NA 4M0YA 2XEYA 2NRUA 4BGHA 3D15A 4C4FA 3D0EA 3OY3A 3TZMA 2PZRA 3TKHA 1TVOA 2HY81 4ZLZA 4P2KA 4ZS4A 1KOAA 4EK4A 2Q83A 2IVSA 2VTTA 2ZV8A 4O84A 1EH4A 2XNEA 3OXIA 3PE1A 1Q99A 4OR5A 3ZM9A 5HBHA 2GNIA 5E8VA 3ORZA 4KKHA 4NU1A 3MB6A 4C2VA 4IZ5A 4FZFB 4ALUA 3RPVA 4BVUA 3SOCA 1H0WA 1M52A 2ITZA 3ULIA 4X2GA 2EU9A 3MESA 5I9ZA 3FV8A 3UQCA 2X8IA 4R7BA 3WZJA 3M42A 3ZEPA 4CFMA 4NJ3A 1HCKA 3RJCA 5K5XA 5GINE 3EN4A 3KMWA 2JKQA 1Z9XA 3IOKA 3BYUA 4QMYA 3CR0A 3FMEA 4O38A 3GC7A 4HVGA 3WE4A 3SVVA 1ATPE 3LPBA 3LM5A 4AOJA 4KINA 1CM8A 1OPJA 3EQPA 4MBLA 5KE0A 3NW7A 4IB3A 3SXFA 2CLXA 4KIKB 4AA4A 1H1PA 3BELA 4JS8A 1JSVA 3QFVA 4IE9A 3Q9YA 1WVXA 3BGZA 4O1PA 3ROYA 5IQAA 3Q4CA 2HW7A 3SG8A 2HZIA 4A4LA 2P4IA 2J7TA 4YZ9A 2VWBA 4YR8A 4D4SA 4YO4A 2CJMA 4A06A 4XOYA 4FGRA 3F2RA 2YIYA 1OZ1A 4KNBA 1GZOA 3BLRA 4RJ8A 3BQRA 1YVJA 4FVPA 5HTIA 4LL0A 2ETKA 2F2UA 3BIZA 5FG8A 4JJRA 5FWKK 3AT4A 4Y95A 4NTSA 2V22A 3QTXA 4EYMA 4FNZA 4RPVA 5E91A 4BTKA 2BAKA 4GT5A 4X3FB 2FSOX 2R3FA 3OT3A 4I0SA 4JG6A 4DFYA 2QNJA 1REKA 4D4YA 3O0GA 4UB7A 3BU6A 4BY9E 1BLXA 3EFJA 3P1AA 3E8CA 4FKGA 5KZIA 4B9DA 4C02A 4WKQA 2BVAA 4BFMA 4S30A 3DBQA 3NRMA 4UWBA 3V6SA 4FIJA 3BLHA 3QXOA 4K1BA 5M07A 3QALE 5K0XA 1Q3DA 2V7OA 2XK9A 4PTGA 3ZO2A 4DGLC 1G8AA 4MWIA 4YZMA 2O8YA 3FC1X 4FV5A 2ITQA 3V5WA 4WHZA 4IZYA 4U42A 4C57A 4ACDA 4EZ7A 4BI1A 4Z7HA 2GFCA 4FIFA 2OSCA 2YLEA 4YTIA 4ZY6A 2C5VA 4GFGA 3PG1A 4FKWA 3CCNA 5IH4A 1MQBA 2OZOA 3RHXA 4NM7A 3LQ8A 3P78A 4I0TA 3LFCA 3O23A 3AD6A 4TYHB 4K6ZA 3C4FA 3IGGA 3PRFA 4OT6A 2OJJA 3FHRA 5HLPA 1YOLA 2JGZA 2F7XE 3E63A 4HYUA 5LQFA 1QPDA 1S9IA 3RAKA 5IZFA 3HUCA 1H26A 3L9MA 2BRGA 4L01A 4G2FA 2GNGA 4JR7A 2CGXA 3BYSA 3HA8A 3UIXA 2BILB 4CZYB 5I9WA 2GQRA 1QCFA 2GS7A 3MFRA 3QQJA 2ITTA 4YJTA 5IKWA 4DAWA 4BR3A 5ETFA 1ZAOA 4R1VA 3ORPA 4GRBA 5FRIA 3A60A 4PMSA 3C13A 3S4QA 4C33A 3QTWA 1UA2A 2HWOA 3FSFA 3H0YA 3LQ3A 2RFSA 3OP5A 3POZA 5JSMA 3AMAA 3CY3A 2PUNA 1RQQA 1UWJA 2GDOA 4NEUA 4QMMA 5KMNA 5L2WA 2ETRA 4GK4A 1H00A 2QG7A 3EL8A 4O82A 1XQZA 4IVCA 1XBBA 2JDRA 5AUTA 3D5XA 2A19B 2XNBA 4JX3A 2VTSA 1GIHA 1OL7A 3RBWA 3GCQA 3PWDA 2BZKB 4EHZA 5EFQA 5L2TA 3VO3A 3IONA 3V51A 4CYJA 1G8SA 4OW8A 5B2KA 2XM8A 4II5A 2CN8A 3PWYA 3BQCA 3V8TA 4F0GA 2JDVA 3P0MA 4F9BA 2EB3A 4O83A 4XCUA 5ANKA 1Q8ZA 2XKEA 3I6UA 2CLQA 3KXGA 3QCSA 4HPTE 2QLUA 2UZNA 3CQWA 5EI2A 5KMMA 4FTLA 5A14A 1ZMVA 5M55A 3E7VA 3R1NA 4F0IA 4IWOA 1ZOEA 3I60A 4JG7A 4AN3A 2Y0AA 5E8ZA 2AC3A 4JBPA 1JQHA 4FT0A 4I3ZA 4F99A 5CAOA 3V5TA 3ZFXA 1TQIA 3GOPA 3O2MA 4YBKA 1T46A 3C4ZA 2LGCA 4YZCA 1PKGA 1MP8A 5BVOA 3BV3A 2RL5A 1H1SA 2J5FA 4O0WA 1OMWA 5KKRC 5CU6A 5A4TA 2XIZA 4A9UA 4ENYA 2C4GA 3K5UA 2CMWA 4M69B 2B54A 4G17A 5DR9A 3O51A 3RGFA 5IDPA 1LUFA 1PXMA 4FZ7A 3R8PA 4TXCA 4FV1A 5DLSA 4FZDB 5I5ZA 4QP4A 3DV3A 3DLZA 4ENXA 4G6NA 4D9TA 2H9VA 2QU5A 4XV2A 3RK5A 2Z7SA 2G01A 4HW7A 3UVQA 4UEUA 5HG7A 5GZ9A 5AP7A 3CQUA 1Y91A 3EQRA 4FR4A 1GIJA 2Y9QA 3RCJA 4TL0A 4XV1A 4XP0A 4S33A 5FEEA 3JS2A 3DBEA 5C8MA 5M44A 4G6LA 4U80A 3Q52A 4QTBA 3FMJA 4AW0A 2RIOA 3EFKA 4R7IA 4A9RA 4RJ5A 4RSSA 5CU3A 4DYMA 2W0JA 3W8LA 3QLFA 3BBTB 2YDJA 3NDMA 1QPEA 3QZIA 3D7ZA 2G2IA 1TQPA 5IEVA 3LXPA 3MBLA 4D9UA 4FTCA 1Q8TA 2IZTA 3Q6WA 4GYGA 4FI1A 1OITA 1IG1A 2KULA 2OZAB 2BRHA 4CMOA 3G6HA 4YSMA 2BCJA 3PLSA 4W4VA 5JZNA 4U3YA 4QYEA 4UY9A 5HVKA 2J90A 4TN6A 4IWDA 3QCQA 4U97A 5EI6A 2FH9A 1OBDA 2BFXA 5DNRA 2OH4A 1E9HA 4M8TA 2J2IB 3V5LA 5HX8A 3R01A 3DKCA 4H1MA 5HNBA 5IQHA 1NXKA 2HZ0A 2YIQA 3BGQA 4ITJA 4OTIA 4XNEA 4D5KA 3TT0A 3HRFA 4IFCA 4PNIA 3L9LA 5JQ5A 5H8EA 5HO6A 5FM2A 5AR2A 2OIDA 3O7LD 5JK3A 4QO9A 3UIUA 4IB1A 3ZLSA 3UNZA 4E20A 4E1ZA 1DM2A 4JVGA 4S31A 5CASA 3FMNA 3FMMA 4YZDA 4TWOA 3AC8A 4GT3A 4QP9A 4IQ6A 5AR7A 1Y6BA 4UZHA 4EEVA 1YOMA 3CIKA 5FBNC 2J0MB 3CPCA 4PUZA 3ZSIA 5IG1A 3O96A 2YZLA 4GEOA 3QD3A 2BZHB 3A61A 3AC2A 4U40A 3ACJA 1A9UA 5DRBA 5CZIA 2QO2A 4O7YA 3BYMA 3H10A 2P0CA 2QOKA 4FVRA 3UO6A 1ZYSA 4HOKA 3RI1A 2JKMA 2ZV7A 4YJUA 4CLIA 3S3IA 4TYJA 2XP2A 5K0KA 3DNEA 5HCZA 2PZ5A 5L3AA 3V6RA 4GT4A 4J71A 3MV5A 4HYHA 5J8IA 3REPA 3SHEA 2R64A 3V01A 4K2RA 1WFCA 4BIBA 4CMTA 4N57A 2Y7JA 3P7BA 3HV7A 2Z7QA 5E8XA 5BMSA 4QP7A 4YC8A 2LAVA 2R3NA 4BDGA 2B0QA 2ZV2A 4QT1A 4IDTA 4PPBA 3IPHA 3KKVA 4QMOA 3PPKA 1X8BA 4NSTA 2FB8A 4CSVA 4GMYA 3QU0A 4PTEA 2YWPA 4HVSA 1AGWA 3T9IA 4E6DA 4YTCA 2DYLA 3FMLA 3E8DA 3MW1A 4E6AA 3GQLA 4IEBA 4O2ZA 4NL0A 3SXSA 4E4LA 1YW2A 1K9AA 3KRXA 3NUNA 5TR6A 5D7VA 1YHSA 3WZDA 2XF0A 4USFA 3G9LX 4UZDA 4EK6A 2CDZA 4I6BA 3LFNA 3QRIA 4PDYA 3CTJA 5AEPA 4AN2A 3ZBXA 4ANLA 1VZOA 3OOGA 3RAWA 3ZM4A 2RFDA 5CNOA 5EHYA 4C34A 3D5VA 4B0GA 3FY2A 2OJIA 5CAVA 4KS8A 1DI8A 4FL3A 4JBQA 2BHHA 5M51A 4XV9A 5I4NA 2GCDA 2NP8A 3SW7A 4B99A 5JH6A 4HYIA 3UGCA 1YXTA 4BDJA 3F7WA 1Y8GA 4OTPA 4ACGA 2IZRA 4YJOA 1KE8A 3W2RA 4DFNA 4WUAA 4FKJA 5HVYA 5J5TA 4JQ8A 4DC2A 4FA2A 5J1WA 2HW6A 4JDIA 5CTPA 5IEYA 2JITA 4BCNA 2E9OA 2C6DA 4WO5A 3O8PA 2YA9A 4C7TA 4EZ5A 4F65A 4FL2A 4I0RA 4QNAA 2HENA 3U55A 4YTFA 4ANMA 3WZKA 3EKKA 3K54A 3BHUA 5EDPA 4O0UA 2HZNA 2BPMA 3W33A 1PRYA 2R5TA 4BYIA 2XIKA 2V0DA 2F7ZE 2WTDA 3T9TA 4DCEA 2RFNA 4WOVA 5L2QA 5T3QA 2QOOA 3DB6A 2WU7A 4C0TA 1Q62A 3ODYX 3C7QA 2UVYA 3DDQA 4FV0A 4NJDA 4F6UA 5J7BA 5AP1A 2W5HA 3TDWA 4DT8A 1U54A 1Q4LA 4BCHA 1Q8YA 3K5VA 2EVAA 2XS0A 5D1JA 3BWJA 1WZYA 3FKNA 4FTJA 4L43A 4QTAA 3R7UA 3NVMB 2BUJA 3FDNA 4BB4A 2V5QA 5AP0A 1CTPE 4QQTA 2C30A 4NZWB 4CKJA 2GNJA 5LMBA 2DWBA 3UPZA 1A48A 2Z8CA 2W1DA 2B9FA 3H0ZA 5EYMA 5FGKA 2VTPA 3UPXA 3QXPA 2WFYA 3RHKA 4E4NA 4O7TA 4EJ7A 5CF4A 2CKPA 3PIXA 3SX9A 2IW8A 3LQ5A 3W16A 3GP0A 4EH2A 4CV9A 5C8KA 4CTBA 3RWQA 1H08A 4UN0C 3ZBFA 5A6NA 4O1OA 3ZFYA 2JFLA 3QQGA 4X0MA 3NW5A 1GAGA 1OVEA 1MQ4A 4KKGA 3LMIA 5M09A 5A4QA 4K0YA 4MXYA 5HD7A 3S00A 3PA4A 4M67A 4DH5A 2ERKA 3DCVA 3UQFA 2OKRA 4P90A 4N6YA 3RTPA 4C3FA 2ZB0A 3HP2A 1Q5KA 2UW5A 2YITA 1RDQE 5M4IA 1DS5A 2UW3A 2X8EA 5HVJA 3W2SA 2WAJA 1PMEA 4IX6A 4ZEGA 4CV8A 4E4XA 3PJ2A 2EUFB 3OOMA 4E8AA 2C0IA 2C1AA 5CXZA 4I6FA 4O86A 2VNYA 3OHTA 4GIIA 2BDWA 2VTNA
chains in the Genus database with same CATH superfamily
2RF9A 3Q9ZA 1DI9A 2ZFYA 3IECA 4NUSA 2PUUA 2HCKA 4ACCA 4OLIA 3R7GA 1NT2A 5BVWA 4AX8A 4EH9A 3WIGA 2EXEA 2I0VA 2X2LA 4W4YA 3UP2A 3UZTA 3MJ2A 3SQQA 4I94A 5DT4A 2NRYA 3DJ6A 2UZBA 4RJ3A 3LFQA 4WUNA 4LV5A 3IDCA 4LUEA 1LEWA 4TWCA 5EI8A 2C5OA 5HCYA 5BVNA 4PDOA 3Q6UA 3IK3A 4UXLA 3JVSA 4ORKA 5GIOE 2OFUA 4DITA 3LIJA 4EWQA 2Z2WA 4GK3A 4CRLA 4O91A 5KUPA 3FKOA 4OBOA 1NY3A 3R9NA 4BDCA 3GENA 3UMXA 2R3LA 5E92A 3LFEA 3RWPA 3UYTA 3LXNA 3MWUA 1P14A 4QQJA 1F0QA 4C61A 4AGCA 2QOQA 4S32A 2ESMA 4DCAA 5BVEA 4ZK5A 2YM7A 4ACHA 3TNPC 1J1CA 4J97A 4HZRA 4R6VA 4G9CA 5AUZA 3OBJA 2H8HA 4CKRA 1PF8A 4RT7A 3I5ZA 2C6MA 3OC1A 4C3PA 4UMPA 3PY1A 3MH2A 2EXCX 2O3PA 4G3DA 2PE0A 3VBWA 2VNWA 2PVNA 1OIYA 2OBJA 1WBNA 4QMLA 3FZ1A 4O4BB 4LRKA 1IA8A 2IW6A 4IM3A 3R1SA 4J96A 2H34A 5HOAA 4AE6A 3I7CA 3O8UA 4Q2AA 4U41A 3PXFA 3VJOA 2W96B 4QTCA 1IEPA 1QPCA 5FEQA 1IA9A 5DWRA 3LCTA 3P9JA 5E8WA 2BIKB 4O0XA 2FGIA 2PWLA 3KU2A 3VW6A 5AUUA 5I3OA 5J1VA 4R78A 2UZTA 5AX9A 4UALA 3NGAA 5ICPA 3V3VA 1H28A 3HV4A 4GL9A 2WQEA 2FO0A 4ASDA 1JSUA 5FTOA 5HORA 2X6DA 4V0GA 3AD4A 4F6WA 5AV1A 4I6HA 5E7RA 4B8MA 5DI1A 1Z5MA 3UNJA 4UYAA 3SA0A 5FLFA 5DRDA 5DVRA 4IAZA 3RM7A 4FT5A 1NVSA 3WF5A 5AA8A 1M2RA 4YJVA 2XNGA 1OI9A 3KN5A 2SRCA 4FODA 1CKIA 2X2MA 4CQGA 2VRXA 2BZJA 3NUPA 4DGNA 1SYKA 3AQVA 5AP2A 1PXKA 3NSZA 5CT7A 3MH1A 4FJVA 4N0SA 4AZFA 3PVWA 5CQUA 4A4OA 3QTIA 1YRPA 2XM9A 4U3ZA 4IZAA 4ZIMA 2UW8A 5CWZA 2WHBA 5CU4A 5EW3A 4IM0A 3PJCA 3ORIA 4XP3A 2X6EA 5G1XA 3ZRLA 3ZSHA 3PIYA 2BFYA 3QYZA 3BZ3A 4IW0A 3TJDA 1W84A 3W32A 2IN6A 4W8DA 4NYEA 3ZTXA 1WMKA 3MFTA 3Q3BA 1JOWB 2PVRA 4M7IA 5FD2A 1Q8UA 5FTGA 2YFXA 3IW7A 3KVXA 5GHVA 3QTZA 2PZPA 4CKIA 3LW0A 4IAAA 3TV4A 2FUMA 4DEHA 3VUKA 4O7WA 3DXNA 4RIYA 1OL6A 3Q4TA 3EQGA 4X3FC 4HVDA 4ZY4A 3VBTA 2W5AA 1XWSA 3NZ0A 4Q9ZA 4AGDA 2HIWA 4ZZNA 5K3YA 1H1QA 5ITAA 4L3LA 4RZWA 2WTKB 5ANIA 4DHJA 4I92A 1SVGA 4YHFA 1H1WA 2E2BA 5KX8A 2I40A 3UC4A 3EKNA 4YLKA 1LEZA 5JGAA 5LMKC 3F2NA 3UDSA 1XH6A 2B1PA 4I5HA 4MBJA 3NYVA 2YN8A 4R5YA 4WG3A 4XLIA 4QPMA 5J9LA 1URCA 4MD7E 5EDRA 2IWIA 4AW2A 1FVVA 2O5KA 3IKAA 1FBNA 2P2HA 2CHLA 3HAMA 4AW1A 4BRXA 5EK7A 4BTMA 4MD8E 3QTRA 5H8GA 3OFMA 5H8BA 3UIMA 3ZZEA 4YPSA 1YXVA 4NTTA 1GNGA 1UWHA 4PTCA 2XIRA 4P5ZA 1Q97A 3KB7A 5LVLA 2W1CA 4JAJA 3TL8A 5CSHA 5BUJA 4M66A 4FKTA 2BHEA 4G5PA 1NA7A 4NCTC 1ZLTA 5HI2A 4B4LA 4KAOA 2VN9A 4LGDA 1M2PA 3DTWA 1PXPA 3QRUA 5J9YA 4X7QA 3LFAA 3PSDA 4O7LA 2BRMA 3SLSA 3BLQA 3FLWA 3VS1A 2VX3A 2I0YA 3AT3A 1M7QA 4F6SA 1BKXA 3VULA 1OIUA 3HUBA 5JFWA 4M84A 5K4IA 5IA5A 3GVUA 1WBVA 1OPLA 4U44A 3VBVA 4XG8A 2ETMA 4RQKA 4IWPA 3NFGB 2XKDA 4HNFA 3CTQA 2WD1A 4X21A 4GKIA 4RX8A 5FTQA 1XR1A 2DQ7X 4O27B 2WOTA 1PYXA 3EOCA 3TTJA 4CCUA 2VTRA 4X3JA 1YXUA 2E9PA 4F63A 2WQMA 3FKLA 3GFEA 4GFMA 4QYFA 3HZTA 4DFBA 1VR2A 3E8NA 1W8CA 3RAHA 4Z3VA 3JUHA 2BRBA 1F5QA 2PY3A 2QODA 3DJ7A 3KCKA 4ZMEA 4BGQA 4PL4A 4MBIA 4D0XA 3KF4A 1J7IA 3ZZWA 4XEYA 2FVDA 2VO3A 3H30A 1STCE 1U54B 2IEWA 2XUUA 4A07A 2YCQA 4X2FA 5AM7A 3DKGA 4L8MA 3DBDA 3EQHA 2GQGA 2Q0NA 2XCKA 4QPSA 4RC2A 4G1WA 2GHLA 3DAKA 3F5GA 3HRCA 4RRVA 4BJJA 3OG7A 5M08A 4WNOA 4J8NA 2QOCA 2BALA 4OAVB 3LCDA 3OBGA 2VO0A 3EQDA 1APME 4EQUA 1J3HA 1Y8YA 4FV7A 3UMWA 4DEDA 5LJJA 2O2UA 2C0TA 5CANA 3PUFC 3NAXA 4MF0A 2YCSA 1R39A 4U9AA 5KMLA 3Q4UA 2X7GA 4G3CA 3KFAA 3PRIA 4MKCA 3WZUA 3DA6A 3TUDA 2YM5A 3E64A 2IJMA 4BF2A 4E73A 4FOCA 1GIIA 2PVKA 3KULB 3FZPA 2X1NA 2QO7A 3A8WA 3QX2A 4UYNA 3IGOA 3GXLA 4IANA 5AWMA 5K5NA 5C01A 3H9FA 5BYYA 4DEEA 4L67A 2C6EA 3COIA 3QF9A 3W1FA 5JQ8A 3NFFB 2XBJA 3F6XA 4RC4A 4IADA 4YHTA 4IXPA 5TE0A 2W5BA 5DR2A 4FYNA 4ACMA 4EKKA 4QDEA 3VS5A 2Z7LA 3TIYA 1Q41A 1ZARA 4Q5EA 3UOHA 3NUSA 1CMKE 3ZO3A 1H25A 1M7NA 3LZBA 3HV5A 4ZSGA 5DHJA 3L8SA 4BWPA 3H3CA 3RZBA 4LV8A 3C4XA 4FT7A 5AV2A 4KIOA 1PW2A 1ZXEA 4F7NA 3F3ZA 3QD2B 4M15A 1OKYA 2QOFA 4ZS0A 5M53A 4I6LA 4F9WA 4OTWA 2VTMA 4V05A 4LV7A 2VWXA 3S0OA 4O6EA 2GMXA 3ENMA 3ORLA 5ANEA 1JVPP 4AZSA 4F9CA 2ITWA 3L8XA 3VS2A 2WOUA 3BGPA 3C9WA 3LCSA 1GZNA 3OCSA 4D2WA 5HIEA 2QG5A 3R83A 4FSZA 4ZAUA 3HNGA 3R7OA 5CNNA 3S95A 4EOOA 5JKGA 4GUBA 2QU6A 3KK8A 4KIPA 4O2PA 4E3CA 2JKKA 3BV2A 3EN7A 2PE1A 1IAJA 3GU8A 4DH3A 2XK7A 3II5A 1OM1A 1S9JA 1MRVA 3LAUA 3VIDA 5I0BA 4PL5A 5KO1A 3HDNA 4F1TA 4U5JA 2REIA 5HX6A 5HZNA 3Q2MA 3RP9A 4AGUA 4ZTLA 3R9DA 2CCHA 4C2WA 4XP2A 3R7VA 3CKWA 1OUYA 1QPJA 1SZMA 3OW3A 1Y57A 2H6DA 3D2KA 4L6QA 2YERA 4TPTA 4GJ3A 5TKDA 4FKSA 1UKIA 3UTOA 4FEVA 3TM0A 2QR8A 5CSPA 5IF1A 4RX5A 4J95A 4KA3A 3ORXA 1ZMUA 3TJCA 2PVJA 4FNWA 1ZMWA 2YLFA 4OGRA 4PPCA 5CSXA 3F2AA 1OKVA 2C69A 3BHVA 4IH8A 4RMZA 4ZTQA 4DBNA 3BHYA 4YJPA 1KE6A 3HECA 2B55A 3BE9A 3GNIB 3MY1A 5D11A 5D41A 3TEIA 1UNHA 5IA2A 2B9IA 2PZIA 3PXKA 4H36A 4BIEA 4H05A 2R3QA 3DK6A 1G5SA 1M2QA 2GU8A 3U9CA 4EKLA 1KUTA 3Q2JA 5AR3A 4J99A 1U4DA 1P2AA 1WBSA 2WZJA 2J0KA 3NX8A 5ANGA 2XNOA 1PMVA 2J5EA 5G6VA 4M14A 2C6LA 4GV1A 5TO8A 4AFJA 4V0GB 2CGVA 2B53A 4X6RA 2G2HA 4OAUC 3GCSA 4QMTA 3LKMA 2OXYA 4O7RA 3C5IA 2QCSA 1P4OA 3ZOSA 2I0EA 2WMSA 1YI3A 4IAFA 2PUPA 2O65A 5DR6A 5EYDA 3CS9A 3EQIA 5L2IA 3UE4A 1RW8A 5M57A 4XMOA 2QHMA 2ZJWA 3R2YA 2JBPA 3DAJA 4CGAA 3E3BX 4IZ7A 4BCGA 2CGUA 2PTKA 2PULA 4IWQA 1KE7A 5AAFA 3K3JA 3MTLA 4C38A 5E1SA 4O22A 3GU6A 2WEIA 2BDFA 5F20A 3A4PA 2JFMA 3T3UA 3ACKA 2C5XA 3KN6A 4JIAA 4RBLA 4ZZMA 3TV7A 4BDBA 2IZSA 3W2OA 4BBMA 4FEUA 4AXFA 4EONA 2UVXA 5IEXA 4FG9A 4RGJA 5DBXA 2HY0A 1OBGA 3KCFA 5D9HA 2QOLA 3C4CA 2YWVA 3K2LA 3G0FA 4D1ZA 4EOKA 4EOQA 5HG5A 2J6MA 5HEZA 4D4VA 1XH8A 4EOJA 2RSVA 3MA6A 1J91A 2VU3A 5DT0A 2OLCA 3FC2A 4WRGA 5GNKA 4QMPA 2RG5A 3CJFA 4RIYB 3DS6A 1A06A 1CSNA 2X0GA 3V5PA 5IMEA 4DF3A 3TZ9A 4ANBA 4GK2A 4ALWA 3PXQA 2QURA 2WIHA 4GG7A 4IJPA 2XKCA 4RA4A 4ZSJA 5GJGA 4WIHA 2OGVA 4FTIA 1XH7A 4IB5A 5HICA 4E6CA 4PP9A 3QGYA 3BHTA 2OIQA 4I21A 4I6QA 5AP3A 1XHAA 3ZH8A 3IW4A 4BKYA 4K8AA 3KIOC 2A0CX 3W55A 1Q8WA 4NM5A 4BCPA 4C4IA 3UQGA 3O71A 4EBWA 3TG1A 3VAPA 5J95A 4LMNA 3QC4A 3RNYA 3F5PA 3LXLA 5C1QB 3NNUA 4XX9A 3BU3A 4KD1A 3KXHA 2HXQA 5M4UA 4DFLA 3FZSA 2R9SA 3OCBA 4EC8A 4HPUE 4JRNA 3DDPA 3V5QA 3U8WA 4XUFA 2JIVA 4Y5QA 4OBPA 5LCJA 4JOAA 1M14A 4FSYA 3W10A 1YXSA 3NAYA 3NLBA 3UOKA 3FMHA 5B7VA 2QONA 2JLDA 4I4EA 4YZBA 2R0IA 4OTQA 1B6CB 4RA5A 5IUHA 4IACA 1W83A 4BDFA 2OICA 1UU3A 4TYEA 3W0OA 1XH4A 4GW8A 2W4JA 4AOTA 2JAVA 1WBPA 4FBXA 4MWHA 2P33A 4WSQA 4DLIA 4M68A 4K11A 2EWAA 4IMYA 1XBAA 3FQSA 4BCOA 1JWHA 5F95A 2VV9A 3QZFA 3UBDA 4E5BA 3PLAE 4QMSA 3VJNA 1R3CA 5DFPA 2R3JA 4FTRA 4L52A 3WE8A 2ONLA 4RFYA 5LARA 2ZB1A 4ANSA 5IQGA 3OXTA 2XMYA 4JI9A 4WBOA 5DGZA 1OKZA 3R71A 2WTVA 5FXQA 4EC9A 4EH6A 2XAOA 5EDQA 4PMPA 4JMQA 1ZYDA 1U5QA 2WB8A 3FJQE 1YDRE 3D83A 3QCYA 4G34A 2XK3A 3PJ3A 4MNEA 4BC6A 3WARA 2ZMDA 4YLLA 5L8JA 3ORKA 1OGUA 4QNYA 3VHEA 3RAIA 5DEWA 2W99B 2W9ZB 1SVHA 4GU9A 4HYSA 3C51A 3F61A 3LFBA 4C36A 3NMUF 4UMRA 3KXZA 4APPA 4BYJA 4CFWA 4NW6A 3ATTA 3NUYA 4RX9A 5DEYA 4O7ZA 5HE3A 5IA3A 5HGIA 3PPJA 2XIXA 2PK9A 4R5SA 3TNWA 3UNKA 4BTFA 1YWNA 4W4WA 2WMTA 1MRUA 4FZ6A 4QMVA 3AGMA 3UZRA 2YISA 4FIHA 4XLVA 3PSBA 4FKOA 4ANOA 4EH4A 1YKRA 2W1ZA 3VQHA 1H8FA 3ZXZA 3VWAA 2PMOX 3R8ZA 1PXIA 2ZOQA 4M3QA 2I7QA 3DZQA 4D4RA 2J50A 3KRLA 3WYXA 3KXNA 3EMGA 3DLSA 1NVRA 1UU8A 4H3BA 4BTJA 3GEQA 3A99A 3E93A 1J1BA 1SMHA 1FVRA 4AQKA 2HOGA 4FSMA 2OFVA 4AP7A 4GSBA 4N70A 3RCDA 3HDMA 2W05A 5I9XA 4ERKA 3VUHA 2YHVA 5I9VA 3DZOA 2B4SB 4FIGA 3DBFA 4TWPA 5HG9A 3CJGA 3N4TA 3FQHA 2NPQA 4LGGA 4TYGA 4DH8A 4LGHA 3HMOA 3ALOA 3VRYA 3ZU7A 4RWLA 1PXNA 2OJ9A 2YIRA 4BDHA 2PYWA 5I9UA 4DFUA 3CLYA 3E92A 2IF8A 1WBTA 3ERKA 4XG2A 1UNLA 4MCVA 4UWCA 3UVPA 3WBLA 4OT5A 3EJ1A 3L8PA 3WI6A 1H24A 4BZOA 4QP3A 5T6KA 1Q3WA 3ETAA 3ALNA 4IDVA 4E93A 2FSTX 2C6TA 2YDIA 3A62A 2C3KA 4YTHA 2Y4PA 4IBMA 3GFWA 3KMMA 3FE3A 2XYNA 3C4EA 3FZRA 3QKMA 1LR4A 4AZTA 1PXLA 2ACXA 4C4EA 3NCGA 4EQMA 2AEGA 2R3PA 4EK8A 3W18A 2J0IA 3FL5A 3R2BA 4I5PA 2YJRA 1SNXA 5HQ0A 3PJ1A 3UC3A 3A2CA 3DGKA 3LFFA 1FINA 2WTWA 5CVFA 4UWYA 3U9NA 4BDIA 4Z7GA 3D4QA 3FPQA 5HG8A 1HOWA 1UVRA 3G0EA 3GT8A 3D14A 4AS0A 4CFNA 1H4LA 2R3HA 5AX3A 2E9VA 3HV3A 3NIZA 4FT9A 3IS5A 2XNPA 4F64A 5J87A 3VONA 3DNDA 4KSQA 3QHRA 2YABA 4PX6A 3TMOA 4FKPA 4DGGA 4FV6A 4DFXE 2JDOA 3B2WA 2R7IA 3QGWA 5BVFA 4XBRA 1CKPA 2NO3A 1FGKA 4AACA 5M56A 4YUQA 4RWJA 5BVDA 2CNQA 2WMAA 1OL2A 4FNYA 4MXXA 5CI6A 4DDIA 4MXOA 3N4VA 2W06A 1WCCA 4EUTA 5IUIA 2J9MA 4K77A 4I5CA 1ZZ2A 3T3VA 4KRDA 4ZSAA 3TKIA 3LXKA 4LFIA 1P4FA 4ANQA 4BGGA 5LVOA 2XBAA 2DUVA 3AG9A 3PIZA 3H9RA 2I0HA 4F78A 5A4LA 3HKOA 3ENHA 4JXFA 4CZUA 2WMVA 4EWHA 4TWNA 4OUCA 3POOA 4D0WA 2X7FA 3O7LB 5GJFA 2Z7RA 2A1AB 4NWMA 3F3TA 4JNWA 5EM6A 4CT1A 2Z60A 3S2PA 2X9FA 4XG4A 4ZTHA 2QOBA 2OW3A 2RKUA 2YEXA 3MFSA 3PVBA 4L7FA 5EH0A 3FXWA 3OWKA 4Y5HA 3AMBA 4G3EA 3ZUUA 4YU2A 5BQ0A 4JLCA 2C5NA 4LMUA 2YIWA 3U6IA 3ORTA 2QHNA 2XNNA 5DPVA 3I4BA 5AP5A 2XK4A 5ANOA 2X4ZA 4CFUA 5C4KA 3FLQA 4JDKA 4LRMA 4O4EA 4WA9A 5F4NA 4XV3A 3WYYA 4IX4A 2AUHA 5ANDA 4G5JA 2VO6A 4D2TA 5HTBA 2BROA 4QP2A 3VUGA 4FSUA 4USDA 4M97A 3TACA 3SOAA 3D5UA 3HX4A 3OWPA 3WF9A 4PRJA 5GIPE 4DBXA 3MTFA 4TTHB 1Y6AA 5CSWA 1ZYCA 4RLKA 3DB8A 4IX3A 1PXOA 3FHIA 2QD9A 4HVIA 5CEPA 2X81A 4D28A 2PVHA 4C58A 4QP8A 3FI8A 3PXRA 4RX7A 3LFDA 3CXWA 3GC9A 2ZMCA 3HEGA 4F9YA 5AP4A 4JT3A 2JEDA 4E7WA 3MVMA 2H96A 5DOSA 1OUKA 3MPMA 3Q4ZA 4EHGA 4AQCA 5I9YA 5A54A 1FMOE 3ROCA 2HK5A 2BAJA 3AT2A 4BWXA 1CKJA 4PMTA 2BR1A 4DINA 1U5RA 1YOJA 5CAQA 1ST0A 3RKBA 3SD0A 3V5JA 4FKVA 5E9EA 2R3OA 1O6KA 2UZDA 4M0ZA 1O6LA 3F5XA 5IPJA 4G3GA 4U45A 2CKQA 5C03A 5HLNA 4O7NA 2ZM3A 3VRZA 3NW6A 4TKSA 2BIYA 2OWBA 2XRWA 2WO6A 2UW0A 5CZHA 2A2AA 2G2FA 4B6LA 2YACA 4ID7A 1XH5A 2C6OA 5LMKA 3KEXA 3PP1A 4D58A 2ZAZA 3GCUA 3BWFA 5AAEA 2ZVAA 5AP6A 5JT2A 4JBOA 4ZJVA 3Q04A 4EI4A 3JXWA 4ZTNA 3BYVA 3VBYA 4DE4A 3BL9A 3DU8A 5CQWA 1I44A 5T68A 4X2KA 4ZTRA 5CALA 4AA0A 3RPYA 1ERKA 4D2PA 3VS7A 4O0SA 2OK1A 4FV9A 4QYYA 2W1EA 3FI4A 4EZ3A 4ZJJA 3PZHA 3G9NA 3UODA 4XOZA 5LCKA 3AD5A 1FPUA 4IJ9A 3RPRA 3G5DA 2GHGA 4CZTA 3Q5ZA 3MN3A 5DIAA 2GSFA 4X6QC 2V55A 4QMNA 4Z16A 4USEA 4FKLA 1AD5A 4QOXA 4RVMA 2UV2A 2I1MA 3WF8A 3GU4A 4QMUA 3MH0A 1OB3A 4R8QA 4NKSA 4FE2A 2A98A 2VGPA 2PU8A 3TKUA 2FA2A 3HLLA 4YSJA 5CF8A 3I79A 1OIQA 2UW4A 1TZDA 2VAGA 2XJ0A 3G6GA 3L9PA 4IVAA 5EHLA 4EOSA 2PUIA 2Y6OA 5HE1A 2JC6A 1FMKA 1ZYLA 4A9SA 1KOBA 2B7AA 2ZDTA 5FDXA 1BI7A 2YM8A 3QRKA 5IQFA 4MNEB 4Z9LA 2O63A 4MXCA 3PTGA 2PVLA 2XK8A 4FF8A 4LG4A 5EKOA 5HU3A 5IQEA 1BL7A 3FMDA 3WOWA 4JX7A 1ZWSA 2IPXA 3CQEA 4F09A 3OT8A 1QMZA 1RE8A 5CLPA 2AQXA 5HBJA 5EHOA 3CPBA 3EN5A 5E1EA 5HLWA 3OS3A 3IW6A 4LUDA 3R7YA 3NVKI 3W0QA 3R63A 1FQ1B 4FNXA 4FKUA 3QQFA 3OVVA 1KV1A 4JQEA 2GNHA 5EQYA 3RVGA 4IX5A 3FWQA 4V01A 3Q53A 4DTKA 2YDKA 5EQEA 2PE2A 4FTMA 4C4JA 1J7LA 2FYSA 2GTNA 2PVMA 5E8YA 5BVKA 1E1XA 2Q0BA 2UZEA 2VX1A 3EFWA 3P7CA 4WBBB 5BYZA 3EZRA 1ZYJA 2OU7A 2WIPA 4Z55A 4FSRA 2XK6A 3A7IA 1DAWA 5J5SA 3C0GA 3KL8A 2I6LA 3SG9A 4CG8A 4YGAA 4ZP5A 3ZC6A 2R3IA 1UKHA 3KGAA 5TOZA 3LM0A 4QP6A 2XVDA 1WBWA 3PJ8A 4A4XA 3AXWA 5AUYA 3NWWA 3F69A 3SAYA 1JKKA 3MA3A 4YNEA 1J7UA 4FEXA 3MPTA 2AC5A 5LXMA 1KSWA 4E4MA 1R1WA 3E62A 3ZDIA 5CT0A 4BZNA 3F66A 3QQKA 4HGSA 1WVWA 2BTSA 3Q96A 1W0XC 5L2SA 4DH1A 3ANQA 3TUBA 3CY2A 3N51A 3COMA 5L6WL 3WZEA 3ZO4A 3OEFX 1WBOA 4QQ5A 3RZFA 3A8XA 4FTOA 4BCFA 4C37A 1YWVA 2R3KA 2HELA 2XZSA 3EL7A 2XRUA 3MVJA 1PYEA 5JGBA 3E87A 4DDGA 3DXQA 1UNGA 3D94A 1W2FA 2W1GA 2UZVA 5D10A 3QZGA 4FYOA 5DT3A 4CYIA 4AAYA 2JDSA 4NW5A 4AA5A 4BCMA 4FOBA 4ZXTA 3P4KA 2C5YA 4FG7A 4BKJA 4EL9A 2WMQA 1MUOA 4KKEA 4MVFA 5KHXA 4M13A 5HE2A 3PVGA 4L9IA 3LE6A 4UXQA 4V04A 3JVRA 1FVTA 4PP7A 1YI4A 2UW9A 1YDSE 3R7EA 5LVNA 2VTIA 3LJ2A 4G3FA 4J52A 2EXMA 5CAUA 4FX3A 1JBPE 5AJQA 5F9EA 1L8TA 1BMKA 1GY3A 3EYGA 5IQDA 5AUXA 3Q5IA 4ASZA 3ITZA 4O0RA 2W1IA 5HESA 3VUIA 3KK9A 2QOHA 4F4PA 4LYNA 5KBQA 2RGPA 4ASXA 4F9AA 4O0TA 3ZMMA 3HA6A 4FK3A 4PDSA 4C4GA 5CVHA 1G8KA 1BUHA 3KVWA 5HO8A 3LCKA 2X4FA 4PPAA 4RWKA 2R0UA 3Q32A 4DG0E 5EM7A 2ITPA 4MD9E 3C4WA 2RG6A 2IO6A 4IB0A 3NUXA 4TNBA 2WKMA 3FMKA 3PFYA 1AQ1A 3UG1A 2WEVA 2QO9A 2ITNA 2Y8OA 2E9UA 3OTUA 4XJ0A 3ATSA 1PXJA 5AUVA 1Q61A 3IDBA 3NS9A 4GU6A 4UMTA 2XJ1A 4BHNA 2G1TA 4G9RA 4QDVA 2IZUA 4AOIA 2QLQA 2RFEA 4W4XA 3KXXA 1V0PA 4LOQA 4GYIA 4TW9A 3ZS5A 4BKZA 5C9CA 4GFOA 5LOHA 3ODZX 4BI2A 5BV3A 4DH7A 3KRJA 3NYXA 1GOLA 3EN6A 3KXMA 3FXXA 2XH5A 4TRLA 4Y46A 3ZHPC 3ML1A 2OJGA 4FSWA 2UZOA 4JIKA 3MSSA 5DA3A 3VUTA 1TQMA 5KMIA 5C27A 3TYKA 5AR5A 2VD5A 2O0UA 3MPAA 4BCKA 5IA4A 5CI7A 3SDJA 3FZTA 4AT3A 4YJQA 3QZHA 3H4JA 4DHFA 4FUYA 2GQSA 3PVUA 3I1AA 4HZSA 3PFQA 3WF7A 5LVMA 3OCTA 2QR7A 3OROA 3QYWA 3QTQA 4UV0A 4Y85A 3RK9A 4KSPA 3GUBA 3SKCA 4CTCA 4DEAA 4FC0A 4E6QA 4MNFA 4JL9A 1R0EA 3I0OA 4O21A 1BI8A 2YCFA 4JDHA 5HTCA 3R1YA 3VC4A 4BCIA 3ID6C 3UOLA 4P7EA 4APCA 2R2PA 3P5KA 3EQCA 4QTDA 1ST4A 5BYLA 4ZMFA 4X2JA 4YURA 1GZ8A 1UV5A 2GFSA 1YHVA 3KC3A 3GI3A 5D12A 2HAKA 4BWKA 3PYYA 3DFAA 3QKKA 4B8LA 1LP4A 5BPYA 4MF1A 1WVYA 4QP1A 5AIRA 2OO8X 2Y4IB 4FTTA 4FZAB 2W4KA 3QRTA 4YC3A 1UU7A 2PL0A 5AMNA 3BL7A 3FEGA 3FL4A 2W1HA 4EBVA 3CGFA 3M11A 4A7CA 3SV0A 5KBRA 2J51A 2CCIA 2OF4A 4A9TA 4DLJA 4YP8A 4E5AX 4CNHA 3COHA 1BYGA 3DAEA 3MVHA 2C6IA 3PSCA 3QWJA 4EOMA 3LMHA 4RC3A 3NYNA 4U43A 3QRJA 3EIDA 3EHAA 3RPOA 3FYKX 1H27A 2PZYA 3VUDA 4I4FA 4RG0A 2P2IA 3CEKA 2ZV9A 2V7AA 4FTUA 5H3QA 5TF9A 4AGWA 4XRLA 3SRVA 3ZYAA 4R7HA 4EH5A 3VN9A 4AZWA 2ZM1A 4MX9A 4QRCA 4JQ7A 5IH5A 4KABA 4OTDA 3A7FA 5JRSA 5JRQA 3DK7A 4OBQA 5GJDA 3W0PA 3HGKA 4FK6A 5KCVA 3LCOA 4L53A 3W0MA 2VWUA 3MY0A 3QWKA 4DFZE 3IW5A 5E8TA 4IFGA 1H07A 3FZOA 4MK0A 1XMMA 4FTQA 2C47A 4MHAA 3P08A 5CX9A 4I41A 3R9RA 1H01A 3R8UA 4PMMA 5HKMA 2XKFA 3FSKA 3HP5A 4RFMA 2YM3A 5ANJA 5F94A 4DA5A 3FLNC 4XG7A 5CF5A 2KTYA 4IM2A 5EG3A 4KB8A 4DT9A 4YJSA 3ZXTA 4FSQA 5L4QA 4L3PA 3PE2A 3HRBA 4EH7A 3UIBA 2DS1A 3KA0A 3DPKA 3OF0A 1BX6A 3D5WA 3R73A 4MXAA 4WNPA 5EW8A 3OEZA 5HHWA 5IQIA 2QKRA 4DEBA 3F88A 3AMYA 3KRRA 3ORMA 3V04A 3ZLWA 5KMKA 5AAGA 4BIDA 4I22A 1F3MC 2ITXA 3D7TA 3V8SA 4RJ7A 3JR1A