4G3FA

Crystal structure of murine nf-kappab inducing kinase (nik) bound to a 2-(aminothiazoly)phenol (cmp2)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
333
structure length
312
Chain Sequence
SGSVSSGQAHSLASLAKTWSGPETEDNEGVLLTEKLKPVDYEYREEVHWMTHQPRVGRGSFGEVHRMKDKQTGFQCAVKKVRLEVFRVEELVACAGLSSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLIKQMGCLPEDRALYYLGQALEGLEYLHTRRILHGDVKADNVLLSSDGSRAALCDFGHALCLDYIPGTETHMAPEVVMGKPCDAKVDIWSSCCMMLHMLNGCHPWTQYFRGPLCLKIASEPPPIREIPPSCAPLTAQAIQEGLRKEPVHRASAMELRRKVGKALQEVGGLKSPWKGEYKEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NF-kappa-beta-inducing kinase
publication title The crystal structure of the catalytic domain of the NF-kappaB inducing kinase reveals a narrow but flexible active site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 107
structure length 312
sequence length 333
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2012-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4g3fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4g3fA01
3GCUA 5CENA 3EN6A 5JMSA 2XCHA 3BLHA 1UKHA 4TT7A 2J50A 4FKWA 5ANGA 2C68A 3ZO1A 4C35A 4WT6A 2WO6A 2R3LA 1MUOA 3TKHA 4M14A 4I1ZA 1K9AA 4EJ7A 5JH6A 5BVWA 5J9LA 1NT2A 4O7TA 5M09A 4D1SA 3NVMB 3RM6A 4I0TA 4QPAA 2V7AA 2YCSA 2HIWA 1RJBA 1U59A 5IKWA 2H8HA 4E4LA 1H24A 2GNGA 3VS6A 4BDHA 2B4SB 5DRDA 3UO6A 3C4XA 2X6DA 4BCQA 3G51A 5H3QA 4FEXA 3BHUA 1KV2A 5DH3A 5KMMA 4BR3A 4E73A 2RF9A 1ZRZA 3MIYA 5FBNC 4ZXTA 4ANNA 5HQ0A 5KMKA 3FMMA 4D2TA 2CCHA 4LL0A 3QRUA 4JIKA 4CTCA 4CRSA 2B52A 4YBJA 3EL7A 3G33A 4RBLA 2C6IA 3OP5A 3G9LX 3SLSA 4AQCA 5BVOA 2X0GA 3QALE 2Z7SA 4JQ7A 2YACA 3GGFA 4L43A 4MH7A 4DTBA 1W98A 4XV3A 4CV8A 2BDWA 2BFXA 3GNIB 3PRIA 3ZC5A 4LV8A 2XK4A 1CM8A 1XO2B 3ERKA 3HDNA 4HZRA 4I6HA 3R73A 5A14A 3PVWA 5LWNA 3LQ8A 3RBWA 4OTRA 2V5QA 4BN1A 3CE3A 2ZM4A 2XH5A 4JVGA 4DGNA 4A9UA 3HMMA 4IE9A 4DYMA 5EKOA 4QTEA 2CKPA 4CVAA 3H10A 3OUKA 4GU9A 2BZHB 3FMDA 3MPAA 4IH8A 3ZUTA 4BBMA 4FOCA 2C6TA 4RFZA 4FKUA 1OPLA 4GUEA 4H3QA 4RVLA 5HZNA 3PWYA 4EQUA 3KN5A 5CI6A 5EM6A 4IIRA 3ANRA 2RGPA 2HZ0A 4WA9A 1WBWA 2QD9A 3IOPA 2JDSA 3I81A 1XH7A 2PE1A 2VAGA 2WMVA 3DK6A 3NAXA 5HEZA 4CD0A 4F9YA 3WZDA 1RDQE 4V04A 3E88A 4RSSA 2R3QA 5FP5A 3CR0A 3H9FA 4LM5A 1Y6BA 3EQPA 1A06A 3LXPA 4F0FA 5JEBA 4BTJA 2PPQA 2B9JA 3NNXA 4W9WA 4HVSA 4WBOA 3VNTA 3AT2A 5AR4A 4BC6A 4PDSA 3FMKA 3F7WA 1H0VA 2HZNA 2W1DA 1WCCA 4R6VA 1UV5A 3ALNA 4RJ3A 2IO6A 3RGFA 2QOOA 3DXNA 5L8LA 4C33A 3FL5A 4BDKA 1WBTA 5H9BA 1SYKA 1G5SA 4IB3A 3V5JA 3EQGA 3R7UA 2AC3A 4K2RA 5C26A 5FXSA 4CMTA 2OZAB 4CNHA 1IG1A 5LMKA 1H27A 2XB7A 3HNGA 4I5PA 3KA0A 4IB5A 5DWRA 4ZTQA 4FUXA 3NUSA 2PUUA 2BR1A 3AQVA 4DFZE 3CEKA 2WB8A 2WMTA 2BAJA 4TWPA 4ZK5A 5IUGA 1Q3WA 5ITAA 2YCQA 3CTJA 4GG5A 1ZY4A 4IZYA 4PX6A 1SMHA 2VRXA 2J9MA 3MVMA 3UVPA 2BZJA 2F2UA 4NH1A 4QP9A 3VHKA 3WZKA 4C02A 5DT4A 3FV8A 5LQFA 4CG8A 3FKLA 1CMKE 2XNMA 3UP7A 5IA3A 3D7TB 3O23A 2XIRA 3EJ1A 3FZPA 5CI7A 4D4SA 4RIWB 5AUXA 3CXWA 1JOWB 3LXLA 4EC8A 2PUPA 4HCVA 4TTHB 2PZPA 3CS9A 3MFUA 1VEBA 4O81A 2CGWA 4IHPA 2J5EA 4YLJA 1OL2A 2P2HA 3FY2A 1TVOA 2SRCA 4FVRA 3BWJA 2R3HA 3E63A 1DS5A 3V6RA 2J5FA 4MXOA 2O5KA 3UYSA 3D14A 3O2MA 3FQEA 5AUWA 2BRHA 4DF3A 3I5NA 3R2YA 4D28A 2OF4A 3F5GA 4BCPA 3DXPA 3V8SA 3L8PA 4A4LA 4QP1A 1Z57A 5J5SA 3DDPA 3LFCA 5AR3A 3THBA 5IQDA 3F5PA 2FSOX 1PHKA 2JD5A 3QC4A 3RP9A 2HOGA 3QRIA 4FF8A 3VBXA 4YURA 2W1FA 2WMUA 4J98A 2WTKB 3D83A 3MY1A 1WVWA 2DYLA 2ESMA 3KK9A 1Q4LA 2YM6A 5C03A 5CU3A 5HVJA 4WKQA 2WKMA 3NUYA 5AR2A 5BUJA 2HXLA 4KD1A 4AE6A 4X2GA 2PU8A 4JLCA 3VS7A 4AXAA 3FEGA 4G6NA 4B0GA 2PZ5A 3LPBA 4LUEA 3F66A 1SZMA 4FSWA 5KBRA 4E20A 1LR4A 4MXYA 3N51A 2P4IA 3OXIA 3Q4TA 4H1JA 3QYWA 4OTFA 4CXAA 3MGYA 4DEEA 4MYGA 3MYGA 2YJSA 4IC8A 4TL0A 3KKVA 3LFNA 3F69A 2OSCA 2WTIA 3VBTA 4EH9A 3R6XA 1NVRA 2WU7A 1IRKA 3E7VA 2GFSA 3CY3A 3PDTA 4DE4A 4V0GB 2YLEA 4H58A 4EHZA 1PXNA 3SG8A 3VULA 4EK6A 1FPUA 5LVOA 3RPSA 4GT5A 5DGZA 1KOBA 3QQJA 4EBWA 1REKA 2WMBA 4PMSA 4CZTA 3SW7A 3RPVA 2WQOA 1ZYJA 2GFCA 4NM3A 4TYHB 3RKBA 2PWLA 3QRKA 4TW9A 4Y83A 3QXOA 5BQ0A 2WU6A 3DXQA 4FZDB 4D2SA 3FHIA 4YTFA 5FXQA 4TPTA 4FIJA 4P90A 1P2AA 4ALUA 1JAMA 2JLDA 3FZSA 4FT0A 1R39A 3GC8A 4EK8A 3ENHA 4F70A 3LMIA 4AZFA 4O7RA 2EXEA 3P9JA 4WO5A 4XMOA 1LP4A 3K54A 2JKMA 4BB4A 5JQ5A 4AUAA 3LFEA 2CGVA 2KTYA 3E7OA 5JKGA 2PUIA 3DB8A 4MWHA 5IA2A 5HE3A 2XEYA 3C7QA 1Q8ZA 4FZ7A 4BDBA 3LCSA 2FGIA 5ETAA 4BZOA 3QL8A 5IEVA 3UNJA 4U43A 2C6EA 1MRVA 4W9XA 5CAVA 3CKWA 5I3RA 4NFNA 4GK4A 2E9VA 2JDTA 4S32A 4UYAA 5CAUA 1ZXEA 3O50A 1YDRE 3N4VA 2IJMA 3SHEA 3FQHA 3FUPA 2PVNA 4CT2A 4C58A 4RPVA 5FTQA 2FSMX 3CJGA 4JBPA 4EOIA 5L6WL 3G15A 3G9NA 4JDHA 3OW4A 3GUBA 4QQ5A 2IPXA 4IWPA 2NP8A 4XNEA 4O2ZA 3BEGA 4D1ZA 2W1ZA 4W4XA 4EOOA 5JFXA 3P08A 5HI2A 1PXLA 3P7BA 1CKPA 2UZOA 4EHGA 2W5AA 4ONAA 4V01A 3DNDA 4U0IA 3HVCA 2GQRA 2GS6A 5M44A 2EU9A 2ITUA 4FIIA 4KS7A 3LM0A 4BBEA 4FT9A 5A4LA 4JQ8A 5GZ8A 3R7GA 4G5JA 2ZVAA 4M13A 4Z7GA 4FTQA 3PP1A 2HW6A 3MH3A 2F57A 1XJDA 2NPQA 4KIPA 2P33A 5EQPA 1KE5A 2C5XA 3WE8A 5LMBA 3ZO4A 2ITNA 2W17A 3PY3A 5BVNA 5L4QA 2OWBA 2JKQA 5HG5A 1XKKA 3DTWA 4AN3A 4IVBA 4O0XA 3DT1A 4J8MA 3COKA 4YC3A 4U45A 4E5BA 1U5RA 3B8QA 3NUNA 5I9YA 3C51A 2QO2A 1JNKA 3ZRMA 3HV4A 3RHKA 4X2NA 3JUHA 2BIKB 3OC1A 3C0GA 5M53A 3MVLA 3R02A 3QQUA 4QQCA 4J71A 2BRBA 2UV2A 5EW9A 2VTIA 4JJRA 3QTRA 4IWQA 4OR5A 4DGOA 4UMPA 1M17A 3OT8A 4N70A 4XRJA 3UZRA 4R3RA 5EKNA 3F5XA 4F7LA 3DAKA 1U54B 3RI1A 4DCAA 2XJ2A 3FLSA 1YOJA 4NTTA 3W16A 3NRMA 2PVHA 4RJ5A 4DEBA 4BGQA 5JRQA 5DI1A 2AUHA 1ZY5A 2BZKB 3WOWA 4G3FA 3PJ8A 5FM3A 2ITTA 3I6WA 4J96A 5DYJA 4HYHA 2XKDA 2XK8A 3BHTA 4GVAA 4UWYA 3L9MA 1R0PA 3GC7A 4GK3A 2B54A 4EK5A 1Y8GA 3CQUA 4G1WA 3BYSA 2HENA 3HEGA 3GT8A 4LFIA 4AA0A 4F4PA 2RFNA 4CMOA 1OIQA 2WMQA 2VGOA 4FKGA 2ITPA 3OHTA 3ALOA 5LCKA 2PVKA 3DCVA 4IM3A 5ANOA 3ACJA 4OTGA 4FTRA 3F2NA 1ZMWA 2IW8A 3ZUUA 2CJMA 4KRDA 2C3LA 1WBSA 2W1HA 3O8UA 4R78A 2GNFA 3PIZA 4GL9A 3MA3A 1YQJA 2C5OA 3LW0A 3S1HA 2Z8CA 3VW6A 4RWJA 3MSSA 5HLWA 3WI6A 4USEA 4RMZA 2HWOA 2ZAZA 4GMYA 4QMUA 4IZAA 2R3NA 4DEGA 2EXMA 5L8KA 3PP0A 2Y0AA 1XH8A 4O7NA 3LVPA 3BE2A 3AGMA 3AMYA 2W1CA 4IEBA 2XNGA 4L3LA 5FUTA 2R3FA 3R1YA 4FSRA 4FV9A 4XH6A 5AEPA 4YJOA 4DH7A 5M4CA 4U5JA 4D4RA 2J90A 2GNLA 4UBAA 3BI6A 4C4EA 4NFMA 4QMYA 1FBNA 4DH5A 3VUTA 3C4CA 4YHTA 3TNIA 1ZLTA 3E62A 2JC6A 3JYAA 4EYMA 2OXXA 2VWZA 3N9XA 4TYJA 5E8YA 2R3OA 4S33A 3ORKA 3I0OA 4BI2A 2BKKA 2QLQA 4H1MA 3HL7A 3ZRKA 5TR6A 2X8IA 4AF3A 5M4UA 3RWQA 4WD5A 1TKIA 4XG8A 4NW5A 2JDRA 2A27A 4G9CA 5CQWA 3V5QA 2CLXA 3LXKA 3OXZA 4I5HA 2OICA 4FK3A 5BYZA 5EI8A 4FG8A 4X2JA 2P55A 3O8TA 4GYIA 3W1FA 4OTDA 1BI7A 3OMVA 2WTWA 4IAZA 4AGWA 2GS2A 4F65A 5HOAA 2XRUA 3MV5A 4ZTRA 5L6OA 1HCKA 4PWNA 4EKLA 4ZY5A 3FKOA 3GU6A 2VO6A 5TF9A 2YAKA 3LFQA 4Z9LA 1KE8A 1BKXA 2YDIA 3Q5ZA 3CGFA 4YZ9A 2VTAA 2ZM1A 2C5VA 3FHRA 4WNKA 3CPCA 5EW3A 5HORA 1JBPE 2XNNA 5IQBA 4I0SA 3PXFA 4YZCA 4S2ZA 5D7AA 5E8ZA 4F9CA 3COMA 5LVPA 5DR6A 4BF2A 2Y7JA 4D1XA 4CCUA 3NR9A 3SOCA 3DK3A 2YHVA 3AD6A 4QMNA 2C47A 2O64A 2X7OA 4HNFA 4IDTA 4IXPA 4NW6A 4WUAA 3DBDA 4ZSAA 5EQEA 2YISA 4DCEA 3VIDA 5EG3A 3W2QA 4O7ZA 1Q97A 3MB6A 1JSVA 4FA2A 4DEAA 5E8WA 1H1WA 3GU7A 4J99A 3A4OX 1FVVA 2ZB0A 4FR4A 4OW8A 3OY1A 4L3PA 4C3FA 4F1MA 5M56A 2CPKE 2W99B 3QLFA 4DITA 2PULA 2PZRA 3HUCA 3QLGA 2QHMA 3ULZA 4XJ0A 4W4YA 4NIFB 4FODA 3MB7A 3QAME 4RIOA 3VVHA 2B53A 4EUUA 1IR3A 4DGMA 3F5UA 3KC3A 2B55A 5GNKA 4DH8A 3A62A 3PWDA 1Y8YA 3DQXA 3FZ1A 4KSPA 4X2KA 4CQEA 1FGIA 1J1CA 5D7VA 3ROCA 4CYIA 1QPDA 3ULIA 3BU3A 4KS8A 2GNJA 4JG8A 4PQNA 5CSXA 2Z7RA 5KKRC 3VJOA 4F1OA 1YDSE 3H9OA 3FZOA 5HX6A 4D2PA 3DBCA 1ZOGA 1FMKA 1PXPA 4XOZA 5A6OA 5FXRA 3A8WA 3RAHA 3E8CA 3SXSA 5HBEA 3CSVA 5E90A 5CAQA 1GIHA 2PZIA 4G31A 5M57A 2RFSA 1GAGA 4FTKA 5DN3A 4O7WA 3W33A 4B6LA 2XM9A 2WOTA 4L7FA 4R1YA 4ASXA 1YXVA 2HWPA 2RSVA 4RC2A 4IZ5A 2BKZA 4EH4A 4FT7A 4O0SA 4CLIA 3IG7A 1L8TA 3TM0A 1FGKA 1F0QA 3NCZA 4LV5A 4A9TA 3FMEA 2C6LA 3CLYA 4R3PA 1IASA 5A46A 3GC9A 4ITHA 4PTCA 4MF0A 5I9WA 5HESA 4OT5A 4ZY6A 3P79A 3I6UA 4YUQA 4RIXA 4R7BA 5IQEA 4U8ZA 4QMQA 3BHYA 3KRWA 4XLVA 5LVMA 4DEIA 2O8YA 4ID7A 3SRVA 3Q6WA 3TKIA 3CTQA 2VTHA 4N0SA 1E9HA 5IA0A 1LUFA 5KO1A 1OL5A 2QOLA 4XG2A 5DVRA 1H8FA 4FKJA 4NM7A 4BDAA 3Q32A 4ZSJA 5FEQA 5HCYA 4AW2A 2OFUA 4CRLA 2XJ0A 3PSDA 3D9VA 4M66A 5CS6A 2JAVA 1W83A 1CKJA 3A7HA 3KEXA 3EQCA 4QQJA 2AC5A 3PY1A 4PPAA 4F7NA 4UWCA 4KINA 2HZIA 2C0TA 3NYXA 4RX9A 2BZIB 4FNWA 4AZVA 1XH9A 4BIEA 4C2VA 3W2RA 4B9DA 1H28A 3IW8A 5IQFA 2XRWA 4AAAA 2C3JA 2QKWB 3MFRA 4O0RA 4BDCA 3QKMA 4FV1A 4DFXE 4Z3VA 2VX0A 4MD7E 4PV0A 3GU8A 3TT0A 5CF6A 5IDPA 4N57A 3PA4A 5AUUA 4FL3A 1OPJA 3GCPA 3OW3A 3TV4A 4EYJA 4ORKA 1M2PA 4BWPA 5JK3A 3BIZA 4ZIMA 4JAIA 2CNVA 3PXZA 4FOBA 2HAKA 3S3IA 3UIBA 2W5HA 4GRBA 4RLLA 3MTFA 4V05A 5HNBA 4JXFA 1Z9XA 3LQ5A 5ACBC 4HVHA 2YM8A 4QMWA 3V01A 5GIPE 1QPEA 3OOGA 3ZM9A 5HCXA 2WTJA 3QD2B 2WMWA 4FSTA 5JZJA 2YEXA 1PYEA 5H2UA 3QD0A 5IQIA 1DI8A 3EZRA 3V5TA 3MTLA 2IG7A 5GJDA 3RPOA 2HK5A 4IFCA 2JKKA 3HV7A 3TZMA 5IUHA 1VZOA 3EQDA 4FV7A 3ZLSA 3R9OA 3GOPA 2VTSA 3RHXA 4FL2A 4WRSA 4D0XA 3ZTXA 2EVAA 2WTVA 3WZUA 1W8CA 4IVDA 5DRBA 3ZUVA 4QOXA 5LJJA 4IVCA 4IM2A 2IVUA 5HO6A 5GHVA 5CYIA 5IA4A 4NCTC 3Q4CA 1MRUA 3BU6A 4TKSA 1OKYA 5CEQA 2ACXA 2Y4IC 4ZOGA 4U80A 2X7FA 1S9IA 4FKRA 4D2RA 2PK9A 2VTTA 2WQMA 4IAFA 1QL6A 3TCPA 1AQ1A 4PNKA 5HBHA 4E5AX 2NRUA 2BIYA 4GG7A 2UZDA 3DBFA 1MQBA 4U40A 5EFQA 5ACKA 2OJFE 3QTUA 3IW6A 4LOQA 5FEDA 1IAHA 3ET7A 4RWKA 1YI3A 3VQHA 2YZLA 5EQYA 4ZMEA 3BU5A 4ZAUA 3QTWA 1HOWA 4CFVA 4EK4A 2BRNA 3R2BA 3BYUA 3HP2A 3RJCA 3GFEA 4JX7A 2JBPA 2XK3A 3HUBA 2UZNA 2C0IA 4MNEA 2PVRA 2GSFA 3O96A 4NT4A 4UALA 2CHLA 2JDOA 5JFVA 4QMLA 1PJKA 3VUMA 5ANKA 3COIA 3ACKA 2XK6A 2WNTA 3OTUA 4NL0A 3QWKA 3DZOA 2OIQA 2Z7LA 2ZV7A 3F3WA 3FQSA 3NS9A 4PRJA 2BDFA 4CYJA 5IG1A 3MN3A 3R7IA 3PIYA 3UDBA 4MQ1A 1UA2A 3EOCA 3QX2A 4C4FA 4G16A 3TJCA 4AGDA 3HLLA 4YSJA 3UOLA 5L2QA 3GXLA 1GZ8A 3Q52A 2YIXA 4MBIA 4N6ZA 4XP0A 4IX5A 4YBKA 3ZEPA 5CU0A 5JQ8A 2R4BA 2VTJA 4EH5A 5DEWA 4I93A 3IOKA 4TXCA 4FT3A 4FSUA 5IA1A 3FI8A 4F64A 3ZLYA 2PMLX 3HA8A 1NY3A 2C3KA 3KXNA 3NW5A 4FTNA 3BYVA 3ZH8A 3GEQA 4JG6A 5C8NA 4YTIA 5CASA 1M52A 5KMJA 5ETCA 5M08A 2PL0A 4LYNA 4F9BA 3MH0A 2X39A 4FZAB 2B9FA 5IEXA 1DM2A 1TQPA 5I0BA 2JGZA 5B2LA 3HRCA 3FL4A 5AP0A 4GCJA 3I7CA 2LAVA 3HAVA 1PKGA 5AIRA 2LGCA 4MXXA 3VQUA 3UTOA 3DZQA 3K3IA 4HNIA 4M0YA 4Y85A 3T3VA 2VWUA 4BDGA 4O7VA 3ORZA 4EOPA 2DUVA 2XIYA 4QP2A 2XNBA 1F5QA 4I41A 1J7IA 1LPUA 5LVLA 3QZIA 4FVQA 4ZSLA 4MVFA 1ZMVA 4IACA 5CY3A 2A2AA 3B8RA 3PXQA 1S9JA 3DBQA 3REPA 2XF0A 2RFEA 4ZTLA 4YSMA 4YHFA 1JQHA 4P4CA 3FMJA 3QYZA 4AZWA 2WHBA 4WBBB 4ANLA 4R5SA 3IS5A 5CXZA 5CVFA 3R0TA 3RAWA 3DTCA 1Q61A 3LJ0A 3FC2A 3QTSA 3EFJA 3SX9A 4BZNA 5L8JA 3LIJA 4BCHA 4EZ5A 5DMZA 3QTIA 3LCOA 4TWOA 3RPRA 3TIZA 4JDKA 4D58A 4QTBA 4BFMA 4YNEA 4KAOA 3UZTA 3R83A 2IZRA 5E1SA 4AOJA 3R7YA 5ANDA 3I0QA 4OBPA 3R8PA 4OLIA 4A06A 3I4BA 2C0OA 4Q5EA 5EHYA 2E9UA 4U44A 2YZAA 3GQLA 4TNBA 2GDOA 1FVTA 4FTTA 2XBJA 4D2VA 3UZPA 4NYEA 2GHLA 4FIGA 5CSWA 1ZOHA 5CSVA 4EBVA 1M2QA 4M3QA 3FMHA 3T9TA 5I9XA 2Z02A 3QQKA 4HGTA 4CKJA 4L52A 4FICA 4Y8DA 4BCGA 2WQEA 4F9AA 3KFAA 5J8IA 5KZ0A 1PXMA 1RW8A 3U51A 1KSWA 3EN7A 3ZHPC 4F6UA 5IQAA 4WSQA 2VWVA 3TDWA 4NM0A 2PVJA 4R77A 3O51A 4APPA 1XR1A 3EQFA 3U9CA 3DV3A 2X2LA 5LARA 3ZLXA 4YHJA 3ATTA 2CGUA 2R3RA 5AR5A 3R9HA 2F7XE 3OBJA 5KUPA 4ZS4A 2FH9A 2IVTA 4ZTSA 4TWNA 3R7EA 4DFBA 4BDEA 3AT3A 5GJGA 3H4JA 4FE2A 3FYKX 4DT9A 1M7QA 1WAKA 4KKGA 5IMXA 2BMCA 3KB7A 5M55A 4FK6A 2OZAA 4I23A 3S2PA 4K0YA 3NUXA 1GIIA 3UIMA 2WMSA 3COHA 3ODZX 4EWHA 5GINE 2V7OA 3QD4A 4CFXA 3QUEA 2X8EA 4RJ7A 1F3MC 2C30A 4P5ZA 3PSCA 4NUSA 3U6IA 2JIIA 3LOKA 4O96A 4C37A 3RK5A 4F7SA 3F2AA 3D7TA 1BL6A 4QRCA 5HE0A 4JRNA 4RIWA 4ZP5A 3BQCA 5DR9A 1ZYSA 3WYYA 2WPAA 3R8MA 4ZZNA 2BUJA 4CFFA 3NIEA 4GT4A 3VC4A 2OG8A 4EJNA 4XCUA 4FKPA 4D5KA 2QC6A 2VNYA 2QCSA 3WF8A 3CC6A 2BROA 1APME 1UNLA 4UWBA 4FZ6A 5CZHA 3SXFA 4NM5A 3G2FA 4A7CA 4C8BA 2GHGA 1NW1A 5AAGA 5AJQA 2BDJA 3OFMA 3H0ZA 1Y6AA 4PDPA 2ITYA 3RVGA 3R71A 4XP3A 3VW8A 4LQMA 2O0UA 4TY1A 3E87A 4EL9A 1Q8UA 2R3GA 4GJ3A 4M69B 4QMOA 5B2KA 4M69A 5BVFA 5KKRB 3RZFA 2OKRA 1VYWA 3R28A 4TYGA 3O7LD 3AT4A 2F2CB 1BUHA 2OF2A 4C0TA 5BNJA 3DB6A 3QFVA 4OTIA 4QD6A 3D2KA 5FDXA 4QYYA 4WNPA 1FINA 4U79A 5EYMA 3UOKA 3AG9A 4EOKA 4QTAA 4X3FB 4I92A 3EB0A 4CV9A 3D5UA 4X3FA 4RWIA 2HY0A 4AA4A 5KMLA 1YXTA 2UW8A 1B6CB 4DFUA 4ZLYA 3EYHA 1BI8A 5BX0A 2BHHA 2ITXA 2OW3A 2YERA 4JRVA 1KE7A 5CLPA 5CAOA 1J7LA 3MS9A 2W5BA 5CEOA 1QPJA 3DJ6A 2UZLA 3ZXTA 1ZYCA 5L2WA 3R8LA 4LI5A 3ITZA 2GNIA 4RJ4A 4AA5A 4XLIA 1P4FA 4EI4A 3ZBFA 1Q5KA 2H96A 4V0GA 4QP4A 3I79A 1Q3DA 1H00A 4YZNA 5EYKA 2W9FB 4S30A 1GOLA 3W2PA 4DG0E 4O0WA 2BVAA 3BGPA 4TYHA 3Q3BA 2Y6OA 2AYPA 4PPCA 1ZMUA 1JKSA 2Y8OA 2PE2A 2QOCA 2CSNA 3PY0A 3EFWA 4GJ2A 3VJNA 4ACCA 3EFLA 2X7GA 4HOKA 5CU6A 2J0JA 4ASDA 3D2IA 3BCEA 1SM2A 3FKNA 2R3JA 5CXHA 2UW3A 4ZSGA 5DT3A 3FXZA 3NLBA 4FYOA 3GENA 3FDNA 3OTVA 5BUEA 5F94A 5EDQA 2PE0A 3TDVA 1GZOA 4BIBA 3ZFYA 5JFWA 1PMUA 5E91A 2OH4A 2NRYA 4G3CA 5C27A 5CEIA 4QQTA 3F88A 4QP6A 3QXPA 4JBVA 3R22A 3V5WA 1WVYA 4J7BA 2V62A 3LFAA 4CKIA 2ITVA 5CT0A 5HE2A 4O7YA 5KMOA 2OIBA 2Z60A 3D5XA 3P1AA 3R30A 4O27B 3SOAA 3O0GA 2XBAA 3A7GA 5FDPA 2W06A 2WIPA 4CLJA 3RTPA 1R78A 5BPYA 4PL4A 2XK7A 3QA0A 4EH3A 1STCE 5M51A 1OPKA 4BTFA 3LM5A 3W2CA 3I5ZA 3PVBA 3BEAA 5AP7A 2GHMA 3WBLA 5C1QB 5DIAA 2BHEA 1A48A 5IMEA 4MKCA 2F7ZE 1W84A 2PHKA 3TXOA 2VTMA 4C2WA 3BWFA 4EZ7A 2O63A 5GJFA 4RIYB 3UC4A 4ASZA 3LCDA 4XV1A 3W18A 3HYHA 4KKHA 5AUYA 5FRIA 5IPJA 4F9WA 2Z7QA 4FKLA 3ATSA 3E3PA 2YM4A 3ORIA 2YFXA 3NUUA 3PJCA 3VBWA 4C7TA 1PMNA 2XVDA 5EYDA 1BMKA 4PL5A 4ZZOA 2QOIA 4QPMA 4C62A 2XCKA 2ZV9A 2JIUA 2ZM3A 3DFCB 2RG6A 5EOBA 5HIEA 1VR2A 3R1NA 4A9SA 4OTQA 3T8OA 5KHWA 1TQIA 4C61A 3O71A 3VRYA 4O82A 4FSQA 3EQHA 3GVUA 3A7FA 4FEQA 4WNMA 5HHWA 4O0UA 5AFVA 3W10A 3TNHA 4Z16A 5D9HA 4QO9A 4G3GA 3CY2A 1WZYA 3SXRA 5A4CA 5IEYA 4LMNA 2G2HA 1KWPA 4PDOA 3FLQA 3KXHA 3QTZA 4O0VA 4D2WA 1XH4A 3PJ3A 4C38A 4M67A 2C4GA 4E6CA 5A4TA 2FA2A 1V1KA 4E6QA 3KL8A 1JLUE 3R21A 5HG9A 5DG5A 1I09A 4BY9E 2UVZA 2J0LA 4YJTA 3DKGA 3D7ZA 4YJUA 4II5A 3FLYA 3UG1A 3ZXZA 2O2UA 2E2BA 2FB8A 3GCVA 4I5CA 4E7WA 5LWMA 1U54A 5M07A 5FQDC 3RNYA 2ONLA 3FWQA 1VYZA 3TNWA 1G8AA 3Q9YA 2YM5A 3ZONA 2I6LA 3EN9A 4ZLZA 4WUNA 5H8EA 3HP5A 2WD1A 5HD7A 3UIUA 3V04A 4ANMA 2UUEA 1LEZA 1U4DA 4G6LA 3OCTA 5CANA 3IGGA 3EQRA 4O83A 3LCKA 4FBXA 3NVKI 1QPCA 2X9FA 2YIRA 3OZ6A 4I24A 4YTHA 2GMXA 1WBPA 3EZVA 4GSBA 4J53A 4DLJA 3ZSIA 5A4QA 5CEKA 5JFSA 4JL9A 4QMMA 5HD4A 2VZ6A 4RVKA 5HTCA 3D5VA 2QOQA 5E7RA 2X9EA 1GZNA 4TYEA 5DA3A 2QOHA 1K3AA 3CD8A 3LFDA 3PG1A 2YIWA 4LRKA 2WMXA 3DJ7A 3OUNB 3L9NA 3PPJA 1P4OA 3NCGA 5CF8A 3FXWA 5IA5A 5CU4A 3U4UA 4GEOA 4GK2A 2QNJA 5DOSA 1J3HA 4X6QC 2OGVA 1SNUA 5CX9A 3DPKA 2ERZE 3OG7A 3R7OA 1DAYA 1UU7A 2F4JA 3TV6A 2WEVA 2UZVA 4O0TA 2WMRA 3C9WA 4IM0A 3HMNA 5AP6A 4O91A 3W55A 4L67A 1V0BA 2BPMA 2W4KA 5HO8A 3WZEA 5IH6A 4M7IA 1O9UA 3P7AA 4U7ZA 3NYVA 4GFOA 4QTDA 2WQBA 3RM7A 4YMJA 4I4EA 4DA5A 3ZO3A 1TQMA 2QU5A 4PF4A 2HZ4A 2I1MA 3QZFA 1REJA 1Y57A 5DLSA 4BRXA 4ZEGA 2YAAA 2GQSA 3A99A 4RGJA 3NAYA 4L00A 2VO3A 4B8LA 4FEUA 4IAKA 3LMHA 2Y4PA 4UXLA 5J9YA 5A3XA 1XBAA 3RWPA 3N4UA 4IAAA 1ZZLA 3Q04A 2VTLA 4O2PA 4C4HA 1PKDA 4Y95A 4ZJIA 1I44A 3E93A 3EIDA 2UZBA 3RZBA 3A7JA 2YA9A 3F3UA 4KIOA 3PZEA 3BELA 1UWHA 3ORLA 4DLIA 2G01A 1OZ1A 2BTSA 2EWAA 2GNHA 2J7TA 3I60A 3R9NA 2JFMA 1ZOEA 2I0EA 5EM7A 3TV7A 3A61A 3UNZA 3VBVA 3AD5A 4G34A 4L68A 3V5PA 2UZEA 2JBOA 3QRJA 4FTUA 4LGHA 4HVIA 4IVAA 2XKFA 4LRMA 4AOTA 2YCFA 4KIQA 1G3NA 3P7CA 5HLPA 3NUPA 4Y46A 3Q9ZA 5CWZA 3WE4A 3AD4A 1RE8A 2YJRA 3OROA 1OMWA 4WG5A 3SAYA 4BKYA 4D5HA 4EH2A 2P3GX 3QHWA 4L44A 2ZDTA 3GBZA 3MJ1A 3T9IA 2GTNA 3ZC6A 4DBNA 1WFCA 3AXWA 4YZDA 4MD8E 4C3RA 3CCNA 4DG3E 5L2IA 5HTIA 4W4VA 1OKVA 2BALA 4PMPA 3LFBA 3HMPA 4JT3A 4WRGA 5TOZA 1ZAOA 3RINA 4F0IA 3NW7A 5KNJA 3FMNA 3PRFA 4G6OA 2G2IA 3F82A 2P2IA 2XMYA 4FNXA 4RA5A 3FAAA 4X3JA 4YZMA 3P78A 4EH8A 1JSUA 4OBQA 4FV0A 4FSMA 3TNPC 3GI3A 3F3ZA 4JR7A 3GP0A 3C4EA 3ZCLA 4FEVA 1O6KA 1FOTA 3KRXA 4CFNA 3AC8A 3F2RA 5K4JA 4C4IA 3IW7A 4I4FA 1SVEA 4X7QA 5AA8A 2CCIA 3GQIA 3QD3A 3SD0A 3WF5A 3NZ0A 4ACGA 3HAMA 1PY5A 1Q8WA 5LMKC 2RL5A 2ITQA 3HECA 4FX3A 3EN5A 4TWCA 3P86A 5ICPA 1H26A 5HO7A 2VN9A 5AUVA 1NVQA 2ZYBA 3F61A 3ZDIA 2CNQA 3L8XA 3Q96A 1V0OA 4NIFA 4ANSA 3IGOA 2UW0A 4CMUA 4HPUE 5CAPA 1WBNA 3VS0A 1KUTA 3FY0A 2J0KA 4D4YA 2FO0A 1H1RA 4F7JA 3BZ3A 4E6DA 1YKRA 2ERKA 1ERKA 3FLZA 3QCYA 3W8QA 2PYWA 4JIAA 5CQUA 5JZNA 4YJQA 2ZJWA 3QTXA 2YIQA 3DKOA 5AP5A 5I9UA 2ZV8A 2OLCA 1WBVA 2HY81 3ORMA 3M2WA 4NKSA 1J91A 3CTHA 3R8ZA 3S00A 1XHAA 4CEGA 3R1SA 4O0YA 4L9IA 2W0JA 3GU5A 5E8UA 5FWKK 3UJGA 3MIAA 3PVUA 4FNYA 3WZJA 1Q8TA 1PMVA 2I0YA 2VD5A 4XRLA 4ANBA 2I0HA 4BDFA 4O7LA 3PE1A 1B39A 3A4PA 3LXNA 2VUWA 4XG3A 5IUIA 4M15A 2QURA 3MH2A 4IC7A 1YXSA 4FZFB 2YN8A 4C59A 4NKAA 4IB0A 4ZSEA 2WTKC 3VS5A 4W8EA 2OBJA 4QMXA 3VUDA 3BPRA 3LZBA 4GIHA 4CFWA 4DFYA 1YXXA 4O6LA 5HE1A 2I7QA 2GTMA 4APCA 4QNYA 4KIKB 3VAPA 3UQCA 4JI9A 4UN0C 3CJFA 3FMLA 3O8PA 4KIKA 5AV3A 3QX4A 3UQFA 2YDJA 3EH9A 2UZWE 3LAUA 2C5YA 3TKUA 4GUBA 3VUGA 4OAVB 1LEWA 3KXXA 5DHJA 1NXKA 1OVEA 4K1BA 3TZ9A 4W8DA 1OUKA 5ETIA 4X0MA 3KREA 4FIEA 4FV6A 2IW6A 2ITWA 3CIKA 4HGSA 4K6ZA 4J95A 4ITJA 2CDZA 3WF7A 3KMUA 2ETRA 3KN6A 1YWVA 5CZIA 3FPQA 3PTGA 4HJOA 4I5MA 3BE9A 3RAKA 3TTIA 3NWWA 4QMPA 2QOKA 4A07A 1W82A 4Q9SA 3GOKA 1BLXA 2XM8A 3ZRLA 4LRJA 5IQGA 4JAJA 4Y5HA 1OM1A 3GU4A 5C8MA 1CKIA 3G90X 4UX9A 1PYXA 2EB2A 2RIOA 3VS3A 3O17A 2V0DA 1YOMA 3EMGA 1XWSA 4AN9A 4CFMA 4DINA 2F7EE 5KCVA 4FV2A 2R7BA 4Y5QA 3SVVA 2DQ7X 3DKFA 3ORNA 2HCKA 4E4NA 1Q41A 3HMIA 4GW8A 1OKWA 4NU1A 3IKAA 4HCTA 2QU6A 2CN5A 3MFTA 5LMAA 1ATPE 3RALA 1PRYA 3SKCA 2NO3A 4AZSA 2J6MA 4AZTA 4L6QA 5KMIA 3PJ2A 4FTJA 4R3CA 4YTCA 4KRCA 3HGKA 5L2TA 2DWBA 4IADA 4PTGA 4DTKA 3ORPA 3VBQA 5AV4A 3C4WA 1OBDA 3F7ZA 2VX3A 1UU8A 3HRFA 3LE6A 3NW6A 2B9HA 4XP2A 5EDPA 2YWVA 5AM6A 2ZV2A 2C69A 2PVFA 4JR3A 4XOYA 1PMEA 2FVDA 2J2IB 1UNHA 4GH2A 4RZWA 2VWWA 4BCOA 4FTCA 4BWKA 4GKHA 4FV3A 3AC1A 5C4KA 1U5QA 4IFGA 5DR2A 4BKJA 2PVLA 4LL5A 1O6LA 5IZFA 3DOGA 3K2LA 4XG6A 5E8VA 5CALA 3G6GA 3F3VA 3FI4A 4FVPA 4M84A 4QYFA 3WILA 5CF5A 2EB3A 3DBEA 4IX4A 4EQCA 1G8SA 2F49A 4MHAA 5EH0A 4FKTA 2GQGA 4YNOA 4XX9A 2IWIA 4U9AA 5EYCA 3DNEA 4MK0A 5IQCA 4MTAA 4XEYA 4IW0A 4QMSA 2QOBA 2YABA 3JVSA 4EC9A 3MVHA 3UOJA 2WEIA 4FTMA 3BHHA 2PMNX 5HBJA 5C8KA 3QUPA 4HYSA 4ACHA 2VNWA 3HX4A 2UW5A 1SVHA 4QMZA 3U6JA 4L7SA 3TZ8A 3PXKA 3DGKA 1KE6A 1R0EA 3ZU7A 4CQGA 4QYEA 4ZJVA 3VS1A 1QMZA 2X4ZA 5AIKA 4K33A 4MAOA 1K2PA 4LMUA 3SG9A 1WVXA 3C13A 3FXXA 3KULB 4Z7HA 4JNWA 4O38A 4C4GA 4E1ZA 4IJPA 3G0EA 4FL1A 2QQ7A 5HG8A 4A4OA 4BDJA 4XS2A 4BTKA 2YITA 3WARA 1Q62A 4H39A 1YWNA 4PMTA 5FTGA 1YDTE 4KABA 3MY0A 3JPVA 3UODA 1V0PA 3EWHA 3PA5A 3QZHA 3K3JA 2RG5A 5HX8A 5AA9A 5M4IA 2A0CX 2W1GA 2Q0NA 3RK7A 3ID6C 5B2MA 3DLSA 2REIA 3KRLA 5EHOA 3SV0A 1M14A 3ENMA 3FC1X 5IU2A 2I40A 2VU3A 5F95A 3E64A 2WQNA 3QKLA 2R3PA 1GNGA 4UYNA 5KBQA 2FSTX 2UW6A 5J9ZA 3PLAE 2QVSE 4RC3A 1JKTA 3FBVA 1B38A 3V5LA 4S31A 3NSZA 4USDA 5LCJA 5AP3A 3ZSHA 5GZAA 5D41A 2IZTA 4IX6A 5HICA 3LLTA 5DPVA 2QHNA 1IA9A 4O86A 4H3PA 3NMUF 1RQQA 4K8AA 3LLAA 2UW7A 1R3CA 4IAYA 4G3EA 3MESA 5K5XA 1PXOA 1YOLA 3JXWA 4BI1A 4FIHA 4F6WA 2QONA 3ELJA 2OZOA 3HKOA 4P2KA 2PTKA 4AZEA 3C5UA 3ZEWA 1QCFA 2XNPA 1T46A 3CKXA 3D0EA 4JBQA 3DQWA 4YPSA 4AG8A 2BRGA 4IAIA 1YI4A 3W2OA 4RC4A 4JS8A 1JKLA 3MFSA 2JAMA 4L8MA 3C5IA 4U6RA 5J7HA 4AFJA 4EOJA 3BBTB 2O65A 3OEZA 3MA6A 4M0ZA 4AN2A 3E3BX 1U46A 3UVQA 5TO8A 2HXQA 4U3ZA 4G5PA 3W32A 3D4QA 2YCRA 4FKSA 4QP7A 3V51A 2XNEA 4BCMA 4O1OA 4JDJA 2VWIA 4O84A 4UV0A 2BCJA 3PPKA 5F20A 5T3QA 3QC9A 1H01A 4UZHA 3QWJA 3F9NA 1JKKA 2JKOA 4MXZA 4AACA 4J52A 2WTCA 4EWQA 2YDKA 1ZARA 2W4OA 2XJ1A 3S0OA 2OFVA 3ZZEA 3NDMA 3RK9A 5K5NA 3VN9A 4R5YA 5ETFA 1PXKA 4TRLA 5FLFA 3ZM4A 5L6PA 5HLNA 4IMYA 2WZJA 3HA6A 4L3JA 3EQIA 3IDBA 4QPSA 1E1VA 5AWMA 3W8LA 2WAJA 4R7HA 4YJPA 3UVRA 4FT5A 3R9RA 3HV6A 3ZDUA 4LOOA 2OI4X 4BCKA 4H36A 4BGGA 2R3KA 4CKRA 4NTSA 1PW2A 2ITOA 4FG9A 3IW4A 5FEEA 4W4WA 2ETKA 2IVSA 4B4LA 4KB8A 4DHFA 4HGLA 4MXCA 5BYLA 2J51A 3LHJA 3PUPA 4DGGA 3TN8A 4LG4A 4EKKA 3SC1A 3DS6A 3VBYA 4FSNA 2EUFB 3V6SA 2G15A 4MD9E 4YLKA 5KMNA 4I22A 4C34A 5CSPA 3KU2A 4K18A 3ZZWA 5I5ZA 5JGBA 4XUFA 1UU9A 3WF6A 3TUBA 1KE9A 5CF4A 3QA8A 4RVTA 3DAEA 4I21A 5EHLA 3PYYA 3DLZA 3MW1A 4BDIA 3A60A 5E8TA 5K0KA 2GS7A 5AP1A 2WMAA 4BHNA 5HVKA 2CNUA 3QQLA 5HKMA 2OJIA 4OGRA 2GU8A 5TKDA 3UGCA 4E4XA 4ENYA 4F0GA 4FV4A 4L53A 3JR1A 4RRVA 2PMIA 3FSFA 5JN2A 3MPTA 3VF9A 2ZMDA 5I9VA 3C4ZA 2WTDA 4JDIA 4NSTA 4AW5A 4KKEA 3E5AA 4ITIA 4IB1A 4I94A 5CSHA 2X1NA 2X2MA 4GFGA 3BRBA 5JSMA 3AGLA 3QZGA 4CTBA 5LVNA 5A54A 2C6KA 4RJ6A 4F63A 3VUHA 2CGXA 2JIVA 3NIZA 5HGIA 5AUZA 3AC5A 5EM5A 1CSNA 4FTLA 1R1WA 4MEDA 4BBFA 1UWJA 3SGCA 5I3OA 3II5A 4D9UA 3T3UA 1OIUA 1URWA 3FSKA 5EK7A 2XYUA 3GCQA 3VHEA 3LJ2A 5A6NA 3B2WA 3NNWA 5IISA 4E93A 4X6RA 1VJYA 1ND4A 2J4ZA 4Y73A 4CT1A 4GU6A 5LOHA 3KXGA 1IEPA 2X8DA 3AC3A 4FMQA 5TE0A 4KSQA 4XV2A 3OD6X 4FKVA 4K77A 4ASEA 4TYIA 4AGCA 2YM3A 5IF1A 4C57A 4AU8A 3Q9XA 4HPTE 5FBOA 3OXTA 2B1PA 4PDYA 3FZRA 4EOQA 4J1RA 4R7IA 2UW4A 5AAEA 3PPZA 1MRYA 3HZTA 4FV8A 1OL1A 5DFPA 4O21A 5FP6A 4AE9A 4AT5A 2W9ZB 4JOAA 3DA6A 3MY5A 4ZTNA 3OY3A 2G9XA 3TNQB 3QCQA 4WHZA 3UE4A 4ZTMA 3JVRA 3JY9A 3A8XA 3MJ2A 4EONA 2I0VA 2X4FA 4AW0A 4L01A 3BYOA 5G6VA 4ZZMA 3VWAA 2VWXA 5AV1A 2NNWB 4WOVA 4DH3A 4MBLA 5HU9A 3IDPA 4ZLOA 4X21A 2CKOA 2Q0BA 3FE3A 2JITA 3SW4A 5E4HA 2BRMA 4RX7A 3P23A 5DE2A 4LOPA 5EI2A 3OCBA 5L2SA 4UB7A 4YC8A 1YHSA 3QQFA 4IX3A 4AWIA 4BYJA 4S34A 4ANQA 1URCA 4P7EA 3Q53A 2VTOA 4IJ9A 3P0MA 3RCDA 5HU3A 4OTHA 4HW7A 3DU8A 3NPCA 1JVPP 5C4LA 2PSQA 4EOMA 2QG5A 3PFQA 3ZFMA 4QP3A 5M06A 2FSLX 4G3DA 2C6MA 3S4QA 2UVYA 4GV1A 3TEIA 3UP2A 5GZ9A 3VUIA 2VX1A 2O3PA 5DBXA 5AP2A 3FZTA 2PVMA 5AR8A 4KA3A 3L8VA 1WBOA 2J0IA 2YWPA 5EOLA 2WGJA 3DDQA 3I1AA 3LQ3A 4PMMA 4QYGA 2RKUA 3BV3A 4AX8A 2CMWA 3LCTA 5D10A 4YO4A 5ANEA 3MVJA 1XBBA 5J5TA 3JS2A 3IPHA 4DGLC 5AAFA 5J7BA 2JEDA 4RFYA 4DG2E 4DTAA 3D94A 4QNAA 5T68A 1OBGA 3FPMA 5I9ZA 4EHVA 3ZS5A 4KNBA 3FLNC 4H05A 4FYNA 4RIYA 3OS3A 3PJ1A 2JDVA 3M11A 3K5UA 1W7HA 3H9RA 4Q2AA 1OUYA 3FI2A 1YHVA 3CGOA 4O1PA 5JRSA 3L1SA 2OXYA 3ORXA 3OCGA 3GB2A 3WIKA 4EOSA 3V3VA 4XG7A 5CT7A 4FSZA 4NCTA 5E9EA 2Y4IB 4K11A 3KCFA 2XKCA 5HIBA 1ZWSA 5FG8A 3IDCA 4E26A 3RCJA 2CLQA 2QKRA 4IDVA 3SQQA 4OTWA 2P0CA 3U54A 1Z5MA 4GS6A 4YJRA 5AR7A 5JT2A 5CVHA 5HNGA 2VO7A 4ANOA 4ZTHA 1ZYLA 3NGAA 1UNGA 2OJJA 4KBKA 3L9LA 5LXMA 4GFMA 3LMGA 5CNOA 3QGWA 3TIYA 4ENXA 4PTEA 4E8AA 5CVGA 4XV9A 3TI1A 4QMVA 4EEVA 4ALVA 3MDYA 2C1AA 4I0RA 3HV3A 2BTRA 5KHXA 4C36A 1XQZA 3EHAA 1OL6A 3TWJA 4MF1A 3ZOSA 5KE0A 4IQ6A 4ZMFA 3U6HA 3DY7A 3LJ1A 2A4LA 2VO0A 3KMMA 3OWPA 4YJNA 1ZYDA 4MNFA 5JGDA 4E5WA 3VS2A 5DNRA 3U8WA 1HCLA 1M7NA 1PXJA 4YJSA 4RA4A 1YWRA 3IECA 4A9RA 2W7XA 1P5EA 2XIKA 4FC0A 3V8TA 4I6FA 4KBAA 5CEMA 4ACDA 4F09A 2IZUA 4DFNA 4F99A 3LKMA 4E6AA 5HVYA 4LGDA 4PPBA 1WMKA 2IW9A 3UMWA 4U97A 1IA8A 2V22A 3KK8A 1OIYA 3Q4UA 4QP8A 4QT1A 2XKEA 4AGUA 2G1TA 3W2SA 4IANA 4CG9A 2WELA 3ORTA 3ANQA 3BYMA 4TZRA 4FI1A 3BLRA 3D5WA 3KF7A 2A19B 4HVDA 3QTQA 3E8EA 5J1WA 2W1EA 2QR8A 2GCDA 1YW2A 1XH6A 3FYJX 3MWUA 3BGZA 4GYGA 4KBCA 4CFUA 1H1SA 4OBOA 4MWIA 3GCSA 4PP9A 4BCJA 3A7IA 3BLQA 3KXMA 4USFA 3FLWA 4PP7A 4ACMA 4HGEA 4YGAA 5BVEA 5J87A 3HDMA 1H25A 3ZFXA 5IDNA 2HW7A 3Q9WA 3UO4A 4PUZA 4HCUA 3JY0A 2GPHA 3R1QA 2W4JA 4MCVA 4OTPA 2C6OA 2VWBA 5CNNA 5HG7A 4ZY4A 5ANJA 3RPYA 4L42A 5EM8A 3QGYA 4H3BA 1DI9A 5AUTA 1NA7A 1PXIA 1UKIA 4AS0A 4WIHA 3VUKA 2ZOQA 4TNDA 3M1SA 5B0XA 2XYNA 3R04A 3KVXA 3C0IA 4FUYA 3U4WA 3VO3A 4FGBA 3L8SA 4RFMA 4G2FA 5AV0A 4DN5A 4PL3A 3DAJA 1Q8YA 3PIXA 2XIXA 3DKCA 3IW5A 4CSVA 2UZTA 4I6QA 2FUMA 2PUNA 3TUCA 1MP8A 1H4LA 4RQVA 5AP4A 3UC3A 5ANIA 3NNVA 2R3MA 4XYFA 1CDKA 3AC2A 3SDJA 4M12A 3NYNA 2DS1A 4U3YA 1JSTA 2XP2A 5CEPA 2X81A 2V55A 3R63A 4D4VA 3WYXA 1O6YA 4LUDA 2KULA 3ODYX 4DAWA 4BCNA 3SA0A 1IAJA 4RG0A 4EK3A 4D9TA 2HYYA 2J0MB 2WOUA 4QTCA 3ZMMA 3TTJA 3C50A 3QUDA 1OKZA 4JQEA 3R8UA 5F4NA 3TZ7A 4BICA 5B7VA 4FKQA 1FQ1B 3G0FA 3OVVA 3I7BA 4RJ8A 3M42A 5L3AA 3UOHA 3D15A 5E8XA 5TT7A 4F6SA 5C01A 2XEZA 4O7SA 2VWYA 2CKQA 3MI9A 1KV1A 3RNIA 3E8DA 3ROYA 4CCBA 3G6HA 4Q5HA 5EDRA 3PVGA 3ZLWA 4RX5A 5DT0A 1OECA 4KUJA 4BGHA 1Q24A 2H6DA 3HV5A 4ARKA 2WIHA 4IZ7A 4F1TA 1OGUA 3EL8A 3VF8A 4RVMA 1XBCA 3R01A 5D11A 4C3PA 2H9VA 3BBWA 2C1BA 1H1PA 3IO7A 3NUAA 3OF0A 4O22A 3FI3A 1JPAA 1CTPE 3G5DA 5J79A 1A9UA 4AOIA 4BZDA 5K3YA 1YVJA 5FM2A 1W0XC 2CKEA 4R8QA 4YZBA 3R7VA 4CZUA 4FKOA 4M97A 4EZ3A 4AT4A 4UY9A 1UU3A 4OAUC 4MX9A 3UNKA 3UBDA 3KXZA 4XBRA 5KX8A 3PZHA 1L3RE 3BX5A 5AMNA 5K9IA 4DEDA 3UO5A 4DFLA 5F1ZA 4I20A 4BTMA 2QO9A 3E8NA 3U55A 3CBLA 1DAWA 1AD5A 3NX8A 4ERKA 2VTQA 2Y6MA 3CPBA 3CD3A 2OJ9A 3Q6UA 4OT6A 5D12A 4WNOA 4BWXA 4N6YA 4GT3A 5KZIA 2C5NA 1KOAA 3Q60A 3K5VA 4XG9A 3IK3A 1E1XA 5HTBA 4P5QA 3C4FA 3VRZA 4M68A 3PE2A 3UYTA 4ALWA 3O7LB 3CQEA 4PY1A 5FTOA 3S95A 4UEUA 4BIDA 3NYOA 2XIZA 2UZUE 2Q83A 4XG4A 3VS4A 4O6EA 5I4NA 4DBXA 1GY3A 4Y72A 2R5TA 4IWDA 2X2KA 4IBMA 4U42A 3KGAA 1UVRA 1SVGA 3Q4ZA 3ZO2A 5EW8A 3HRBA 2HELA 3EYGA 4X2FA 3H3CA 3KF4A 4GVJA 4RX8A 3N4TA 2PMOX 3RAIA 2W1IA 4XBUA 4BKZA 4DH1A 1YXUA 1MQ4A 4WSYA 1YRPA 4XHKB 5BMSA 3ZSGA 3QU0A 3E92A 4NJ3A 2OXDA 3KRJA 3OWJA 4G9RA 2ZMCA 4QMTA 2JFLA 4U41A 3LFSA 2OIDA 2H34A 3OEFX 2Y9QA 4AP7A 3FJQE 4K9YA 3AOXA 4RZVA 3WIGA 2XS0A 2QOFA 4FTOA 3CP9A 3AMAA 4X3FC 3OCSA 1OIRA 2E9PA 4J8NA 4AFEA 4E4MA 3AMBA 3Q2MA 5M4FA 3F3TA 3MBLA 3DFAA 4FKIA 4QYHA 4YP8A 4DC2A 5IH5A 4FGRA 4GKIA 3ETAA 4UMUA 5C9CA 2X6EA 3PXYA 3QKKA 3ZBXA 4YR8A 3EKKA 3F6XA 4UMTA 4CGAA 4YU2A 2R0IA 1YHWA 3EFKA 2B7AA 4RIXB 3PLSA 3MPMA 4C4JA 2QR7A 5H8BA 4YLLA 1AGWA 4MQ2A 1XH5A 2VTRA 4FSYA 4J97A 2XA4A 4UZDA 5CU2A 3SRVB 3WF9A 4L45A 1H08A 3ZYAA 2UW9A 2ZB1A 4MBJA 2YIYA 2Z2WA 2OJGA 4G17A 1BL7A 5D1JA 3QCXA 3C0HA 4A9YA 3QQHA 4EUTA 4A4XA 2PY3A 5AADA 4IWOA 3KY2A 4I6BA 4YPDA 4WG4A 4F08A 2ITZA 3KVWA 5H8GA 3A2CA 4FTIA 3BHVA 3POZA 1BYGA 4Z55A 2BFYA 1YI6A 4U81A 5CTPA 3RMFA 1J7UA 2FYSA 2R0UA 3QHRA 4L46A 3NNUA 5E8SA 3TJDA 4NEUA 4N4SA 3UQGA 3EQBA 2BAQA 5E1EA 3QF9A 2XZSA 4D55A 2QG7A 2C6DA 1P14A 2B9IA 2G2FA 1H0WA 5T6KA 2YM7A 1X8BA 3TG1A 1J1BA 3U87A 4NK9A 4B99A 4BVUA 5IH4A 4UMRA 3QQGA 1ZZ2A 5BVKA 5HNIX 3UMXA 3AC4A 3DK7A 3PG3A 3IONA 5BUIA 3Q2JA 1JWHA 4OUCA 5HCZA 3R9DA 2OH0E 3NEWA 4ERWA 4JX3A 1OI9A 4EORA 4R1VA 4HVGA 3U9NA 4FNZA 4FG7A 3UG2A 5F9EA 3R8VA 3TUDA 4HYIA 1Q99A 5J95A 2UVXA 5IQHA 4FIFA 5EI6A 1GJOA 3EN4A 3KCKA 2OU7A 3QBNA 3EKNA 2BAKA 3GFWA 2PVYA 3TL8A 3V8WA 2R7IA 4HYUA 4BHZA 1OB3A 1EH4A 2CN8A 1NVSA 3BGQA 4YC6A 4RQKA 3BV2A 2RFDA 2W96B 3Q5IA 3OBGA 3GC0A 4JG7A 3R00A 3LFFA 4UXQA 3PXRA 4BCFA 5BMMA 4FV5A 4I3ZA 2EXCX 3OT3A 2E9OA 4RWLA 5K0XA 2R2PA 2ETMA 2W05A 2R9SA 4WG3A 5A4EA 1BX6A 4GIIA 4B8MA 4Q9ZA 2C3IB 5A9UA 4E3CA 4BDDA 2QO7A 3MH1A 5GIOE 3POOA 2QI8A 4AT3A 2A1AB 5K4IA 5AM7A 2WXVA 2VTNA 1OL7A 2QLUA 4KWPA 4BYIA 4YO6A 1Y91A 1GIJA 2F9GA 2VV9A 3BQRA 3DJ5A 3QCSA 4NWMA 4YJVA 4M8TA 2PZYA 4EHEA 3PA3A 4FTAA 5BVDA 3B2TA 3C1XA 3CQWA 5DEYA 3PSBA 2B0QA 2XUUA 4D0WA 3OOMA 2XNOA 4PNIA 2R64A 5BYYA 3KULA 2OO8X 4ZS0A 1PF8A 4RLKA 4BCIA 3IQ7A 3OWKA 4MXAA 2R3IA 2VTPA 4EOLA 4EH7A 3L9PA 3UIXA 4ZJJA 2E9NA 3KRRA 4BI0A 4FEWA 2YLFA 4B7TA 4MNEB 4DEHA 4JBOA 5G1XA 2QODA 2WFYA 5AX3A 1FVRA 1H1QA 5E92A 3KMWA 3KQ7A 3P4KA 5HIDA 3TACA 3QRTA 3OWLA 1SNXA 5J1VA 2XK9A 1H07A 2VGPA 4UMQA 5AV2A 4DT8A 4LGGA 4RT7A 4HZSA 4CZYB 2IN6A 3H30A 2IZSA 3UPXA 2ZDUA 5FD2A 4BL1A 3HMOA 5AX9A 5FGKA 2OK1A 4NZWB 5JGAA 4EQMA 3H0YA 4NJDA 1T45A 4TN6A 2IVVA 2ONLC 1OITA 4AW1A 3BKBA 3UPZA 4EH6A 3P5KA 1FMOE 1GZKA 1M2RA 2BILB
chains in the Genus database with same CATH superfamily
3GCUA 5CENA 3EN6A 5JMSA 2XCHA 3BLHA 1UKHA 4TT7A 2J50A 4FKWA 5ANGA 2C68A 3ZO1A 4C35A 4WT6A 2WO6A 2R3LA 1MUOA 3TKHA 4M14A 4I1ZA 1K9AA 4EJ7A 5JH6A 5BVWA 5J9LA 1NT2A 4O7TA 5M09A 4D1SA 3NVMB 3RM6A 4I0TA 4QPAA 2V7AA 2YCSA 2HIWA 1RJBA 1U59A 5IKWA 2H8HA 4E4LA 1H24A 2GNGA 3VS6A 4BDHA 2B4SB 5DRDA 3UO6A 3C4XA 2X6DA 4BCQA 3G51A 5H3QA 4FEXA 3BHUA 1KV2A 5DH3A 5KMMA 4BR3A 4E73A 2RF9A 1ZRZA 3MIYA 5FBNC 4ZXTA 4ANNA 5HQ0A 5KMKA 3FMMA 4D2TA 2CCHA 4LL0A 3QRUA 4JIKA 4CTCA 4CRSA 2B52A 4YBJA 3EL7A 3G33A 4RBLA 2C6IA 5BV3A 3OP5A 3G9LX 3SLSA 4AQCA 5BVOA 2X0GA 3QALE 2Z7SA 4JQ7A 2YACA 3GGFA 4L43A 4MH7A 4DTBA 1W98A 4XV3A 4CV8A 2BDWA 2BFXA 3GNIB 3PRIA 3ZC5A 4LV8A 2XK4A 1CM8A 1XO2B 3ERKA 3HDNA 4HZRA 4I6HA 3R73A 5A14A 3PVWA 5LWNA 3LQ8A 3RBWA 4OTRA 2V5QA 4BN1A 3CE3A 2ZM4A 2XH5A 4JVGA 4DGNA 4A9UA 3HMMA 4IE9A 4DYMA 5EKOA 4QTEA 2CKPA 4CVAA 3H10A 3OUKA 4GU9A 2BZHB 3FMDA 3MPAA 4IH8A 3ZUTA 4BBMA 4FOCA 2C6TA 4RFZA 4FKUA 1OPLA 4GUEA 4H3QA 4RVLA 5HZNA 3PWYA 4EQUA 3KN5A 5CI6A 5EM6A 4IIRA 3ANRA 2RGPA 2HZ0A 4WA9A 1WBWA 2QD9A 3IOPA 2JDSA 3I81A 1XH7A 2PE1A 2VAGA 2WMVA 3DK6A 3NAXA 5HEZA 4CD0A 4F9YA 3WZDA 1RDQE 4V04A 3E88A 4RSSA 2R3QA 5FP5A 3CR0A 3H9FA 4LM5A 1Y6BA 3EQPA 1A06A 3LXPA 4F0FA 5JEBA 4BTJA 2PPQA 2B9JA 3NNXA 4W9WA 4HVSA 4WBOA 3VNTA 3AT2A 5AR4A 4BC6A 4PDSA 3FMKA 3F7WA 1H0VA 2HZNA 2W1DA 1WCCA 4R6VA 1UV5A 3ALNA 4RJ3A 2IO6A 3RGFA 2QOOA 3DXNA 5L8LA 4C33A 3FL5A 4BDKA 1WBTA 5H9BA 1SYKA 1G5SA 4IB3A 3V5JA 3EQGA 3R7UA 2AC3A 4K2RA 5C26A 5FXSA 4CMTA 2OZAB 4CNHA 1IG1A 5LMKA 1H27A 2XB7A 3HNGA 4I5PA 3KA0A 4IB5A 5DWRA 4ZTQA 4FUXA 3NUSA 2PUUA 2BR1A 3AQVA 4DFZE 3CEKA 2WB8A 2WMTA 2BAJA 4TWPA 4ZK5A 5IUGA 1Q3WA 5ITAA 2YCQA 3CTJA 4GG5A 1ZY4A 4IZYA 4PX6A 1SMHA 2VRXA 2J9MA 3MVMA 3UVPA 2BZJA 2F2UA 4NH1A 4QP9A 3VHKA 3WZKA 4C02A 5DT4A 1OGYA 3FV8A 5LQFA 4CG8A 3FKLA 1CMKE 2XNMA 3UP7A 5IA3A 3D7TB 3O23A 2XIRA 3EJ1A 3FZPA 5CI7A 4D4SA 4RIWB 5AUXA 3CXWA 1JOWB 3LXLA 4EC8A 2PUPA 4HCVA 4TTHB 2PZPA 3CS9A 3MFUA 1VEBA 4O81A 2CGWA 4IHPA 2J5EA 4YLJA 1OL2A 2P2HA 3FY2A 1TVOA 2SRCA 4FVRA 3BWJA 2R3HA 3E63A 1DS5A 3V6RA 1W2FA 1XMMA 2J5FA 4MXOA 2O5KA 3UYSA 3D14A 3O2MA 3FQEA 5AUWA 2BRHA 4DF3A 3I5NA 3R2YA 4D28A 2OF4A 3F5GA 4BCPA 3DXPA 3V8SA 3L8PA 4A4LA 4QP1A 1Z57A 5J5SA 3DDPA 3LFCA 5AR3A 3THBA 5IQDA 3F5PA 2FSOX 1PHKA 2JD5A 3QC4A 3RP9A 2HOGA 3QRIA 4FF8A 3VBXA 4YURA 2W1FA 2WMUA 4J98A 2WTKB 3D83A 3MY1A 1WVWA 2DYLA 2ESMA 3KK9A 1Q4LA 2YM6A 5C03A 5CU3A 5HVJA 4WKQA 2WKMA 3NUYA 5AR2A 5BUJA 2HXLA 4KD1A 4AE6A 4X2GA 2PU8A 4JLCA 3VS7A 4AXAA 3FEGA 4G6NA 4B0GA 2PZ5A 3LPBA 4LUEA 3F66A 1SZMA 4FSWA 5KBRA 4E20A 1LR4A 4MXYA 3N51A 2P4IA 3OXIA 3Q4TA 4H1JA 3QYWA 4OTFA 4CXAA 2A98A 3MGYA 4DEEA 4MYGA 3MYGA 2YJSA 4IC8A 4TL0A 3KKVA 3LFNA 3F69A 2OSCA 2WTIA 3VBTA 4EH9A 3W0QA 3R6XA 1NVRA 2WU7A 1IRKA 3E7VA 2GFSA 3CY3A 3PDTA 4DE4A 4V0GB 2YLEA 4H58A 4EHZA 1PXNA 3SG8A 3VULA 4EK6A 1FPUA 5LVOA 3RPSA 4GT5A 5DGZA 1KOBA 3QQJA 4EBWA 1REKA 2WMBA 4PMSA 4CZTA 3SW7A 3RPVA 2WQOA 1ZYJA 2GFCA 4NM3A 4TYHB 3RKBA 2PWLA 3QRKA 4TW9A 4Y83A 3QXOA 5BQ0A 2WU6A 4O4BB 4FZDB 4D2SA 3FHIA 4YTFA 5FXQA 4TPTA 4FIJA 4P90A 1P2AA 4ALUA 1JAMA 2XARA 2JLDA 3FZSA 4FT0A 1R39A 3GC8A 4EK8A 3ENHA 4F70A 3LMIA 4AZFA 4O7RA 2EXEA 3P9JA 4WO5A 4XMOA 1LP4A 3K54A 2JKMA 4BB4A 5JQ5A 4AUAA 3LFEA 2CGVA 2KTYA 3E7OA 5JKGA 2PUIA 3DB8A 4MWHA 4FJVA 5IA2A 5HE3A 2XEYA 3C7QA 1Q8ZA 4FZ7A 4BDBA 3LCSA 2FGIA 5ETAA 4BZOA 3QL8A 5IEVA 3UNJA 4U43A 2C6EA 1MRVA 4W9XA 5CAVA 3CKWA 5I3RA 4NFNA 4GK4A 2E9VA 2JDTA 4S32A 4UYAA 5CAUA 1ZXEA 3P5JC 3O50A 1YDRE 3N4VA 2IJMA 3SHEA 3FQHA 3FUPA 2PVNA 4CT2A 4C58A 4RPVA 5FTQA 2FSMX 3CJGA 4JBPA 4EOIA 5L6WL 3G15A 3G9NA 4JDHA 3OW4A 3GUBA 4QQ5A 2IPXA 4IWPA 2NP8A 4XNEA 4O2ZA 3BEGA 4D1ZA 2W1ZA 4W4XA 4EOOA 5JFXA 3P08A 5HI2A 3BL9A 1PXLA 3P7BA 1CKPA 2UZOA 4EHGA 2W5AA 4ONAA 4V01A 3DNDA 4U0IA 3HVCA 2GQRA 2GS6A 5M44A 2EU9A 2ITUA 4FIIA 4KS7A 3LM0A 4BBEA 4FT9A 5A4LA 4JQ8A 5GZ8A 3R7GA 4G5JA 2ZVAA 4M13A 4Z7GA 4FTQA 3PP1A 2HW6A 3MH3A 2F57A 1XJDA 2NPQA 4KIPA 2P33A 5EQPA 1KE5A 2C5XA 3WE8A 5LMBA 3ZO4A 2ITNA 2W17A 3PY3A 5BVNA 5L4QA 2OWBA 2JKQA 5HG5A 1XKKA 3DTWA 4AN3A 4IVBA 4O0XA 3DT1A 4J8MA 3COKA 4YC3A 4U45A 4E5BA 1U5RA 3B8QA 3NUNA 5I9YA 3C51A 2QO2A 1JNKA 3ZRMA 3HV4A 3RHKA 4X2NA 3JUHA 2BIKB 3OC1A 3C0GA 5M53A 3MVLA 3R02A 3QQUA 4QQCA 4J71A 2BRBA 2UV2A 5EW9A 2VTIA 4JJRA 3QTRA 4IWQA 4OR5A 4DGOA 4UMPA 1M17A 3OT8A 4N70A 4XRJA 3UZRA 4R3RA 1G8KA 5EKNA 3F5XA 4F7LA 3DAKA 1U54B 3RI1A 4DCAA 2XJ2A 3FLSA 1YOJA 4NTTA 3W16A 3NRMA 2PVHA 4RJ5A 4DEBA 4BGQA 5JRQA 5DI1A 2AUHA 1ZY5A 2BZKB 3WOWA 4G3FA 3PJ8A 5FM3A 2ITTA 3I6WA 4J96A 5DYJA 4HYHA 2XKDA 2XK8A 3BHTA 4GVAA 4O4DA 4UWYA 3L9MA 1R0PA 3GC7A 4GK3A 2B54A 4EK5A 1Y8GA 3CQUA 4G1WA 3BYSA 2HENA 3HEGA 3GT8A 4LFIA 4AA0A 4F4PA 2RFNA 4CMOA 1OIQA 4AAYA 2WMQA 2VGOA 4FKGA 2ITPA 3OHTA 3ALOA 5LCKA 2PVKA 3DCVA 4IM3A 5ANOA 3ACJA 4OTGA 4FTRA 3F2NA 1ZMWA 2IW8A 3ZUUA 2CJMA 4KRDA 2C3LA 1WBSA 2W1HA 3O8UA 4R78A 2GNFA 3PIZA 4GL9A 3MA3A 1YQJA 2C5OA 3LW0A 3S1HA 2Z8CA 3VW6A 4RWJA 3MSSA 5HLWA 3WI6A 4USEA 4RMZA 2HWOA 2ZAZA 4GMYA 4QMUA 4IZAA 2R3NA 4DEGA 2EXMA 5L8KA 3PP0A 2Y0AA 1XH8A 4O7NA 3LVPA 3BE2A 3AGMA 3AMYA 2W1CA 4IEBA 2XNGA 4L3LA 5FUTA 2R3FA 3R1YA 4FSRA 4FV9A 4XH6A 5AEPA 4YJOA 4DH7A 5M4CA 4U5JA 4D4RA 2J90A 2GNLA 4UBAA 3BI6A 4C4EA 4NFMA 4QMYA 1FBNA 4DH5A 3VUTA 3C4CA 4YHTA 3TNIA 1ZLTA 3E62A 2JC6A 3JYAA 4EYMA 2OXXA 2VWZA 3N9XA 4TYJA 5E8YA 2R3OA 4S33A 3ORKA 3I0OA 4BI2A 2BKKA 2QLQA 4H1MA 3HL7A 3ZRKA 5TR6A 2X8IA 4AF3A 5M4UA 3RWQA 4WD5A 1TKIA 4XG8A 4NW5A 2JDRA 2A27A 4G9CA 5CQWA 3V5QA 2CLXA 3LXKA 3OXZA 3DXQA 4I5HA 2OICA 4FK3A 5BYZA 5EI8A 4FG8A 4X2JA 2P55A 3O8TA 4GYIA 3W1FA 3NFGB 4OTDA 1BI7A 3OMVA 2WTWA 4IAZA 4AGWA 2GS2A 4F65A 5HOAA 2XRUA 3MV5A 4ZTRA 5L6OA 1HCKA 4PWNA 4EKLA 4ZY5A 3FKOA 3GU6A 2VO6A 5TF9A 2YAKA 3LFQA 4Z9LA 1KE8A 1BKXA 2YDIA 3Q5ZA 3CGFA 4YZ9A 2VTAA 2ZM1A 2C5VA 3FHRA 4WNKA 3CPCA 5EW3A 5HORA 1JBPE 2XNNA 5IQBA 1G8JA 4I0SA 3PXFA 4YZCA 4S2ZA 5D7AA 5E8ZA 4F9CA 3COMA 5LVPA 5DR6A 4BF2A 2Y7JA 4D1XA 4CCUA 3NR9A 3SOCA 3DK3A 2YHVA 3AD6A 4QMNA 2C47A 2O64A 2X7OA 4HNFA 4IDTA 4IXPA 4NW6A 4WUAA 3DBDA 4ZSAA 5EQEA 2YISA 4DCEA 3VIDA 5EG3A 3W2QA 4O7ZA 1Q97A 3MB6A 1JSVA 4FA2A 4DEAA 5E8WA 1H1WA 3GU7A 4J99A 3A4OX 1FVVA 2ZB0A 4FR4A 4OW8A 3OY1A 4L3PA 4C3FA 4F1MA 5M56A 2CPKE 2W99B 3QLFA 4DITA 2PULA 2PZRA 3HUCA 3PFYA 3QLGA 2QHMA 3ULZA 4XJ0A 4W4YA 4NIFB 4FODA 3MB7A 3W0OA 3QAME 4O4FA 4RIOA 3VVHA 2B53A 4EUUA 1IR3A 4DGMA 3F5UA 3KC3A 2B55A 5GNKA 4DH8A 3A62A 3PWDA 1Y8YA 3DQXA 3FZ1A 4KSPA 4X2KA 4CQEA 1FGIA 1J1CA 5D7VA 3ROCA 4CYIA 1QPDA 3ULIA 3BU3A 4KS8A 2GNJA 4JG8A 4PQNA 5CSXA 2Z7RA 5KKRC 3VJOA 4F1OA 1YDSE 3H9OA 3FZOA 5HX6A 4D2PA 3DBCA 1ZOGA 1FMKA 1PXPA 4XOZA 5A6OA 5FXRA 3A8WA 3RAHA 3E8CA 3SXSA 5HBEA 4JMQA 3CSVA 5E90A 5CAQA 1GIHA 2PZIA 4G31A 5M57A 2RFSA 1GAGA 4FTKA 5DN3A 4O7WA 3W33A 4B6LA 2XM9A 2WOTA 4L7FA 4R1YA 4ASXA 1YXVA 2HWPA 2RSVA 4RC2A 4IZ5A 2BKZA 4EH4A 4FT7A 4O0SA 4CLIA 3IG7A 3UDZA 1L8TA 3TM0A 1FGKA 1F0QA 3NCZA 4LV5A 4A9TA 3FMEA 2C6LA 3CLYA 4R3PA 1IASA 5A46A 3GC9A 4ITHA 4PTCA 4MF0A 5I9WA 5HESA 4OT5A 4ZY6A 3P79A 3I6UA 4YUQA 4RIXA 4R7BA 5IQEA 4U8ZA 4QMQA 3BHYA 3KRWA 4XLVA 5LVMA 4DEIA 2O8YA 4ID7A 3SRVA 3Q6WA 3TKIA 3CTQA 2VTHA 4N0SA 1E9HA 5IA0A 1LUFA 5KO1A 1OL5A 2QOLA 4XG2A 5DVRA 1H8FA 4FKJA 4NM7A 4BDAA 3Q32A 4ZSJA 5FEQA 5HCYA 4AW2A 2OFUA 4CRLA 2XJ0A 3PSDA 3D9VA 4M66A 5CS6A 2JAVA 1W83A 1CKJA 3A7HA 3KEXA 3EQCA 4QQJA 2AC5A 3PY1A 4PPAA 4F7NA 4UWCA 4KINA 2HZIA 2C0TA 3NYXA 4RX9A 2BZIB 4FNWA 4AZVA 1XH9A 2AEGA 4BIEA 4C2VA 3W2RA 4B9DA 1H28A 3IW8A 5IQFA 2XRWA 4AAAA 2C3JA 2QKWB 3MFRA 4O0RA 4BDCA 3QKMA 4FV1A 4DFXE 4Z3VA 2VX0A 4MD7E 4PV0A 3GU8A 3TT0A 5CF6A 5IDPA 4N57A 3PA4A 5AUUA 4FL3A 1OPJA 3GCPA 3OW3A 3TV4A 4EYJA 4ORKA 1M2PA 4BWPA 5JK3A 3BIZA 4ZIMA 4JAIA 2CNVA 3PXZA 4FOBA 2HAKA 3S3IA 3UIBA 4MUQA 2W5HA 4GRBA 4RLLA 3MTFA 4V05A 5HNBA 4JXFA 1Z9XA 3LQ5A 5ACBC 4HVHA 2YM8A 4QMWA 3V01A 5GIPE 1QPEA 3OOGA 3ZM9A 5HCXA 2WTJA 3QD2B 2WMWA 4FSTA 5JZJA 2YEXA 1PYEA 5H2UA 3QD0A 5IQIA 1DI8A 3EZRA 3V5TA 3MTLA 2IG7A 5GJDA 3RPOA 2HK5A 4IFCA 2JKKA 3HV7A 3TZMA 5IUHA 1VZOA 3EQDA 4FV7A 3ZLSA 3R9OA 3GOPA 2VTSA 3RHXA 4FL2A 4WRSA 4D0XA 3ZTXA 2EVAA 2WTVA 3WZUA 1W8CA 4IVDA 5DRBA 3ZUVA 4QOXA 5LJJA 4IVCA 4IM2A 2IVUA 5HO6A 5GHVA 5CYIA 5IA4A 4NCTC 3Q4CA 1MRUA 3O5AA 3BU6A 4TKSA 1OKYA 5CEQA 2ACXA 2Y4IC 4ZOGA 4U80A 2X7FA 1S9IA 4FKRA 4D2RA 2PK9A 2VTTA 2WQMA 4IAFA 1QL6A 3TCPA 1AQ1A 4PNKA 5HBHA 4E5AX 2NRUA 2BIYA 4GG7A 2UZDA 3DBFA 1MQBA 4U40A 5EFQA 5ACKA 2OJFE 3QTUA 3IW6A 4LOQA 5FEDA 1IAHA 3ET7A 4RWKA 1YI3A 3VQHA 2YZLA 5EQYA 4ZMEA 3BU5A 4ZAUA 3QTWA 1HOWA 4CFVA 4EK4A 2BRNA 3R2BA 3BYUA 3HP2A 3RJCA 3GFEA 4JX7A 2JBPA 2XK3A 3HUBA 2UZNA 2C0IA 4MNEA 2PVRA 2GSFA 3O96A 4NT4A 4UALA 2CHLA 2JDOA 5JFVA 4QMLA 1PJKA 3VUMA 5ANKA 3COIA 3ACKA 2XK6A 2WNTA 3OTUA 4NL0A 3QWKA 3DZOA 2OIQA 2Z7LA 2ZV7A 3F3WA 3FQSA 3NS9A 4PRJA 2BDFA 4CYJA 5IG1A 3MN3A 3R7IA 3PIYA 3UDBA 4MQ1A 1UA2A 3EOCA 3QX2A 4C4FA 4G16A 3TJCA 4AGDA 3HLLA 4YSJA 3UOLA 5L2QA 3GXLA 1GZ8A 3Q52A 2YIXA 4MBIA 4N6ZA 4XP0A 4IX5A 4YBKA 3ZEPA 5CU0A 5JQ8A 2R4BA 2VTJA 4EH5A 5DEWA 4I93A 3IOKA 4TXCA 4FT3A 4FSUA 5IA1A 3FI8A 4F64A 3ZLYA 2PMLX 3HA8A 1NY3A 2C3KA 3KXNA 3NW5A 4FTNA 3BYVA 3ZH8A 3GEQA 4JG6A 5C8NA 4YTIA 5CASA 1M52A 5KMJA 5ETCA 5M08A 2PL0A 4LYNA 4F9BA 3MH0A 2X39A 4FZAB 2B9FA 5IEXA 1DM2A 1TQPA 2XANA 5I0BA 2JGZA 5B2LA 3HRCA 3FL4A 5AP0A 4GCJA 3I7CA 2LAVA 3HAVA 1PKGA 1W2DA 5AIRA 2LGCA 4MXXA 3VQUA 3UTOA 3DZQA 3K3IA 4HNIA 4M0YA 4Y85A 3T3VA 2VWUA 4BDGA 4O7VA 3ORZA 4EOPA 2DUVA 2XIYA 4QP2A 2XNBA 1F5QA 4I41A 1J7IA 1LPUA 5LVLA 3QZIA 4FVQA 4ZSLA 4MVFA 1ZMVA 4IACA 5CY3A 2A2AA 3B8RA 3PXQA 1S9JA 3DBQA 3REPA 2XF0A 2RFEA 4ZTLA 4YSMA 4YHFA 1JQHA 4P4CA 3FMJA 3QYZA 4AZWA 2WHBA 4WBBB 4ANLA 4R5SA 3IS5A 5CXZA 5CVFA 3R0TA 3RAWA 3DTCA 1Q61A 3LJ0A 3FC2A 3QTSA 3EFJA 3SX9A 3UDSA 4BZNA 5L8JA 3LIJA 4BCHA 4EZ5A 3TYKA 5DMZA 3QTIA 3LCOA 4TWOA 3RPRA 3TIZA 4JDKA 4D58A 4QTBA 4BFMA 4YNEA 4KAOA 3UZTA 3R83A 2IZRA 5E1SA 4AOJA 3R7YA 5ANDA 3I0QA 4OBPA 3R8PA 4OLIA 4A06A 3I4BA 2C0OA 4Q5EA 5EHYA 2E9UA 4U44A 2YZAA 3GQLA 4TNBA 2GDOA 1FVTA 4FTTA 2XBJA 4D2VA 3UZPA 4NYEA 2GHLA 4FIGA 5CSWA 1ZOHA 5CSVA 4EBVA 1M2QA 4M3QA 3FMHA 3T9TA 5I9XA 2Z02A 3QQKA 4HGTA 3BL7A 4CKJA 4L52A 4FICA 4Y8DA 4BCGA 2WQEA 4F9AA 3KFAA 5J8IA 5KZ0A 1PXMA 1RW8A 3U51A 1KSWA 3EN7A 3ZHPC 4F6UA 5IQAA 4WSQA 2VWVA 3TDWA 4NM0A 2PVJA 4R77A 3O51A 4APPA 1XR1A 3EQFA 3U9CA 3DV3A 2X2LA 5LARA 3ZLXA 4YHJA 3ATTA 2CGUA 2R3RA 5AR5A 3R9HA 2F7XE 3OBJA 5KUPA 4ZS4A 2FH9A 2IVTA 4ZTSA 4TWNA 3R7EA 4DFBA 4BDEA 3AT3A 5GJGA 3H4JA 4FE2A 3FYKX 4DT9A 1M7QA 1WAKA 4KKGA 5IMXA 2BMCA 3KB7A 5M55A 4FK6A 2OZAA 4I23A 3S2PA 4K0YA 3NUXA 1GIIA 3UIMA 2WMSA 1TFFA 3COHA 3ODZX 4EWHA 5GINE 2V7OA 3QD4A 4CFXA 3QUEA 2X8EA 4RJ7A 1F3MC 2C30A 4P5ZA 3PSCA 4NUSA 3U6IA 2JIIA 3LOKA 4O96A 4C37A 3RK5A 4F7SA 3F2AA 3D7TA 1BL6A 4QRCA 5HE0A 4JRNA 4RIWA 4ZP5A 3BQCA 5DR9A 1ZYSA 3WYYA 2WPAA 3R8MA 4ZZNA 2BUJA 4CFFA 3NIEA 4GT4A 3VC4A 2OG8A 4EJNA 4DHZA 4XCUA 4FKPA 4D5KA 2QC6A 2VNYA 2QCSA 3WF8A 3CC6A 2BROA 1APME 1UNLA 1TZDA 4UWBA 4FZ6A 5CZHA 3SXFA 4NM5A 3G2FA 4A7CA 4C8BA 2GHGA 1NW1A 4AXDA 5AAGA 5AJQA 2BDJA 3OFMA 3H0ZA 1Y6AA 4PDPA 2ITYA 3RVGA 3R71A 4XP3A 3VW8A 4LQMA 2O0UA 4TY1A 3E87A 4EL9A 1Q8UA 2R3GA 4GJ3A 4M69B 4QMOA 5B2KA 4M69A 5BVFA 5KKRB 3RZFA 2OKRA 1VYWA 3R28A 4TYGA 3O7LD 3AT4A 2F2CB 1BUHA 2OF2A 4C0TA 5BNJA 3DB6A 3QFVA 4OTIA 4QD6A 3D2KA 5FDXA 4QYYA 4WNPA 1FINA 4U79A 5EYMA 3UOKA 3AG9A 4EOKA 4QTAA 4X3FB 4I92A 3EB0A 4CV9A 3D5UA 4X3FA 4RWIA 2HY0A 4AA4A 5KMLA 1YXTA 2UW8A 1B6CB 2XAOA 4ZLYA 4DFUA 3EYHA 1BI8A 5BX0A 2BHHA 2ITXA 2OW3A 2YERA 4JRVA 1KE7A 5CLPA 5CAOA 1J7LA 3MS9A 2W5BA 5CEOA 1QPJA 3DJ6A 2UZLA 3ZXTA 1ZYCA 5L2WA 3R8LA 4LI5A 3ITZA 2GNIA 4RJ4A 4AA5A 4XLIA 1P4FA 4EI4A 3ZBFA 1Q5KA 2H96A 4V0GA 4QP4A 3I79A 1Q3DA 1H00A 4YZNA 5EYKA 2W9FB 4S30A 1GOLA 3W2PA 4DG0E 4O0WA 2BVAA 3BGPA 4TYHA 3Q3BA 2Y6OA 2AYPA 4PPCA 1ZMUA 1JKSA 2Y8OA 2PE2A 2QOCA 2CSNA 3PY0A 3EFWA 4GJ2A 3VJNA 4ACCA 3EFLA 2X7GA 4HOKA 5CU6A 2J0JA 4ASDA 3D2IA 3BCEA 1SM2A 3FKNA 2R3JA 5CXHA 2UW3A 4ZSGA 5DT3A 3FXZA 3NLBA 4FYOA 3GENA 3FDNA 3OTVA 5BUEA 5F94A 5EDQA 2PE0A 3TDVA 1GZOA 4BIBA 3ZFYA 5JFWA 1PMUA 5E91A 2OH4A 2NRYA 4G3CA 5C27A 5CEIA 4QQTA 3F88A 4QP6A 3QXPA 4JBVA 3R22A 3V5WA 1WVYA 4J7BA 2V62A 3LFAA 4CKIA 2ITVA 5CT0A 5HE2A 3AKJA 5KMOA 4O7YA 2OIBA 2Z60A 3D5XA 3P1AA 3R30A 4O27B 3SOAA 3O0GA 2XBAA 3A7GA 5FDPA 2W06A 2WIPA 4CLJA 3RTPA 1R78A 5BPYA 4PL4A 2XK7A 3QA0A 4EH3A 1STCE 4LDTA 3KIOC 5M51A 1OPKA 4BTFA 3LM5A 3W2CA 3I5ZA 3PVBA 3BEAA 5AP7A 2GHMA 3WBLA 5C1QB 5DIAA 2BHEA 1A48A 5IMEA 4MKCA 2F7ZE 1W84A 2PHKA 3TXOA 2VTMA 4C2WA 3BWFA 4EZ7A 2O63A 5GJFA 4RIYB 3UC4A 4ASZA 3LCDA 4XV1A 3W18A 3HYHA 4KKHA 5AUYA 5FRIA 5IPJA 4F9WA 2Z7QA 4FKLA 3ATSA 3E3PA 2YM4A 3ORIA 2YFXA 3NUUA 3PJCA 3VBWA 4C7TA 1PMNA 2XVDA 5EYDA 1BMKA 4PL5A 4ZZOA 2QOIA 4QPMA 4C62A 2XCKA 2ZV9A 2JIUA 2ZM3A 2IF8A 3DFCB 2RG6A 5EOBA 5HIEA 1VR2A 3R1NA 4A9SA 4OTQA 3T8OA 5KHWA 1TQIA 4C61A 3O71A 3VRYA 4O82A 4FSQA 3EQHA 3GVUA 3A7FA 4FEQA 4WNMA 5HHWA 1ST4A 3PUFC 4O0UA 5AFVA 4FRFA 3W10A 3TNHA 4Z16A 5D9HA 4QO9A 4G3GA 3CY2A 1WZYA 3SXRA 5A4CA 5IEYA 4LMNA 2G2HA 1KWPA 4PDOA 3FLQA 3KXHA 3QTZA 4O0VA 4D2WA 1XH4A 3PJ3A 4C38A 4M67A 2C4GA 4E6CA 5A4TA 2FA2A 1V1KA 4E6QA 3KL8A 1JLUE 3R21A 5HG9A 5DG5A 1I09A 2X0PA 4BY9E 2UVZA 2J0LA 4YJTA 3DKGA 3D7ZA 4YJUA 4II5A 3FLYA 3UG1A 3ZXZA 2O2UA 2E2BA 2FB8A 3GCVA 4I5CA 4E7WA 5LWMA 1U54A 5M07A 5FQDC 3RNYA 2ONLA 3FWQA 1VYZA 3TNWA 1G8AA 3Q9YA 2YM5A 3ZONA 2I6LA 3EN9A 4ZLZA 4WUNA 5H8EA 3HP5A 2WD1A 5HD7A 3UIUA 3V04A 4ANMA 2UUEA 1LEZA 1U4DA 4G6LA 3OCTA 5CANA 3IGGA 3EQRA 4O83A 3LCKA 4FBXA 3NVKI 1QPCA 2X9FA 2YIRA 3OZ6A 4I24A 4YTHA 2GMXA 1WBPA 3EZVA 4GSBA 4J53A 4DLJA 3ZSIA 5A4QA 5CEKA 5JFSA 4JL9A 4QMMA 5HD4A 2VZ6A 4RVKA 5HTCA 3D5VA 2QOQA 5E7RA 2X9EA 1GZNA 4TYEA 5DA3A 2QOHA 1K3AA 3CD8A 3LFDA 3PG1A 2YIWA 4LRKA 2WMXA 3DJ7A 3OUNB 3L9NA 3UDTA 3PPJA