4G3FA

Crystal structure of murine nf-kappab inducing kinase (nik) bound to a 2-(aminothiazoly)phenol (cmp2)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
333
structure length
312
Chain Sequence
SGSVSSGQAHSLASLAKTWSGPETEDNEGVLLTEKLKPVDYEYREEVHWMTHQPRVGRGSFGEVHRMKDKQTGFQCAVKKVRLEVFRVEELVACAGLSSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLIKQMGCLPEDRALYYLGQALEGLEYLHTRRILHGDVKADNVLLSSDGSRAALCDFGHALCLDYIPGTETHMAPEVVMGKPCDAKVDIWSSCCMMLHMLNGCHPWTQYFRGPLCLKIASEPPPIREIPPSCAPLTAQAIQEGLRKEPVHRASAMELRRKVGKALQEVGGLKSPWKGEYKEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NF-kappa-beta-inducing kinase
publication title The crystal structure of the catalytic domain of the NF-kappaB inducing kinase reveals a narrow but flexible active site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 107
structure length 312
sequence length 333
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2012-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4g3fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4g3fA01
1JVPP 4C33A 5BVFA 3UYSA 3U6JA 5EKNA 5HESA 3ZFXA 4S33A 4X2GA 3MIAA 4AA5A 4X21A 3OROA 5CEIA 5HCXA 4CQGA 5J5TA 3I1AA 1IASA 4AZFA 5FXQA 4FUYA 3TNPC 4BVUA 3EYGA 2O64A 4X3JA 4BKZA 4MAOA 4BKJA 1PMUA 5KMJA 2PPQA 2VTNA 1O6KA 3CP9A 3M42A 3GU7A 4QMZA 3CE3A 2XIKA 1PMNA 3I60A 1REJA 4UX9A 4M84A 3WZKA 3PVGA 4QPMA 3MFSA 3HV5A 1WMKA 1YWNA 5LMKC 5FRIA 4S31A 3V5PA 4FNXA 1J7UA 1Z5MA 1H1SA 2BROA 4MXOA 4A4XA 2IW6A 2RSVA 1G8AA 4EQUA 2CGWA 1LUFA 2ITNA 2YM4A 3IOKA 4CYJA 3B2TA 3OZ6A 5HD7A 4TW9A 3HEGA 4O1PA 4ASXA 4JJRA 2RG5A 2XK9A 3WF6A 2ITOA 4NSTA 4AACA 4UWBA 3HMMA 3SQQA 3D5WA 2H6DA 2O3PA 3TZ8A 2YISA 2EXMA 2PSQA 2CKOA 4GYIA 5DR6A 2YDJA 4DBNA 2QODA 2WTCA 4PL4A 5KNJA 1PXMA 5LVNA 4IW0A 2ONLC 3P86A 5K0XA 2E9NA 2XZSA 4CMUA 4E5BA 5EW3A 2PUNA 3VVHA 3RZBA 3WZUA 2VU3A 4GT4A 2OJ9A 3FJQE 4E4NA 3R73A 4EHEA 2YACA 2BDJA 2JIIA 2AC3A 4LMNA 4FEQA 3RM6A 3ZRMA 2ZJWA 3HGKA 5KUPA 4USFA 1R0EA 1YWRA 5GJDA 4NCTA 2CNVA 1KE6A 3D5XA 2W05A 2XUUA 3D4QA 2UW3A 1UWJA 2OJJA 2PE0A 3FL5A 4AAAA 4B0GA 3ALOA 3FMDA 1OL7A 1Q8ZA 5KKRB 4D55A 4JI9A 4IZ5A 3I7BA 3ZS5A 2B9IA 4X6QC 3OS3A 4JVGA 4A9UA 2QD9A 3Q53A 4EOJA 5CQWA 3PXYA 4C58A 1WBTA 5B2KA 3VNTA 3OVVA 4DGLC 4U79A 5EQEA 4RWIA 3QKLA 5FEEA 2W1HA 2PYWA 4O38A 3HRCA 2JIUA 1YWVA 5ICPA 3NIEA 1UWHA 4OTDA 4D4RA 3PWYA 5CSPA 1P4OA 2WMAA 3HUCA 3MDYA 4QMOA 5AR3A 3D7TB 3T8OA 4PPBA 2BRGA 2HAKA 3ZZEA 4CV9A 3P0MA 4I41A 4NM3A 4YJTA 2QONA 3UIXA 3W8QA 5L4QA 3ATSA 2ACXA 2JEDA 2WMVA 4G6LA 1W0XC 3FMHA 4KSPA 4FK6A 1OKYA 1BX6A 3VUHA 3RVGA 5CU3A 3LZBA 5CVGA 4FIEA 4YZDA 3BQCA 1ZLTA 5L8KA 2DWBA 3DB8A 3QTRA 3D9VA 2VTSA 3P1AA 5CWZA 1O6LA 3LJ0A 4BCQA 4D28A 4YMJA 2B9HA 4HCTA 3TJCA 4IB5A 3DOGA 3VWAA 3LKMA 3RINA 2PHKA 3HV4A 4EH8A 3EQDA 3FHRA 3LIJA 1ZWSA 1XO2B 3LCDA 3MWUA 1J7LA 4C59A 2ERZE 2Q83A 4XH6A 1PYEA 3QZGA 3SD0A 1WBWA 5E7RA 4BFMA 3FL4A 4BDFA 2WQOA 4Q2AA 4ENXA 3KL8A 3UOHA 4X3FC 1YXTA 2YJRA 1DAWA 4EHVA 2VTLA 2PE2A 1VZOA 3QHRA 3AC4A 5I9UA 5CAOA 5HO8A 4J99A 5EDQA 2QOHA 3R1QA 5D7AA 3V5JA 4KS8A 1OL6A 3FUPA 4JQ7A 2YIRA 4GK3A 3MTFA 5CAUA 4GU9A 3PG1A 4Q9ZA 3ZRKA 5I3OA 3VUGA 3C9WA 2H8HA 3R7OA 3DBQA 3QXOA 4MKCA 1G3NA 4BCNA 2DUVA 2R9SA 5AP0A 3Q04A 4DHFA 3BHVA 3R22A 1R3CA 2PUUA 2R7BA 4HYIA 4F4PA 5HLNA 4MXYA 5IQCA 3NZ0A 3H9RA 4AN9A 4BL1A 2VTMA 3GUBA 3HMIA 4FSRA 2J90A 4ZOGA 2PMIA 3TNWA 2PVNA 2RG6A 3CGFA 4Y73A 2XH5A 3NNXA 3QZHA 3LFDA 4O7NA 2VTPA 4ZMFA 5A14A 3VN9A 3SG9A 4EOOA 2W9ZB 1OPKA 3C0IA 3MTLA 4W4WA 1VEBA 2R4BA 3F5GA 4MNEB 3BWFA 2PE1A 5DPVA 4O7TA 1W84A 1BMKA 4AFEA 4PTGA 1JSVA 2J9MA 3VJNA 4AGWA 4YNEA 2W1ZA 1UNLA 4F7LA 1XBAA 4O7VA 3R2YA 2A27A 4Z55A 4UWYA 3GFWA 5B2LA 4WSQA 2OW3A 5J9YA 2PZYA 4HYHA 3VUMA 4Z9LA 3BE9A 3LMGA 3QQLA 2WFYA 1OL2A 1P5EA 3RAWA 3TNIA 4NJ3A 4XCUA 2WQNA 5DN3A 4ZS4A 4QQCA 3QRJA 4BDAA 4I3ZA 3BU6A 5D12A 2GHGA 4RVTA 3KVWA 3L9MA 5LWMA 3FZSA 2OIBA 2PL0A 3PSBA 1S9IA 3KXXA 4FTKA 4G17A 4B9DA 4EQMA 4QP7A 1FMOE 5DT4A 4MQ1A 4UXLA 4CGAA 4FIIA 4FTCA 4M0YA 5LMAA 3RALA 2YM7A 3IS5A 3DCVA 2OXDA 2Y0AA 4JRNA 1YI6A 4RZWA 1R1WA 5CI6A 2PZ5A 3VS0A 2IVSA 4PV0A 5AP6A 3RK5A 4BC6A 5L8JA 2YIYA 4L45A 4H3QA 4C3FA 4DEGA 4WHZA 5IA0A 5IU2A 4B7TA 4RIYA 2HOGA 4RJ6A 3MFUA 4IJPA 4CTBA 4U80A 5IEXA 4TKSA 4YC6A 2XYNA 3UIUA 3MH0A 2HZIA 3EH9A 5M4UA 3ZSGA 3G0FA 4QTCA 4QNYA 3E5AA 4AT4A 4BTMA 5M51A 5EYMA 4BF2A 3UQGA 1JPAA 3P08A 4KSQA 5DG5A 5J95A 2GSFA 3ETAA 3SDJA 5AFVA 1M2PA 1GOLA 3WIKA 4BDGA 4EH3A 5KMNA 1AD5A 4U6RA 3AT4A 4O96A 4DEEA 3GCUA 1YRPA 3BI6A 4C57A 3BHUA 3QQKA 1I09A 1PMEA 4GG7A 5BUIA 3Q96A 4BDIA 1E1VA 4BGGA 4H58A 3VULA 2RKUA 3KRXA 3QQGA 3QD0A 4IWOA 4ZAUA 2H34A 2JIVA 1YDRE 3PA4A 4CXAA 3UMXA 2JD5A 4QQ5A 4WA9A 3Q9ZA 4QTEA 3TDVA 3R21A 4JR3A 4NKSA 3HZTA 2NRYA 3RK7A 4E1ZA 5J7HA 2Z2WA 2HENA 4LL5A 4DBXA 3E7OA 4ITJA 3R9DA 1ZYCA 4EC9A 3V8WA 2VGOA 3PRIA 3DTCA 5KBRA 2WTWA 3CLYA 3CKXA 1PJKA 2BCJA 3ZDIA 3OCGA 5ETFA 3OT3A 2GFCA 4AT5A 2BAQA 3ODZX 1STCE 3VBQA 5BVKA 2W9FB 1R0PA 4W4XA 3HP5A 3WF5A 3V51A 4ACMA 3Q52A 2WTJA 4D0XA 2XJ1A 5LJJA 3IW5A 4OBOA 2OJIA 2X7OA 3TKIA 4D9TA 4O86A 5LVPA 4AZEA 3EN9A 2HY0A 1KUTA 4WSYA 3C0GA 4BDCA 1TQIA 4ALUA 3CJFA 2X0GA 2PVYA 5AUXA 4Y95A 3BU3A 3DXNA 2FB8A 3BHHA 2FSMX 3W2CA 5HIDA 4RPVA 1H0WA 2QOCA 1KOBA 2R3FA 2E9VA 3R9OA 3EN7A 3LM0A 4GYGA 2XIYA 3N4UA 3W8LA 1YW2A 2HELA 2Y4PA 3KXMA 5A54A 3BHTA 2WD1A 3RPOA 4D2PA 1KE7A 3A7FA 3Q6WA 3R1NA 2IPXA 3WYYA 3II5A 3PXFA 5EHLA 4BZOA 5AEPA 3I81A 5BMSA 2XK4A 2YITA 4GCJA 1URCA 1WZYA 3LXPA 4BCIA 3OC1A 5CNNA 4ASEA 5DBXA 5CF6A 3RTPA 4FT5A 4KAOA 1LR4A 3HECA 4QP1A 5AP5A 3FZ1A 4RJ3A 4J1RA 2C3JA 1H24A 1HOWA 4R8QA 4XRLA 3UTOA 3ZLWA 2VTAA 5EG3A 3K54A 2WTKB 4L6QA 3P23A 3LMHA 2ESMA 4IANA 3AMBA 4USDA 3OD6X 2PVJA 3EQRA 5BNJA 4P5QA 5F95A 4O2PA 3E3PA 5LMKA 5DEWA 3EKNA 4D58A 1K2PA 4KKGA 3MJ1A 3OP5A 3T9TA 5DR9A 3TWJA 3FMJA 3LW0A 3OCSA 5FTQA 3ZO3A 4XG6A 5ETIA 3GXLA 3PDTA 3W55A 2R0IA 3A8WA 3UJGA 4GRBA 3KF4A 5E8ZA 4BCFA 3F5XA 4ARKA 2HZNA 1W7HA 3GCVA 4QTAA 2F7XE 5TE0A 3CY2A 4YNOA 4DFLA 4YU2A 2GTMA 3POOA 3L8PA 4IVBA 2J50A 3QUEA 5H8GA 1JNKA 2YM8A 4QMMA 4EUTA 4Q5EA 3E93A 2YM3A 4FL3A 2AC5A 2GQRA 3KCFA 4E4XA 4XNEA 4TL0A 4I6FA 3CIKA 4RA5A 5CU6A 4CMTA 1CKJA 1YXUA 3W1FA 3POZA 1MUOA 3ITZA 1ZAOA 4FV3A 3RZFA 3RPRA 4HW7A 3SW7A 2QG7A 5L2QA 2J5FA 2B4SB 2E9PA 4M69A 1JWHA 3FC1X 4XV9A 3W33A 4CFWA 4E93A 4EH7A 3TJDA 3HYHA 3PZHA 2X6DA 3FPQA 3MVMA 4EOIA 1OIRA 2GHLA 3EQPA 4ZTRA 5HVJA 1YQJA 3MPMA 4RZVA 4IZYA 3O50A 5CQUA 4CTCA 5DFPA 2UVZA 3QAME 5BUJA 5HNIX 3UDBA 4YJQA 4G16A 5E92A 3VQUA 3PJ2A 1CKPA 3ORLA 4S32A 2X2MA 5GJFA 5EQPA 5JGDA 1MRYA 4DT8A 4RJ7A 4OBQA 5L2SA 2BAKA 2BMCA 3HUBA 4WUAA 5HVKA 2C69A 3F88A 4LUDA 4QMVA 5TR6A 4AWIA 4N57A 1H07A 1UNHA 3GU8A 4LRJA 4ZSGA 3TIZA 4E3CA 4I0TA 4WD5A 5EDRA 3WI6A 2YDIA 4CCUA 4YTCA 5BVEA 3WZDA 4FG7A 3VS2A 3ACJA 4N4SA 4IFCA 4F9YA 4QP3A 3AC1A 2QNJA 2Z7SA 4K2RA 1RE8A 3PA3A 1PKGA 5E8WA 3SHEA 3EJ1A 5AP7A 4FEXA 2QO9A 3SVVA 1MRVA 1GAGA 2XVDA 3GB2A 5T3QA 4AG8A 5LXMA 3UO5A 3RKBA 1OBGA 3MY0A 4EUUA 4IIRA 2CGVA 3EB0A 2WMRA 3GOKA 3O2MA 4O84A 4QQTA 1XH6A 4IC7A 3ZMMA 3DJ6A 3ORZA 5LARA 2BKKA 2UW0A 1W82A 2G2FA 2JDOA 1T46A 4D2SA 4WNKA 3TUBA 4FIFA 3PRFA 3U8WA 3MW1A 3VJOA 4DINA 3O7LD 1WAKA 5D1JA 1R39A 1UVRA 3WILA 3UVQA 4GK4A 4JBVA 5IF1A 3S0OA 4O7SA 3SXSA 3NPCA 1BUHA 2VTTA 4W8DA 2G2IA 4FTAA 4IQ6A 4XG3A 4TXCA 4BI0A 5BPYA 5HBJA 4TNBA 2JFMA 3PWDA 2R3MA 2C47A 4M15A 4QOXA 3BE2A 2Y4IC 4HGTA 3UO6A 3DAKA 2PMNX 4EH2A 1JBPE 4RJ5A 3E63A 4FV1A 3FWQA 2R3JA 4O0RA 4PL3A 4IM0A 3ATTA 1ATPE 1U4DA 4JBOA 4LG4A 4YBKA 3OW4A 3R9HA 4KIKB 2WGJA 3FSKA 4MTAA 3I0OA 4U3ZA 3UNJA 5EH0A 3D94A 4HZRA 4EHZA 4CVAA 2C6OA 3DNEA 5G1XA 3LFQA 4AA0A 1TVOA 4C4EA 4NK9A 2FH9A 3ODYX 1L3RE 2OICA 4FTQA 4IXPA 4N6YA 4X2JA 3UZPA 4XLVA 3ORPA 3R7VA 5IMXA 1J3HA 2X9FA 4M68A 3SXFA 3DXPA 2ZYBA 4ANMA 4FOBA 4QQJA 3GEQA 2W5BA 4F6UA 3OOMA 4J53A 3BU5A 4LMUA 3I5NA 4HGEA 4FKJA 3GFEA 2UZOA 4IVAA 5A6OA 4M69B 4IVCA 5DT3A 3VS6A 4EH5A 1QMZA 5AAFA 1T45A 4FC0A 5M53A 3QD3A 3QD4A 4QMXA 3OWPA 3CS9A 3QX4A 4HYSA 4XUFA 5ETCA 1YKRA 2LGCA 4WO5A 3UVPA 3NW5A 2OF4A 4M12A 2J0IA 3TEIA 2GNHA 4I20A 5I4NA 5M09A 2BVAA 1S9JA 3IQ7A 4LRMA 5CU4A 2IG7A 2O0UA 3R02A 5IH6A 1J1BA 4J71A 3GCQA 3MV5A 3MESA 4U5JA 4GS6A 1IAJA 1GZNA 4DTBA 2QI8A 2IZSA 2FVDA 5KX8A 2IZRA 2YIXA 4V05A 4A4LA 3UYTA 4F09A 4MYGA 1ND4A 4C3PA 4FKIA 2J0LA 4CD0A 5KCVA 4QYHA 3DPKA 4FV4A 2GS2A 4E73A 4F0IA 3CTJA 4PMSA 3PJ3A 2DQ7X 3OUKA 4YO4A 1P2AA 4LV8A 2VX1A 1U54A 3KRWA 5L6OA 1IR3A 5LOHA 3CQUA 4RLLA 4MCVA 1FGIA 2CLQA 3KMMA 2Z7QA 3EL7A 1QCFA 2W1CA 5TF9A 2OLCA 4QMWA 4UMPA 3F2NA 2QOBA 4PDSA 4JIKA 4IAFA 3Q5ZA 1GZ8A 2OU7A 4I5HA 5FG8A 3UG2A 4YC8A 3G9NA 3VBXA 2YFXA 3R1YA 4P2KA 4U9AA 5EYKA 3TKUA 1YDTE 3CCNA 3D7ZA 3E8EA 3TKHA 5CLPA 4O7LA 4JXFA 3FYJX 3ZU7A 5K5NA 3LMIA 3LQ8A 4U8ZA 2YJSA 2F57A 3IDCA 4G3EA 1XKKA 5FWKK 4O82A 4LGGA 5T6KA 5JMSA 1URWA 3RI1A 5DH3A 5CEOA 4YTIA 4D1XA 4P7EA 5CVHA 1J7IA 3KXHA 3KULA 5FTOA 4EC8A 4IAIA 5LQFA 2CDZA 4BIBA 3ELJA 3QQFA 3SRVA 3TTIA 4XV3A 5M56A 3TL8A 3DK7A 3Q60A 3R01A 4OAVB 3D15A 2UZEA 1YHVA 4L43A 1JKTA 2WTKC 1QPCA 3AXWA 4ZTSA 2ITZA 3UBDA 4F9WA 4DA5A 3ZFYA 3CY3A 3QALE 5A3XA 4QRCA 5CSWA 5HCZA 4DH3A 3Q4CA 3CBLA 2BTSA 4RIXA 4DLIA 1WVYA 4AOJA 5IA3A 4B99A 4AXAA 3LFFA 2RFSA 2RFDA 3G6GA 1GIHA 5HZNA 4IB3A 3PIXA 2XYUA 5CEKA 4MF1A 3OF0A 2O5KA 4TWPA 3ZUVA 4ANNA 4UXQA 2ZDUA 5ANIA 5K4JA 3HLLA 4ZTQA 3ZSIA 5C8MA 4FSWA 4M7IA 2XIZA 4NYEA 2B54A 2HIWA 5I9VA 1H8FA 1A06A 4KKHA 3ZM9A 3HMOA 2RGPA 2PZRA 4BI2A 4BTJA 4E6QA 1ZYDA 1U46A 4Y46A 4EK5A 3T9IA 2R3OA 2C5NA 4FBXA 4YZBA 3TT0A 3TZ9A 5AP2A 3Q9YA 1ERKA 4QMSA 4XV1A 5CTPA 4EZ3A 3DQXA 3IW7A 1TQMA 2B52A 2HW6A 2IO6A 2BUJA 4EOKA 1ZYJA 4NIFA 4CFVA 2XK8A 3FC2A 3QXPA 4OTIA 1Y8YA 4EQCA 4A9RA 4UV0A 5HE3A 5KMKA 4IE9A 2PUIA 5DA3A 3QCQA 3D2IA 5HTBA 1ZMVA 1YOLA 5G6VA 3FXXA 2H96A 3R2BA 3AD6A 2JLDA 3KGAA 5IA1A 4ERWA 1BI8A 4BDDA 4Z7GA 5E8YA 3MI9A 3WF7A 3JVSA 4CFMA 3HV6A 3ZLYA 1NT2A 4PQNA 1VYZA 5KZ0A 4JQEA 1M7NA 5C01A 5TOZA 1NY3A 2BRNA 1JKLA 4AA4A 2HW7A 3OEFX 2QOKA 4WG3A 3SW4A 3V3VA 2QR8A 3ZRLA 4KIPA 4OTQA 3U6IA 3PY1A 2FYSA 2BZKB 3S4QA 4E6AA 4FUXA 2PVKA 4ZSJA 4GKIA 2WMTA 4FZ6A 3I6WA 1G8SA 5AX9A 4I0SA 5EKOA 4AGDA 5HBHA 3W2RA 5JRQA 5C4KA 5C4LA 4QO9A 2W96B 3BZ3A 4EONA 2BFYA 5FD2A 2X8DA 4YO6A 1V1KA 3EKKA 4PNIA 3DKCA 5L2IA 4PF4A 4TPTA 2GNFA 3VS5A 4AU8A 3BYMA 3QQUA 4O0SA 4FIHA 4IM2A 2CLXA 3N9XA 5L6WL 3OW3A 4Z7HA 3VIDA 4N6ZA 2F2CB 1YVJA 5J1WA 3KB7A 4OBPA 1Q97A 3NYOA 3CQWA 1XH8A 4JX7A 4ONAA 4RMZA 5JH6A 3QQJA 3D0EA 1JOWB 1PXKA 3N51A 2CHLA 4FA2A 1YOJA 3UGCA 3THBA 3FQSA 3TUDA 4QYEA 4XOZA 4MK0A 4RIXB 4Y83A 3BPRA 3I5ZA 4YJNA 5ETAA 5EYDA 2FA2A 5AM7A 4EL9A 2UV2A 3HMPA 3GT8A 4FVQA 4UMRA 3ZBXA 3LXNA 4ZZMA 3PVUA 3DZQA 3FMEA 2YLEA 3MB6A 4QMUA 4YJUA 3MY1A 2JBPA 4WT6A 5HBEA 2G15A 2B55A 4GT5A 4DTKA 2XJ0A 4DG0E 2GU8A 4NL0A 2IWIA 3R7IA 4DITA 5AUZA 5D9HA 4BGHA 2ZV9A 3KFAA 3NW7A 2GNJA 4BYJA 1PYXA 2OJFE 2OGVA 4CRLA 4EI4A 5IQBA 5DGZA 3R8MA 5J9LA 2R3HA 2R3IA 4FKOA 5CYIA 1Q62A 3WBLA 1Q3WA 2PK9A 4IC8A 2WU6A 3FMNA 3V5TA 2OF2A 4L44A 1OUKA 5D10A 1WCCA 4G9RA 1Y8GA 3BWJA 3LXKA 3BGZA 4QP8A 1J91A 1YI4A 3QTSA 3NIZA 4YC3A 3U4UA 4O81A 2R3QA 3W10A 4D4VA 4YSJA 1JKSA 5CAPA 4O91A 5I9YA 3PP0A 4LGDA 4O6LA 5CF4A 2C1AA 4HCUA 3RNYA 4IAKA 1ZOEA 3ZUUA 4OTRA 3TZMA 3AG9A 4GSBA 4KINA 1Y91A 5ANDA 3QU0A 4EZ7A 4UEUA 3PP1A 4AUAA 1WBOA 5HQ0A 3HRFA 5E9EA 1QPEA 1WBPA 3DY7A 3FY2A 5I5ZA 2HWPA 5E1EA 4NW6A 4XG2A 4F08A 2C68A 5FDXA 2WOUA 4L3LA 3SAYA 1XH9A 3C50A 4XHKB 3NCZA 5EQYA 2UZWE 3CR0A 5BQ0A 2YCQA 5T68A 3UZTA 3DBDA 4ZSLA 3KEXA 4M8TA 4ZTHA 5KBQA 2V22A 4XS2A 4UB7A 4F99A 3HA6A 4ASDA 2G1TA 3GQIA 4ASZA 3CC6A 1B6CB 3OY1A 4PUZA 4UMQA 4Y72A 1L8TA 3LHJA 2O63A 3G2FA 1PXOA 4L3PA 4QMQA 3HP2A 2P55A 4C36A 2AUHA 3OBJA 4H05A 4JDHA 3KVXA 2OIQA 4C02A 1OPLA 4RJ8A 2JKKA 1PW2A 4F64A 3ORXA 3TM0A 4CZYB 4UN0C 2ZMDA 2VAGA 4FKQA 2ITQA 3F3WA 1GIJA 5C27A 1PXPA 4J52A 3TACA 1JQHA 3V01A 3FI2A 3M1SA 3MVJA 4ZJIA 4CSVA 3JYAA 4XX9A 3C7QA 4EZ5A 1ZOGA 4MF0A 4RFYA 3MBLA 3V5LA 2UW8A 2QHNA 3NGAA 4IWPA 3TZ7A 3PXQA 4BRXA 4C0TA 4ERKA 3MFTA 5AADA 4NW5A 3QA8A 5L8LA 3BV2A 3H10A 5CU2A 1KV2A 2CSNA 4KRCA 4I4EA 2REIA 5EHOA 3S2PA 1SVHA 4YJVA 3M2WA 4BWKA 1JKKA 5DI1A 4UMUA 1K9AA 2CJMA 1RJBA 1YDSE 3QX2A 4YHJA 2W5HA 3ZONA 3JPVA 3JVRA 3EFWA 3SG8A 4AZVA 4EH9A 4I23A 2CCHA 5M4FA 3MJ2A 3V8TA 4DC2A 2PU8A 2VTIA 3IO7A 1ZARA 2OH4A 3ZLSA 1IG1A 5DE2A 3O23A 5AIRA 3ZSHA 2BPMA 3QZFA 2C6MA 2J51A 4K1BA 4NH1A 4U97A 4BY9E 3NVKI 4F7NA 2ITTA 4WRGA 5AP3A 3TI1A 4FGRA 3HV3A 4MD8E 5A6NA 3HX4A 2CCIA 3VC4A 4NM0A 4Y5HA 4JDIA 2YEXA 2BDFA 2YZAA 4FYNA 3U4WA 2J2IB 5H9BA 2W1GA 2F7ZE 3VUKA 3OCTA 2YHVA 4KKEA 1OL1A 3Q4ZA 5AAEA 2VX0A 5EI8A 4AZWA 5TT7A 2QOQA 3BEGA 5F94A 3MA6A 2XJ2A 1M2QA 4IZAA 2P0CA 2WO6A 5IPJA 1OKZA 3NMUF 1ZOHA 5DRDA 2UZLA 3D14A 4JBPA 2HCKA 2VWUA 2VX3A 2Z7RA 3FE3A 4RFMA 4YR8A 3NVMB 2EVAA 1GY3A 4RA4A 4S34A 4O22A 2C5VA 3KN5A 4BDKA 5AUTA 4FTLA 1H25A 2R3RA 3BBTB 3H0ZA 3H4JA 3I0QA 2IZUA 2ZM1A 3C4EA 3Q32A 4M0ZA 4XG7A 4GL9A 5E8SA 3WZJA 4HVGA 5J1VA 2V7OA 4GK2A 2ZV2A 5CT0A 1MQBA 3K3JA 4HPUE 4Y85A 4L68A 4FKLA 1XJDA 4E4MA 1P14A 4OUCA 5LCKA 4GFMA 3DXQA 3PUPA 2BRBA 4BDHA 2V55A 2YZLA 2EU9A 4FSZA 4GKHA 1NW1A 4RX5A 4W4YA 1O6YA 3VS4A 2OBJA 3QRIA 5EYCA 3ENHA 2X6EA 3G90X 3FMKA 2VWIA 2EXCX 4FVPA 4Y5QA 2WMQA 2VD5A 4RC2A 1SNXA 3EOCA 5KZIA 1OPJA 5TKDA 3UC3A 1OBDA 1SVGA 4FV6A 2P2HA 3KA0A 4YHTA 3ZO2A 5CU0A 4GUBA 4H1JA 5LVOA 3DKFA 2GQGA 4EKLA 3A8XA 2OWBA 4F1OA 5L2WA 3PZEA 4APPA 3UG1A 4C4GA 4FV5A 3KKVA 4LL0A 5DWRA 4MWHA 3U87A 4BWXA 5LCJA 3PY3A 3OXZA 1ZYLA 4I94A 3RCJA 4MWIA 4LOQA 4MD7E 1JSUA 2WIPA 3DKOA 2W17A 1B39A 5CNOA 4CQEA 4NKAA 4L8MA 2ZOQA 4O1OA 3ZLXA 4EOLA 4R7BA 2WPAA 2BZJA 4W9XA 5HIBA 4YPDA 3PYYA 3QCSA 4DEDA 3DK6A 4X2NA 5C03A 2YIQA 4BCGA 4V0GA 4CKJA 4IM3A 4EJNA 3GVUA 2WQEA 3R9NA 2XNMA 2GCDA 2I1MA 1NA7A 3ZHPC 1IRKA 2BRHA 3R1SA 4Q9SA 3KF7A 5H8EA 2QR7A 1OZ1A 2OH0E 4YZMA 4L46A 3NAYA 3UC4A 5IQDA 4J95A 4GH2A 4DFBA 5E1SA 4O7RA 3OXTA 4AW2A 4DGMA 3Q9WA 3TNQB 5A4QA 2BKZA 5KKRC 3OCBA 4Z16A 3AMYA 3OTUA 2XNOA 2I0VA 2XNBA 4AE9A 1OITA 5DVRA 3LQ3A 5HNGA 2VZ6A 3SGCA 3NR9A 2X9EA 3NRMA 2GHMA 3QD2B 5IQFA 3F3VA 2W4KA 2JDSA 1FGKA 3KMUA 1Y57A 3RWQA 5IMEA 3GU5A 2NPQA 4D1ZA 2XCHA 3MH3A 4R5SA 3UIBA 3VRYA 3G0EA 5A46A 2E9UA 4QMPA 4I5CA 3SOCA 1ZZ2A 4WBBB 5F20A 3F7ZA 2DS1A 3SLSA 4H39A 5CENA 3GC0A 4YZCA 3GCSA 4QNAA 5GZ9A 5LVLA 4RIYB 3U55A 2ITWA 4FKPA 4OTHA 4YP8A 5EM7A 4MVFA 2B7AA 3VBVA 3PVWA 2XRWA 4TYGA 3CEKA 2QLUA 3PLAE 3MS9A 3FBVA 1M17A 4L42A 1UKHA 5C9CA 5B7VA 2BDWA 5FBNC 3KK8A 2NNWB 5IQIA 3LFAA 3KXNA 5EFQA 1YXVA 3LPBA 4EH4A 2ZM4A 3CTQA 2XKDA 4JOAA 2UZTA 4EOPA 3SA0A 4PNKA 3BKBA 5BYLA 2HZ0A 5M08A 2OSCA 5HTCA 1DI9A 3UPZA 3FY0A 1CDKA 4FG9A 3ZDUA 4O83A 5AP1A 5CS6A 4BGQA 2WMWA 4QTDA 3FPMA 4BIDA 1Q99A 4DFXE 5ANGA 3C4CA 2XM8A 4E7WA 3KMWA 1OI9A 4IADA 1U59A 4ZY4A 4GT3A 4O0WA 4YZ9A 2UW5A 4HVDA 3R63A 2ONLA 5AJQA 2WB8A 3NUSA 5GZ8A 2XEZA 1YHSA 2OKRA 4NTTA 5JRSA 4FT7A 2R3PA 3Q6UA 3RAKA 3G33A 4I0RA 3NUUA 1PMVA 3L8VA 2WNTA 4IX5A 5D11A 2OFVA 3ROYA 3FMMA 3QWJA 3BYVA 3ZBFA 4WRSA 1XH5A 2XK7A 1PF8A 2GMXA 4HJOA 3B2WA 3RPVA 4G2FA 3R04A 4GFGA 4IHPA 2C30A 4PMPA 2VTOA 3R8VA 4KBCA 5CEMA 3C4ZA 3F5UA 4EHGA 5HG8A 4PL5A 3T3UA 1PHKA 3RHXA 3PE2A 4QMLA 4V0GB 3VBTA 4FSYA 4MBIA 4IAYA 4O27B 5FEQA 4ZLYA 2V62A 4EH6A 2RFNA 3JR1A 4NCTC 5JZJA 4O0XA 4FSTA 5I9ZA 2J7TA 4FV7A 1FVRA 4M97A 4DYMA 3EL8A 5CANA 2C3LA 4FKGA 3FQEA 2PUPA 2XB7A 3ET7A 3L9PA 4LFIA 3R8LA 4DN5A 1FOTA 3AOXA 3OFMA 4GW8A 4JRVA 5C26A 3PXRA 5HIEA 4YZNA 1ZYSA 3E87A 4CMOA 4LRKA 4R78A 5EK7A 5ANJA 3NYVA 3EHAA 4K6ZA 1O9UA 3GQLA 3F2AA 3LCSA 3O96A 3A99A 3UODA 3OTVA 2BHHA 3M11A 4HNFA 4BCMA 5J7BA 4BI1A 3B8QA 3EN4A 5HE1A 4MQ2A 3BGQA 3BELA 2G01A 2FSOX 5FBOA 5ITAA 4D2TA 2Y7JA 4FEVA 4RWKA 1OVEA 2BILB 4AX8A 2WMSA 1YXSA 3IG7A 5E8TA 4R5YA 1XWSA 4QP6A 4XP3A 3PY0A 4RFZA 3E92A 4A07A 4XG4A 3RCDA 1E1XA 1TKIA 3DAEA 3CPCA 2WIHA 3NUYA 3Q4TA 3JUHA 2J5EA 1Y6BA 5M07A 4JL9A 3DJ5A 1BKXA 5KMLA 2WMBA 3V04A 2F9GA 4G6NA 4LGHA 5IUGA 5HKMA 4FF8A 5I9XA 3UIMA 3F7WA 1REKA 5BVNA 2OIDA 1QPJA 2V0DA 5BYYA 3QTIA 5M06A 5KE0A 3QRUA 4X3FA 1B38A 3F66A 4FZDB 4AOTA 2R3NA 2Z60A 3IW8A 4JQ8A 3REPA 3TV6A 3NW6A 4O21A 2UZVA 4E8AA 2R2PA 5CF8A 4TNDA 3GC7A 2J6MA 1F5QA 3WARA 1H1QA 1H1WA 2YCSA 1PXJA 5JQ5A 4C7TA 2UW6A 2XNEA 4FKUA 4L01A 5GNKA 1IEPA 4F6SA 3ULIA 3LFBA 1H27A 3JS2A 4ZLOA 5FM3A 5AM6A 4MD9E 5HEZA 4O7WA 2JAVA 1WBNA 3IK3A 4G9CA 4I22A 4JG8A 4F9BA 4F9AA 4ZZNA 2C6TA 4IZ7A 4DTAA 1AQ1A 2YLFA 4R7HA 2X2LA 2WQMA 5EI6A 4B8MA 3OWJA 4FOCA 3EMGA 4PY1A 3DDQA 4G31A 1H0VA 4PP9A 2UUEA 2OZAA 5IH4A 3QWKA 3UOJA 3ULZA 3K2LA 3DBEA 3ZO1A 2QO7A 4GFOA 1MRUA 3GU6A 5H2UA 3PPJA 4EYJA 3P79A 4FKRA 4TT7A 4KRDA 2W06A 4MX9A 2CKQA 4K9YA 3N4TA 2JDVA 1JSTA 2E2BA 3JY0A 1MP8A 3BV3A 5EM5A 3UPXA 4EBVA 4WKQA 2WQBA 3LCKA 4OTGA 4EOMA 4IH8A 4PPAA 4I1ZA 2GNIA 2PVLA 3FXWA 3OBGA 3QTXA 5AUYA 4ENYA 5IQGA 3ORKA 3RP9A 3O0GA 4E6DA 5HG5A 2Y6MA 2XKEA 5BVOA 5ANKA 3IONA 4FICA 3BX5A 5A4EA 4E6CA 2GNGA 3P4KA 3RAHA 3QLFA 4HYUA 2C3IB 3QTZA 4RQVA 5BX0A 4FVRA 4R3RA 5GINE 2X1NA 4IDTA 5ACBC 3AQVA 4B6LA 3R6XA 3HDNA 2XKFA 4HZSA 1Q41A 3TXOA 5HICA 4K11A 1Q61A 2C3KA 1OIYA 1MQ4A 1HCLA 2PTKA 4ZTLA 4AZTA 4D5KA 4C4IA 5IISA 2VO6A 4QPAA 4BCOA 2Z8CA 4MH7A 5JK3A 2WTIA 3C1XA 5DOSA 1JAMA 2GTNA 4RIWA 2X8IA 1FVVA 1UU3A 3QFVA 4TTHB 5AMNA 2X81A 5GIOE 3MYGA 4QMTA 2JKMA 2O2UA 4FIJA 4R3CA 3AC5A 5F1ZA 3GNIB 4I24A 4KB8A 4KIOA 4NU1A 1XHAA 3KU2A 3W18A 1Q8UA 4UY9A 4AW1A 1Y6AA 3AD4A 4J97A 4ZK5A 3COMA 4D5HA 4YTFA 3JY9A 3NNUA 3DKGA 1P4FA 2ERKA 2YAKA 4HNIA 4OR5A 3HAMA 2X4ZA 4J96A 4ZMEA 4UZDA 4XBUA 5HLWA 3S1HA 4V01A 4XMOA 2BIKB 3HMNA 2BRMA 3DK3A 5HNBA 2LAVA 4FKWA 5DRBA 4NFNA 4CZTA 3H9OA 1WBVA 4GIIA 3DDPA 3U51A 5IEYA 1CM8A 3E8DA 2IVVA 2XM9A 4MXAA 4XLIA 3MH2A 3SXRA 4TYIA 5C1QB 4UBAA 2RF9A 4OTPA 5AUVA 1Q4LA 2PVHA 4LOOA 3WIGA 4IAAA 5EDPA 3RAIA 4BR3A 4ALWA 2OJGA 1Q5KA 3MVHA 4EJ7A 4AS0A 3QA0A 3ZM4A 3FMLA 5IG1A 5I9WA 3HKOA 3NDMA 2OZAB 2NP8A 1OL5A 3NNWA 3PLSA 3BLQA 3F6XA 4G6OA 3B8RA 3DNDA 2B1PA 3NS9A 2CPKE 2BR1A 2C6IA 4MXXA 5HU3A 5FUTA 4USEA 4RGJA 5CASA 1GZOA 3QLGA 3WYXA 4AFJA 3A7HA 3H0YA 4EK6A 3MB7A 1SNUA 1UKIA 4FL1A 4FT0A 5HE2A 3O8UA 4AP7A 5L2TA 2HXLA 2JFLA 1XQZA 3E7VA 1VYWA 2GQSA 3IKAA 3QHWA 3DFAA 4CV8A 1FINA 2UVXA 4OW8A 3D5VA 2FUMA 3K5VA 2CKEA 4NM7A 4GVAA 1U54B 3F3UA 4WNPA 3C4WA 2Y8OA 4XJ0A 3PFQA 4AW0A 3ZXTA 4DCAA 2C6DA 2GFSA 3K5UA 3DGKA 4IB1A 3UO4A 1CTPE 1PXNA 2QOIA 4OTFA 2QKRA 4U42A 3E62A 3F5PA 5A4CA 3NNVA 3GC8A 5K3YA 4A9YA 1NVRA 4DFUA 1ZZLA 2IVTA 1ZMUA 4AW5A 5K0KA 4S2ZA 4P90A 3ENMA 4P5ZA 2BFXA 3AGMA 3EN6A 3L9NA 4FODA 4F70A 2PY3A 5DMZA 2CN5A 3DA6A 4EWHA 4PPCA 1SYKA 3MH1A 5E90A 5AUUA 2JKQA 1M7QA 3D7TA 5M4CA 5BUEA 3LM5A 3FI3A 2FGIA 4FKSA 4JG6A 4YBJA 2SRCA 4NT4A 5AIKA 2HXQA 2YA9A 4BHZA 4OT5A 4UYAA 5HX8A 1RW8A 2VTJA 1M14A 4R1YA 4MBLA 1XR1A 4IX4A 3KULB 5CEPA 4KS7A 2YDKA 4D0WA 2AYPA 3CKWA 2P33A 3MY5A 3SRVB 2GDOA 4DH8A 2ZDTA 4EORA 1UU8A 5CX9A 3LQ5A 2PZIA 2GNLA 4RIOA 5IA5A 3SOAA 4UALA 2IZTA 3R7UA 4BBMA 4JBQA 1VJYA 1H4LA 4NEUA 5GJGA 2XCKA 4BKYA 2X7GA 2VGPA 3R83A 4TYEA 3DBFA 3P7AA 5FQDC 3MN3A 2QVSE 4ZJVA 2QU5A 3HA8A 3CD8A 4FTUA 3KRLA 4O6EA 4ORKA 4R3PA 3VF8A 3FQHA 4EK8A 3OWLA 2JITA 4RBLA 4RLKA 3VHKA 2QQ7A 3Q5IA 2JAMA 3O17A 3PJCA 5B2MA 1KWPA 2H9VA 2VO7A 5JGAA 4DE4A 1Z57A 4ZP5A 4JLCA 4OLIA 2B53A 2PVMA 3A4PA 4OAUC 2VO3A 4MXCA 2ZB1A 5D41A 3BYSA 3EFKA 4JNWA 5DR2A 2WMUA 4O0YA 3FZOA 4PRJA 4HVSA 4QYGA 3QCXA 5A4LA 1PY5A 3C0HA 2PMOX 5J5SA 2HK5A 3L9LA 3O7LB 5CT7A 3LFSA 5F9EA 3SX9A 4DF3A 3DAJA 2XA4A 3V8SA 5IA2A 4FNYA 3E3BX 4NIFB 5HO7A 2C0IA 2VTRA 4DG3E 3QGWA 4QMNA 4B4LA 3P7BA 4EK3A 1LP4A 1Q8YA 3BBWA 5BYZA 1OUYA 2EB3A 3C51A 5JFSA 3A7IA 2CGUA 4G3GA 1PXIA 5FXRA 2I0EA 3R8ZA 2J0KA 2CN8A 4KBKA 4IDVA 5CZIA 4MNEA 3GU4A 3IGOA 3MVLA 1BLXA 2J4ZA 3QUDA 4DAWA 4KABA 4IBMA 3R8PA 1HCKA 3ORMA 3IGGA 5FP6A 3TNHA 4U0IA 4F1TA 3ANRA 5GIPE 4BDEA 3GCPA 1H26A 2XEYA 4I21A 2QG5A 4ACCA 4K33A 5AV2A 4JX3A 4WG4A 3RGFA 3DT1A 4C34A 5AV0A 4RVKA 4AGUA 4BDJA 4DGGA 2B0QA 4NJDA 1LEWA 2W0JA 3DQWA 4U41A 3HNGA 3ZTXA 4CEGA 3ZEWA 4KBAA 3ALNA 1PKDA 2F2UA 5FP5A 3RWPA 3QTWA 3WF9A 4FYOA 3VRZA 4C4JA 5AV4A 4CKRA 1K3AA 3KY2A 2XRUA 1WFCA 4IX6A 3OUNB 3FKNA 2W4OA 3GGFA 3KRRA 5AUWA 3JXWA 4PMTA 5IQHA 3IDBA 3FKOA 3R0TA 4FSQA 4ZSAA 5HOAA 4D4SA 4L9IA 3R30A 5AV3A 4BTKA 4FEWA 3LCOA 4RVLA 4ZJJA 1UU9A 2ITYA 4C4HA 5E4HA 4U40A 4FZ7A 2ZMCA 4PTEA 4YPSA 5A9UA 4RG0A 4AT3A 4M3QA 4II5A 4FTNA 1XH7A 5CAVA 3ZYAA 3LFCA 4ZY5A 2HYYA 3MPAA 3KC3A 4E20A 4QD6A 4IMYA 3P5KA 4PWNA 5HLPA 4O7ZA 4C2VA 2JBOA 3EZRA 5JZNA 4R6VA 3R71A 2GPHA 3CPBA 3PE1A 2W99B 3ZCLA 4Q5HA 5CAQA 1FBNA 1SZMA 2R64A 3NYNA 4ID7A 3CD3A 4YSMA 3VUIA 4FE2A 2P2IA 2GS7A 5E91A 4QT1A 4BTFA 1YOMA 5GHVA 2ITUA 2VNYA 5JQ8A 2WHBA 3AGLA 4GVJA 3EQIA 4ALVA 4C8BA 2WTVA 5HGIA 1NVSA 2JDTA 3QKMA 2OO8X 5JEBA 3UQFA 1YHWA 4U44A 5FXSA 3Q2MA 4N70A 2XNPA 3CGOA 4WNMA 4FIGA 1APME 2CGXA 4LOPA 4MXZA 5I3RA 1BL6A 2Y6OA 3LAUA 4XP0A 3EFLA 2YIWA 3N4VA 1DI8A 2B9JA 3TUCA 1JLUE 2CKPA 3AC2A 4GEOA 4BHNA 4BZDA 2X8EA 2WXVA 3ZUTA 5JFXA 5L3AA 4S30A 2P4IA 5IEVA 3VS3A 5JKGA 4QTBA 3FDNA 2VWYA 4F7JA 4F0FA 4IB0A 3WZEA 3U9NA 4V04A 1SMHA 4RRVA 4ZZOA 4YJOA 1KE8A 5DEYA 4TYHA 4F63A 4DFZE 3Q2JA 2R5TA 2W7XA 2VWBA 5AR2A 4JAJA 4L53A 4RQKA 3AT3A 4ZS0A 3HV7A 2ETMA 2R7IA 3I79A 1QL6A 3A2CA 3EQFA 4I93A 2PWLA 2R0UA 4IX3A 4BN1A 4DH7A 3WOWA 2EB2A 3BLHA 4EWQA 4NUSA 3BQRA 3TDWA 4M66A 5FM2A 3GOPA 4BCPA 3DLZA 4YGAA 3NUPA 4FTOA 4TYJA 3TIYA 2XMYA 4DGOA 2RL5A 2UW7A 4YJPA 5HCYA 4ZTMA 2CMWA 3L1SA 2VWZA 4UZHA 4YLLA 5AV1A 3VW8A 2C4GA 2A2AA 3HDMA 2OK1A 3WE4A 1ZXEA 2VWWA 2BTRA 1KOAA 3KXGA 3FI8A 1H1PA 3QCYA 4ITHA 5AR8A 2XIXA 2PULA 3PIYA 2C5XA 5IQEA 4QP2A 4YLKA 3RPYA 4HVIA 3G15A 3ZZWA 2PVRA 3MPTA 2PMLX 1VR2A 1KV1A 2BZHB 4HPTE 2XBAA 4DLJA 2A4LA 3OHTA 5IA4A 5KMIA 4KA3A 5ANOA 4ACDA 1GNGA 1H08A 1ZY5A 3KCKA 3V5QA 5K5XA 2R3GA 2X4FA 4BICA 2Y4IB 2GS6A 4PP7A 2Z02A 4LV5A 1KE9A 3D5UA 4N0SA 4WUNA 3LVPA 3LLAA 3A7JA 3A60A 4U81A 4I6BA 2WELA 4X2KA 4M67A 2EUFB 5IKWA 3CXWA 4JAIA 3Q3BA 4FTMA 4WOVA 5CZHA 2C5YA 5HHWA 4F6WA 4BBFA 1NVQA 5B0XA 4C4FA 4WG5A 4JR7A 3WE8A 3E88A 3PIZA 5EM8A 4D2WA 4FI1A 2KULA 4M14A 4AQCA 3NLBA 3HL7A 5M57A 4HGLA 4Z3VA 2ITXA 3H3CA 3QBNA 2A1AB 5JFVA 2Z7LA 3RK9A 4IACA 2C0TA 4FR4A 4D2VA 5K9IA 1IA9A 5AR4A 2HWOA 3PJ1A 3MGYA 4DFNA 3KREA 4CT1A 3VQHA 4GJ3A 3UOKA 3QGYA 3R7YA 3NWWA 4TZRA 3LFNA 3PA5A 3PTGA 1UA2A 3L8XA 3G9LX 4XRJA 3IECA 3RHKA 2XIRA 4JDKA 4UYNA 3SC1A 3O8PA 2I6LA 4E4LA 3U6HA 3UNKA 3QYWA 5EM6A 5JT2A 3VO3A 2QOOA 4KWPA 4ANLA 2Y9QA 1U5QA 4GUEA 5E8UA 5A4TA 2UZNA 3MFRA 3NUNA 4HCVA 5I0BA 2XK3A 4FKVA 3QRKA 3E64A 4PTCA 4RWLA 4FKTA 4G5JA 4IVDA 2VV9A 3IPHA 3BLRA 2ZV7A 4QYFA 2WOTA 2OG8A 3KK9A 3BGPA 4TYHB 5TO8A 5DHJA 4MHAA 4OTWA 4DEIA 1OGUA 2QURA 4AZSA 3OT8A 2UW9A 3QTUA 4JS8A 3F61A 2YM6A 5AA9A 3QC9A 4A9TA 2C6LA 4FNZA 5EOLA 5M4IA 3O51A 1GZKA 4P4CA 4XEYA 3C5UA 4I5PA 4EEVA 4NWMA 3MA3A 3KN6A 4FK3A 4BWPA 3LLTA 4G34A 5FGKA 1CMKE 5IZFA 2ZAZA 3FSFA 3OG7A 1DAYA 3DZOA 5J87A 2C6EA 2B9FA 3I4BA 4FT3A 4M13A 5AP4A 5AR7A 2RFEA 3W32A 4QP9A 4FTTA 1ZMWA 4G3DA 4DEHA 2J0MB 4K8AA 4RT7A 3TTJA 4EBWA 3COKA 4ZXTA 4CKIA 3OEZA 2P3GX 3DTWA 1V0OA 2QU6A 2FSTX 3PSCA 2QKWB 4FV0A 2IVUA 4KD1A 2ITVA 3EIDA 1FMKA 5JN2A 3PPZA 1Q8WA 3UVRA 1ZRZA 3KQ7A 2I40A 1U5RA 2IN6A 3EWHA 3L8SA 3LXLA 2YM5A 4C3RA 2YWPA 4IWQA 1F0QA 4CLIA 1R78A 4JT3A 1Q3DA 3PXKA 4AF3A 3ID6C 4RX8A 2NO3A 3FV8A 2VUWA 4GU6A 5J8IA 3QQHA 1BL7A 1WVXA 4I6QA 3PXZA 1YXXA 4MBJA 2WKMA 3LCTA 4W4VA 5E8VA 2YCFA 4J8NA 5EOBA 2X2KA 4APCA 3QF9A 4KIQA 4ANBA 5M55A 1SVEA 5HD4A 2E9OA 3ERKA 1YI3A 3C5IA 3LOKA 2R3LA 2O65A 4U7ZA 4G1WA 1PRYA 1X8BA 3TG1A 4DGNA 3A4OX 4GG5A 4K77A 2ETRA 3V6RA 4DEAA 3PG3A 3E8CA 2R3KA 1M2RA 3FZTA 5AAGA 2QCSA 3D2KA 4IWDA 3RMFA 3R7GA 4IEBA 5F4NA 3ZOSA 3RM7A 2QOLA 1Z9XA 3A62A 4FV9A 4YJSA 5CVFA 4RVMA 5HI2A 3KXZA 3VBWA 2Q0BA 4DG2E 3KRJA 3CTHA 1QPDA 4ACGA 1EH4A 4A7CA 2IJMA 5EW8A 3RBWA 2OFUA 5GZAA 4KIKA 1J1CA 3CSVA 5AX3A 4CG9A 3OOGA 4A4OA 3R28A 2VWVA 1LEZA 1W8CA 1WBSA 5HVYA 5LWNA 3R9RA 3VF9A 4ZSEA 4BBEA 3COHA 3W16A 4YJRA 3PVBA 4D2RA 5HU9A 2BIYA 4RC3A 1XBBA 4BYIA 5HE0A 3BRBA 4IJ9A 1FQ1B 5IUIA 3TCPA 1H28A 4W9WA 3ZC6A 4D4YA 2QLQA 4AN2A 4NTSA 1W83A 4QMYA 2BZIB 3EN5A 4O0TA 4TRLA 5DT0A 3EQHA 5ACKA 5DYJA 4E5WA 3TV7A 3PJ8A 4L3JA 2W4JA 4F65A 3PPKA 2CNUA 4TN6A 2IW9A 5AA8A 3NUXA 3VW6A 3GC9A 3OWKA 3FLZA 4HOKA 5KHWA 3H30A 3VUTA 3W2OA 2OZOA 5BMMA 3OXIA 3ZH8A 4UMTA 3AC3A 4OT6A 3V5WA 2VN9A 2XNNA 4CFNA 4E5AX 4FZFB 4CYIA 3F82A 4YURA 5JGBA 4H3BA 1KSWA 3Q4UA 2VO0A 3R7EA 2I0YA 3FKLA 4F1MA 3R00A 3BYUA 4FNWA 4O2ZA 3ACKA 4O0UA 2W1DA 3DV3A 4G3CA 3VS7A 4A9SA 3GENA 1RDQE 1W98A 2YCRA 4ANQA 4F9CA 1PXLA 3Q9XA 4BCHA 2C5OA 1RQQA 4CT2A 1OB3A 2XBJA 2FO0A 2V5QA 3I6UA 1A9UA 4ZTNA 4FSUA 3F2RA 3SV0A 2WU7A 3PSDA 3LJ1A 2WMXA 1H1RA 2BALA 4CFXA 5HORA 5J79A 3G51A 3UOLA 4CFFA 4RSSA 3C4FA 5EI2A 3EQCA 1ZY4A 3BIZA 2HZ4A 4L7SA 4JIAA 5AWMA 4CCBA 5C8NA 4RC4A 3F3TA 4QP4A 4BIEA 3K3IA 4H1MA 4XP2A 4TY1A 1KE5A 5DIAA 5E8XA 4AE6A 3OY3A 4FMQA 4EK4A 1IA8A 3TV4A 4Y8DA 1NXKA 4XG8A 4I4FA 3EQBA 3QL8A 5JSMA 3AD5A 4LYNA 5KMMA 3NSZA 4X7QA 4ANSA 2PZPA 2UW4A 2OXYA 5BVDA 1WVWA 5CSVA 5AR5A 4FV2A 4MEDA 3VBYA 4R1VA 3SKCA 5EHYA 4I5MA 3CJGA 4YTHA 2YERA 1FPUA 4DEBA 1FVTA 2DYLA 2BAJA 3EYHA 2WZJA 3DS6A 3EFJA 3MSSA 3UE4A 1GJOA 2WAJA 2EWAA 1LPUA 3IW4A 4FT9A 4ZLZA 5J9ZA 4MNFA 4HGSA 4BCJA 4E26A 2F4JA 3NUAA 5EW9A 1A48A 2C0OA 1DM2A 4PDYA 3P78A 3ROCA 2WTDA 3W2SA 2WEVA 3QTQA 3COIA 2XNGA 3BHYA 4AOIA 2VTHA 4EOSA 3NEWA 5H8BA 3LJ2A 4C2WA 3DJ7A 3UP7A 4O7YA 2VRXA 2W1IA 3FLSA 3FZPA 3IOPA 3FHIA 4NM5A 3VUDA 4A06A 5HO6A 4ZY6A 2V7AA 3T3VA 2XF0A 5LMBA 4FTJA 4DH5A 4CLJA 3GBZA 2F49A 2XK6A 3ZFMA 5CXZA 5LVMA 2JKOA 3NCGA 5L6PA 5IDPA 3FYKX 3RPSA 3DBCA 4OGRA 3A7GA 1Q8TA 4CNHA 4FTIA 4EYMA 4KUJA 2ZM3A 3ORTA 1UU7A 2ZB0A 1OIUA 3QC4A 3FLYA 3EZVA 5DNRA 4C38A 3UNZA 3U54A 3VAPA 3DLSA 4XV2A 3U9CA 1AGWA 5ANEA 4G5PA 1CKIA 3ANQA 2UZDA 5C8KA 4J7BA 4XOYA 1TQPA 3DB6A 4TWNA 3ORIA 1SM2A 4CZUA 4ITIA 1XBCA 2QC6A 1OM1A 4I92A 1E9HA 3LFEA 3O71A 4GMYA 4JDJA 4NZWB 5CSHA 4YHFA 4KNBA 1OKVA 3BYOA 2X39A 4UWCA 4YUQA 1OECA 3W2PA 1F3MC 2XS0A 3I7CA 4TWOA 2QO2A 4QPSA 3GI3A 3WF8A 1GIIA 3BCEA 5KMOA 4D9UA 3HVCA 3IW6A 5D7VA 1UNGA 4IAZA 3FLWA 3AMAA 4RX7A 3HAVA 4ZIMA 3VS1A 3QZIA 4XYFA 4C35A 4FG8A 1Q24A 3FXZA 3EQGA 3S3IA 4B8LA 4R7IA 1H01A 5FLFA 2IW8A 2YABA 1V0BA 4LM5A 3FLQA 2ZV8A 4DFYA 4RWJA 4K18A 4FL2A 4X3FB 4GJ2A 5IH5A 5FTGA 1IAHA 4DCEA 2HY81 2QHMA 4IFGA 5FEDA 2KTYA 2I0HA 3FLNC 4G3FA 4LQMA 4PMMA 4F7SA 2OI4X 3F9NA 5H3QA 4LI5A 4EOQA 5CSXA 2PVFA 3UQCA 2C1BA 4D1SA 4R77A 4BDBA 4C62A 4LUEA 2UZBA 1M52A 4C37A 2G9XA 3AT2A 3C4XA 3DU8A 5K4IA 5HG7A 4WNOA 3S00A 4AN3A 2J0JA 3FI4A 3RJCA 3ZC5A 4RJ4A 2WEIA 3RNIA 3TN8A 3UP2A 4FSMA 3OMVA 1OIQA 3A61A 4X2FA 4TWCA 2ITPA 5IUHA 4BB4A 1BI7A 2W5AA 3G5DA 4CRSA 3FEGA 4NFMA 5JFWA 2VTQA 3F3ZA 4DH1A 2YN8A 1H00A 3ZXZA 1BYGA 4DT9A 3HRBA 5IQAA 4H36A 3QYZA 1XH4A 2F7EE 4I6HA 3P7CA 2C6KA 5HX6A 4ZEGA 5KHXA 3FZRA 2ZVAA 4WBOA 3R8UA 3NAXA 4X6RA 4FGBA 4L67A 3ZEPA 2W1FA 3P9JA 5CALA 4HVHA 4L00A 4GV1A 2OXXA 4U43A 5CI7A 2A19B 4EKKA 3D83A 2VWXA 2CNQA 3QKKA 4JG7A 3E8NA 5HTIA 2YWVA 3MIYA 3UZRA 4PDPA 3IDPA 4PX6A 3BEAA 4CG8A 2G2HA 5IDNA 5CEQA 1CSNA 4YLJA 5HG9A 3LE6A 4FV8A 1DS5A 2VNWA 3G6HA 1OMWA 4L52A 1G5SA 3GP0A 3W2QA 3VHEA 4AGCA 4RX9A 4U3YA 5FDPA 4FX3A 5M44A 2UVYA 4L7FA 4CFUA 3DFCB 4F0GA 4FTRA 3NYXA 4K0YA 2JDRA 4J98A 3AC8A 5BVWA 4X0MA 2FSLX 2RIOA 2UZUE 3NX8A 2NRUA 4C61A 4FEUA 2JGZA 4H3PA 1V0PA 3C13A 4W8EA 3CQEA 1UV5A 3H9FA 3F69A 4FSNA 4XG9A 3ZO4A 2XKCA 4U45A 3UMWA 4ANOA 4J8MA 2A0CX 4WIHA 5KO1A 3S95A 2ETKA 5DLSA 4BZNA 3QUPA 4FZAB 4QYYA 4PDOA 1OKWA 4ACHA 2JC6A 5CF5A 4RIWB 3V6SA 5CXHA 2XP2A 3ORNA 2Q0NA 4BCKA 4XBRA 2YAAA 2I7QA 2W1EA 2O8YA 2X7FA 4O0VA 5CY3A 3O8TA 2BHEA 2QOFA 3FAAA 3QRTA 1I44A 4GIHA 2EXEA
chains in the Genus database with same CATH superfamily
1JVPP 4C33A 5BVFA 3UYSA 3U6JA 5EKNA 5HESA 3ZFXA 4S33A 4X2GA 3MIAA 4AA5A 4X21A 3OROA 5CEIA 5HCXA 4CQGA 5J5TA 3I1AA 1IASA 4AZFA 5FXQA 4FUYA 3TNPC 4BVUA 3EYGA 2O64A 4X3JA 4BKZA 4MAOA 4BKJA 1PMUA 5KMJA 2PPQA 2VTNA 1O6KA 3CP9A 3M42A 3GU7A 4QMZA 3CE3A 2XIKA 1PMNA 3I60A 1REJA 4UX9A 4M84A 3WZKA 3PVGA 4QPMA 3MFSA 3HV5A 1WMKA 1YWNA 5LMKC 5FRIA 4S31A 3V5PA 4FNXA 1J7UA 1Z5MA 1H1SA 2BROA 4MXOA 4A4XA 2IW6A 2RSVA 1G8AA 4EQUA 2CGWA 1LUFA 2ITNA 2YM4A 3IOKA 4CYJA 3B2TA 3OZ6A 5HD7A 4TW9A 3HEGA 4O1PA 4ASXA 4JJRA 2RG5A 2XK9A 3WF6A 2ITOA 4NSTA 4AACA 4UWBA 3HMMA 3SQQA 3D5WA 2H6DA 2O3PA 3TZ8A 2YISA 2EXMA 2PSQA 2CKOA 4GYIA 5DR6A 2YDJA 4DBNA 2QODA 2WTCA 4PL4A 5KNJA 1PXMA 5LVNA 4IW0A 2ONLC 3P86A 5K0XA 2E9NA 2XZSA 4CMUA 4E5BA 5EW3A 2PUNA 3VVHA 3RZBA 3WZUA 2VU3A 4GT4A 2OJ9A 3FJQE 4E4NA 3R73A 4EHEA 2YACA 2BDJA 2JIIA 2AC3A 4LMNA 4FEQA 3RM6A 3ZRMA 2ZJWA 3HGKA 5KUPA 4USFA 1R0EA 1YWRA 5GJDA 4NCTA 2CNVA 1KE6A 3D5XA 2W05A 2XUUA 3PUFC 3D4QA 2UW3A 3AKKA 1UWJA 2OJJA 2PE0A 3FL5A 1W2DA 4AAAA 4B0GA 3ALOA 3FMDA 1OL7A 1Q8ZA 5KKRB 4D55A 4JI9A 4IZ5A 3I7BA 3ZS5A 2B9IA 4X6QC 3OS3A 4JVGA 4A9UA 2QD9A 3Q53A 4EOJA 5CQWA 3PXYA 4C58A 1WBTA 5B2KA 3VNTA 3OVVA 4DGLC 4U79A 5EQEA 4RWIA 3QKLA 5FEEA 2W1HA 2PYWA 4O38A 3HRCA 2JIUA 1YWVA 5ICPA 3NIEA 2IEWA 1UWHA 4OTDA 4D4RA 3PWYA 5CSPA 1P4OA 2WMAA 3HUCA 3MDYA 4QMOA 5AR3A 3D7TB 3T8OA 4PPBA 2BRGA 2HAKA 3ZZEA 4CV9A 3P0MA 4I41A 4NM3A 4YJTA 2QONA 3UIXA 3W8QA 5L4QA 3ATSA 2ACXA 2JEDA 2WMVA 4G6LA 1W0XC 3FMHA 4KSPA 4FK6A 1OKYA 1BX6A 3VUHA 3RVGA 5CU3A 3LZBA 5CVGA 4FIEA 4YZDA 3BQCA 1ZLTA 5L8KA 2DWBA 3DB8A 3QTRA 3D9VA 2VTSA 3P1AA 5CWZA 1O6LA 3LJ0A 4BCQA 4D28A 4YMJA 2B9HA 4HCTA 3TJCA 4IB5A 3DOGA 3VWAA 3LKMA 3RINA 2PHKA 3HV4A 4EH8A 3EQDA 3FHRA 3LIJA 1ZWSA 1XO2B 3LCDA 3MWUA 1J7LA 4C59A 2ERZE 2Q83A 4XH6A 1PYEA 3QZGA 3SD0A 1WBWA 5E7RA 4BFMA 3FL4A 4BDFA 2WQOA 4Q2AA 4ENXA 3KL8A 3UOHA 4X3FC 1YXTA 2YJRA 1DAWA 4EHVA 2VTLA 2PE2A 1VZOA 3QHRA 3AC4A 5I9UA 5CAOA 5HO8A 4J99A 5EDQA 2QOHA 3R1QA 5D7AA 3V5JA 4KS8A 1OL6A 3FUPA 4JQ7A 2YIRA 4GK3A 3MTFA 5CAUA 4GU9A 3PG1A 4Q9ZA 3ZRKA 5I3OA 3VUGA 3C9WA 2H8HA 3R7OA 3DBQA 3QXOA 4MKCA 1G3NA 4BCNA 2DUVA 2R9SA 5AP0A 3Q04A 4DHFA 4DHJA 3BHVA 3R22A 1R3CA 2PUUA 2R7BA 4HYIA 4F4PA 5HLNA 4MXYA 5IQCA 3NZ0A 3H9RA 4AN9A 4BL1A 2VTMA 3GUBA 3HMIA 4FSRA 2J90A 4ZOGA 2PMIA 3TNWA 2PVNA 2RG6A 3CGFA 4Y73A 2XH5A 3NNXA 3QZHA 3LFDA 4O7NA 2VTPA 4ZMFA 5A14A 3VN9A 3SG9A 4EOOA 2W9ZB 1OPKA 3C0IA 3MTLA 4W4WA 1VEBA 2R4BA 3F5GA 4MNEB 3BWFA 2PE1A 5DPVA 4O7TA 1W84A 1BMKA 4AFEA 4PTGA 1JSVA 2J9MA 3VJNA 4AGWA 4YNEA 2W1ZA 1UNLA 4F7LA 1XBAA 4O7VA 3R2YA 2A27A 4DHZA 4Z55A 4UWYA 3GFWA 5B2LA 4WSQA 2OW3A 5J9YA 2PZYA 4HYHA 3VUMA 4Z9LA 3BE9A 3LMGA 3QQLA 2WFYA 1OL2A 1P5EA 3RAWA 3TNIA 4NJ3A 4XCUA 2WQNA 5DN3A 4ZS4A 4QQCA 3QRJA 4BDAA 4I3ZA 3BU6A 5D12A 2GHGA 4RVTA 3KVWA 3L9MA 5LWMA 3FZSA 2OIBA 2PL0A 3PSBA 1S9IA 3KXXA 4FTKA 4G17A 4B9DA 4EQMA 4QP7A 1FMOE 5DT4A 4MQ1A 4UXLA 4CGAA 4FIIA 4FTCA 4M0YA 5LMAA 3RALA 2YM7A 3IS5A 3DCVA 2OXDA 2Y0AA 4JRNA 1YI6A 4RZWA 1R1WA 5CI6A 2PZ5A 3VS0A 2IVSA 4PV0A 5AP6A 3RK5A 4BC6A 5L8JA 2YIYA 4L45A 4H3QA 4C3FA 4DEGA 4WHZA 5IA0A 5IU2A 4B7TA 4RIYA 2HOGA 4RJ6A 3MFUA 4IJPA 4CTBA 4U80A 5IEXA 4TKSA 4YC6A 2XYNA 3UIUA 3MH0A 2HZIA 3EH9A 5M4UA 3ZSGA 3G0FA 4QTCA 4QNYA 3E5AA 4AT4A 4BTMA 5M51A 5EYMA 4BF2A 3UQGA 1JPAA 3P08A 4KSQA 5DG5A 5J95A 2GSFA 3ETAA 3SDJA 5AFVA 1M2PA 1GOLA 3WIKA 4BDGA 4EH3A 5KMNA 1AD5A 4U6RA 3AT4A 4O96A 4DEEA 3GCUA 1YRPA 3BI6A 4C57A 3BHUA 3QQKA 1I09A 1PMEA 4GG7A 5BUIA 3Q96A 4BDIA 1E1VA 4BGGA 4H58A 3VULA 2RKUA 3KRXA 3QQGA 3QD0A 4IWOA 4ZAUA 2H34A 2JIVA 4BJJA 1YDRE 3PA4A 4CXAA 3UMXA 2JD5A 4QQ5A 4WA9A 3Q9ZA 4QTEA 4O4DA 3TDVA 3R21A 4JR3A 4NKSA 3P5JC 3HZTA 2NRYA 3RK7A 4E1ZA 5J7HA 2Z2WA 2HENA 4LL5A 4DBXA 3E7OA 4ITJA 3R9DA 1ZYCA 4EC9A 3V8WA 2VGOA 3PRIA 3DTCA 5KBRA 2WTWA 3CLYA 3CKXA 1PJKA 2BCJA 3ZDIA 3OCGA 5ETFA 3OT3A 2GFCA 4AT5A 2BAQA 3ODZX 1STCE 3VBQA 5BVKA 2W9FB 1R0PA 4W4XA 3HP5A 3WF5A 3V51A 4ACMA 3Q52A 2WTJA 4D0XA 2XJ1A 5LJJA 3IW5A 4OBOA 2OJIA 2X7OA 3TKIA 4D9TA 4O86A 5LVPA 4AZEA 3EN9A 2HY0A 1KUTA 4WSYA 3C0GA 4BDCA 1TQIA 4ALUA 3CJFA 2X0GA 2PVYA 5AUXA 4Y95A 2X0PA 3BU3A 3DXNA 2FB8A 3BHHA 2FSMX 3W2CA 5HIDA 4RPVA 1H0WA 2QOCA 1KOBA 2R3FA 2E9VA 3R9OA 3EN7A 3LM0A 3PFYA 1G8KA 4GYGA 2XIYA 3N4UA 3W8LA 1YW2A 2HELA 2Y4PA 3KXMA 5A54A 3BHTA 2WD1A 3RPOA 4D2PA 1KE7A 3A7FA 3Q6WA 3R1NA 2IPXA 3WYYA 3II5A 3PXFA 5EHLA 4BZOA 5AEPA 3I81A 5BMSA 2XK4A 2YITA 4GCJA 1URCA 1WZYA 3LXPA 4BCIA 3OC1A 5CNNA 4ASEA 5DBXA 5CF6A 3RTPA 4FT5A 4KAOA 1LR4A 3HECA 4QP1A 5AP5A 3FZ1A 4RJ3A 4J1RA 2C3JA 1H24A 1HOWA 4R8QA 4XRLA 3UTOA 3ZLWA 2VTAA 5EG3A 3K54A 2WTKB 4L6QA 3P23A 3LMHA 2ESMA 4IANA 3AMBA 4USDA 3OD6X 3W0QA 2PVJA 3EQRA 5BNJA 4P5QA 5F95A 4O2PA 3E3PA 5LMKA 5DEWA 3EKNA 4D58A 1K2PA 4KKGA 3MJ1A 3OP5A 3T9TA 5DR9A 3TWJA 3FMJA 3LW0A 3OCSA 5FTQA 3ZO3A 4XG6A 5ETIA 3GXLA 3PDTA 3W55A 2R0IA 3A8WA 3UJGA 4GRBA 3KF4A 5E8ZA 4BCFA 3F5XA 4ARKA 2HZNA 1W7HA 3GCVA 4QTAA 2F7XE 5TE0A 3CY2A 4YNOA 4DFLA 4YU2A 4JMQA 2GTMA 3POOA 3L8PA 4IVBA 2J50A 3QUEA 5H8GA 1JNKA 2YM8A 4QMMA 4EUTA 4Q5EA 3E93A 2YM3A 4FL3A 2AC5A 2GQRA 3KCFA 4E4XA 4XNEA 4TL0A 4I6FA 3CIKA 4RA5A 5CU6A 4CMTA 1CKJA 1YXUA 3W1FA 3POZA 1MUOA 3ITZA 1ZAOA 4FV3A 3RZFA 3RPRA 4HW7A 3SW7A 2QG7A 5L2QA 2J5FA 2B4SB 2E9PA 4M69A 1JWHA 3FC1X 4XV9A 3W33A 4CFWA 4E93A 4EH7A 3TJDA 3HYHA 3PZHA 2X6DA 3FPQA 3MVMA 4EOIA 1OIRA 2GHLA 3EQPA 4ZTRA 5HVJA 1YQJA 3MPMA 4RZVA 4IZYA 3O50A 5CQUA 4CTCA 5DFPA 2UVZA 3QAME 5BUJA 5HNIX 3UDBA 4YJQA 4G16A 5E92A 3VQUA 3PJ2A 1CKPA 3ORLA 4S32A 2X2MA 5GJFA 5EQPA 5JGDA 1MRYA 4DT8A 4RJ7A 4OBQA 5L2SA 2BAKA 2BMCA 3HUBA 4WUAA 5HVKA 2C69A 3F88A 4LUDA 4QMVA 5TR6A 4AWIA 4N57A 1H07A 1UNHA 3GU8A 4LRJA 4ZSGA 3TIZA 4E3CA 4I0TA 4WD5A 5EDRA 3WI6A 2YDIA 4CCUA 4YTCA 5BVEA 3WZDA 4FG7A 3VS2A 3ACJA 4AAYA 4N4SA 4IFCA 4F9YA 4QP3A 3AC1A 2QNJA 2Z7SA 4K2RA 1RE8A 3PA3A 1PKGA 5E8WA 3SHEA 3EJ1A 5AP7A 4FEXA 2QO9A 3SVVA 1MRVA 1GAGA 2XVDA 3GB2A 5T3QA 4AG8A 5LXMA 3UO5A 3RKBA 1OBGA 3MY0A 4EUUA 4IIRA 2CGVA 3EB0A 2WMRA 3GOKA 3O2MA 4O84A 4QQTA 1XH6A 4IC7A 3ZMMA 3DJ6A 3ORZA 5LARA 2BKKA 1G8JA 2UW0A 1W82A 2G2FA 3W0PA 2JDOA 1T46A 4D2SA 4WNKA 3TUBA 4FIFA 3PRFA 3U8WA 3MW1A 3VJOA 4DINA 3O7LD 1WAKA 5D1JA 1R39A 1UVRA 3WILA 3UVQA 4GK4A 4JBVA 5IF1A 3S0OA 4O7SA 3SXSA 3NPCA 1BUHA 2VTTA 4W8DA 2G2IA 4FTAA 4IQ6A 4XG3A 4TXCA 4BI0A 5BPYA 5HBJA 4TNBA 2JFMA 3PWDA 4AQKA 2R3MA 2C47A 4M15A 4QOXA 3BE2A 2Y4IC 4HGTA 3UO6A 3DAKA 2PMNX 4EH2A 1JBPE 4RJ5A 3E63A 4FV1A 3FWQA 2R3JA 4O0RA 4PL3A 4IM0A 3ATTA 1ATPE 1U4DA 4JBOA 4LG4A 4YBKA 3OW4A 3R9HA 4KIKB 2WGJA 3FSKA 4MTAA 3I0OA 4U3ZA 3UNJA 5EH0A 3D94A 4HZRA 4EHZA 4CVAA 2C6OA 3DNEA 5G1XA 3LFQA 4AA0A 1TVOA 4C4EA 4NK9A 2FH9A 3ODYX 1L3RE 2OICA 4FTQA 4IXPA 4N6YA 4X2JA 3UZPA 4XLVA 3ORPA 3R7VA 5IMXA 1J3HA 2X9FA 4M68A 3SXFA 3DXPA 2ZYBA 4ANMA 4FOBA 4QQJA 3GEQA 2W5BA 4F6UA 3OOMA 4J53A 3BU5A 4LMUA 3I5NA 4HGEA 4FKJA 3GFEA 2UZOA 4IVAA 5A6OA 4M69B 4IVCA 5DT3A 3VS6A 4EH5A 1QMZA 5AAFA 1T45A 4FC0A 5M53A 3QD3A 4DHIB 3QD4A 4QMXA 3OWPA 3CS9A 3QX4A 4HYSA 4XUFA 5ETCA 1YKRA 2LGCA 4WO5A 3UVPA 3NW5A 2OF4A 4M12A 2J0IA 3TEIA 2GNHA 4I20A 5I4NA 5M09A 2BVAA 1S9JA 3IQ7A 4LRMA 5CU4A 2IG7A 2O0UA 3R02A 5IH6A 1J1BA 4J71A 3GCQA 3MV5A 3MESA 4U5JA 4GS6A 1IAJA 1GZNA 4DTBA 2QI8A 2IZSA 2FVDA 5KX8A 2IZRA 2YIXA 4V05A 4A4LA 3UYTA 4F09A 4MYGA 1ND4A 4C3PA 4FKIA 2J0LA 4CD0A 5KCVA 4QYHA 3UDSA 3DPKA 4FV4A 2GS2A 4E73A 4F0IA 3CTJA 4PMSA 3PJ3A 2DQ7X 3OUKA 4YO4A 1P2AA 4LV8A 2VX1A 1U54A 3KRWA 5L6OA 1IR3A 5LOHA 3CQUA 4RLLA 4MCVA 1FGIA 2CLQA 3KMMA 2Z7QA 3EL7A 1QCFA 2W1CA 5TF9A 2OLCA 4QMWA 4UMPA 3F2NA 2QOBA 4PDSA 4JIKA 4IAFA 3Q5ZA 1GZ8A 2OU7A 4I5HA 5FG8A 3UG2A 4YC8A 4LV7A 3G9NA 3VBXA 2YFXA 3R1YA 4P2KA 4U9AA 5EYKA 3TKUA 1YDTE 3CCNA 3D7ZA 3E8EA 3TKHA 5CLPA 4O7LA 4JXFA 3FYJX 3ZU7A 5K5NA 3LMIA 3LQ8A 4U8ZA 2YJSA 2F57A 3IDCA 4G3EA 1XKKA 5FWKK 4O82A 4LGGA 5T6KA 5JMSA 1URWA 3RI1A 5DH3A 5CEOA 4YTIA 4D1XA 4P7EA 5CVHA 1J7IA 3KXHA 3KULA 5FTOA 4EC8A 4IAIA 5LQFA 2CDZA 4BIBA 3ELJA 3QQFA 3SRVA 3TTIA 4XV3A 5M56A 3TL8A 3DK7A 3Q60A 3R01A 4OAVB 3D15A 2UZEA 1YHVA 4L43A 1JKTA 2WTKC 1QPCA 3AXWA 4ZTSA 2ITZA 3UBDA 4F9WA 4DA5A 3ZFYA 3CY3A 3QALE 5A3XA 4QRCA 5CSWA 5HCZA 4DH3A 4LDTA 3Q4CA 3CBLA 2BTSA 4RIXA 4DLIA 1WVYA 4AOJA 5IA3A 4B99A 4AXAA 3LFFA 2RFSA 2RFDA 3G6GA 1GIHA 5HZNA 4IB3A 3PIXA 2XYUA 5CEKA 1TZDA 3OF0A 2O5KA 4MF1A 4TWPA 3ZUVA 4UXQA 4ANNA 2ZDUA 5ANIA 5K4JA 3HLLA 4ZTQA 3ZSIA 5C8MA 4FSWA 4M7IA 2XIZA 4NYEA 2B54A 2HIWA 5I9VA 1H8FA 1A06A 4KKHA 3ZM9A 3HMOA 2RGPA 2PZRA 4BI2A 4BTJA 4E6QA 1ZYDA 1U46A 4Y46A 4EK5A 3T9IA 2R3OA 2C5NA 4FBXA 4YZBA 3TT0A 3TZ9A 5AP2A 3Q9YA 1ERKA 4QMSA 4XV1A 5CTPA 4EZ3A 3DQXA 3IW7A 1TQMA 2B52A 2HW6A 2IO6A 2BUJA 4EOKA 1ZYJA 4NIFA 4CFVA 2XK8A 3FC2A 3QXPA 4OTIA 1Y8YA 4EQCA 4A9RA 4UV0A 5HE3A 5KMKA 4IE9A 2PUIA 5DA3A 3QCQA 3D2IA 5HTBA 1ZMVA 1YOLA 5G6VA 3TYKA 3FXXA 2H96A 3R2BA 3AD6A 2JLDA 3KGAA 5IA1A 4ERWA 1BI8A 4BDDA 4Z7GA 5E8YA 3MI9A 3WF7A 3JVSA 4CFMA 3HV6A 3ZLYA 1NT2A 4PQNA 1VYZA 5KZ0A 4JQEA 1M7NA 5C01A 5TOZA 1NY3A 2BRNA 1JKLA 4AA4A 2HW7A 3OEFX 2QOKA 4WG3A 3SW4A 3V3VA 2QR8A 3ZRLA 4KIPA 4OTQA 3U6IA 3PY1A 2FYSA 2BZKB 3S4QA 4E6AA 4FUXA 2PVKA 4ZSJA 4GKIA 2WMTA 4FZ6A 3I6WA 1G8SA 5AX9A 4I0SA 5EKOA 4AGDA 5HBHA 3W2RA 5JRQA 5C4KA 5C4LA 4QO9A 2W96B 3BZ3A 4EONA 2BFYA 5FD2A 2X8DA 4YO6A 1V1KA 3EKKA 4PNIA 3DKCA 5L2IA 4PF4A 4TPTA 2GNFA 3VS5A 4AU8A 3BYMA 3QQUA 4O0SA 4FIHA 4IM2A 2CLXA 3N9XA 5L6WL 3OW3A 4Z7HA 3VIDA 4N6ZA 2F2CB 1YVJA 5J1WA 3KB7A 4OBPA 1Q97A 3NYOA 3CQWA 1XH8A 4JX7A 4ONAA 4RMZA 5JH6A 3QQJA 3D0EA 1JOWB 1PXKA 3N51A 2CHLA 4FA2A 1YOJA 3UGCA 3THBA 3FQSA 3TUDA 4QYEA 4XOZA 4MK0A 4RIXB 4Y83A 3BPRA 3I5ZA 4YJNA 5ETAA 5EYDA 2FA2A 5AM7A 4EL9A 2UV2A 3HMPA 3GT8A 4FVQA 4UMRA 3ZBXA 3LXNA 4ZZMA 3PVUA 3DZQA 3FMEA 2YLEA 3MB6A 4QMUA 4YJUA 3MY1A 2JBPA 4WT6A 5HBEA 2G15A 2B55A 4GT5A 4DTKA 2XJ0A 4DG0E 2GU8A 4NL0A 2IWIA 3R7IA 4DITA 5AUZA 5D9HA 4BGHA 2ZV9A 3KFAA 3NW7A 2GNJA 4BYJA 1PYXA 2OJFE 2OGVA 4CRLA 4EI4A 5IQBA 5DGZA 3R8MA 5J9LA 2R3HA 2R3IA 4FKOA 5CYIA 1Q62A 3WBLA 1Q3WA 2PK9A 4IC8A 2WU6A 3FMNA 3V5TA 2OF2A 4L44A 1OUKA 5D10A 1WCCA 4G9RA 1Y8GA 3BWJA 3LXKA 3BGZA 4QP8A 1J91A 1YI4A 3QTSA 3NIZA 4YC3A 3U4UA 4O81A 2R3QA 3W10A 4D4VA 4YSJA 1JKSA 5CAPA 3ML1A 4O91A 5I9YA 3PP0A 4LGDA 4O6LA 5CF4A 2C1AA 4HCUA 3RNYA 4IAKA 1ZOEA 3ZUUA 4OTRA 3TZMA 3AG9A 4GSBA 4KINA 1Y91A 5ANDA 3QU0A 4EZ7A 4UEUA 3PP1A 4AUAA 1WBOA 5HQ0A 3HRFA 5E9EA 1QPEA 1WBPA 3DY7A 3FY2A 5I5ZA 2HWPA 5E1EA 4NW6A 4XG2A 4F08A 2C68A 5FDXA 2WOUA 4L3LA 3SAYA 1XH9A 3C50A 4XHKB 3NCZA 5EQYA 2UZWE 3CR0A 5BQ0A 2YCQA 5T68A 3UZTA 3DBDA 4ZSLA 3KEXA 3KIOC 4M8TA 4ZTHA 5KBQA 2V22A 4XS2A 4UB7A 4F99A 3HA6A 4ASDA 2G1TA 3GQIA 4ASZA 3CC6A 1B6CB 3OY1A 4PUZA 4UMQA 4Y72A 1L8TA 3LHJA 2O63A 3G2FA 1PXOA 2ZFYA 4L3PA 4QMQA 3HP2A 2P55A 4C36A 2AUHA 3OBJA 4H05A 4JDHA 3KVXA 2OIQA 4C02A 1OPLA 4RJ8A 2JKKA 1PW2A 4F64A 3ORXA 3TM0A 4CZYB 4UN0C 2ZMDA 2VAGA 4FKQA 2ITQA 3F3WA 1GIJA 5C27A 1PXPA 4J52A 3TACA 1JQHA 3V01A 3FI2A 3M1SA 3MVJA 4ZJIA 4CSVA 3JYAA 4XX9A 3C7QA 4EZ5A 1ZOGA 4MF0A 4RFYA 3MBLA 3V5LA 2UW8A 2QHNA 3NGAA 4IWPA 3TZ7A 3PXQA 4BRXA 4C0TA 4ERKA 3MFTA 5AADA 4NW5A 3QA8A 5L8LA 3BV2A 3H10A 5CU2A 1KV2A 2CSNA 4KRCA 4I4EA 2REIA 5EHOA 3S2PA 1SVHA 4YJVA 3M2WA 4BWKA 1JKKA 5DI1A 4UMUA 1K9AA 2CJMA 1RJBA 1YDSE 3QX2A 4YHJA 2W5HA 3ZONA 3JPVA 3JVRA 3EFWA 3SG8A 4AZVA 4EH9A 4I23A 2CCHA 5M4FA 3MJ2A 3V8TA 4DC2A 2PU8A 2VTIA 3IO7A 1ZARA 2OH4A 3ZLSA 1IG1A 5DE2A 3O23A 5AIRA 3ZSHA 2BPMA 3QZFA 2C6MA 2J51A 4K1BA 4NH1A 4U97A 4BY9E 3NVKI 4F7NA 2ITTA 4WRGA 5AP3A 3TI1A 4FGRA 3HV3A 4MD8E 5A6NA 3HX4A 2CCIA 3VC4A 4NM0A 4Y5HA 4JDIA 2YEXA 2BDFA 2YZAA 4FYNA 3U4WA 2J2IB 5H9BA 2W1GA 2F7ZE 3VUKA 3OCTA 2YHVA 4KKEA 1OL1A 3Q4ZA 5AAEA 2VX0A 5EI8A 4AZWA 5TT7A 2QOQA 3BEGA 5F94A 3MA6A 2XJ2A 1M2QA 4IZAA 2P0CA 2WO6A 5IPJA 1OKZA 3NMUF 1ZOHA 5DRDA 2UZLA 3D14A 4JBPA 2HCKA 2VWUA 2VX3A 2Z7RA 3FE3A 4RFMA 4YR8A 3NVMB 3UDTA 2EVAA 1GY3A 4RA4A 4S34A 4O22A 2C5VA 3KN5A 4BDKA 5AUTA 4FTLA 1H25A 2R3RA 3BBTB 3H0ZA 3H4JA 3I0QA 2IZUA 2ZM1A 3C4EA 3Q32A 4M0ZA 4XG7A 4GL9A 5E8SA 3WZJA 4HVGA 5J1VA 2V7OA 4GK2A 2ZV2A 5CT0A 1XMLA 1MQBA 3K3JA 4HPUE 4Y85A 4L68A 4FKLA 1XJDA 4E4MA 1P14A 4OUCA 5LCKA 4GFMA 3DXQA 3PUPA 2BRBA 4BDHA 2V55A 2YZLA 2EU9A 4FSZA 4GKHA 1NW1A 4RX5A 4W4YA 1O6YA 3VS4A 2OBJA 3QRIA 5EYCA 3ENHA 2X6EA 3G90X 3FMKA 2VWIA 2EXCX 4FVPA 4Y5QA 2WMQA 2VD5A 4RC2A 1SNXA 3EOCA 5KZIA 5BV3A 1OPJA 5TKDA 3UC3A 1OBDA 1SVGA 4FV6A 2P2HA 3KA0A 4YHTA 3ZO2A 5CU0A 4GUBA 4H1JA 5LVOA 3DKFA 2GQGA 4EKLA 3A8XA 2OWBA 4F1OA 5L2WA 3PZEA 4APPA 3UG1A 4C4GA 4FV5A 3KKVA 4LL0A 5DWRA 4MWHA 3U87A 4BWXA 5LCJA 3PY3A 3OXZA 1ZYLA 4I94A 3RCJA 4MWIA 4LOQA 4MD7E 1JSUA 2WIPA 3DKOA 2W17A 1B39A 5CNOA 4CQEA 4NKAA 4L8MA 2ZOQA 4O1OA 3ZLXA 4EOLA 4R7BA 2WPAA 2BZJA 4W9XA 5HIBA 4YPDA 3PYYA 3QCSA 4DEDA 3DK6A 4X2NA 5C03A 2YIQA 4BCGA 3W0MA 4V0GA 4CKJA 4IM3A 4EJNA 3GVUA 2WQEA 3R9NA 2XNMA 2GCDA 2I1MA 1NA7A 3ZHPC 1IRKA 2BRHA 3R1SA 4Q9SA 3KF7A 5H8EA 2QR7A 1OZ1A 2OH0E 4YZMA 3W0OA 4L46A 3NAYA 3UC4A 5IQDA 2IF8A 4J95A 4GH2A 4DFBA 5E1SA 4O7RA 3OXTA 4AW2A 4DGMA 3Q9WA 3TNQB 5A4QA 2BKZA 5KKRC 3OCBA 4Z16A 3AMYA 3OTUA 2XNOA 2I0VA 2XNBA 4AE9A 1OITA 5DVRA 3LQ3A 5HNGA 2VZ6A 3SGCA 3NR9A 2X9EA 3NRMA 2GHMA 3QD2B 5IQFA 3F3VA 2W4KA 2JDSA 4AXFA 1FGKA 3KMUA 1Y57A 3RWQA 5IMEA 3GU5A 2NPQA 4D1ZA 2XCHA 3MH3A 4R5SA 3UIBA 3VRYA 3G0EA 5A46A 2E9UA 4QMPA 4I5CA 3SOCA 1ZZ2A 4WBBB 5F20A 3F7ZA 2DS1A 3SLSA 4H39A 2XAOA 5CENA 3GC0A 4YZCA 3GCSA 4QNAA 5GZ9A 5LVLA 4RIYB 3U55A 2ITWA 4FKPA 4OTHA 4YP8A 5EM7A 4MVFA 2B7AA 3VBVA 3PVWA 2XRWA 4TYGA 3CEKA 2QLUA 1ST0A 3MS9A 3FBVA 1M17A 3PLAE 4L42A 1UKHA 5C9CA 5B7VA 2BDWA 5FBNC 3KK8A 2NNWB 5IQIA 3LFAA 3KXNA 5EFQA 1YXVA 3LPBA 4EH4A 2ZM4A 3CTQA 2XKDA 4JOAA 2UZTA 4EOPA 3SA0A 4PNKA 3BKBA 5BYLA 2HZ0A 5M08A 2OSCA 5HTCA 1DI9A 3UPZA 3FY0A 1CDKA 4FG9A 3ZDUA 4O83A 5AP1A 5CS6A 4BGQA 2WMWA 4QTDA 3FPMA 4BIDA 1Q99A 4DFXE 5ANGA 3C4CA 4BJJB