4G3FA

Crystal structure of murine nf-kappab inducing kinase (nik) bound to a 2-(aminothiazoly)phenol (cmp2)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
333
structure length
312
Chain Sequence
SGSVSSGQAHSLASLAKTWSGPETEDNEGVLLTEKLKPVDYEYREEVHWMTHQPRVGRGSFGEVHRMKDKQTGFQCAVKKVRLEVFRVEELVACAGLSSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLIKQMGCLPEDRALYYLGQALEGLEYLHTRRILHGDVKADNVLLSSDGSRAALCDFGHALCLDYIPGTETHMAPEVVMGKPCDAKVDIWSSCCMMLHMLNGCHPWTQYFRGPLCLKIASEPPPIREIPPSCAPLTAQAIQEGLRKEPVHRASAMELRRKVGKALQEVGGLKSPWKGEYKEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords NF-kappa-beta-inducing kinase
publication title The crystal structure of the catalytic domain of the NF-kappaB inducing kinase reveals a narrow but flexible active site.
pubmed doi rcsb
source organism Mus musculus
total genus 107
structure length 312
sequence length 333
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2012-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4g3fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4g3fA01
3COKA 4D4VA 4CMOA 2YJRA 2BFXA 4BTFA 1ERKA 4FKRA 1U54B 2HAKA 2ZYBA 4EONA 5JK3A 5CI6A 4Q2AA 3MPAA 2QOFA 3C0HA 2WMRA 2Y0AA 4LV5A 5CZIA 3ZO4A 5DEYA 5G6VA 4I23A 1YW2A 1KWPA 1PXLA 4Z3VA 3FAAA 3QQGA 3BE2A 2WTJA 4FUYA 4CLIA 1P5EA 1SVHA 4P5QA 4TWCA 3FSFA 4A07A 5BVEA 5F1ZA 3E8DA 3FXWA 4FIGA 1OZ1A 4G3EA 2R3MA 2HY0A 4O22A 4JJRA 3BYUA 4ZLZA 4RIXB 2O0UA 2ZAZA 3PP1A 2PK9A 3EB0A 4TTHB 3LM5A 3GCPA 3BBWA 3LAUA 3U9NA 4H3BA 3UNKA 4DE4A 3IW4A 3L9PA 1WBPA 2YZAA 3DOGA 1CTPE 2VTOA 4DGGA 2PL0A 1Q8WA 4K0YA 4WG5A 2UW8A 2BFYA 4WT6A 3ORLA 2FSMX 3MBLA 3NCZA 3EQRA 2YAAA 4FMQA 4L3PA 4U5JA 3WIGA 1GZOA 4AUAA 5AR4A 2YM7A 3VS3A 4XV3A 4BC6A 4CVAA 5HD7A 5EW3A 5CSWA 2PE0A 1SVEA 3CSVA 2GQSA 3G15A 4L52A 3S0OA 4RJ8A 1KOBA 5ETAA 5K4IA 3LCDA 4E6CA 2GNGA 2WD1A 3QYZA 5A9UA 3ZCLA 3TUDA 3PXKA 4JQ7A 2BDJA 2VWWA 3A60A 4OBQA 4EH3A 5CAVA 3UJGA 4QO9A 1O6LA 3HGKA 3UP7A 1ZARA 4IB3A 1RW8A 1F3MC 1LEZA 2A0CX 3K5UA 2J50A 3M11A 3VS7A 4EJNA 5AA9A 4FV4A 1PXMA 2UVZA 1UU3A 2VNYA 4F9YA 4FTMA 3BEGA 3VRZA 4V05A 3I4BA 2A4LA 2X4FA 4BHZA 2UW6A 2X7OA 3FHRA 5A3XA 1OPKA 3DZOA 3DK3A 4GRBA 5IPJA 2C30A 2W1ZA 4JBPA 4I41A 3EOCA 4YSMA 4EHEA 5G1XA 4EOKA 3A4OX 4RVTA 4YP8A 3U55A 4BDDA 5M08A 4IM2A 3R2BA 4CQEA 4FYOA 4ZS0A 4U3YA 2WMAA 3L8SA 4BKZA 3NUAA 4EK8A 4U42A 4FV0A 1XR1A 2Y6MA 2A19B 2UZVA 4I21A 4LOPA 5FTQA 4DTAA 2C68A 4BCFA 4XV1A 3PRFA 3Q6WA 1KOAA 2XYNA 2UZEA 2XRUA 2OW3A 4MXOA 1T46A 4OTQA 3JPVA 4ZJJA 4U6RA 1KE5A 4Q9SA 4A4OA 3UQFA 4K1BA 1V0BA 3MPTA 4NCTA 4QP3A 2PUPA 4RC4A 2GHLA 3B2TA 3QXOA 4I6QA 2IVVA 4FSTA 3R8UA 5F20A 3MESA 3GB2A 4D9UA 1I44A 2VWXA 3NW6A 2XNGA 2CGWA 3H30A 4HNIA 3V5PA 4ZMFA 2VO0A 5ANEA 3NGAA 5B7VA 4G6LA 4UBAA 4DTKA 2UZUE 5M4IA 4IHPA 3PDTA 2BIKB 1GNGA 3GCQA 4ZSJA 1YXSA 3OUNB 3DTCA 2QG5A 4FEXA 4FT5A 4DFNA 2UVXA 4NW6A 4DAWA 4EZ7A 5F4NA 1XBBA 4IAFA 4EKLA 2W06A 3DFCB 1UKHA 5HU9A 4LQMA 3RCDA 4W9WA 3AC3A 3HDMA 5CQUA 3EHAA 2WHBA 5BVDA 3NNWA 3TNHA 3EN5A 4UMPA 1J7LA 4HCVA 4GSBA 2C0IA 3H9OA 1BL6A 3P7CA 3IDPA 3ORNA 3PSBA 4YLKA 4AXAA 1NA7A 3W2SA 4CV8A 2YM5A 2QOIA 2ZDUA 3E7VA 5KMOA 5A6NA 3R1SA 3IGGA 4YNEA 4M3QA 4L46A 1OKYA 2HXLA 4BTMA 4J7BA 4B99A 4CV9A 3DK6A 2R9SA 5CEIA 1CDKA 4C4GA 4LUEA 4C3RA 3UIXA 2R5TA 3BQRA 4PRJA 3VHKA 2XBAA 3AQVA 4RA4A 4RZVA 1YHVA 4XJ0A 4EUUA 2ZV9A 1Q97A 3O0GA 4GK3A 4LMNA 4UZHA 4YJVA 1OKZA 4WHZA 5IZFA 5M4UA 4QNYA 4AZWA 1VR2A 4QPSA 1OBGA 2ESMA 1GAGA 1Y8GA 1XH5A 2V62A 1KSWA 1OL5A 1TKIA 4X2GA 2Z60A 3P4KA 5ANDA 3VF9A 5CT7A 4H3PA 1XH7A 2YLFA 3RPOA 2C1AA 2W5BA 3CJFA 3KRXA 3DZQA 3LJ2A 3UOLA 1H1PA 4YC6A 3LZBA 4BWPA 3NYVA 5HO7A 5JH6A 3FZTA 4RJ6A 4EK5A 4CCUA 2C6OA 4ZJIA 4KB8A 4ACDA 4MD8E 2FA2A 4N4SA 3BX5A 4U3ZA 4EOPA 3DAJA 4F7SA 4ENYA 5JGAA 4MBLA 4CG8A 3TNIA 4AX8A 1R3CA 2C6EA 3GOKA 4KBCA 3FHIA 3PE2A 5FXRA 3SAYA 4BB4A 5EFQA 4QNAA 3W8QA 1GZNA 3R9RA 3ZEPA 2WXVA 1Q99A 4GK4A 4MNEB 4FODA 5ACKA 4C0TA 2GS6A 3Q5ZA 3OUKA 2X7FA 2FGIA 2BTSA 4JR3A 2AC3A 2ZV8A 3GC7A 3AC5A 3NUNA 4FG8A 4QP7A 4GYGA 3W8LA 4G2FA 1PXKA 4M97A 4XRJA 5HE2A 4NYEA 4HGSA 4R3CA 4IDTA 3KKVA 2XNMA 2ZDTA 4W4VA 5E8UA 4DH8A 3PJ8A 4Q5EA 3U9CA 3VUHA 2R3KA 1VYWA 1ZY4A 3MIAA 5EHLA 3EQIA 2RFEA 3POZA 3ZO1A 4CNHA 3CGFA 5IQGA 3R2YA 5J9LA 4YC8A 4PF4A 1XH8A 4QMPA 4RJ3A 1PMNA 4E4MA 4YC3A 4UWYA 2JBOA 2GNLA 4ENXA 2FSLX 3PP0A 3QD3A 4QMOA 3AGMA 3VUDA 4G3GA 4PV0A 2QOKA 5M53A 4ZLYA 4RFMA 4W8DA 5AUYA 4L42A 2QOOA 2G1TA 3GU6A 3H0YA 3Q4CA 3OS3A 3VBWA 4HVDA 1JKLA 3L8VA 3LHJA 4W4XA 5AUUA 3QU0A 4RIXA 5JFWA 4NJ3A 5FUTA 3KULA 3EQGA 3OBGA 4HVHA 4HNFA 2P33A 4XH6A 4FIJA 3IOPA 2XIYA 2R2PA 2GPHA 3IG7A 2HK5A 3W10A 2QU6A 4QYEA 4QP1A 3U6HA 3BGZA 2E2BA 1J7IA 3ODYX 3NSZA 5EM8A 5EQPA 5A14A 3FC1X 3CP9A 3RM6A 4OAUC 5AADA 4BIDA 3Q32A 3JYAA 2XKEA 3LJ0A 5E8VA 1FMOE 4F09A 3OXTA 5GZAA 4F7LA 2WQNA 2YISA 4GUBA 4FICA 1V0OA 3SOCA 4QTAA 3DFAA 4FV9A 3F88A 4R3PA 5L4QA 1ZYSA 4FL1A 5DBXA 3UIMA 1M7NA 4DEBA 1A48A 3PG1A 4BHNA 3P86A 4EUTA 3RAHA 4D2WA 2VWVA 3ZUTA 3KC3A 3F82A 2B1PA 3D7ZA 1OI9A 1OKVA 2WMVA 2W1DA 4TYEA 4FT0A 3ZSGA 1ZOHA 2C0OA 5EM5A 1REJA 2J0LA 3NS9A 5EKOA 5AR7A 3RPSA 3S3IA 4JRNA 3F2RA 1M2QA 2J90A 4KIOA 5B2MA 3SC1A 2HIWA 1SM2A 4RIYA 5T68A 3OOMA 4WSYA 2EXEA 4R1VA 4I0SA 3O96A 4C4JA 4PMPA 3JR1A 4Y8DA 3RVGA 1O9UA 1PKDA 3HL7A 5IMEA 1BL7A 2ZB0A 2V7AA 2Y8OA 1P2AA 3OWKA 4WUNA 2O65A 4J98A 5LOHA 4UMUA 3DJ6A 4Q9ZA 4OTIA 4C33A 5HCZA 5AR5A 2C6MA 4G34A 3F3WA 4JR7A 3SOAA 4GJ2A 4QRCA 2GS7A 4E1ZA 5HNGA 2B9JA 3SVVA 4O7WA 3HRCA 2W4OA 3R71A 4R7HA 3PZEA 3DKFA 4NKAA 1JKSA 2YCSA 5K0KA 4JDJA 5LMKC 1BI7A 2ETKA 2DQ7X 4WA9A 1PXNA 3BV2A 3UZPA 4H36A 5CY3A 4FG9A 4GYIA 3PY1A 3KL8A 4K18A 4U0IA 4FVPA 1FVTA 2V0DA 3T3VA 3TI1A 4EZ5A 2H9VA 4GW8A 4E3CA 2F7XE 4LV8A 5AP1A 5HQ0A 3AG9A 3OG7A 4F1MA 2ITVA 3Q3BA 3ZO3A 5JEBA 1YOMA 3D7TA 3KRRA 3QRTA 1GJOA 3A4PA 2VUWA 5KKRC 4CFNA 2W5HA 3QF9A 5AV4A 1YXTA 3L9NA 2BKKA 1ZOGA 1WVYA 1UU9A 3QHWA 1QPJA 1SMHA 3IW8A 3FBVA 1BYGA 2WQOA 4GG7A 1S9JA 3TV7A 1MUOA 3E7OA 3C1XA 2WQMA 3Q9XA 2QQ7A 1ATPE 2ITQA 1Q8TA 2XRWA 2YABA 3QZHA 4FYNA 4HGEA 5FP6A 4M13A 4TZRA 4BYIA 4R78A 3DBDA 4UWBA 2ITYA 2YACA 2OO8X 2UW3A 4O1OA 4AOJA 3KGAA 3KN5A 4G6OA 4MCVA 4WSQA 4LM5A 4AN3A 3G0FA 5CYIA 3HVCA 4QD6A 4CMUA 2QG7A 4BICA 4O96A 5E4HA 3BHHA 4R6VA 2J4ZA 2XKCA 3CD8A 2VTRA 4YZMA 2I7QA 1K3AA 4APPA 2PZIA 4AQCA 4AW0A 3VN9A 2W1CA 4D4RA 3A99A 4V0GB 3R22A 4X21A 4G3FA 2LGCA 4E20A 1ZMUA 4YZCA 3PJ3A 3ZBFA 2XYUA 3GU4A 5I9WA 5DYJA 3JUHA 2OJIA 3PPKA 3WZJA 2C3JA 3QQFA 4C4IA 4FSNA 5EYMA 5DVRA 2OF2A 3V04A 3ORIA 4IWOA 4EQUA 4O7LA 1H0WA 3DA6A 5JGBA 4RZWA 1OITA 1NVSA 4FKTA 2GFSA 4PP7A 2HZIA 5FM2A 4FI1A 5E91A 5IDPA 2GMXA 3UTOA 3HNGA 4YHJA 3SGCA 2JBPA 4PTEA 3QWJA 3KMMA 3EZVA 4G1WA 4NK9A 2BAKA 1NVRA 4HYHA 4MK0A 2GS2A 4N0SA 4EBVA 2WU6A 4J1RA 2WB8A 1W98A 4EOOA 5LVNA 5HEZA 1LP4A 5FDXA 5ITAA 1M2PA 5E92A 3OD6X 4ZTQA 1AGWA 2A2AA 3F5XA 4RC3A 4YHTA 5EDQA 3R7VA 4JXFA 2HZ4A 5DIAA 1JQHA 2Z7SA 3KF7A 4Z9LA 1M17A 2XK6A 2OZOA 2YDIA 1W0XC 4I5PA 4E93A 5HCYA 3HECA 1U5QA 2OBJA 3DKCA 3QTSA 4I93A 2R4BA 5HIBA 3Q9ZA 2VTIA 3TM0A 1XJDA 4MNEA 2XNPA 3TNQB 2C1BA 4LFIA 4BGQA 2JD5A 4JDHA 5EQEA 4YJSA 5FD2A 2IW8A 5E8XA 5L2IA 1WMKA 4HYIA 5IU2A 5HBHA 3W2OA 5D41A 3ID6C 3NUUA 5DT3A 2FB8A 4KNBA 3MY0A 4O0SA 1KV1A 5CS6A 3ZDUA 4QYFA 5FXSA 3COIA 5H9BA 4MTAA 1PXOA 4ALVA 4Z16A 4FKLA 4AGCA 4CKIA 4TKSA 4XBRA 3V3VA 4FIEA 3HMOA 5KKRB 5H8EA 5ANIA 4EQCA 3R8ZA 4HCTA 5BVFA 4O91A 3VBYA 3AD6A 2OSCA 4FV3A 4L7SA 3PY3A 2XS0A 1V0PA 3ATTA 2OGVA 1ZLTA 5KMMA 1YI3A 2GFCA 2X7GA 3C4XA 5HGIA 4ZK5A 3PY0A 3MH2A 4YTCA 4M67A 2FH9A 1J3HA 3F61A 4RX8A 5DMZA 1YWRA 1ZXEA 5KHXA 3DDQA 3OCBA 2VWIA 3PA5A 3ATSA 2BHHA 4F6UA 5I4NA 5AMNA 4BKJA 5J87A 4BCJA 4FEUA 2YM8A 3ITZA 3G6GA 4S33A 5GZ9A 2R3GA 2JLDA 3HUCA 3WF6A 3NX8A 1ZY5A 4FZ6A 3CXWA 4KKHA 1OUYA 4F70A 4EK6A 2HXQA 5BQ0A 3SQQA 2Y9QA 3T9TA 3QAME 3QYWA 4AZVA 3CGOA 5LVPA 4BCHA 3VS0A 3TV6A 5I3RA 4O81A 2BZIB 2EXMA 3ULZA 5TE0A 3C51A 3E8CA 2EB3A 5HVYA 4FOBA 4TT7A 3V5LA 4ITHA 1PJKA 3BYMA 3QUPA 1JWHA 2OXDA 3GEQA 5KMNA 4DEAA 4EHVA 4CYJA 2V22A 3R04A 4G9RA 2ITWA 4N6YA 3IW5A 2LAVA 4EOSA 1VEBA 1FVRA 4LGGA 2CNQA 3DXNA 5AP4A 1OL6A 5DI1A 5F95A 1LPUA 4FV1A 5EDPA 3R7IA 4AOIA 4BDBA 4KKGA 4MWHA 2XB7A 3GC8A 5HE3A 3KA0A 5HNBA 4J99A 4HJOA 2IG7A 4IZ7A 3ZFYA 5A4CA 2XJ1A 4RIOA 3D0EA 3UOJA 3A7GA 4QMSA 4U40A 3FKLA 1GIJA 3ZFMA 3G9NA 3NMUF 2NNWB 2WTKB 2VTMA 3C4FA 4XLVA 5E8SA 3IW7A 2X2KA 2YDJA 2RFSA 2JIIA 3K5VA 1WBOA 2CGVA 3Q52A 1OGUA 4XYFA 3DLSA 4USDA 5CXHA 5IQHA 3TG1A 4GS6A 3PRIA 1CM8A 2CDZA 2J0JA 4FKPA 5JRSA 3ZXZA 1URCA 2IO6A 1A9UA 4UB7A 5EK7A 5AIKA 1IG1A 3HV7A 3DU8A 5AX3A 2QNJA 3VQUA 4I20A 2UZDA 2O8YA 3ANQA 4TW9A 3SW4A 2EWAA 4J71A 3ORKA 5M06A 2XF0A 4XG6A 2GNFA 4OT5A 3A7JA 3CTQA 5HICA 5AUTA 3NUSA 3RPRA 2GHGA 4O83A 2EXCX 3C4EA 1H00A 3O50A 4GEOA 3ZHPC 3MB6A 1YRPA 2C47A 4XV2A 4TWOA 4XOZA 3N4UA 2UZNA 3OWPA 1JOWB 4H3QA 4XX9A 1Q5KA 3BBTB 3P9JA 5AA8A 3ANRA 3RKBA 3MFRA 2H96A 5FDPA 3HMNA 3KXZA 4GKHA 4G5JA 1WVXA 4M0YA 1FBNA 3EYHA 5CXZA 4YTHA 3QRKA 5HE0A 2YWPA 2WQBA 3HKOA 3ETAA 4GU6A 4YMJA 4IM3A 3GU8A 2P2HA 4X2NA 3SG9A 4K9YA 5IA5A 5DG5A 3ALOA 3QL8A 3RK7A 2PMNX 3QFVA 1PMEA 4DF3A 3CQEA 5TF9A 3KK9A 4WRGA 4QTDA 4ANBA 5K5XA 1IA8A 4L8MA 4A9SA 2XEYA 1W83A 3II5A 3R7UA 4BR3A 3FZPA 1S9IA 3LFFA 4QMXA 4K8AA 1VZOA 4CZTA 4OAVB 4FTNA 3AD4A 3V5JA 2OZAB 2WEVA 3OP5A 4GFOA 5E8WA 2OK1A 2W17A 3ZLWA 2HZ0A 3EQCA 2OJ9A 2QODA 3LXPA 2OU7A 4G3DA 4U41A 5DH3A 3WI6A 4EH8A 4LI5A 4EOJA 5DPVA 2C6KA 3NYOA 4F6WA 4KRDA 1OIQA 3UOKA 4FIFA 3FC2A 2QOBA 3CCNA 4RFYA 4U8ZA 2IPXA 2GTMA 2R3IA 4XUFA 3OMVA 5LCKA 4DG2E 4O0XA 1OL1A 2XNOA 4N6ZA 3UO4A 5M51A 2YM6A 4I6FA 5JMSA 2HWOA 2IVTA 2WO6A 3MH1A 3OF0A 5E7RA 3CEKA 4QTEA 5D9HA 5AV2A 3V8SA 4H1MA 2HOGA 5FP5A 5ANKA 4A9TA 5BVNA 3BU3A 5EM6A 4D1ZA 4D0WA 2RIOA 2WOUA 3VS2A 2J0KA 4KSPA 5EOBA 5CASA 4JX3A 2CKOA 4LYNA 2OJGA 3PWDA 3Q9WA 1OUKA 4FTIA 4GIIA 4E5BA 4YO6A 5AUZA 3GT8A 3HP5A 4KINA 1Y91A 2VGOA 2ZM4A 3R00A 4X3FC 4H39A 1YKRA 3FMEA 3V5WA 4ERKA 2WMSA 5M09A 4L3LA 3PJ2A 3WF7A 2HENA 3QCQA 3KCKA 5EW8A 5CVHA 3CTJA 3MVLA 3NIZA 4AF3A 2PVJA 3ENMA 5IUHA 3OXZA 3VQHA 4F08A 2I0EA 3RBWA 2IZRA 2A27A 5HBEA 3UIBA 4ZSLA 4FV5A 3ENHA 4H58A 5EW9A 4IX3A 1IR3A 4FNYA 2ETMA 5IA2A 1Q8UA 3KRJA 3MY1A 4BCPA 4UYNA 3TACA 4O7TA 4YJRA 5H3QA 5HIEA 3WE4A 3QQLA 1HOWA 3D14A 4ID7A 1NXKA 3IO7A 1APME 3E63A 2F7ZE 2PUUA 4PX6A 1EH4A 5ICPA 3H3CA 1U5RA 1ZWSA 4YSJA 5HBJA 5AAFA 2BILB 3QRJA 2FSTX 4CCBA 1YWVA 3QX4A 4FG7A 1K2PA 4DH1A 4AACA 4IDVA 4AW2A 4RG0A 3A2CA 2H6DA 3U8WA 4JBVA 3UE4A 3OFMA 3VS5A 3KY2A 5BVWA 1TQMA 3UYSA 2JDVA 3ZEWA 4ZIMA 3UNZA 4K6ZA 4NJDA 4TYJA 3D83A 4TWNA 4QP8A 3R7YA 1IAJA 1XQZA 4J97A 4IIRA 2QO9A 4FTQA 4J53A 3C0GA 4LOOA 5M57A 1H08A 4NM0A 4DCEA 4RRVA 3VW8A 2X81A 4E5WA 3HV6A 4L44A 4BDFA 2BHEA 2IWIA 1MRVA 2OJFE 2VTTA 3R63A 5KZIA 3EN6A 1ZZLA 2JFLA 1RE8A 3DBCA 3OTUA 2UZTA 5CU0A 4KS8A 5JGDA 2E9OA 3KXXA 1H24A 1XBCA 2YLEA 5FTGA 1GZ8A 4FSQA 5EYDA 1JNKA 1MQ4A 2XP2A 4NSTA 3IONA 5C03A 3RWQA 3O17A 3ZU7A 2UZLA 3KMUA 2FYSA 4L53A 3RK5A 3RPYA 1PXJA 2RG6A 3OTVA 4WNPA 4LUDA 1ZYLA 3VBTA 2B9IA 2G01A 3L9LA 4FTCA 4U81A 3AT2A 1UNLA 4I24A 3AOXA 3UPXA 5F94A 4ZSAA 4GFGA 2Y4IC 1DAYA 4JQEA 4AZTA 4FK6A 3VUTA 3TUBA 3E88A 3WZUA 2B7AA 2IJMA 4BZOA 3UO5A 2Q0BA 3HX4A 3L8XA 2VD5A 3FEGA 1DI8A 3AT3A 3MDYA 4DFXE 3KQ7A 2ZB1A 3CQWA 2YHVA 4EC8A 4F9BA 4EH7A 5FEEA 3EN7A 3UIUA 4F7JA 3RM7A 4ZJVA 4I6HA 4QYHA 3WZDA 1V1KA 3W55A 3FL5A 4FL3A 2X6DA 2VU3A 4OTFA 4QMQA 5KBRA 2UW7A 3EFJA 5HI2A 3R1NA 4O7YA 3JY0A 3PVWA 1J1CA 4F0FA 3Q4UA 4ZTHA 4BL1A 2QU5A 1XWSA 3ORXA 4IWQA 2RFDA 5A4TA 5HU3A 3A61A 3EIDA 3DKOA 4P7EA 2XVDA 4E6AA 4M69A 4AAAA 3W2PA 1CMKE 3QQJA 4S32A 2PE1A 5KNJA 4RPVA 4MWIA 3OEZA 1OBDA 2B9HA 2J5EA 1GIIA 3BKBA 3BYOA 3TNWA 4ALUA 4FA2A 1KUTA 3C5IA 3LMIA 3ZS5A 4BFMA 3QZIA 3C13A 4GT5A 2ITPA 3PXFA 4E4LA 5AM6A 3E3BX 3WF8A 3GBZA 4EOIA 3IKAA 2WAJA 2VTJA 3L1SA 4IADA 4Y95A 4Z55A 5JFXA 4KAOA 3PTGA 3ZM4A 3SX9A 1E1VA 2CN8A 3PVGA 3LFSA 2R3JA 3GQLA 1IEPA 3CE3A 1WZYA 2OG8A 3K3IA 3DJ5A 3RNYA 3DQWA 2VX0A 3NW7A 4DHFA 1PXPA 2VTAA 3ET7A 4ZZNA 3PIXA 5IA4A 3JXWA 4CTBA 2E9VA 2W99B 2YWVA 3R73A 2O5KA 3CC6A 5HORA 3HP2A 3MGYA 3DGKA 4DN5A 4RIWB 1B38A 3QC4A 3UBDA 4BWKA 3EQPA 1Q8YA 4IEBA 1REKA 3AMYA 1FGIA 4DINA 1U59A 4OGRA 4ANQA 2YA9A 2XMYA 3VWAA 1R1WA 4EEVA 5IEYA 4P90A 4HZSA 4XOYA 4IAAA 4IX4A 4BI2A 3RAWA 2P4IA 5IDNA 4HVGA 3COHA 4XV9A 5FXQA 4Q5HA 5L8JA 5EG3A 4KIKA 2W4KA 2BRGA 2WNTA 3WILA 4F64A 2WZJA 2OZAA 3F5UA 4FSYA 4YPDA 4WRSA 5EOLA 4JOAA 1CKPA 2WMWA 1ZYCA 5M44A 4D28A 5JKGA 3VBVA 3FL4A 5D11A 2F57A 4HVSA 3R9OA 4GCJA 2RG5A 4KBKA 2P0CA 2R3NA 4IJ9A 1H27A 5B0XA 4MQ1A 2VTQA 5CU3A 3VAPA 1PXIA 2VO7A 3UG1A 1A06A 3P23A 3D15A 3FMKA 2R3FA 4I5HA 5IEXA 4HCUA 2GTNA 2V55A 3FJQE 5ANJA 5A46A 3VUKA 3GGFA 5E8YA 3EQHA 5HCXA 3VHEA 3OT3A 5I9UA 4TL0A 5BX0A 3C4WA 3PLSA 4LRKA 4PQNA 3OHTA 1H0VA 5IQAA 3D2KA 3QUDA 4MD7E 4I6BA 3F69A 3QUEA 3KF4A 5I5ZA 3FE3A 4CLJA 5LQFA 5IQIA 3JY9A 4ZTMA 4FKUA 5EI6A 3BU6A 3RTPA 5DE2A 4EYJA 2BIYA 4YGAA 3W2RA 4TWPA 4FKSA 3G33A 3FXXA 3SW7A 1U54A 2W1EA 4JI9A 2XNNA 4NM5A 5AM7A 3WZKA 1M7QA 3DV3A 3C7QA 4U44A 1R39A 3Q4ZA 3VULA 2XKFA 2F9GA 1ZMWA 4DA5A 3V5QA 1OB3A 3PLAE 1ZAOA 3DNEA 4F7NA 2VWYA 3AGLA 2GDOA 4YZ9A 3TL8A 1FPUA 3CY3A 2R7BA 1U46A 4FZ7A 5AP0A 4KIQA 4XP2A 4FEQA 3AC4A 3HV3A 2UUEA 4FT7A 2JKMA 4QT1A 5DLSA 4QQTA 4FE2A 4CRLA 3DAEA 3PXZA 3I6UA 4ZTSA 3EQDA 5L6PA 4BGGA 1FVVA 2XIZA 3MJ1A 3R6XA 4TXCA 3BLQA 4CZUA 5M4FA 4FR4A 2REIA 3ZDIA 1NW1A 4YZDA 2Z02A 3OVVA 4RC2A 5JFVA 3I81A 2VN9A 5LVMA 3Q96A 4PNIA 3BU5A 4NM3A 2QO2A 2YM4A 4AZEA 4GH2A 1W8CA 5E90A 2C3KA 2QKWB 3QC9A 5J1VA 5K5NA 3N9XA 2VWZA 5TKDA 4MXCA 5HD4A 2C3IB 4EH2A 3DBQA 3I1AA 1FOTA 4FTAA 4M0ZA 5GHVA 4DGLC 3TUCA 2JIUA 3POOA 4PPBA 2ITZA 4W8EA 2VV9A 5HKMA 4JIAA 1DS5A 4DLJA 5AP5A 3PJ1A 4RWLA 3JVRA 2WTCA 3PYYA 4GU9A 3MY5A 4IB0A 3KFAA 3LFNA 3RWPA 4FV6A 4DFLA 4FKIA 3MA6A 5AX9A 3UVQA 2G9XA 2W7XA 3K54A 4I92A 3QQHA 2QI8A 5GJDA 3TWJA 2YERA 4O0VA 5A4EA 3C0IA 4C2WA 5HIDA 3Q60A 4F1TA 3P5KA 4FTKA 2IVUA 4AGDA 4I94A 4JG8A 1JKKA 3ORZA 2PUIA 4RX9A 4QMYA 1H4LA 4WNOA 1BX6A 2W1IA 4IVBA 4R3RA 5CAOA 2ONLC 4FK3A 4RWJA 5M07A 2GNHA 4RJ4A 4OBOA 4QYYA 1UNHA 4BTKA 3OZ6A 1Y6BA 4MVFA 4EOMA 4DFYA 3CKXA 3F6XA 4ZY6A 5KE0A 4CKJA 2BKZA 2FVDA 3MA3A 2BALA 4AP7A 3QTRA 4OBPA 5CENA 4AT3A 4RT7A 1H1RA 1JPAA 2EB2A 5CEQA 1K9AA 2JDRA 3V01A 3NNXA 3EZRA 2PMOX 4L01A 2JKQA 4PDPA 4GUEA 3V5TA 4M66A 2E9UA 5AR3A 2WTIA 3CPCA 4DGOA 4Z7HA 4USFA 4FEVA 3C5UA 2PVMA 1F0QA 3DJ7A 3RAKA 4R77A 1G3NA 3WF5A 4MBIA 3AMBA 4PUZA 4B9DA 4Y5QA 3E8EA 3NUYA 4R7BA 3DXPA 5ANGA 1JSTA 2YM3A 2R3PA 3DLZA 5DR9A 2C5XA 5J8IA 1OKWA 3OCTA 3ZRLA 2DYLA 5EHOA 5L2SA 4YJPA 4FT3A 2X6EA 2IW6A 4C36A 4BIEA 3PSCA 2PVKA 2X8EA 4LRJA 3AT4A 4UMQA 3NRMA 4X6QC 4EHZA 1QMZA 2QLUA 2XH5A 4YJTA 2X4ZA 2NRYA 3N51A 3EFKA 2YZLA 4GG5A 3Q2JA 3IS5A 1PMUA 4NU1A 4X2JA 2PY3A 3MS9A 4EWQA 1CSNA 4D2RA 4O0UA 3O51A 4FSWA 1BMKA 4M12A 5D12A 2JFMA 4RVMA 3BZ3A 1H01A 2Z7RA 1YHSA 5C4LA 3TTJA 2BRMA 5K9IA 3QTQA 2BMCA 4BCOA 3WBLA 1YXXA 4DFBA 5HX8A 2NO3A 3EN9A 3W16A 4OTGA 2CN5A 2P55A 3E62A 4RGJA 3F66A 4RQKA 2JGZA 4RVLA 4XG2A 1DM2A 3UZRA 2X1NA 5HG8A 2W9FB 2O3PA 3O8PA 4M8TA 4QPAA 3UOHA 4FKOA 3BHUA 4BGHA 4RX7A 2CSNA 2NP8A 2PVFA 2AYPA 3WOWA 2PZYA 1VJYA 1FMKA 3ERKA 3RAIA 4BBFA 4XMOA 1W82A 2PVNA 1YHWA 4ASZA 4KBAA 4Z7GA 3IGOA 4XBUA 4A9YA 3VJOA 2CLXA 2C5YA 2JKKA 3ZMMA 4YUQA 1UVRA 5HTCA 3ACJA 4MKCA 4QMVA 5L8KA 2J2IB 4P2KA 4NL0A 4CXAA 3BE9A 5KZ0A 5HLPA 3AXWA 4AWIA 2KTYA 4X6RA 3C50A 3IDBA 4BCNA 2UW0A 4BY9E 3BLHA 3B2WA 3NAXA 3Q6UA 3A8WA 4NW5A 3GCUA 3PIYA 3QTXA 4W4WA 4YZNA 1KE6A 2QOHA 3FUPA 4RIWA 4Y73A 4BBEA 4FZAB 4L45A 2BZHB 1PRYA 1ZMVA 3S1HA 5LJJA 3R30A 2EVAA 3MFSA 4FNWA 3SXFA 3A62A 4C8BA 3MH0A 3LXLA 3A7IA 5C8MA 4MNFA 2Q0NA 1CKIA 2B9FA 4I3ZA 2CGXA 5DT4A 1H1SA 2CMWA 4ZZOA 1GOLA 4TYHB 1Q3WA 1QCFA 3QRIA 5IQDA 1O6KA 4U9AA 4GK2A 5IQEA 4CFMA 2C0TA 4FTOA 5BMSA 3OROA 4ZS4A 4RQVA 4LMUA 4WKQA 3RINA 3I7BA 3H4JA 3EMGA 3DKGA 2ACXA 3U87A 3RI1A 3GNIB 2RFNA 1H1QA 3BELA 1UNGA 3HMPA 4A7CA 2PULA 3OY1A 5H2UA 4EOLA 4C3FA 5JQ5A 3KB7A 5DR6A 1YWNA 4PMTA 1JBPE 1NT2A 4N57A 3FWQA 2PVHA 4NCTC 1PF8A 3KCFA 2R0UA 3DPKA 3HYHA 5EDRA 4F65A 3E8NA 3W32A 3DCVA 4C58A 2J51A 3DDPA 5T3QA 3M42A 3O23A 1UKIA 4J8MA 3LKMA 5EHYA 4E73A 2IZUA 2PSQA 1Q62A 3H9RA 4RA5A 4HYSA 3DB6A 3OW3A 4ACCA 3TKHA 2R3OA 1MQBA 5CX9A 3M1SA 3VJNA 4IM0A 3HAVA 3TDWA 4JBQA 3ZC5A 2QLQA 4MYGA 5CU2A 5DFPA 3R01A 4ACGA 4CD0A 5FG8A 4MX9A 3FLSA 4AFJA 2FSOX 5CVGA 2EU9A 2UZOA 4XLIA 2ITNA 4MF1A 1T45A 3PA3A 4EQMA 4BF2A 2BRHA 4BYJA 5BPYA 5J7HA 2RGPA 5DHJA 3R9NA 4DCAA 4GVJA 1TQPA 4C4FA 3P0MA 4C4EA 2HW6A 3F2NA 3VS4A 2GU8A 3O2MA 4ZEGA 3BV3A 4EH5A 2R64A 4FSRA 4KA3A 3R0TA 3AC8A 4FKVA 2JDOA 3EKKA 4CSVA 2YDKA 5ETCA 5AV1A 3R8VA 4BI0A 3LCTA 3F3UA 4FV7A 2AUHA 3ZBXA 4CEGA 3GOPA 4NTSA 3G9LX 5FQDC 4DH5A 4TN6A 1OL2A 2W4JA 3CJGA 5FTOA 2X0GA 1ND4A 2I1MA 2W9ZB 4E5AX 3SG8A 3OBJA 3PXRA 2OIDA 3OEFX 4FSZA 2H8HA 3GENA 4FV8A 3N4VA 5J1WA 4F4PA 5KMKA 1P4FA 1PW2A 4S30A 4IE9A 3LCSA 4E6QA 3SV0A 3QQUA 1H25A 3TCPA 3UGCA 3BI6A 1WAKA 1SZMA 1B39A 1JKTA 4RX5A 4DT8A 2GNIA 3QGYA 1VYZA 3VS1A 3I0QA 5AR8A 3KN6A 4WNKA 4JBOA 3R9HA 4M15A 5L8LA 3VO3A 3R83A 3UMWA 5CEKA 1SNXA 3F9NA 3MFUA 3IECA 3R7GA 4IBMA 5CT0A 4D55A 1YXVA 3DAKA 5EQYA 5CTPA 3SD0A 5E1SA 4BDKA 3H10A 5IF1A 1P14A 3BLRA 4BDGA 5BUJA 3NYXA 4TNBA 4DYMA 4K11A 3E5AA 3RALA 2CKPA 3LVPA 4CFWA 2DWBA 3LFCA 3ZRKA 5AV0A 4PNKA 3ELJA 2WMTA 3HEGA 5IA3A 4HZRA 4BWXA 4R5YA 3BGQA 4FGBA 2J9MA 3ZTXA 4I4FA 2UW9A 4X2FA 1OECA 2B52A 4O0TA 3CD3A 5DWRA 3HMMA 1QL6A 3E92A 4YJUA 4L68A 1XBAA 5LVLA 4ZY4A 3G90X 4CFFA 1HCLA 3FZSA 4PDSA 4Y85A 3MWUA 3SA0A 3UG2A 4F0GA 3P08A 5HO8A 3F7ZA 2VTNA 3PZHA 2FUMA 3UMXA 4ARKA 3VIDA 1XKKA 4G3CA 3QGWA 5M4CA 1ZRZA 2GSFA 5IQFA 4O0WA 3BHVA 1W84A 1OM1A 3K3JA 2XZSA 4U79A 4E8AA 4EJ7A 3R8MA 5CAUA 3W33A 3G2FA 3EL7A 4FSMA 2J0IA 3ODZX 5I9XA 3MW1A 5IQBA 2GCDA 1GZKA 3GC9A 4QP6A 5GNKA 4D2PA 5I9YA 5IKWA 4B8MA 1PKGA 3H0ZA 3RP9A 3ORPA 5J79A 3LE6A 4HW7A 3RCJA 1OVEA 4XG9A 5HHWA 3FQEA 4NKSA 4V04A 4HPTE 4UX9A 3RK9A 4IZAA 3IQ7A 4JX7A 4I1ZA 4BRXA 3SKCA 3RPVA 1ZYDA 4DGMA 4RLKA 2JIVA 2Z2WA 3MB7A 4D5KA 3QCXA 1E9HA 4GIHA 5CVFA 3FLZA 4O38A 4DEDA 2F2CB 3E3PA 4UY9A 4BIBA 3NIEA 4C37A 4FKGA 4KRCA 1BUHA 2XJ0A 3E64A 2ITUA 2UZWE 1Z57A 4W4YA 4F99A 3OOGA 3F3TA 2ZVAA 2BZKB 2VTHA 3EKNA 4G5PA 4NZWB 4YURA 4JQ8A 3QX2A 2OJJA 1FQ1B 2XK9A 1F5QA 5CWZA 4DC2A 5CSPA 3NVKI 4TNDA 3DS6A 3K2LA 4AT4A 2X9FA 5CQWA 5ETFA 3QRUA 4O7RA 4FIHA 4C3PA 4V0GA 4MAOA 1Z5MA 4XP0A 3VUMA 4G6NA 4E4NA 2JDSA 5C9CA 3ORTA 4KABA 4EH6A 4JDKA 4X0MA 2QVSE 3PE1A 5CF4A 4PDYA 1PY5A 2OWBA 2X2LA 3ORMA 4YU2A 5TT7A 2B55A 4GFMA 2KULA 4MHAA 3PUPA 4L00A 2YIQA 2V7OA 4ONAA 2W5AA 5B2KA 4RVKA 3EH9A 3FZRA 4KSQA 1LR4A 3EFWA 1MRUA 4Y46A 3WIKA 3ZC6A 3R02A 3TTIA 3R7EA 4FTTA 3PFQA 4D1SA 1TQIA 4LGDA 5DRDA 2WFYA 4ZP5A 4EHGA 2PUNA 4DTBA 4DT9A 2A1AB 5DRBA 4DEHA 5TO8A 3KVXA 4AZSA 3VRYA 2RL5A 3VNTA 4I0RA 4MH7A 4O27B 2BPMA 4OTPA 4TYHA 4I5CA 4DEEA 5AAGA 3VUIA 1O6YA 4JAJA 4O7VA 5HX6A 5IUIA 3NYNA 1PMVA 2VAGA 4DEGA 4HYUA 3MTLA 1YI6A 3BRBA 2XM9A 2QURA 4FL2A 4K2RA 5FWKK 3HDNA 1L3RE 2JAMA 1W7HA 2GHMA 4ORKA 4QMUA 4O7NA 3ZUUA 2PZ5A 3ZSIA 2AC5A 5E9EA 4C35A 3HAMA 3BHYA 3TKIA 5ANOA 3SXRA 5DNRA 5BUEA 3IPHA 4BBMA 5LMKA 2C3LA 4J52A 2YCRA 4TYGA 3NW5A 3LLTA 3UP2A 4FTLA 4CG9A 3NPCA 3HLLA 3D5WA 2IVSA 2ERKA 2J6MA 5KCVA 2YJSA 3A8XA 5KMLA 5JZJA 3L9MA 3QHRA 3VW6A 1JSVA 4D4SA 4EZ3A 3MI9A 2ZMDA 4QMZA 4D5HA 1IA9A 2CNUA 4D58A 5CU4A 3FY0A 1OIRA 2CCIA 4IFGA 4AE6A 4FF8A 1WBSA 3KULB 4KWPA 2BUJA 4DG3E 3PXQA 2XKDA 3WYYA 5J5SA 3LMHA 2BRBA 4ASDA 3FMHA 2UW5A 5CF6A 3NNUA 2YITA 4OT6A 4QPMA 3IOKA 4G9CA 2P3GX 3D5XA 4WG3A 2PVRA 4WBBB 4FC0A 2G2IA 4FT9A 4XG7A 3F5GA 5I3OA 3QTZA 1J1BA 2WGJA 4F1OA 2VX3A 5L6OA 3P78A 2HY81 3BWFA 5BYYA 4FZDB 3ZZEA 1JVPP 2F4JA 3LFEA 3LPBA 3HMIA 4AW5A 5DEWA 1Q41A 1DI9A 3HRBA 4AOTA 4W9XA 3LW0A 2VX1A 4LG4A 5FBOA 3NUXA 2C5OA 3QZGA 3WARA 5AUVA 3PVUA 2X9EA 5HOAA 2R7IA 2HYYA 4DEIA 3FMNA 3HV4A 3BCEA 3LCOA 3Q2MA 4IW0A 2F7EE 3IK3A 2PWLA 4NH1A 2C4GA 4YJNA 4AA4A 3GU7A 5CSVA 3NVMB 1IRKA 4XHKB 2YEXA 2F2UA 3W1FA 4QP4A 1NVQA 4YTIA 2WELA 2IZTA 3TEIA 4RIYB 1UU8A 4IC7A 4KD1A 1RQQA 3NLBA 3QWKA 4DH7A 4CZYB 1B6CB 4X3FB 4IX6A 3FYJX 3TT0A 4PP9A 3QD4A 4LL5A 2CKEA 4UEUA 5DGZA 4RJ7A 3RMFA 3FZ1A 3LXKA 3D5UA 3LM0A 4UN0C 5ETIA 5LCJA 2W0JA 1FINA 4C57A 3ULIA 1G8SA 4IJPA 4Y83A 4MQ2A 4WIHA 3ZZWA 3KEXA 4GT4A 4PTGA 2PE2A 3RZBA 5I0BA 1JSUA 3FMLA 2QOCA 2G2FA 3HUBA 4GL9A 1FGKA 3EWHA 2XCKA 3B8QA 2OIQA 4XG4A 4ACMA 2XK3A 1PYXA 2O64A 3QCYA 5GJGA 3O8UA 2VNWA 2XA4A 4O21A 3FKNA 5E1EA 3U4WA 4ASXA 2ITXA 5AR2A 4CT2A 4IAIA 4FKJA 2G15A 3QTWA 4M14A 4CMTA 4C38A 4J95A 3MN3A 4GJ3A 3DT1A 5IUGA 4PL5A 3RHKA 4II5A 1WVWA 3CTHA 4IZYA 3OC1A 4E6DA 2XIKA 3D7TB 3LIJA 4OTWA 1WCCA 2Y4PA 1XH9A 3F2AA 4RWIA 4UXLA 4U80A 3FYKX 4XP3A 4EK3A 5CEMA 2JITA 3C4CA 3LOKA 4M7IA 3GCVA 1JAMA 3KVWA 4L9IA 3DY7A 2BVAA 4L43A 3FLNC 4XG3A 3D9VA 3FI4A 4PL4A 1YOLA 4EBWA 4AE9A 2PMLX 1XH6A 4JRVA 3ZUVA 2Z7LA 4O0YA 4L3JA 4M68A 5T6KA 5FBNC 5B2LA 4EOQA 4NM7A 5LMBA 3NZ0A 4P5ZA 4OTHA 4RMZA 3T9IA 3TZ7A 4BCIA 5LWNA 5FLFA 3S4QA 4EI4A 5JN2A 3H9FA 2C69A 3KRLA 4JG6A 3C4ZA 1H07A 4CRSA 4QYGA 3FLQA 4HGTA 2R3RA 4QMMA 5HE1A 3UC4A 5AP7A 4L7FA 4ANMA 4EK4A 2WTWA 3RGFA 3TIZA 2WU7A 1G5SA 2NPQA 2VZ6A 3FKOA 2WOTA 4MEDA 4AN9A 4C62A 5HLNA 3U54A 3AC2A 1XO2B 4JL9A 2GQGA 4BI1A 1TVOA 4LRMA 3FI2A 4P4CA 3PG3A 2I0VA 3OW4A 3G5DA 4WUAA 2W05A 2BTRA 2OF4A 3GP0A 2OICA 4B4LA 2FO0A 3EN4A 2I40A 4S31A 2Y4IB 2I0YA 2JC6A 2Z8CA 4OLIA 1L8TA 1Y6AA 4RLLA 4FEWA 1SYKA 4IH8A 4LL0A 5BYZA 4CKRA 2HZNA 4H05A 1J91A 4UMRA 1YQJA 2E9NA 3PPJA 3F3ZA 4ZTRA 3DBEA 3L8PA 3FY2A 3LMGA 3ZLXA 4APCA 3DXQA 4BN1A 1P4OA 5BYLA 4C7TA 3R1YA 2XK7A 4B8LA 1DAWA 4ANNA 4O6LA 1H26A 2HCKA 3VBXA 3JVSA 5CNNA 2OXYA 4FTJA 4O0RA 5BVOA 3S00A 5I9ZA 4FVRA 3D2IA 3WZEA 2VWUA 4E4XA 2SRCA 4N70A 4B6LA 4IVAA 3UC3A 4CQGA 4F6SA 4A9UA 1U4DA 5CEPA 3EYGA 4X7QA 1WFCA 3LQ5A 5CSXA 3F7WA 3FLYA 3MJ2A 2Z7QA 4O2PA 4JVGA 3UODA 1I09A 4AA0A 4EH9A 4B0GA 4D2TA 5CAPA 3SRVB 5AAEA 4F9WA 5J9ZA 1Q61A 5C8NA 3KXNA 4L6QA 4C34A 1CKJA 4XEYA 3AMAA 2VO6A 2ITOA 4UZDA 4D0XA 5AFVA 5CEOA 1Q3DA 4IZ5A 2C5VA 4WO5A 3C9WA 2R3HA 4JIKA 1LUFA 4IB1A 2RF9A 3OT8A 1AQ1A 5DOSA 5EYKA 4BDJA 3D94A 1JLUE 4FSUA 4UWCA 1Q4LA 5D7AA 5CU6A 4ANSA 4K33A 4WOVA 3CY2A 4R7IA 3FPMA 5LMAA 4G17A 4ANOA 3U6JA 3BYVA 5FEDA 4BCMA 3UQCA 2Q83A 3NCGA 2XBJA 3PIZA 2XNBA 3OY3A 3TNPC 2XCHA 2X8DA 2ITTA 3GXLA 4UALA 5GJFA 3QKMA 3M2WA 3T8OA 4AGUA 3ZOSA 2R0IA 2OXXA 5TR6A 3FLWA 3HRFA 3TZ8A 4QTBA 4C4HA 1SVGA 4U97A 2I0HA 4PWNA 4QMLA 1YXUA 4O7SA 4BDHA 4UYAA 2ZOQA 3P7BA 3WF9A 2CGUA 4YBKA 3TIYA 3FZOA 4B7TA 2JAVA 3OXIA 4ZLOA 4DLIA 1ZOEA 4R1YA 4IVCA 4TYIA 3IW6A 5IQCA 4Y5HA 3ZSHA 3QALE 4ASEA 4IMYA 4HVIA 4DITA 5HNIX 2PZPA 4QP2A 4BDIA 3GFWA 4MXYA 3AC1A 4EYMA 3HV5A 4EORA 5IH5A 5JSMA 3TZMA 3EQBA 2WQEA 3LFBA 5M56A 2WEIA 3TXOA 4ANLA 2YCQA 2W1FA 4O6EA 3CQUA 4XG8A 4PPAA 5AV3A 2BAJA 2O2UA 4FKWA 1H28A 5C27A 4EL9A 2IN6A 2CCHA 2WMXA 3KMWA 3AD5A 4UMTA 4UXQA 5A6OA 3TJDA 3VF8A 5CANA 2XJ2A 4QP9A 5HTBA 4A06A 5HZNA 4ITJA 3OCGA 5E8ZA 2E9PA 4MBJA 3DB8A 4U45A 4IXPA 4KS7A 3ZO2A 3LLAA 3P7AA 4DGNA 3BHTA 5JZNA 1R0PA 4KUJA 4FX3A 5IA1A 2HELA 3MSSA 3F3VA 3R1QA 5L6WL 4CFVA 4EH4A 2PU8A 3ROYA 4OUCA 3UYTA 3VC4A 4AU8A 3FV8A 2C5NA 4G16A 5AJQA 1GY3A 2YAKA 4O2ZA 4HPUE 4BCKA 3GQIA 5LXMA 2C6DA 2BROA 3FMDA 2EUFB 3UZTA 4JDIA 2OH4A 2C6TA 2JKOA 2J7TA 3UDBA 1UWHA 2CJMA 2QR7A 3BYSA 4R5SA 4X3FA 4AT5A 4FUXA 2OFVA 3O8TA 4IB5A 4PY1A 5C01A 3R8LA 4IFCA 3JS2A 3NUPA 4I5MA 1UU7A 3GUBA 4BDCA 1KV2A 3DK7A 1YVJA 4NT4A 3KREA 3ROCA 4IVDA 1BLXA 3PXYA 4ZTLA 2ZV2A 4DBNA 4XS2A 5KHWA 5K0XA 1IAHA 5C4KA 3NDMA 5HG9A 4K77A 2Y7JA 3ZONA 1PYEA 3A7HA 4QQJA 5M55A 1R0EA 5JT2A 4DH3A 4YNOA 4U43A 3BGPA 5D7VA 2OLCA 4OR5A 4DFUA 4V01A 2I6LA 4BTJA 4BVUA 4F63A 3WE8A 2W1GA 3KXMA 5EH0A 4AFEA 4FNZA 1STCE 2YCFA 3FQSA 2PZRA 3GCSA 2V5QA 2WMUA 2Y6OA 4I22A 3CKWA 1H1WA 2C6LA 1OL7A 2OKRA 3QBNA 4J96A 5IISA 4O7ZA 4IC8A 2PTKA 3BIZA 3FPQA 4YR8A 3O7LD 5J5TA 4D2VA 4MF0A 2WKMA 5ACBC 3GFEA 4O82A 5C1QB 3VBQA 2YIRA 4NIFB 2VRXA 4JG7A 4OW8A 4FTUA 3OWLA 2BCJA 2CPKE 4IQ6A 2PPQA 5IEVA 4BCGA 3ZFXA 2VGPA 5CALA 2UV2A 1HCKA 3E87A 4C2VA 1M2RA 4CGAA 4LGHA 4FZFB 3U51A 4ZTNA 3SLSA 5CLPA 2QD9A 4ZZMA 4C61A 4C59A 5D10A 5D1JA 2B0QA 1OIUA 3A7FA 5C26A 3LQ3A 4D4YA 4I0TA 4ERWA 5FGKA 4DBXA 5J95A 2OIBA 4BKYA 2PVLA 1MRYA 4LOQA 1OPJA 4NUSA 1LEWA 3EQFA 4QMWA 5HVJA 5AWMA 5FRIA 3MVMA 3I60A 1J7UA 3Q53A 4GMYA 4WG4A 3MIYA 4KIPA 4WD5A 2XK4A 2QHMA 2ZJWA 3DNDA 4CT1A 4O86A 5GZ8A 3NAYA 3W2CA 2VWBA 3ALNA 5DN3A 5GIPE 5AIRA 4A4XA 5H8BA 3CR0A 4YO4A 3EFLA 3MYGA 5DA3A 4DFZE 4FNXA 2XEZA 3RHXA 4EC9A 1YDSE 1QPDA 1Y8YA 2O63A 3CPBA 2R3LA 2BR1A 5CNOA 4FVQA 4RFZA 5C8KA 3R21A 5L2QA 1H8FA 2YIWA 3VUGA 3I5ZA 4QMNA 3G0EA 3MFTA 4ZSGA 3QZFA 4QMTA 4QOXA 2B53A 2ERZE 3FMMA 2WTKC 4L67A 4X3JA 4ZXTA 1IASA 2QO7A 5BNJA 5L2TA 5AUWA 3QD2B 4F9CA 3REPA 3I0OA 4BDEA 2BZJA 3LFDA 2JEDA 4G31A 3Q4TA 4IAKA 4YLLA 2QKRA 2WMBA 3EJ1A 4PDOA 3TKUA 5A4QA 2VO3A 4AA5A 3ZH8A 1BKXA 3ZRMA 2WIPA 3MVJA 3SRVA 3QTUA 4A9RA 2QR8A 3PPZA 2G2HA 3FI8A 4YPSA 2VTSA 3TZ9A 5AP3A 3VS6A 5E8TA 2PMIA 2QCSA 5LARA 3RZFA 4GT3A 2GQRA 1YOJA 3N4TA 2OH0E 4CFXA 4CYIA 4XCUA 4IAYA 5J9YA 4BCQA 5F9EA 2CKQA 5K4JA 5HO6A 5HG7A 2YIXA 5LWMA 5I9VA 5LVOA 3V8TA 3FI3A 4GVAA 5DT0A 4ZSEA 1NY3A 3ZYAA 5FEQA 4JLCA 4QQ5A 4MXXA 4TRLA 5KUPA 3WYXA 3PJCA 4BDAA 4IWDA 5HVKA 4O1PA 4M84A 5IH4A 2BDWA 2P2IA 3COMA 2YFXA 1OIYA 1WBTA 4NWMA 4ITIA 1M52A 3GI3A 4FGRA 2X2MA 4WNMA 2ZV7A 3QLGA 3LFQA 1URWA 4NFMA 5BMMA 1BI8A 3BQCA 3ZLYA 3FXZA 4IWPA 4C02A 3S2PA 1OPLA 2QC6A 5BVKA 2X39A 3W18A 4WBOA 4AN2A 1YI4A 5JFSA 5L3AA 3KXGA 1PHKA 3PSDA 5EI8A 3SHEA 3LFAA 4MXAA 4F9AA 2IW9A 3FDNA 2IZSA 3CLYA 2GNJA 1OMWA 2YIYA 3G51A 4FV2A 2H34A 3KU2A 2UVYA 4UV0A 4XNEA 5AUXA 3V6RA 3V51A 3ACKA 2WTDA 4PMMA 3ZLSA 4OTDA 3SDJA 3TN8A 1KE8A 2B4SB 2F49A 3NR9A 4DG0E 5DR2A 1MP8A 2CHLA 4YJOA 5HG5A 3Q5IA 4RBLA 3LCKA 4MD9E 4NEUA 4QTCA 3QA0A 1QPCA 1ZZ2A 4R8QA 3UQGA 4USEA 4FOCA 3GVUA 1M14A 4GV1A 4E26A 2OFUA 3BEAA 3I79A 3QKLA 2XIRA 5A4LA 3FQHA 4CFUA 1Q24A 3F5PA 1R78A 2R3QA 4FKQA 4IACA 4NFNA 3UVPA 5EI2A 3IDCA 4KKEA 3PA4A 4PL3A 2RKUA 3B8RA 5HESA 4JAIA 2BRNA 2XK8A 3T3UA 5FM3A 3LXNA 2XUUA 3R28A 3QQKA 5JQ8A 1XHAA 3DBFA 3KRWA 3Q9YA 3V6SA 4EWHA 1Y57A 4JNWA 1AD5A 5L2WA 3KK8A 5AP2A 1YDTE 4HGLA 1E1XA 4M69B 5KMJA 1UA2A 3BPRA 1WBVA 3TDVA 4YHFA 2VTPA 2JDTA 5JRQA 4AW1A 4MXZA 5CZHA 3QKKA 3CS9A 4PPCA 1KE7A 3THBA 4GKIA 1RDQE 5IH6A 5K3YA 3U6IA 3QA8A 3UVRA 4F0IA 4TPTA 4AG8A 2X8IA 3HZTA 4E7WA 3G6HA 3O7LB 4O84A 2HW7A 5HTIA 5KX8A 2WMQA 3QD0A 3R7OA 1Z9XA 3MH3A 2QOQA 3TV4A 4QQCA 4AGWA 4Y72A 4D2SA 4BZDA 3PVBA 3DQXA 4ALWA 4NTTA 4CTCA 5CF5A 4YBJA 3ZM9A 3I5NA 3Q04A 3U4UA 1SNUA 3QTIA 4AS0A 3KXHA 2OI4X 2ZM3A 3RJCA 2B54A 4EKKA 1KE9A 2VTLA 3BWJA 3D5VA 3MV5A 4RJ5A 2J5FA 3GU5A 3P1AA 5GIOE 2CNVA 4PTCA 3UNJA 2ZMCA 4U7ZA 4D1XA 1QPEA 5EYCA 3EL8A 3NEWA 3W2QA 3OCSA 4D9TA 2BDFA 4ZAUA 5CAQA 5HLWA 4RSSA 2BAQA 2WPAA 2PYWA 3DTWA 2XM8A 5AP6A 5IG1A 1UV5A 3R8PA 3D4QA 2UZBA 3I7CA 3S95A 3UO6A 3MPMA 4RWKA 4FIIA 4YLJA 5KMIA 2C6IA 5CSHA 3LJ1A 2W96B 3FMJA 3FSKA 4H1JA 1GIHA 1UWJA 2WIHA 3NWWA 4NIFA 2XNEA 5AEPA 3UPZA 1WBNA 4TY1A 2RSVA 4KIKB 2ZM1A 3CIKA 1X8BA 2QOLA 3TJCA 2PVYA 4JT3A 3V8WA 3ZXTA 4ACHA 5GINE 3QLFA 2J0MB 3MVHA 5CF8A 1RJBA 3MTFA 4YZBA 4FTRA 2QHNA 4ZY5A 5EKNA 3GC0A 4BZNA 4FBXA 4I4EA 2CLQA 3HA8A 4IX5A 2PHKA 1WBWA 2DUVA 1ZYJA 4OTRA 3OWJA 3SXSA 3VVHA 4ZOGA 4J8NA 4AZFA 3E93A 2ETRA 2HWPA 4XRLA 3QCSA 1XH4A 2W1HA 4PMSA 3NNVA 5BUIA 5J7BA 4X2KA 3PWYA 5TOZA 2QONA 4S2ZA 4ZMEA 2ONLA 4JS8A 3CBLA 3HA6A 3O71A 1G8AA 3QXPA 2YN8A 1YDRE 5KBQA 4IAZA 4A4LA 3LQ8A 3I6WA 4YTFA 3R9DA 5KO1A 2WTVA 2XIXA 3P79A 2DS1A 2UW4A 4HOKA 2NRUA 5A54A 5EM7A 4IANA 5IA0A 4YJQA 4S34A 5H8GA 3RNIA 5IMXA 5CI7A 1Q8ZA
chains in the Genus database with same CATH superfamily
3COKA 4D4VA 4CMOA 2YJRA 2BFXA 4BTFA 1ERKA 4FKRA 1U54B 2HAKA 2ZYBA 4EONA 5JK3A 5CI6A 4Q2AA 3MPAA 2QOFA 3C0HA 2WMRA 2Y0AA 4LV5A 5CZIA 3ZO4A 5DEYA 5G6VA 4I23A 1YW2A 1KWPA 1PXLA 4Z3VA 3FAAA 3QQGA 3BE2A 2WTJA 4FUYA 4CLIA 1P5EA 1SVHA 4P5QA 4TWCA 3FSFA 4A07A 5BVEA 5F1ZA 3E8DA 4FJVA 3FXWA 4FIGA 1OZ1A 4G3EA 2R3MA 2HY0A 4O22A 4JJRA 3BYUA 4ZLZA 4RIXB 2O0UA 2ZAZA 3PP1A 2PK9A 3EB0A 4TTHB 3LM5A 3GCPA 3BBWA 3LAUA 3U9NA 4H3BA 3UNKA 4DE4A 3IW4A 3L9PA 1WBPA 2YZAA 3DOGA 1CTPE 2VTOA 4DGGA 4DDIA 2PL0A 1Q8WA 4K0YA 4WG5A 2UW8A 2BFYA 4WT6A 3ORLA 2FSMX 3MBLA 3NCZA 3EQRA 2YAAA 4FMQA 4L3PA 4U5JA 3WIGA 1GZOA 4AUAA 5AR4A 2X0PA 2YM7A 4XV3A 3VS3A 4BC6A 5HD7A 4CVAA 5EW3A 5CSWA 2PE0A 1SVEA 3CSVA 2GQSA 3G15A 4L52A 3S0OA 4RJ8A 1KOBA 5ETAA 5K4IA 3LCDA 4E6CA 2GNGA 2WD1A 3QYZA 5A9UA 3ZCLA 3TUDA 3PXKA 4JQ7A 2BDJA 2VWWA 3A60A 4OBQA 4EH3A 5CAVA 3UJGA 4QO9A 1O6LA 3HGKA 3UP7A 1ZARA 4IB3A 1RW8A 3AKLA 1F3MC 1LEZA 2A0CX 3K5UA 2J50A 3M11A 3VS7A 4EJNA 5AA9A 4FV4A 1PXMA 2UVZA 1UU3A 2VNYA 4F9YA 4FTMA 3BEGA 3VRZA 4V05A 3I4BA 2A4LA 2X4FA 4BHZA 2UW6A 2X7OA 3FHRA 5A3XA 1OPKA 3DZOA 3DK3A 4BJJB 4GRBA 5IPJA 2C30A 2W1ZA 4JBPA 4I41A 3EOCA 4YSMA 4EHEA 5G1XA 4EOKA 3A4OX 4RVTA 4YP8A 3U55A 4BDDA 5M08A 4IM2A 3R2BA 4CQEA 4FYOA 4ZS0A 4U3YA 2WMAA 3L8SA 4BKZA 3NUAA 4EK8A 4U42A 4FV0A 1XR1A 2Y6MA 2A19B 2UZVA 4I21A 4LOPA 5FTQA 4DTAA 2C68A 4BCFA 4XV1A 3PRFA 3Q6WA 1KOAA 2XYNA 2UZEA 2XRUA 2OW3A 4MXOA 1T46A 4OTQA 3JPVA 4ZJJA 4U6RA 1KE5A 4Q9SA 4A4OA 3UQFA 4K1BA 1V0BA 3MPTA 4NCTA 4QP3A 2PUPA 4RC4A 2GHLA 3B2TA 3QXOA 4I6QA 2IVVA 4FSTA 2A98A 3R8UA 5F20A 3MESA 3GB2A 4D9UA 1I44A 2VWXA 3NW6A 2XNGA 2CGWA 3H30A 4HNIA 3V5PA 4ZMFA 2VO0A 5ANEA 3NGAA 5B7VA 4G6LA 4UBAA 4DTKA 2UZUE 5M4IA 4IHPA 3PDTA 2BIKB 1GNGA 3GCQA 4ZSJA 1YXSA 3OUNB 3DTCA 2QG5A 4FEXA 4FT5A 4DFNA 2UVXA 4NW6A 4DAWA 4EZ7A 5F4NA 1XBBA 4IAFA 4EKLA 2W06A 3DFCB 1UKHA 5HU9A 4LQMA 3RCDA 4W9WA 3AC3A 3HDMA 5CQUA 3EHAA 2WHBA 5BVDA 3NNWA 3TNHA 3EN5A 4UMPA 1J7LA 4HCVA 4GSBA 2C0IA 3H9OA 1BL6A 3P7CA 3IDPA 3ORNA 3PSBA 4YLKA 4AXAA 1NA7A 3W2SA 4CV8A 2YM5A 2QOIA 2ZDUA 3E7VA 5KMOA 5A6NA 3VONA 3R1SA 3IGGA 4YNEA 4M3QA 4L46A 1OKYA 2HXLA 4BTMA 4J7BA 4B99A 4CV9A 3DK6A 2R9SA 5CEIA 1CDKA 4C4GA 4LUEA 4C3RA 3UIXA 2R5TA 3BQRA 4PRJA 3VHKA 2XBAA 3AQVA 4RA4A 4RZVA 1YHVA 4XJ0A 4EUUA 2ZV9A 1Q97A 3O0GA 4GK3A 4LMNA 4UZHA 4YJVA 1OKZA 4WHZA 5IZFA 5M4UA 4QNYA 4AZWA 1VR2A 4QPSA 1OBGA 2ESMA 1GAGA 1Y8GA 1XH5A 2V62A 1KSWA 1OL5A 1TKIA 4X2GA 2Z60A 3P4KA 5ANDA 3VF9A 5CT7A 4H3PA 1XH7A 2YLFA 3RPOA 2C1AA 2W5BA 3CJFA 3KRXA 3DZQA 3LJ2A 3UOLA 1H1PA 4YC6A 3LZBA 4BWPA 3NYVA 5HO7A 5JH6A 3FZTA 4RJ6A 4EK5A 4CCUA 2C6OA 4ZJIA 4KB8A 4ACDA 4MD8E 2FA2A 4N4SA 3BX5A 4U3ZA 4EOPA 3DAJA 4F7SA 4ENYA 5JGAA 4MBLA 4CG8A 3TNIA 4AX8A 1R3CA 2C6EA 3GOKA 4KBCA 3FHIA 3PE2A 5FXRA 3SAYA 4BB4A 5EFQA 4QNAA 3W8QA 1GZNA 3R9RA 3ZEPA 2WXVA 1Q99A 4GK4A 4MNEB 4FODA 5ACKA 4C0TA 2GS6A 3Q5ZA 3OUKA 2X7FA 2FGIA 2BTSA 4JR3A 2AC3A 2ZV8A 3GC7A 3AC5A 3NUNA 4FG8A 4QP7A 4GYGA 3W8LA 4G2FA 1PXKA 4M97A 4XRJA 5HE2A 4NYEA 4HGSA 4R3CA 4IDTA 3KKVA 2XNMA 2ZDTA 4W4VA 5E8UA 4DH8A 3PJ8A 4Q5EA 3U9CA 3VUHA 2R3KA 1VYWA 1ZY4A 3MIAA 5EHLA 3EQIA 2RFEA 3POZA 3ZO1A 4CNHA 3CGFA 5IQGA 3R2YA 5J9LA 4YC8A 4PF4A 1XH8A 4QMPA 4RJ3A 1PMNA 4E4MA 4YC3A 4UWYA 2JBOA 2GNLA 4ENXA 2FSLX 3PP0A 3QD3A 4QMOA 3AGMA 3VUDA 4G3GA 4PV0A 2QOKA 5M53A 4ZLYA 4RFMA 4W8DA 5AUYA 4L42A 2QOOA 2G1TA 3GU6A 3H0YA 3Q4CA 3OS3A 3VBWA 4HVDA 1JKLA 3L8VA 3LHJA 4W4XA 5AUUA 3QU0A 4RIXA 5JFWA 4NJ3A 5FUTA 3KULA 3EQGA 3OBGA 4HVHA 4HNFA 2P33A 4XH6A 4FIJA 3IOPA 2XIYA 2R2PA 2GPHA 3IG7A 2HK5A 3W10A 2QU6A 4QYEA 4QP1A 3U6HA 3BGZA 2E2BA 1J7IA 3ODYX 3NSZA 5EM8A 5EQPA 5A14A 3FC1X 3CP9A 3RM6A 4OAUC 5AADA 4BIDA 3Q32A 3JYAA 2XKEA 3LJ0A 5E8VA 1FMOE 4F09A 3OXTA 5GZAA 4F7LA 2WQNA 2YISA 4GUBA 4FICA 1V0OA 3SOCA 4QTAA 3DFAA 4FV9A 3F88A 4R3PA 5L4QA 1ZYSA 4FL1A 5DBXA 3UIMA 1M7NA 4DEBA 1A48A 3PG1A 4BHNA 3P86A 4EUTA 3RAHA 4D2WA 1VLRA 2VWVA 3ZUTA 3KC3A 3F82A 2B1PA 3D7ZA 1OI9A 1OKVA 2WMVA 2W1DA 4TYEA 4FT0A 3ZSGA 1ZOHA 2C0OA 5EM5A 1REJA 2J0LA 3NS9A 5EKOA 5AR7A 3RPSA 3S3IA 4JRNA 5BV3A 3F2RA 1M2QA 2J90A 4KIOA 5B2MA 3SC1A 2HIWA 1SM2A 4LV7A 4RIYA 5T68A 3OOMA 4WSYA 2EXEA 4R1VA 4I0SA 3AKJA 3O96A 4C4JA 4PMPA 3JR1A 4Y8DA 3RVGA 1O9UA 1PKDA 3HL7A 5IMEA 1BL7A 2ZB0A 2V7AA 2Y8OA 1P2AA 3OWKA 4WUNA 2O65A 4J98A 5LOHA 4UMUA 3DJ6A 4Q9ZA 4OTIA 4C33A 5HCZA 5AR5A 2C6MA 4G34A 3F3WA 4JR7A 3SOAA 4GJ2A 4QRCA 2GS7A 4E1ZA 5HNGA 2B9JA 3SVVA 4O7WA 3HRCA 2W4OA 3R71A 4R7HA 3PZEA 3DKFA 4NKAA 1JKSA 2YCSA 5K0KA 4JDJA 5LMKC 1BI7A 2ETKA 2DQ7X 4WA9A 1PXNA 3BV2A 3UZPA 4H36A 5CY3A 4FG9A 4GYIA 3PY1A 3KL8A 4K18A 4U0IA 4FVPA 1FVTA 2V0DA 3T3VA 3TI1A 4EZ5A 2H9VA 4GW8A 4E3CA 2F7XE 4LV8A 5AP1A 5HQ0A 3AG9A 3OG7A 4F1MA 2ITVA 3Q3BA 3ZO3A 5JEBA 1YOMA 3D7TA 3KRRA 3QRTA 1GJOA 3A4PA 2VUWA 5KKRC 4CFNA 2W5HA 3QF9A 5AV4A 1YXTA 3L9NA 2BKKA 1ZOGA 1WVYA 1UU9A 3QHWA 1QPJA 1SMHA 3IW8A 3FBVA 1BYGA 2WQOA 4GG7A 1S9JA 3TV7A 1MUOA 3E7OA 3C1XA 2WQMA 3Q9XA 2QQ7A 1ATPE 2ITQA 1Q8TA 2XRWA 2YABA 3QZHA 4FYNA 4HGEA 5FP6A 4M13A 4TZRA 4BYIA 4R78A 3DBDA 4UWBA 2ITYA 2YACA 2OO8X 2UW3A 4O1OA 4AOJA 3KGAA 3KN5A 4G6OA 4MCVA 4WSQA 4LM5A 4AN3A 3G0FA 5CYIA 3HVCA 4QD6A 4CMUA 2QG7A 4BICA 4O96A 5E4HA 3BHHA 4R6VA 2J4ZA 2XKCA 3CD8A 2VTRA 4YZMA 2I7QA 1K3AA 4APPA 2PZIA 4AQCA 4AW0A 3VN9A 2W1CA 4D4RA 3A99A 4V0GB 3R22A 4X21A 4G3FA 2LGCA 4E20A 1ZMUA 4YZCA 3PJ3A 3ZBFA 2XYUA 3GU4A 5I9WA 4QDEA 5DYJA 3JUHA 2OJIA 3PPKA 3WZJA 2C3JA 3QQFA 4C4IA 4FSNA 5EYMA 5DVRA 2OF2A 3V04A 3ORIA 4IWOA 4EQUA 4O7LA 1H0WA 3DA6A 5JGBA 4RZWA 1OITA 1NVSA 4FKTA 2GFSA 4PP7A 2HZIA 5FM2A 4FI1A 5E91A 5IDPA 2GMXA 3UTOA 3HNGA 3P5JC 4YHJA 3SGCA 2JBPA 4PTEA 3QWJA 3KMMA 3EZVA 4G1WA 4NK9A 2BAKA 1NVRA 4HYHA 4MK0A 2GS2A 4N0SA 4EBVA 2WU6A 4J1RA 2WB8A 1W98A 4EOOA 5LVNA 5HEZA 1LP4A 5FDXA 5ITAA 1M2PA 5E92A 3OD6X 4ZTQA 1AGWA 2A2AA 3F5XA 4RC3A 4YHTA 5EDQA 3R7VA 4JXFA 2HZ4A 5DIAA 1JQHA 2Z7SA 3KF7A 4Z9LA 1M17A 2XK6A 2OZOA 2YDIA 1W0XC 4I5PA 4E93A 5HCYA 3HECA 1U5QA 2OBJA 3DKCA 3QTSA 4I93A 2R4BA 5HIBA 3Q9ZA 2VTIA 3TM0A 1XJDA 4MNEA 2XNPA 3TNQB 2C1BA 4LFIA 4BGQA 2JD5A 4JDHA 5EQEA 4YJSA 5FD2A 2IW8A 5E8XA 5L2IA 1WMKA 4HYIA 5IU2A 5HBHA 3W2OA 5D41A 3ID6C 3NUUA 5DT3A 2FB8A 4KNBA 3MY0A 4O0SA 1KV1A 5CS6A 3ZDUA 4QYFA 5FXSA 3COIA 5H9BA 4MTAA 1PXOA 4ALVA 4Z16A 4FKLA 4AGCA 4CKIA 4TKSA 4XBRA 3V3VA 4FIEA 3HMOA 5KKRB 5H8EA 5ANIA 4EQCA 3R8ZA 4HCTA 5BVFA 4O91A 3VBYA 3AD6A 2OSCA 4FV3A 4L7SA 3PY3A 2XS0A 1V0PA 3ATTA 2OGVA 1ZLTA 5KMMA 1YI3A 2GFCA 2X7GA 3C4XA 5HGIA 4ZK5A 3PY0A 3MH2A 4YTCA 4M67A 2FH9A 1J3HA 3F61A 4RX8A 5DMZA 1YWRA 1ZXEA 5KHXA 3DDQA 3OCBA 2VWIA 3PA5A 3ATSA 2BHHA 4F6UA 5I4NA 5AMNA 4BKJA 5J87A 4BCJA 4FEUA 2YM8A 3ITZA 3G6GA 4S33A 5GZ9A 2R3GA 2JLDA 3HUCA 3WF6A 3NX8A 1ZY5A 4FZ6A 3CXWA 4KKHA 1OUYA 4F70A 4EK6A 2HXQA 5BQ0A 3SQQA 2Y9QA 3T9TA 3QAME 3QYWA 4AZVA 3CGOA 5LVPA 4BCHA 3VS0A 3TV6A 5I3RA 4O81A 2BZIB 2EXMA 3ULZA 5TE0A 3BLAA 3C51A 3E8CA 2EB3A 5HVYA 4FOBA 4TT7A 3V5LA 4ITHA 3ML1A 1PJKA 3BYMA 3QUPA 1JWHA 2OXDA 3GEQA 5KMNA 4DEAA 4EHVA 4CYJA 2V22A 3R04A 4G9RA 2ITWA 4N6YA 3IW5A 2LAVA 4EOSA 1VEBA 1FVRA 4LGGA 2CNQA 3DXNA 5AP4A 1OL6A 5DI1A 5F95A 1LPUA 4FV1A 5EDPA 3R7IA 4AOIA 4BDBA 1XMLA 4KKGA 4MWHA 2XB7A 3GC8A 4AXDA 5HE3A 3KA0A 5HNBA 4J99A 4HJOA 2IG7A 4IZ7A 3ZFYA 5A4CA 2XJ1A 4RIOA 3D0EA 3UOJA 3A7GA 4QMSA 4U40A 3FKLA 1GIJA 3ZFMA 3G9NA 3NMUF 2NNWB 2WTKB 2VTMA 3C4FA 4XLVA 5E8SA 3IW7A 2X2KA 2YDJA 2RFSA 2JIIA 3K5VA 1WBOA 2CGVA 3Q52A 1OGUA 4XYFA 3DLSA 4USDA 5CXHA 5IQHA 3TG1A 4GS6A 3PRIA 1CM8A 2CDZA 2J0JA 4FKPA 5JRSA 3ZXZA 1URCA 2IO6A 1A9UA 4UB7A 5EK7A 5AIKA 1IG1A 3HV7A 3DU8A 5AX3A 2QNJA 3VQUA 4I20A 2UZDA 2O8YA 3ANQA 4TW9A 3SW4A 2EWAA 4J71A 3ORKA 5M06A 2XF0A 4XG6A 2GNFA 4OT5A 3A7JA 3CTQA 5HICA 5AUTA 3NUSA 3RPRA 2GHGA 4O83A 2EXCX 3C4EA 1H00A 3O50A 4GEOA 3ZHPC 3MB6A 1YRPA 2C47A 4XV2A 4TWOA 4XOZA 3N4UA 2UZNA 3OWPA 1JOWB 4H3QA 4XX9A 1Q5KA 3BBTB 3P9JA 5AA8A 3ANRA 3RKBA 3MFRA 2H96A 5FDPA 3HMNA 3KXZA 4GKHA 4G5JA 1WVXA 4M0YA 1FBNA 3EYHA 5CXZA 4YTHA 3QRKA 5HE0A 2YWPA 2WQBA 3HKOA 3ETAA 4GU6A 4YMJA 4IM3A 3GU8A 2P2HA 4X2NA 3SG9A 4K9YA 5IA5A 5DG5A 3ALOA 3QL8A 3RK7A 2PMNX 3QFVA 1PMEA 4DF3A 3CQEA 5TF9A 3KK9A 4WRGA 4QTDA 4ANBA 5K5XA 1IA8A 4L8MA 4A9SA 2XEYA 4AAYA 1W83A 3II5A 3R7UA 4BR3A 3FZPA 1S9IA 3LFFA 4QMXA 4K8AA 1VZOA 4CZTA 4OAVB 4FTNA 3AD4A 3V5JA 2OZAB 2WEVA 3OP5A 4GFOA 5E8WA 2OK1A 2W17A 3ZLWA 2HZ0A 3EQCA 2OJ9A 2QODA 3LXPA 2OU7A 4G3DA 4U41A 5DH3A 3WI6A 4EH8A 4LI5A 4EOJA 5DPVA 2C6KA 3NYOA 4F6WA 4KRDA 1OIQA 3UOKA 4FIFA 3FC2A 2QOBA 3CCNA 4RFYA 4U8ZA 2IPXA 4QDVA 2GTMA 2R3IA 4XUFA 3OMVA 5LCKA 4DG2E 4O0XA 1OL1A 2XNOA 4N6ZA 3UO4A 5M51A 2YM6A 4I6FA 5JMSA 2HWOA 2IVTA 2WO6A 3MH1A 3OF0A 5E7RA 3CEKA 4QTEA 5D9HA 5AV2A 3V8SA 4H1MA 2HOGA 5FP5A 5ANKA 4A9TA 5BVNA 3BU3A 5EM6A 4D1ZA 4D0WA 2RIOA 2XARA 2WOUA 3VS2A 2J0KA 4KSPA 5EOBA 5CASA 4JX3A 2CKOA 4LYNA 2OJGA 3PWDA 3Q9WA 1OUKA 4FTIA 4GIIA 4E5BA 4YO6A 5AUZA 3GT8A 3HP5A 4KINA 4O4BB 1Y91A 2VGOA 2ZM4A 3R00A 4X3FC 4H39A 1YKRA 3FMEA 3V5WA 4ERKA 2WMSA 5M09A 4L3LA 3PJ2A 3WF7A 2HENA 3QCQA 3KCKA 5EW8A 5CVHA 3CTJA 4DHIB 5GINE 3MVLA 3NIZA 4AF3A 2PVJA 3ENMA 5IUHA 3OXZA 3VQHA 4F08A 2I0EA 3RBWA 2IZRA 2A27A 5HBEA 3UIBA 2IEWA 4ZSLA 4FV5A 3ENHA 4H58A 5EW9A 4IX3A 1IR3A 4FNYA 2ETMA 5IA2A 4BJJA 1Q8UA 3KRJA 3MY1A 4BCPA 4UYNA 3TACA 4O7TA 4YJRA 5H3QA 5HIEA 3WE4A 3QQLA 1HOWA 3D14A 4ID7A 1NXKA 3IO7A 1APME 3E63A 2F7ZE 2PUUA 4PX6A 1EH4A 5ICPA 3H3CA 1U5RA 1ZWSA 4YSJA 5HBJA 5AAFA 2BILB 3QRJA 2FSTX 4CCBA 1YWVA 3QX4A 4FG7A 1K2PA 4DH1A 4AACA 4IDVA 4AW2A 4RG0A 3A2CA 2H6DA 3U8WA 4JBVA 3UE4A 3OFMA 3VS5A 3KY2A 5BVWA 1TQMA 3UYSA 2JDVA 3ZEWA 4ZIMA 3UNZA 4K6ZA 4NJDA 4TYJA 3D83A 4TWNA 4QP8A 3R7YA 1IAJA 1XQZA 4J97A 4IIRA 2QO9A 4FTQA 4J53A 3C0GA 4LOOA 5M57A 1H08A 4NM0A 4DCEA 4RRVA 3VW8A 2X81A 4E5WA 3HV6A 4L44A 4BDFA 2BHEA 2IWIA 1MRVA 2OJFE 2VTTA 4O4DA 3R63A 5KZIA 3EN6A 1ZZLA 2JFLA 1RE8A 3DBCA 3OTUA 2UZTA 5CU0A 4KS8A 5JGDA 2E9OA 3KXXA 1H24A 1XBCA 2YLEA 5FTGA 1GZ8A 4FSQA 5EYDA 1JNKA 1MQ4A 2XP2A 4NSTA 3IONA 5C03A 3RWQA 3O17A 3ZU7A 2UZLA 3KMUA 2FYSA 4L53A 3RK5A 3RPYA 1PXJA 2RG6A 3OTVA 4WNPA 4LUDA 1ZYLA 3VBTA 4AQKA 2B9IA 2G01A 3L9LA 4FTCA 4U81A 3AT2A 1UNLA 4I24A 3AOXA 3UPXA 5F94A 4ZSAA 4GFGA 2XANA 2Y4IC 1DAYA 4JQEA 4AZTA 4FK6A 3VUTA 3TUBA 3E88A 3WZUA 2B7AA 2IJMA 4BZOA 3UO5A 2Q0BA 3HX4A 3L8XA 2VD5A 3FEGA 1DI8A 3AT3A 3MDYA 4DFXE 3KQ7A 2ZB1A 3CQWA 2YHVA 4EC8A 4F9BA 4EH7A 5FEEA 3EN7A 3UIUA 4F7JA 3RM7A 4ZJVA 4I6HA 4QYHA 3WZDA 1V1KA 3W55A 3FL5A 4FL3A 2X6DA 2VU3A 4OTFA 4QMQA 5KBRA 2UW7A 3EFJA 5HI2A 3R1NA 4O7YA 3JY0A 3PVWA 1J1CA 4F0FA 3Q4UA 4ZTHA 4BL1A 2QU5A 1XWSA 3ORXA 4IWQA 2RFDA 5A4TA 5HU3A 3A61A 3EIDA 3DKOA 4P7EA 2XVDA 4E6AA 4M69A 4AAAA 3W2PA 1CMKE 1OGYA 3QQJA 4S32A 2PE1A 5KNJA 4RPVA 4MWIA 3OEZA 1OBDA 2B9HA 2J5EA 1GIIA 3BKBA 3BYOA 3TNWA 4ALUA 4FA2A 1KUTA 3C5IA 3LMIA 3ZS5A 4BFMA 3QZIA 3C13A 4GT5A 2ITPA 3PXFA 4E4LA 5AM6A 3E3BX 3WF8A 3GBZA 4EOIA 3IKAA 2WAJA 2VTJA 3L1SA 4IADA 4Y95A 4Z55A 5JFXA 4KAOA 3PTGA 3ZM4A 3SX9A 1E1VA 2CN8A 3PVGA 3LFSA 2R3JA 3GQLA 1IEPA 3CE3A 1WZYA 1G8JA 2OG8A 3K3IA 3DJ5A 3RNYA 3DQWA 2VX0A 3NW7A 4DHFA 1PXPA 2VTAA 3ET7A 4ZZNA 3PIXA 5IA4A 3JXWA 4CTBA 2E9VA 2W99B 2YWVA 3R73A 2O5KA 3CC6A 5HORA 3HP2A 3MGYA 3DGKA 4DN5A 4RIWB 1B38A 3QC4A 3UBDA 4BWKA 3EQPA 1Q8YA 4IEBA 1REKA 2IF8A 3AMYA 1FGIA 4DINA 1U59A 4OGRA 4ANQA 2YA9A 2XMYA 3VWAA 1R1WA 4EEVA 5IEYA 4P90A 4HZSA 4XOYA 4IAAA 4IX4A 4BI2A 3RAWA 2P4IA 5IDNA 4HVGA 3COHA 4XV9A 5FXQA 4Q5HA 5L8JA 5EG3A 4KIKA 2W4KA 2BRGA 2WNTA 3WILA 4F64A 2WZJA 2OZAA 3F5UA 4FSYA 4YPDA 4WRSA 5EOLA 4JOAA 1CKPA 2WMWA 1ZYCA 5M44A 4D28A 5JKGA 3VBVA 3FL4A 5D11A 2F57A 4HVSA 4F78A 3R9OA 4GCJA 2RG5A 4KBKA 2P0CA 2R3NA 4IJ9A 1H27A 5B0XA 4MQ1A 2VTQA 5CU3A 3VAPA 1PXIA 2VO7A 3UG1A 1A06A 3P23A 3D15A 3FMKA 2R3FA 4I5HA 5IEXA 4HCUA 2GTNA 2V55A 3FJQE 5ANJA 5A46A 3VUKA 3GGFA 5E8YA 3EQHA 5HCXA 3VHEA 3OT3A 5I9UA 4TL0A 5BX0A 3C4WA 3PLSA 4LRKA 4PQNA 3OHTA 1H0VA 5IQAA 3D2KA 3QUDA 4MD7E 4I6BA 3F69A 3QUEA 3KF4A 5I5ZA 3FE3A 4CLJA 5LQFA 5IQIA 3JY9A 4ZTMA 4FKUA 5EI6A 3BU6A 3RTPA 5DE2A 4EYJA 2BIYA 4YGAA 3W2RA 4TWPA 4FKSA 3G33A 3FXXA 3SW7A 1U54A 2W1EA 4JI9A 2XNNA 4NM5A 5AM7A 3WZKA 1M7QA 3DV3A 3C7QA 4U44A 1R39A 3Q4ZA 3VULA 2XKFA 2F9GA 1ZMWA 4DA5A 3V5QA 1OB3A 3PLAE 1ZAOA 3DNEA 4F7NA 2VWYA 3AGLA 2GDOA 4YZ9A 3TL8A 1FPUA 3CY3A 2R7BA 1U46A 4FZ7A 5AP0A 4KIQA 4XP2A 4FEQA 3AC4A 3HV3A 2UUEA 4FT7A 2JKMA 4QT1A 5DLSA 4QQTA 4FE2A 4CRLA 3DAEA 3PXZA 3I6UA 4ZTSA 3EQDA 5L6PA 4BGGA 1FVVA 2XIZA 3MJ1A 3R6XA 4TXCA 3BLQA 4CZUA 5M4FA 4FR4A 2REIA 3ZDIA 1NW1A 4YZDA 2Z02A 3OVVA 4RC2A 5JFVA 3I81A 2VN9A 5LVMA 3Q96A 4PNIA 3BU5A 4NM3A 2QO2A 2YM4A 4AZEA 4GH2A 1W8CA 5E90A 2C3KA 2QKWB 3QC9A 5J1VA 5K5NA 3N9XA 2VWZA 5TKDA 4MXCA 5HD4A 2C3IB 4FRFA 4EH2A 3DBQA 3I1AA 1FOTA 4FTAA 4M0ZA 5GHVA 4DGLC 3TUCA 2JIUA 3POOA 4PPBA 2ITZA 4W8EA 2VV9A 5HKMA 4JIAA 1DS5A 4DLJA 5AP5A 3PJ1A 4RWLA 3JVRA 4O4FA 2WTCA 3PYYA 4GU9A 3MY5A 4IB0A 3KFAA 3LFNA 3RWPA 4FV6A 4DFLA 4FKIA 3MA6A 5AX9A 3UVQA 2G9XA 2W7XA 3K54A 4I92A 3QQHA 2QI8A 5GJDA 3TWJA 2YERA 4O0VA 5A4EA 3C0IA 4C2WA 5HIDA 3Q60A 4F1TA 3P5KA 4FTKA 3UDZA 2IVUA 4AGDA 4I94A 4JG8A 1JKKA 3ORZA 2PUIA 3TYKA 4RX9A 4QMYA 1H4LA 4WNOA 1BX6A 2W1IA 4IVBA 4R3RA 5CAOA 2ONLC 4FK3A 4RWJA 5M07A 2GNHA 4RJ4A 4OBOA 4QYYA 1UNHA 4BTKA 3OZ6A 1Y6BA 4MVFA 4EOMA 4DFYA 3CKXA 3F6XA 4ZY6A 5KE0A 4CKJA 2BKZA 2FVDA 3MA3A 2BALA 4AP7A 3QTRA 4OBPA 5CENA 4AT3A 4RT7A 1H1RA 1JPAA 2EB2A 5CEQA 1K9AA 4AXCA 2JDRA 3V01A 3NNXA 3EZRA 2PMOX 4L01A 2JKQA 4PDPA 4GUEA 4O4CA 4M66A 2E9UA 5AR3A 2WTIA 3CPCA 3V5TA 4DGOA 4Z7HA 4USFA 4FEVA 3C5UA 2PVMA 1F0QA 3DJ7A 3RAKA 4R77A 1G3NA 3WF5A 4MBIA 3AMBA 4PUZA 4B9DA 4Y5QA 3E8EA 3NUYA 4R7BA 3DXPA 5ANGA 1JSTA 2YM3A 2R3PA 3DLZA 5DR9A 2C5XA 5J8IA 1OKWA 3OCTA 3ZRLA 2DYLA 5EHOA 5L2SA 4YJPA 4FT3A 2X6EA 2IW6A 4C36A 4BIEA 3PSCA 2PVKA 2X8EA 4LRJA 3AT4A 4UMQA 3NRMA 4X6QC 4EHZA 1QMZA 2QLUA 2XH5A 4YJTA 2X4ZA 2NRYA 3N51A 3EFKA