4G3FA

Crystal structure of murine nf-kappab inducing kinase (nik) bound to a 2-(aminothiazoly)phenol (cmp2)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
333
structure length
312
Chain Sequence
SGSVSSGQAHSLASLAKTWSGPETEDNEGVLLTEKLKPVDYEYREEVHWMTHQPRVGRGSFGEVHRMKDKQTGFQCAVKKVRLEVFRVEELVACAGLSSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLIKQMGCLPEDRALYYLGQALEGLEYLHTRRILHGDVKADNVLLSSDGSRAALCDFGHALCLDYIPGTETHMAPEVVMGKPCDAKVDIWSSCCMMLHMLNGCHPWTQYFRGPLCLKIASEPPPIREIPPSCAPLTAQAIQEGLRKEPVHRASAMELRRKVGKALQEVGGLKSPWKGEYKEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of the catalytic domain of the NF-kappaB inducing kinase reveals a narrow but flexible active site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
molecule keywords NF-kappa-beta-inducing kinase
total genus 107
structure length 312
sequence length 333
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2012-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4g3fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4g3fA01
3G33A 3HMIA 3PIZA 5L2WA 3W16A 2C3IB 5KMLA 3NSZA 3ZONA 4F6WA 1ZYCA 2UW0A 2HZNA 2Z7QA 4YZDA 3RCJA 3TZ9A 3UZPA 2GS7A 3IDPA 5AIRA 3VQHA 2NO3A 2ZOQA 4V05A 5AMNA 1U5QA 3FLNC 1OVEA 2CLQA 2X4FA 3PY3A 5D9HA 3IK3A 3OFMA 4R1YA 1XBBA 5GIPE 3S3IA 4FE2A 1DS5A 2X2LA 2CJMA 4L00A 2BHEA 5C1QB 4RX8A 3FPQA 4YJVA 4HCVA 2NP8A 3OHTA 2C0IA 2PVHA 2V7OA 2YM5A 3EN6A 1S9IA 2C6LA 3UMWA 1SM2A 5L6OA 3G0FA 4IB0A 4H39A 5CEMA 1OGUA 2IVUA 3EN9A 4DG2E 4I0RA 3F2AA 3QF9A 3HLLA 1QPJA 3I6UA 4U81A 2PVKA 4FTUA 3F3TA 3DLZA 4X7QA 4C4HA 5CAQA 2XKEA 2HY81 4IWQA 5DOSA 3R00A 3VS4A 3BU5A 3EJ1A 1DAYA 1A9UA 3VRYA 4JAJA 4AZTA 3L8PA 2W4KA 1WCCA 3QXPA 5CSVA 4G3GA 3GU8A 3AGLA 2B4SB 3R04A 3FSFA 3GEQA 3DV3A 3RZBA 3H9FA 4YC3A 5M56A 4ZSJA 2C1BA 2VTMA 4UB7A 4GV1A 3W55A 3H30A 4XYFA 1KUTA 3VF9A 3SLSA 4NYEA 3MH3A 4FSZA 3Q04A 4O7LA 4O1PA 4O7NA 5FP6A 3A8XA 3I4BA 4UBAA 4YJSA 3UG2A 3ORTA 4U97A 4YO6A 3C1XA 4KKEA 5B7VA 4DG3E 2C69A 4CFNA 3IOKA 2VWXA 5CVHA 3GC9A 5D7AA 2WO6A 4O91A 5KZIA 3UZRA 5I0BA 3FAAA 1GZOA 3EFJA 3PTGA 1YDRE 4S32A 5KNJA 4XOZA 3Q6UA 2O64A 3FMJA 4MXAA 2J0IA 2X8EA 4UYNA 5GJDA 3VO3A 4L7FA 4PL3A 1YVJA 4RIOA 4MXCA 4Y83A 4FSTA 2WZJA 2XYNA 4BTMA 3BU3A 2BROA 2XIKA 4QTEA 4NH1A 2R4BA 2WPAA 4WSQA 5F95A 3IPHA 3ZLWA 4EBVA 3DKOA 3EQRA 3C51A 4BCIA 4LI5A 4Y85A 4IVAA 3VVHA 4JDJA 4E4LA 2V62A 2OG8A 3REPA 3PFQA 3U9CA 1JWHA 3DK3A 2P3GX 4BDGA 1KV2A 4AE9A 1O6KA 1QPDA 4X6RA 4YHTA 4ALWA 4PDOA 4R1VA 2GHMA 4QMMA 3PSDA 5DGZA 3POOA 5J95A 4FZDB 3PDTA 3RI1A 5CF4A 3HRFA 3Q5ZA 5EHLA 3O0GA 2W1FA 3QCQA 1Z9XA 4Z7HA 4L67A 4UXLA 4H1MA 5AUYA 2EB2A 1F0QA 1SMHA 3F66A 3BQCA 5BUJA 2YM7A 4IAFA 5HGIA 2HK5A 3DJ7A 3R9RA 4ZY5A 3KF7A 4M69A 4RZWA 4LYNA 4JX3A 2VTNA 4XV2A 4XG3A 1KE5A 3BHYA 5K5XA 4FF8A 3C7QA 1ZRZA 2YDIA 4APPA 4PNKA 3NUSA 3PE2A 4J8MA 4C3FA 5CSPA 3D15A 2JBOA 2VO0A 3D14A 3GQLA 1CM8A 1HCLA 4RWJA 2JD5A 2W1EA 4RIXA 1XO2B 4YC8A 3VW6A 3GCSA 3C9WA 4NK9A 5JSMA 4D2TA 4OR5A 4WG4A 4FNYA 1QMZA 4K2RA 4FKTA 2B9HA 4RC4A 1ZOEA 5IEVA 5C03A 5ETAA 3UVRA 5I4NA 1KWPA 5HLWA 2OFVA 4E7WA 2UZTA 3KXHA 2QODA 3ZM4A 4ZLOA 4AOJA 4GKHA 3UBDA 2VUWA 4FSUA 2JITA 3PY1A 3QX4A 4AU8A 3TWJA 4BDIA 2B1PA 4ZMEA 5JFXA 4G2FA 4R5YA 1K2PA 4FKQA 3RPYA 3TN8A 3HVCA 5A54A 4K6ZA 2Y4IB 4U9AA 4L6QA 4QT1A 3B8QA 1O6YA 3EQDA 4UMUA 4BCFA 5DBXA 4K18A 3V5QA 4MQ1A 3OW3A 2YERA 4KWPA 4RC3A 3P1AA 3KVWA 5IUGA 2R3QA 4FKUA 4BZDA 1BX6A 2WTKB 3PE1A 4QMYA 2ITQA 1IR3A 1H00A 4ZOGA 3D2IA 2UW8A 4FZFB 3EMGA 4L46A 3HUCA 5CT0A 3CSVA 3HMOA 1UU7A 1ZOGA 2J7TA 3MVMA 3WOWA 2JEDA 3HV3A 3R02A 3TNIA 3U4WA 2W99B 4GKIA 4IJPA 4KS8A 2PMIA 3FQHA 4AWIA 4QP2A 2RG5A 4CYIA 2JC6A 3L9PA 2YIYA 3BEAA 3N4TA 3E8CA 1OL6A 3OEFX 1JKTA 4EK6A 5ETFA 5CALA 1RDQE 2XIYA 3A8WA 5LMKC 5K4JA 3PRFA 4OTRA 2ITPA 4L3JA 4AZSA 2PZYA 2XP2A 3BQRA 1YI6A 4FKLA 2X8DA 2BHHA 3MVJA 3E87A 3ZO1A 4C3PA 3DNEA 3RWPA 2UW9A 2WU7A 2I0EA 4I93A 4KIQA 2QOCA 2WKMA 3NW6A 4AP7A 5FRIA 1Q99A 4GIIA 3LMGA 1GJOA 5HE0A 4DTKA 4FT3A 4OBQA 5IH5A 3UP7A 2PMNX 4J52A 3B2WA 3MI9A 4JG6A 4M84A 4WG5A 5AV0A 4DH3A 5IEYA 2HELA 2ITVA 5EDPA 4HVGA 5E92A 5JEBA 4XRJA 4U5JA 4I22A 3C4CA 1FMOE 3KXMA 2P33A 4EI4A 2Y6MA 1T45A 4C4IA 2XF0A 3L9LA 1ZY4A 3NYOA 3R8ZA 1Y6AA 4OTPA 3D5VA 4GH2A 3GP0A 4ZLYA 3NZ0A 3R8VA 4KB8A 4EOQA 5CAVA 1IAHA 3RK5A 3RPRA 4LM5A 4C8BA 4F9CA 5BX0A 5I3OA 5A4TA 2BFYA 1Q5KA 1ZYJA 3Q9ZA 4ZJVA 5FTGA 2I7QA 1ZYLA 4QMTA 4B9DA 4CZUA 4A4OA 4RBLA 5ETIA 4BR3A 3WBLA 3UYSA 4EBWA 4D2VA 2YCSA 1H1WA 4B7TA 4I5PA 2IVTA 4DT9A 1ATPE 3QX2A 1ND4A 1Q61A 4UZDA 4EOSA 4BIEA 1MRVA 3QTQA 4RQVA 4X0MA 3PZHA 5DMZA 4Y5QA 2RG6A 3L1SA 2G9XA 4XOYA 4TWCA 4ACMA 5FM2A 1H26A 3E62A 3QWJA 3PJ3A 2BDWA 4ITIA 1Q3WA 4LUDA 3SC1A 3ZOSA 4RVTA 5IH6A 3RJCA 3MGYA 2ZAZA 3BU6A 4DGOA 2XM8A 2PULA 4PRJA 3OT8A 2W17A 3QALE 2W05A 4AOIA 4QTDA 2HYYA 2WXVA 4CKJA 3QLFA 4MYGA 3IW6A 2XS0A 4F99A 1OECA 4QMQA 2B7AA 4YTCA 2VTJA 4IB5A 4F70A 3QZIA 3ORLA 5HCXA 3NUAA 4FI1A 1OKZA 3Q60A 4K77A 1ZOHA 4UEUA 2O2UA 4EL9A 4ACGA 4FEXA 5HE2A 3LFDA 3B2TA 1OPJA 4H3BA 4BTFA 4ZJJA 2B53A 3ZRMA 2PUPA 3R8PA 5M4FA 4JR7A 4HNIA 4FK6A 3D4QA 5C27A 5HBEA 5IQCA 4WNOA 3SOCA 3FDNA 2BIYA 4FZ6A 3HKOA 3COIA 4EQMA 4ORKA 2G2IA 1P4OA 4WOVA 4CTCA 2XIXA 3PIXA 4XJ0A 1RJBA 4IJ9A 1YXTA 5CWZA 3KXXA 1P4FA 1Q8TA 2GTNA 5A46A 4CLJA 4FL1A 4G17A 5EYCA 3VUGA 4AN3A 1G8AA 5CAPA 2R3NA 4EJ7A 2PE0A 2XA4A 3DGKA 3WARA 5AAFA 2IG7A 2GS2A 4CD0A 2R7IA 4JIAA 2WMXA 1XH8A 3MTFA 2VN9A 4AX8A 3FC2A 4HYUA 5DRBA 3RCDA 1U54B 3RGFA 5HU3A 3GU7A 3OF0A 3U6IA 5AP4A 4HYSA 3TUCA 4FNZA 3V51A 4GEOA 5M08A 3KL8A 4G6OA 3DZQA 5FG8A 4MKCA 2OH4A 3R1SA 1I44A 3M42A 5CX9A 3IG7A 3SXFA 2RL5A 2JIUA 5CS6A 4FBXA 4IAKA 4HPUE 4BBEA 4J53A 5IA2A 2Y4PA 3NYNA 4CQGA 1UKIA 1OL1A 4QPMA 5KMIA 5EM8A 3QC4A 4D5KA 4EK8A 2UW4A 4YJTA 5DIAA 3VHKA 5KHXA 4DFLA 4JQ7A 4QP8A 2VWWA 1FMKA 4AG8A 2R64A 3H10A 3DCVA 2XNGA 3GB2A 2DQ7X 3LW0A 3V04A 1MUOA 1OIUA 4DEGA 4LFIA 1IG1A 3DBFA 3PVGA 4H36A 4UWCA 2PVLA 5CXHA 5T6KA 4RX5A 1ZMWA 1YOLA 2RFEA 5M4IA 4YHJA 5GINE 1H4LA 3BHHA 1G8SA 1PXPA 3FMMA 2WB8A 4ZY6A 3WF5A 1KSWA 3FXZA 3WYXA 3UZTA 4HW7A 3S4QA 1WZYA 2JDSA 3V6SA 3BZ3A 4G16A 4GG7A 5CEIA 4CXAA 1S9JA 3PA4A 2OJFE 4NIFA 3II5A 1TKIA 3I81A 3QFVA 2HY0A 2WQMA 2WTDA 4ENYA 4XV1A 5HO6A 5JN2A 5JGAA 3M1SA 4GCJA 4O82A 5EQPA 3CTQA 5DT4A 4PV0A 3OS3A 3KQ7A 4FNWA 3W8QA 2X4ZA 2UVXA 2JIIA 2YDJA 4L3LA 4YLJA 3TKIA 3BCEA 4HGLA 4AT4A 4O0SA 3VUHA 3NAYA 5HIDA 3OG7A 5EKOA 3R9NA 3HA8A 2OIDA 1Q8ZA 2BTRA 3ZSIA 5AR2A 3UQFA 1OKYA 3LLTA 3DT1A 3ORNA 2XBJA 4PMMA 2JKQA 4L52A 4LQMA 3QRKA 4BCHA 2AUHA 1STCE 3DOGA 3JS2A 4BZNA 3DTWA 3NUPA 5BVEA 1ZMUA 5HG7A 3NMUF 5CXZA 4FMQA 2PU8A 4JVGA 4EQCA 3D5XA 2OW3A 4TRLA 2XB7A 2PZIA 2XZSA 3DB6A 5IDNA 5IG1A 1G3NA 4JIKA 4N57A 2ZB0A 4A9UA 3ELJA 4FZAB 2IVVA 4GUEA 4XG6A 3ZTXA 4DYMA 2E9UA 4XMOA 3DKGA 5EYMA 4R77A 3FZPA 3ENMA 5CF6A 4F9BA 4A7CA 3Q4TA 1JQHA 3MA6A 4AQCA 2ZB1A 4XG7A 2RFNA 5CU2A 3BYUA 2VTSA 4ANOA 4QMWA 3RINA 5K4IA 2YHVA 4UX9A 4IZYA 2OKRA 2XBAA 2QLUA 4E5BA 2I6LA 2OZAB 4MX9A 3FMNA 3RKBA 3UVPA 3UODA 4EH3A 1H24A 2C3LA 2PZPA 4R7IA 3ZUUA 4M3QA 1WAKA 1IASA 5D41A 2BDJA 5EOLA 3C13A 1ZYDA 4NZWB 4A9TA 3CEKA 4FYOA 1WBOA 2OJ9A 4GT4A 3OWLA 4RX9A 4D2WA 4G1WA 4X3FA 1JSUA 4I3ZA 1GY3A 5I9VA 3Q2MA 5HX8A 3CC6A 2JKKA 3BHUA 3TACA 3A60A 5ANIA 3DY7A 3F88A 4ZSLA 3OEZA 4IB1A 4DAWA 3IDBA 5LOHA 1NVSA 2CHLA 3EHAA 5KHWA 4ASZA 1OIQA 2ITUA 3U6HA 3AC4A 1Z57A 4QQ5A 4Z7GA 3ENHA 3JR1A 3L9NA 5ANOA 2QURA 3HV6A 4G31A 4XLIA 4JG8A 3FI8A 3LXPA 2XK3A 5ITAA 2XNOA 1W83A 2F2CB 3ZUVA 4QMUA 3TZ7A 2EU9A 2R3JA 5A4EA 2XK7A 4FT7A 3BPRA 2CLXA 2OIBA 5AP3A 4V0GA 3SW7A 5HVJA 2FUMA 4L7SA 4XG9A 3RP9A 5CEOA 3D5WA 4EONA 1CKPA 4CYJA 1OUYA 5JT2A 2PSQA 2GMXA 2QO7A 3R2YA 3V8SA 2YJRA 3FMLA 4G6LA 4ID7A 1UU8A 2BRHA 2BZIB 4BYJA 2CN5A 2RF9A 3JPVA 5BPYA 1HCKA 3I7BA 4RZVA 4BDKA 4XHKB 4UWBA 4XRLA 1O6LA 2WOTA 5D12A 4J98A 3N9XA 3WE8A 2B52A 3OCSA 1E1XA 1FVTA 2SRCA 3LAUA 5L8KA 4AN9A 1SVHA 4DA5A 4BGHA 5AA9A 4A06A 4BTJA 4HNFA 5ETCA 5JZNA 2JAMA 3EB0A 4G3EA 4O7VA 3LKMA 3FMKA 3KCFA 1V0PA 3MPAA 4HOKA 4IVCA 2ZVAA 4U3ZA 3UYTA 3SV0A 4CCBA 3UQCA 4IAIA 4OAUC 3FLZA 1YHWA 3PUPA 2VU3A 5E4HA 5EM7A 2IZSA 2QHMA 3IW4A 3OCTA 5CNNA 2VTPA 1KE8A 5AR3A 5BMSA 3BBWA 4TXCA 2BDFA 4D4VA 1J7UA 3A7HA 5FWKK 3V5JA 3BE9A 3U55A 1GIJA 5IF1A 3KULA 4FIEA 4AT5A 4OT6A 4KKGA 2R7BA 2BRBA 3MSSA 4KUJA 4UMTA 3FL5A 1MP8A 3SRVA 4R3PA 4IQ6A 4C4JA 2WTJA 4RSSA 1MRYA 3HNGA 4FEUA 2VD5A 3UVQA 4BIDA 5EM5A 3VNTA 1WMKA 4BGQA 5CASA 1NVQA 4A9RA 4NL0A 2YABA 5CZIA 2ITYA 3K2LA 3A7IA 3DU8A 2ITOA 3DK7A 4FV3A 5CY3A 5IQAA 5AFVA 3D83A 4OT5A 1XKKA 3ORKA 1M17A 1Y6BA 2XJ0A 3HMMA 5FTOA 5I3RA 4RLLA 1BYGA 2IZRA 4R7BA 5E1SA 4CZYB 1JNKA 3KMWA 1J91A 4L01A 1IEPA 4LGDA 3W18A 4G6NA 3ZDUA 5IA1A 2YJSA 4RJ5A 2JGZA 4AGWA 4X3FB 3P7AA 4BI1A 3TI1A 2XK8A 4X2NA 2Y7JA 5LCJA 3DLSA 1H01A 4LV8A 3K5VA 3OMVA 3PIYA 4DGNA 1AD5A 5EQYA 1K9AA 2CKPA 2HXLA 4YPSA 1R0PA 5E8VA 4M8TA 2BZHB 3C4FA 1V1KA 3I5ZA 4LOOA 5CU3A 5DHJA 3ZCLA 3KGAA 5CEQA 5CSHA 3FY2A 3P78A 4WO5A 4Y72A 3ZO2A 4TL0A 4O0XA 4O0UA 4OLIA 5C8MA 4C58A 3UIUA 3SKCA 5EDQA 2VTAA 4AAAA 2UW7A 3LIJA 5L6PA 4IIRA 2C3JA 5HLPA 2VTHA 4ZSEA 3CJFA 5M53A 5C8KA 5FEEA 1LEZA 2YM3A 3QTIA 4ZS0A 3WZKA 5LJJA 4LOQA 5HO7A 4R8QA 3EFLA 3IONA 1LPUA 2QG7A 4O84A 1Q24A 4QRCA 1A48A 4ERKA 5FDPA 3UOJA 2QR7A 3OWPA 4W4YA 4IM3A 1FQ1B 4KSPA 2XKCA 1FBNA 2WIHA 5D11A 4MBJA 4W4WA 4BN1A 3GU4A 4DC2A 2HW7A 3P5KA 4ACCA 3KRXA 4BBMA 5ANGA 2G01A 2YIWA 2XKFA 3A2CA 3OBGA 3VS2A 5I9WA 5BUIA 1Q62A 4MXYA 4DH7A 3BBTB 4XP2A 3HMPA 3ULZA 3DAJA 5DR9A 2QLQA 2OLCA 2ERKA 5IA4A 2Y9QA 1IA8A 4WBBB 4R78A 2RIOA 2X7GA 3ODYX 4UV0A 5AR7A 4QQJA 4XG8A 4C4GA 2R3HA 4MK0A 1MQ4A 2O5KA 4TN6A 1BMKA 3H0ZA 4FEWA 2B9FA 3DS6A 3VN9A 2B9JA 3IS5A 3QYZA 3FBVA 3VAPA 1H27A 2YIXA 5DT0A 5C9CA 4ZTHA 4QTAA 3NUXA 3R01A 2VWZA 4JJRA 4EHZA 3O96A 4QPSA 4DEIA 2XMYA 3DXQA 3IW8A 3HGKA 2X9EA 5AV3A 4EKKA 1PMUA 3S1HA 4K11A 3ZUTA 3KKVA 4OTHA 4CMOA 3H4JA 1PXLA 2GFCA 2ZV2A 3LXKA 1KE7A 4S31A 3HZTA 1YKRA 3R9DA 4BCGA 5JFWA 2GPHA 4FT9A 5AR5A 2XYUA 4K1BA 4BWXA 2GHLA 3DBEA 3MV5A 4JBPA 5IQIA 4BWKA 2V55A 3LCKA 3DTCA 4JDKA 2UZBA 4Y8DA 4LL0A 3RNYA 2IZTA 3A7FA 1XWSA 4KBKA 2YM8A 3TXOA 4HVSA 5JGDA 1PXJA 2UZLA 2R3FA 3R8LA 3R83A 2ITZA 3GQIA 2RKUA 3JXWA 3U87A 4XCUA 3VBYA 4IB3A 4S30A 2PVYA 5H9BA 5HI2A 1GZNA 1Q4LA 2OSCA 3HYHA 4BDEA 3BELA 3C50A 4O7WA 3EIDA 3QQFA 3QGWA 4QMXA 5K3YA 4YLKA 3JY0A 5A3XA 1RE8A 1TQMA 1XJDA 5L8LA 5CZHA 5J87A 4FTRA 3S00A 4BGGA 3TIYA 1FGIA 3C4ZA 5ICPA 2UZEA 2UZNA 5J1VA 3EKNA 4CZTA 3ALOA 5IQDA 1J1BA 3MH1A 4EH6A 2HWOA 4TYGA 5HU9A 2VTIA 3OC1A 3OXIA 2LGCA 3KN6A 4YTHA 2UZDA 3VS5A 4C33A 5L4QA 3D0EA 5IA3A 3QRIA 4F65A 2EUFB 4IADA 3HV4A 4FOBA 4JRVA 5M57A 1QCFA 4NFNA 4FGBA 2XK9A 3DA6A 3KF4A 5GNKA 3COMA 4UY9A 2A27A 1U46A 2P55A 4E6QA 2A2AA 3ZHPC 1E1VA 3FZOA 3V01A 3MJ2A 4AA0A 4FKPA 4IBMA 5ANDA 3KXNA 3NNXA 2BKKA 4FKSA 5G1XA 2QOQA 3G6GA 4EZ5A 3CPCA 1SZMA 2WEVA 5LVLA 4ASEA 3SA0A 2W96B 4LRKA 5HBHA 4BCKA 3FLWA 3HRBA 5AUWA 2X6DA 4II5A 4MNFA 4IH8A 2EXMA 2CNQA 5AUUA 4U0IA 5T68A 3W32A 4KRCA 5AM7A 3EQGA 2E9PA 4QQTA 3G90X 5B2MA 4MNEB 3P08A 3MYGA 4DT8A 1PYXA 1M2PA 5AAEA 2LAVA 4XH6A 3R7YA 5KBQA 2UZVA 1FVVA 3QTRA 3R73A 4RIYA 4DITA 2QC6A 3EKKA 4IW0A 5AUTA 4JOAA 4ITJA 4HVDA 4D5HA 4QMVA 4GK3A 4J71A 2J0LA 3L8SA 2G2FA 3PPZA 5LVMA 5LARA 2OICA 4RQKA 2C1AA 3Q4UA 1YWVA 4ERWA 3B8RA 4O6EA 3DK6A 4OTFA 5EDRA 3GT8A 3MH0A 1WBTA 4FSWA 3GU6A 4U8ZA 3SW4A 3R8MA 4CG9A 3OD6X 4RIWA 1YDSE 2GDOA 1V0OA 4AW1A 3WF7A 5CAUA 4DEDA 1MQBA 3VHEA 4FSMA 5HG8A 2UVZA 2PZRA 5E91A 5M44A 2GNLA 3AT3A 4D1ZA 4B0GA 4BVUA 3E92A 4FV0A 4N4SA 5DR6A 4EHGA 2ZV8A 5FXRA 2O0UA 4FT5A 5DRDA 3PJ2A 4BZOA 4YZ9A 5AP5A 1O9UA 1V0BA 4E6CA 1ZYSA 3MB6A 5DVRA 4O7RA 3OCBA 5BQ0A 4LL5A 4TYHB 3DKFA 2H9VA 2W4OA 3QHWA 4ZTSA 4P4CA 5TO8A 1PF8A 4YJNA 5HESA 3ORZA 5IZFA 4ANLA 3R7IA 2R3PA 4JBOA 3DAEA 2IW6A 2P4IA 2XIZA 3LCDA 1WVWA 5JFSA 2BTSA 4M0YA 4C4FA 3MIAA 1NT2A 4L8MA 2VWVA 4R6VA 3AC1A 3GOKA 4RGJA 5HE3A 3QU0A 4RFYA 3QKKA 2VNWA 4CGAA 4DLJA 3RTPA 3I79A 1FOTA 3MA3A 1SNXA 4I4EA 3KY2A 4NCTC 2XVDA 4F6UA 5EI8A 3EFWA 3TKHA 1YWNA 4XX9A 3EFKA 4CMTA 2CCHA 2VX0A 3EQIA 5C8NA 2JFMA 4QMLA 4BDAA 4DF3A 4W4XA 4ALVA 4TWNA 3MFSA 1GAGA 4WIHA 3SX9A 3DB8A 3LE6A 4YC6A 3NUYA 4RLKA 3GOPA 4R5SA 3FZRA 1GIIA 2W4JA 1W7HA 4UALA 4E5AX 4J97A 1ZARA 4GUBA 5HNIX 4MD7E 4BI0A 1XH9A 2BMCA 4IWPA 1YQJA 4F7LA 3QKMA 4MBLA 4KIPA 4W8DA 4BF2A 4PWNA 1OPLA 1JAMA 1REKA 2HZ0A 3PP0A 3QBNA 1H1PA 3W2OA 4EYMA 3D2KA 3NIZA 2Z02A 4EKLA 2AC3A 4TW9A 2OH0E 3AD5A 1M14A 4DBXA 3K5UA 4O7TA 4E3CA 3GFWA 4I21A 3F7WA 3PJCA 5CI6A 2H34A 2C5XA 4FTTA 3DFCB 3ORIA 3KULB 3R21A 2YA9A 4QP9A 4B99A 2ZV9A 3KREA 2WMVA 2VWUA 3TTJA 5A4CA 5E8TA 3GC8A 1DM2A 2F7ZE 3ACJA 3WIKA 3VBVA 3R1YA 4GMYA 3QA8A 3IW7A 4YHFA 4EEVA 1K3AA 3CTJA 5M4UA 2IJMA 1JSVA 5TKDA 4FV8A 3R7OA 4EJNA 2YM6A 4CNHA 4CFXA 3ZZWA 5FXSA 5KMNA 1DI8A 2J6MA 3PA3A 5JQ8A 1JKSA 3EL8A 1UU9A 5J5TA 5B2KA 1R0EA 4PTGA 3GCQA 5BNJA 5AM6A 5FDXA 4BICA 4WHZA 1JKLA 1R78A 4FODA 4FSRA 4TTHB 3VS1A 2WMRA 3K3JA 5CF5A 2QO9A 4I20A 2WEIA 3D7TB 1W98A 3DDQA 3R0TA 4FIGA 3VBQA 3ZBXA 4Z3VA 3F2RA 4F7JA 3HA6A 4AW0A 3T9IA 3TL8A 1U59A 3F3WA 4M13A 5IISA 4S2ZA 2QG5A 3P7CA 1P5EA 4I24A 2PVMA 3QGYA 4OBPA 4XNEA 5AUZA 5ANKA 3UTOA 4E93A 4W9XA 2VWIA 3E8DA 1PY5A 3C0HA 3TDVA 2ERZE 4BDHA 2R3OA 3PRIA 2J51A 4NFMA 5CYIA 3PSCA 3ZZEA 4WNPA 3FPMA 4LMUA 4JX7A 4ANNA 2J9MA 5CF8A 2VTOA 5L2IA 1H0WA 1KE6A 1URWA 5EI2A 4AS0A 4A07A 5DE2A 3DQXA 2VZ6A 3LOKA 4F0FA 3ZRLA 1VYZA 5E7RA 4EZ7A 3QZGA 5KBRA 3GC0A 3V8WA 3TT0A 5EW3A 4O86A 2GU8A 4ZMFA 3UQGA 4D4RA 1OPKA 1YHSA 4GJ3A 3RBWA 3U9NA 1YOJA 2VWBA 1WBPA 2PHKA 2W5AA 3KXZA 3PY0A 2YDKA 3CD8A 3KMUA 3Q2JA 4E6AA 4EHEA 4NJ3A 4FV9A 4BDJA 4DEBA 3HDNA 2E9OA 3KRRA 4RJ4A 1YI3A 3VS7A 3ZXZA 1KV1A 3F69A 4L42A 5EG3A 4NW6A 4D4SA 4LGHA 4S34A 2VGOA 2VO3A 4DH5A 3PPKA 4JL9A 5EW9A 2YLEA 3TNQB 2X6EA 3QTXA 5CNOA 4X3JA 3Q5IA 4QYEA 4UMRA 4GSBA 4UZHA 3MY5A 2XNMA 4CLIA 4DH1A 5AP7A 3OY1A 1T46A 2B9IA 3LXLA 4EH4A 4WA9A 3SVVA 3BEGA 5M07A 3ZLXA 5GIOE 4CQEA 3R1NA 3QZFA 2YEXA 4H3PA 4M14A 4EQUA 2BRNA 4MAOA 3MVHA 4YBKA 2FGIA 2G15A 3FI3A 3PWDA 3MFUA 5IUIA 1Q8UA 3G6HA 4EK3A 4F08A 2DS1A 4ZEGA 2F49A 4ZXTA 4RWLA 1OM1A 4QPAA 5HG5A 3PVBA 2JDOA 3OOMA 1OKWA 4GJ2A 5DEWA 2VTRA 3F3UA 3NAXA 3NEWA 4HGTA 4YZNA 3VBXA 4I5HA 4FNXA 3RMFA 5B2LA 4RJ3A 1PKGA 3W33A 4U41A 2PL0A 3BGPA 3NUNA 4YSMA 3MY1A 3U8WA 3DFAA 5A4LA 3VRZA 4QOXA 1PXMA 3T8OA 4MHAA 2FSLX 5M55A 3O8UA 1J7IA 4JXFA 5EM6A 1H8FA 3U6JA 4JDIA 1PXIA 2E2BA 1I09A 3AD6A 3IDCA 2WTIA 4U45A 1MRUA 5CT7A 1JSTA 2W1GA 4KKHA 2OWBA 4CG8A 3ETAA 3ZC6A 2G2HA 3NCZA 5LVPA 1R3CA 3EH9A 2CGXA 4BFMA 1U54A 4TWPA 4IACA 4XP0A 5F94A 2NRUA 2DYLA 3C5UA 2YZLA 3ITZA 2QOLA 4MD9E 4FEQA 5IQEA 4I0TA 5G6VA 2WTKC 2R3RA 4WT6A 4FG9A 3W10A 5EYDA 2XCKA 3QCYA 3LLAA 1H1QA 5ANEA 3F61A 3JY9A 4QYFA 4YO4A 3ULIA 4NCTA 2XCHA 2X81A 2PTKA 2VX1A 3NPCA 3TNWA 2CSNA 2Q0NA 2WTVA 4BCPA 3FLSA 1VJYA 4HZRA 4C57A 1H1RA 3OROA 5HICA 4O2ZA 3UNZA 1L8TA 4ZTLA 3WE4A 2C5OA 3D7ZA 3ID6C 1OKVA 4O96A 3R9HA 3F5XA 3KEXA 4IZ7A 2X8IA 4C35A 5I9UA 1IRKA 4FUYA 2XH5A 4YJOA 5DNRA 4IDTA 4K33A 1VR2A 3D9VA 2RGPA 5AP1A 3MW1A 1RQQA 3TM0A 2YIQA 4WNMA 5BMMA 4PMPA 3F3VA 4NKAA 4BBFA 3GI3A 3BYSA 4FKRA 3DAKA 4PQNA 3Q4ZA 5EI6A 3KXGA 3P7BA 3AQVA 3G9LX 1B38A 2F9GA 3CD3A 3Q9YA 5FP5A 5TF9A 3UC4A 3ZFYA 3ZO3A 2PUIA 1JKKA 4BY9E 1LUFA 4NKSA 2XK4A 1LP4A 4L43A 3HAMA 4O83A 4TPTA 1FVRA 4NJDA 5A9UA 2OBJA 4H58A 4QD6A 4NM0A 5HHWA 5IQHA 3EQFA 4NUSA 4KIKA 4CEGA 3W2RA 4YJPA 5CU0A 4F1OA 1P14A 3F5GA 3VW8A 1GOLA 3P4KA 3CGOA 3FMHA 2JBPA 4G5PA 3HV7A 4IZ5A 3PJ1A 3PYYA 4JDHA 3ZFMA 2NRYA 2C5YA 3T9TA 4DCEA 5JK3A 3U51A 5M06A 4MH7A 5M09A 3HMNA 3NNVA 4P5ZA 4G3CA 3NYVA 1ZAOA 5JZJA 1GZ8A 2XJ2A 5EOBA 3CPBA 4MXZA 5FD2A 2GQRA 4I6BA 4TYJA 5HORA 4FX3A 5DH3A 2FSTX 2I40A 3F7ZA 4QP6A 3V5PA 3QTZA 4O22A 3UJGA 4IFCA 3UOKA 4C4EA 4PMSA 3OTVA 4U44A 1H28A 5AP2A 4AA5A 3EL7A 2WQEA 4H05A 2W9ZB 5AUVA 5C01A 2W5HA 4TYEA 3Q6WA 4N0SA 4ZTNA 1WBWA 4I5MA 4FTMA 5AWMA 4BHNA 4O7YA 5IPJA 4F0IA 4B8MA 2C3KA 2YCRA 4ZJIA 5M51A 1XQZA 1J1CA 1CKIA 4FK3A 3T3VA 4W8EA 1JBPE 1UNLA 2GS6A 4FKVA 4NW5A 1DAWA 4Z9LA 4YNOA 3WZJA 4D2RA 4RIWB 3EQBA 3O50A 4RJ6A 3UMXA 5JRQA 1JOWB 5F4NA 3IKAA 3QZHA 4E5WA 3LCOA 3FQSA 4J96A 4L53A 3PXKA 3W2PA 4JQ8A 2XNPA 3AGMA 2CGVA 3F6XA 4RPVA 4YNEA 3BGZA 3LFBA 4QP1A 4R3CA 4DGMA 3ERKA 3PP1A 4NWMA 3CY2A 5FLFA 3NNWA 3Q9XA 4BKZA 3N4VA 4DTBA 3NVKI 3DXNA 2W1IA 3KCKA 4AZEA 3LXNA 1UV5A 3QC9A 3BIZA 4FKOA 3RK9A 2NPQA 4MWHA 4V01A 4M15A 1YRPA 2PUNA 4AXAA 1OL7A 4ZZOA 3OW4A 5CEKA 4GS6A 2CCIA 3PZEA 3E8NA 3ATTA 5KMOA 4UN0C 1Q8WA 4FTIA 2VV9A 4GFGA 3RPVA 5J1WA 2W1HA 3FJQE 4PUZA 5CSXA 4G3DA 3HAVA 3FL4A 4ZP5A 4YJQA 5IKWA 4V04A 4ANBA 3SRVB 5IA0A 2ETMA 3SAYA 1UKHA 4CTBA 3QRTA 1OIYA 1TVOA 2JDVA 5CENA 5E1EA 4YP8A 2W06A 2UUEA 3AC5A 2C6OA 4NSTA 4I6HA 1OI9A 2J5FA 4PY1A 2C6IA 2CGWA 4QYYA 4AGCA 4IX4A 2QHNA 3M11A 4FTCA 2P2HA 3QQLA 4GG5A 2H6DA 4JBVA 5HVKA 5E90A 5HD4A 1WVXA 3WZEA 5CEPA 3CLYA 3I60A 4UMPA 2GTMA 3C0IA 3F9NA 3GFEA 2ETRA 5CSWA 4A9SA 4D55A 3PXQA 5E8ZA 2Z7LA 3MTLA 3ZLYA 4CFUA 4RG0A 3UO4A 3PPJA 2J2IB 3NLBA 4L45A 1QPCA 4ZTQA 2QNJA 1ZXEA 3PXFA 3BGQA 4M12A 4BDBA 4NM7A 3PSBA 3JYAA 1BLXA 4TYIA 2WD1A 2YWPA 3AOXA 4Q5HA 3DQWA 4B6LA 4F63A 3I6WA 4MWIA 5AP0A 4FZ7A 4TNDA 3ANRA 5DT3A 3L9MA 3FMEA 3PVWA 2WHBA 5HQ0A 3AC2A 1M7NA 2WQOA 3EN4A 3JVSA 3NWWA 3L8XA 3Q52A 1WVYA 3MWUA 2X1NA 3WI6A 5E8YA 4ANQA 1M2QA 2IPXA 3GVUA 4UWYA 5JGBA 2UV2A 4OTDA 3PWYA 4IXPA 3ZFXA 4EOLA 5CTPA 4YR8A 3TV4A 4HGEA 4AE6A 4ALUA 4FEVA 4PDYA 3FYJX 3H9OA 4JQEA 4KS7A 4F9YA 2R3LA 1PXNA 4C2WA 2CGUA 3MFTA 4FTOA 3R71A 3IGGA 3KRWA 5IEXA 3EQPA 3MESA 2YM4A 1REJA 4W9WA 5AEPA 5HD7A 3GC7A 1Y91A 4YZMA 3WF8A 4EWQA 2X2MA 3FMDA 5GZ8A 4E26A 3DZOA 1QL6A 3EYHA 5FTQA 5EHOA 4A4LA 3C4XA 4CSVA 3LVPA 3MIYA 4QO9A 1U5RA 1XHAA 3KN5A 4Q9SA 4QYHA 3HEGA 5CU4A 1SYKA 2QOHA 1ZZ2A 3UPXA 5HE1A 5HTCA 2O65A 3IQ7A 4Y73A 5JFVA 4G9RA 4ZAUA 1NA7A 3CY3A 3O17A 4CKIA 1GZKA 2BVAA 1ERKA 4M97A 2BAQA 1BL7A 3E7VA 4RT7A 3QQJA 2QU6A 5D7VA 1KE9A 3MBLA 4MF0A 2W1DA 3U4UA 4KRDA 4X2GA 3GNIB 5J9YA 2OZAA 2W9FB 4P90A 5LVOA 3NW7A 5GHVA 1CDKA 3ET7A 4EYJA 4X2FA 4QNAA 5F1ZA 2IW8A 5DWRA 1KOBA 2C6DA 3LFSA 4TYHA 1H25A 3E3PA 4YGAA 4PF4A 3IW5A 5K0KA 4O7ZA 4PP7A 4BCOA 5BYZA 3R9OA 3TZMA 3G9NA 4G34A 1WBSA 2KTYA 1X8BA 2WGJA 4FUXA 2HZ4A 2CN8A 4LRMA 1GIHA 2EB3A 4I5CA 3G15A 1H08A 2WQNA 3MPMA 2ONLA 3FV8A 2YACA 4L68A 3RHKA 2OXXA 2R2PA 4KD1A 4F0GA 5AR8A 4IM0A 5A4QA 4DTAA 3KMMA 4EH8A 4BB4A 2UZWE 4AN2A 5HVYA 4JG7A 4RJ8A 4GFOA 5KO1A 2BUJA 3EOCA 4KIOA 5TE0A 3UIMA 4DFZE 4M67A 3BWFA 3QCXA 5TOZA 5BYYA 3G0EA 3VBWA 4XUFA 5CQUA 5LMBA 3QD2B 4GU9A 1PMNA 4IAZA 3ZBFA 2YIRA 4WKQA 3V5TA 4U42A 4FV1A 1UWHA 5A6NA 3RAWA 3POZA 5DYJA 3OOGA 4ZSGA 4E4XA 1J7LA 3QKLA 3D7TA 4FKJA 1W8CA 1AGWA 2OO8X 2BPMA 2ZYBA 4EH5A 3C0GA 4MF1A 4D28A 4J7BA 1UWJA 2ZMCA 4RWKA 3UO6A 4DFYA 3VS3A 4ZY4A 4FV2A 2Z2WA 4WUNA 1M7QA 3RALA 4LV5A 3R7VA 1VZOA 2B54A 4PPCA 1OZ1A 3IOPA 2Y8OA 2BRGA 4EC8A 5GZAA 3CTHA 3GCPA 1R39A 5AJQA 2C30A 5EQEA 3SOAA 3PLSA 3UC3A 2XKDA 2R3GA 2YN8A 3G5DA 3VUKA 1EH4A 2OXDA 5IMEA 5LQFA 1LR4A 4KINA 2XJ1A 5HG9A 1WBNA 2PMOX 3F2NA 5FXQA 3F3ZA 3OUNB 4Z16A 1PXKA 4EOIA 4F7SA 1PYEA 3A7GA 1YI4A 4GYGA 3R7EA 2BIKB 4RMZA 3BLRA 2A0CX 3E63A 3JVRA 3VBTA 4AACA 4K9YA 3WIGA 3ZEWA 1AQ1A 5LWNA 5HOAA 4EH7A 3I1AA 3FSKA 3NVMB 4MXOA 2BZJA 4U3YA 3UDBA 3HUBA 3RM7A 3SXSA 3ZEPA 3C5IA 5HLNA 5KMJA 1H0VA 4KIKB 2WIPA 2YFXA 3DBCA 5BVWA 4U79A 4YJUA 5DLSA 3CBLA 3GXLA 4DFBA 1SVEA 1PMVA 4GL9A 4IC8A 4IWDA 3LQ8A 2UVYA 2VAGA 2WAJA 4E20A 2FSMX 2WMAA 3F82A 1OBGA 3FI4A 2CNUA 4DCAA 3A4OX 5HO8A 2I0YA 3FXXA 3P79A 5L6WL 4I41A 4M0ZA 5DPVA 4G3FA 4IVDA 4C02A 3FXWA 3FY0A 2CPKE 5GJGA 4ANMA 3COKA 3QCSA 4O0VA 4RWIA 3NX8A 2A19B 4FR4A 3MJ1A 4XG2A 4HPTE 2VRXA 3CQUA 4OTWA 3LJ2A 4PPBA 4GVJA 3RAHA 4FGRA 1LEWA 5HIBA 4WBOA 4YPDA 4OTGA 4EUTA 2BILB 2EVAA 4I1ZA 5LMKA 4C38A 1UU3A 5CI7A 3QUPA 5HCYA 3KU2A 4RVKA 4XLVA 3WF9A 2HXQA 4NIFB 3BHTA 3UE4A 3ZM9A 2VTQA 3V6RA 3AC3A 3KB7A 3NRMA 4GU6A 2PE2A 4IVBA 3LQ3A 1Y57A 2C4GA 4DGLC 2O63A 3NS9A 3GGFA 4I92A 4OBOA 4RRVA 3VF8A 1F3MC 2OK1A 3E88A 3QLGA 2QONA 2GNHA 3ZLSA 3RPOA 4HCUA 4BWPA 3VS0A 5C26A 3Q32A 3RK7A 2REIA 1OBDA 2X9FA 1IA9A 1FPUA 2Q0BA 4USDA 4ZZNA 3DPKA 5E8XA 3A7JA 4A4XA 3UOLA 3SG9A 4QTBA 5CANA 1BI7A 3UG1A 4C36A 3FI2A 2YZAA 3BYMA 2ITWA 2OI4X 3ZXTA 2XM9A 2GNIA 4D9UA 5BYLA 4F6SA 3LFCA 2WU6A 3R1QA 4IM2A 4MCVA 3QWKA 3N4UA 3PJ8A 2ZDTA 5KE0A 4S33A 2NNWB 4DN5A 2XK6A 3UP2A 5A6OA 3GCUA 2WQBA 3P0MA 4F9AA 3FHIA 3GUBA 4PDSA 3G51A 3QTUA 4JLCA 3HV5A 4Y5HA 4D1SA 3BHVA 4BC6A 4BCMA 5AX9A 2OJJA 4WUAA 5IA5A 4RIYB 5J79A 3Q3BA 5HNBA 5ACBC 1OL2A 2HAKA 4FIHA 4GT5A 4YLLA 5EKNA 4OTIA 4P7EA 5TT7A 4D1XA 1NY3A 3D5UA 2OZOA 3BV2A 3MN3A 4N6YA 4XEYA 1XH6A 2PZ5A 3ALNA 1YXUA 2PYWA 2QKWB 2WELA 3LM5A 4CV9A 3NW5A 4FSQA 2QVSE 3HDMA 3AXWA 1XH4A 2WMTA 4M66A 4OTQA 4PPAA 2YAAA 4EHVA 2ZM1A 4X3FC 3I0OA 3ZS5A 5L8JA 3QTWA 5JRSA 5C4LA 2J0MB 1M52A 3VUTA 2GQGA 5A14A 3R7UA 2YCQA 5LVNA 4O6LA 4O38A 4FIIA 4GFMA 3BYVA 2J5EA 3QQKA 3LM0A 4M68A 5J8IA 3ZSHA 4GVAA 3MVLA 4IZAA 2F57A 5L2SA 3WF6A 3NNUA 4EOKA 1J3HA 4PTCA 4FV5A 2DUVA 4W4VA 5KZ0A 1P2AA 5KMMA 3V5WA 3ORPA 3VQUA 1JLUE 3NCGA 4AT3A 4Z55A 3LJ0A 1ZY5A 5D10A 5FGKA 3SDJA 2ONLC 5I5ZA 5J9LA 2PWLA 5IUHA 2C6TA 2PUUA 5TR6A 4NTTA 4E4MA 4RC2A 5LXMA 2KULA 1L3RE 4ZZMA 2ACXA 2WNTA 4E6DA 4DEEA 3ANQA 4P5QA 3LFFA 4MQ2A 3SQQA 2HOGA 1U4DA 4QP7A 4XBRA 2Y4IC 3SHEA 4CKRA 5CU6A 2Z60A 1RW8A 4EOJA 3FZSA 1PW2A 3QQGA 3CCNA 4UYAA 3BYOA 3P9JA 4O81A 3O7LD 4BDDA 3P86A 4Q9ZA 4DINA 3QAME 2R9SA 4FL3A 4AGDA 4YMJA 2OFUA 1PHKA 1PXOA 3CR0A 1A06A 2XIRA 3ORMA 3E3BX 4YBJA 5AV2A 4OUCA 4D0WA 5AV4A 2VO7A 3IGOA 1YXVA 5KUPA 4YUQA 1NXKA 2ETKA 3MY0A 2BZKB 4FSYA 4U40A 2YCFA 4CT2A 4IFGA 2OGVA 2EXEA 3T3UA 2PVJA 2ITTA 2X0GA 5KKRC 4I6FA 4MTAA 1NW1A 2Y6OA 5H8BA 4FG8A 4JAIA 3W1FA 2IW9A 4O2PA 4CT1A 3O8PA 4OGRA 2DWBA 4E1ZA 5AAGA 5IU2A 4AZFA 4EWHA 4RVLA 2RSVA 2I0VA 1B39A 2JKOA 2V5QA 4FVQA 1CKJA 3FUPA 2VNYA 4C2VA 3HL7A 2XEYA 4AF3A 4KABA 3ACKA 4ZK5A 5IQFA 5E8WA 4L9IA 3ROCA 5J7HA 4KAOA 3FYKX 4KSQA 2XRWA 5J5SA 5IQGA 2YITA 4GK2A 4U7ZA 3TG1A 5I9YA 3JUHA 1BUHA 4N6ZA 1APME 4DFNA 4X6QC 2UW5A 2HENA 2O3PA 4USEA 4O0RA 5L2TA 4FTLA 4DH8A 2YWVA 4FV4A 2ZMDA 3DBDA 4EUUA 4BTKA 3Q53A 2IN6A 3NGAA 2AYPA 4FOCA 5GZ9A 4RFZA 4QMPA 3W2QA 2XRUA 3EYGA 4K8AA 3VUDA 4O1OA 2EWAA 2FVDA 2XNBA 4PDPA 2JIVA 3ZMMA 3SG8A 3ZO4A 3WILA 2H96A 4TWOA 3RWQA 1GNGA 2PMLX 5JKGA 2CNVA 4BCQA 5BVKA 1ZWSA 2WOUA 5DG5A 3ZRKA 3AT2A 5KKRB 4R7HA 4NM5A 2PPQA 3PXRA 1XR1A 3QD0A 3OTUA 3W8LA 2JFLA 3RM6A 3ZC5A 2X7FA 4C59A 4C61A 2ESMA 1CMKE 2V7AA 3A62A 3LFQA 3QA0A 5AUXA 3BWJA 3FZTA 1TQPA 4LUEA 4FTAA 5BVOA 3C4EA 4DFUA 2W5BA 3I5NA 4AFJA 2EXCX 4FV6A 4EH9A 4F4PA 3GENA 3DDPA 4EORA 2YLFA 4FL2A 3PG1A 3TUBA 4RJ7A 3DJ6A 2V22A 2C5NA 4FV7A 3O7LB 1H07A 2XNEA 3LFNA 1OITA 3LPBA 3OY3A 4A9YA 2BAJA 2X39A 3AC8A 4B4LA 4JNWA 2VTLA 5HZNA 5FUTA 4ZIMA 2ZDUA 4GT3A 2OU7A 4I0SA 4TY1A 2R3KA 5JMSA 4DHFA 4CFVA 4NEUA 3UNKA 4O7SA 2G1TA 3KC3A 4LOPA 3V8TA 3Q9WA 2R0IA 4M7IA 4F1TA 4DLIA 1KOAA 3DJ5A 3RHXA 5HIEA 2OF4A 4ITHA 4AGUA 3NR9A 1Q3DA 4RA4A 4MNEA 1G5SA 1SNUA 2R5TA 4CFWA 5DN3A 3DBQA 4G9CA 4IDVA 4IAYA 5DA3A 3QRJA 5EFQA 4Q2AA 1WBVA 1M2RA 2Z8CA 4WSYA 2ZM3A 3TKUA 3FKNA 1FGKA 2Z7SA 4ENXA 3F5UA 3SD0A 3BI6A 5BVDA 4FKIA 5HEZA 5FEQA 2W1ZA 2O8YA 3QYWA 2F7XE 2RFDA 4H1JA 4GK4A 3O51A 2JDRA 3WZDA 5CVGA 3K3IA 4CFFA 4FTQA 3LCTA 3LZBA 2HW6A 3OWJA 3PXZA 5I9ZA 4WRSA 5I9XA 2F2UA 3A4PA 3ZSGA 1Q41A 3TV6A 4J8NA 3TEIA 4CRSA 4IWOA 4V0GB 4FKWA 1HOWA 2VGPA 5LWMA 4BI2A 3KK8A 3FQEA 4G5JA 3OT3A 4CVAA 4PTEA 1H1SA 3O8TA 3FEGA 2J50A 2QU5A 3LMHA 4FT0A 2A1AB 2E9NA 4I4FA 3HECA 4O0YA 3QL8A 4RVMA 2ITNA 1NVRA 5IMXA 3KA0A 2X2KA 4HGSA 1XH5A 2QI8A 3EN5A 3E5AA 2W1CA 4JI9A 3HRCA 4APCA 3R28A 5FBOA 4BKJA 4XV3A 3P23A 4YTIA 4F9WA 2CKQA 3VJNA 3TJCA 4GIHA 4PMTA 2OXYA 3THBA 5F20A 1URCA 3EZVA 3FKLA 5FBNC 4RX7A 5FQDC 4PL4A 1BI8A 4FVRA 4TNBA 2Y0AA 4E73A 4CMUA 3VWAA 3FKOA 2FA2A 3NDMA 3DKCA 4MXXA 1QPEA 1ZMVA 2YAKA 4TT7A 4D2PA 4HVIA 4FC0A 1YWRA 4C34A 5D1JA 3OBJA 4FIFA 2B55A 3LCSA 2BCJA 3OXTA 2WTCA 4BKYA 4YSJA 3MDYA 4RA5A 3HP5A 3VUMA 4BIBA 4CFMA 3UO5A 4NU1A 4IX5A 4DE4A 4EH2A 1JVPP 4D58A 1BKXA 4AW5A 1JPAA 2FSOX 4L44A 1WFCA 5DFPA 3RZFA 4DEAA 5IDPA 3MPTA 2WMSA 2C6EA 4JBQA 3HP2A 2YISA 3O71A 3OZ6A 4IMYA 3NIEA 2QO2A 2P2IA 5E8UA 5EYKA 4AUAA 5DR2A 4QTCA 1CTPE 3ZYAA 1OIRA 4I23A 4AW2A 3KRLA 5CLPA 3S2PA 4E8AA 3TV7A 4BDFA 3ODZX 4FTJA 2I1MA 4TKSA 2R3IA 2FYSA 4IE9A 4AA4A 2CMWA 2OJGA 4FKGA 2PE1A 4PX6A 3RAKA 2C0OA 4WRGA 4ARKA 5EW8A 1R1WA 4F64A 1IAJA 3ATSA 2BAKA 5T3QA 3WYYA 2ZJWA 5KX8A 2QKRA 1E9HA 3CGFA 2R0UA 4PNIA 1YOMA 1YDTE 2Z7RA 2HWPA 5AR4A 2J0JA 4HCTA 3LMIA 3FZ1A 5E8SA 1BL6A 4NTSA 4CV8A 2QQ7A 3OCGA 3OXZA 3TZ8A 4LG4A 5C4KA 5LMAA 3PVUA 1OUKA 3LFEA 4QQCA 5ANJA 2IVSA 3UNJA 4DEHA 1W0XC 3BE2A 4WD5A 1UA2A 3BLHA 3FC1X 4WNKA 3BV3A 3TUDA 1CSNA 3R6XA 4RIXB 3C4WA 3CXWA 2C6KA 4ACDA 4BCNA 5EH0A 2WTWA 3A61A 3CJGA 2QOIA 2GCDA 4K0YA 1XBCA 2XNNA 3ROYA 5JH6A 2PVRA 4CCUA 3QQHA 1PMEA 4MBIA 4KNBA 3TCPA 3UGCA 2WMWA 2HCKA 3AD4A 4IHPA 3FLQA 2HIWA 4H3QA 2F7EE 3CQWA 4BHZA 4C62A 5EK7A 5FEDA 3S0OA 3OP5A 5HX6A 4F1MA 3EZRA 2UW3A 4X21A 3O2MA 2QR8A 2IO6A 5B0XA 1YXXA 2UZUE 3CKXA 3I7CA 4EK4A 3CE3A 1B6CB 3K54A 2PK9A 4OW8A 4FTNA 3QD4A 4IANA 2F4JA 4AZWA 4MEDA 4HVHA 1PJKA 1YXSA 2OJIA 2QOBA 4I6QA 4JRNA 5IH4A 3DNDA 4B8LA 4KA3A 2C68A 3FLYA 3NUUA 5GJFA 3R8UA 5JQ5A 4LGGA 3U54A 2BALA 2QOFA 1YHVA 2ZM4A 1UVRA 5AP6A 5HTIA 4ACHA 3LJ1A 4EK5A 5H3QA 4ZSAA 3BX5A 5K5NA 3BLQA 4BDCA 4EC9A 2J90A 2W0JA 5AV1A 5EHYA 1Q8YA 4PL5A 3AG9A 3ORXA 2QD9A 3QTSA 4QP4A 3QRUA 5FM3A 3TNPC 5KMKA 2ZV7A 5AA8A 3R30A 3F5PA 2PVNA 4Y46A 3VUIA 5HBJA 1UNHA 3M2WA 4O0TA 2GSFA 3W2SA 2IZUA 4KBAA 4KBCA 2UZOA 4IEBA 4E4NA 2FO0A 4HYHA 1XBAA 1Q97A 3BKBA 4DGGA 3PLAE 5K0XA 3MH2A 4D9TA 1PRYA 1ZZLA 2OIQA 4WG3A 4OAVB 2BKZA 3RPSA 3EQHA 4FYNA 4ONAA 3H0YA 4UMQA 4YZCA 5ACKA 4AZVA 4CRLA 2VWYA 3CP9A 3EWHA 4NT4A 4ZTMA 5J7BA 2Q83A 3V5LA 4C37A 1UNGA 4YJRA 3WZUA 4Y95A 3V3VA 3MFRA 2I0HA 3VC4A 2WMBA 3SGCA 3RAIA 2BR1A 2QCSA 2GNGA 5DEYA 5J9ZA 4QP3A 3AT4A 2GHGA 2E9VA 4DBNA 2GFSA 4J99A 4IX3A 3QHRA 2W7XA 5DI1A 3UIXA 3AMAA 4FVPA 2VO6A 3LQ5A 5HKMA 4XG4A 5CAOA 3QUEA 4MD8E 3A99A 3ZDIA 2X7OA 4F09A 5LCKA 4BCJA 3HX4A 4QMZA 4QMNA 2B0QA 4IAAA 3TDWA 1W84A 2AC5A 5E9EA 4Q5EA 3Q4CA 2VX3A 3E8EA 4RFMA 2CKOA 3BRBA 4FICA 4DFXE 5L3AA 5AIKA 3KK9A 4FIJA 4O21A 4FSNA 3KVXA 4QNYA 4HYIA 4QMSA 1OB3A 3AMYA 3Q96A 4QYGA 2PVFA 4P2KA 2FB8A 3FHRA 1FINA 4PP9A 5KCVA 5AADA 4M69B 1DI9A 1ZLTA 3QD3A 4EZ3A 1W82A 1Z5MA 2GNJA 2C5VA 4FTKA 5HCZA 3IO7A 4EOMA 3VJOA 4ASXA 1PKDA 3ZH8A 5HTBA 4C3RA 4DG0E 2V0DA 5K9IA 1YW2A 4JS8A 4JR3A 3LHJA 4D0XA 2WMQA 3R63A 3NYXA 2R3MA 3PXYA 5BVNA 4JT3A 3VULA 4BRXA 2J0KA 5BUEA 3OWKA 2GNFA 3RNIA 5IQBA 2C47A 3LFAA 2C0TA 2WMUA 2WFYA 2J4ZA 2PY3A 2P0CA 3FE3A 3MS9A 3QQUA 4HJOA 3I0QA 4XP3A 5AX3A 4D2SA 4LRJA 2C6MA 3H3CA 4MVFA 4HZSA 3QXOA 4U6RA 4ASDA 4XBUA 1TQIA 2UW6A 3E7OA 4GW8A 3CIKA 2CKEA 4TZRA 5H8GA 3RVGA 3ZU7A 4YU2A 1OMWA 2IWIA 2H8HA 4J1RA 1SVGA 5HNGA 3CKWA 2BRMA 2HZIA 3IECA 3R22A 3S95A 4ZTRA 5BVFA 1Y8YA 3KFAA 1OL5A 3W2CA 3EN7A 5CVFA 4YURA 4IC7A 4R3RA 4J95A 3DXPA 4LMNA 4O27B 3CS9A 2QOKA 2OF2A 4USFA 3EQCA 4AOTA 3PG3A 1XH7A 2VTTA 4EOPA 3GU5A 5L2QA 4X2JA 4O0WA 4U43A 3O23A 3AMBA 4C0TA 4EOOA 3GBZA 1F5QA 3OUKA 3H9RA 3G2FA 4X2KA 4YTFA 4N70A 4F7NA 3MB7A 4AFEA 1VEBA 4FA2A 5F9EA 3R7GA 4QMOA 4YZBA 5CQWA 2RFSA 5H8EA 4ANSA 3COHA 3TNHA 2XUUA 4GYIA 3PA5A 3CQEA 3GCVA 2JLDA 4FG7A 3KRJA 3N51A 3TTIA 3FWQA 3UPZA 3VIDA 2XEZA 5M4CA 3R2BA 4IX6A 4L3PA 4D4YA 4ZLZA 2CDZA 3QUDA 3UOHA 1Y8GA 3TIZA 4GRBA 3UIBA 4XS2A 2FH9A 3D94A 3VS6A 3L8VA 4ZS4A 2BFXA 3SXRA 2JDTA 3OVVA 3TJDA 4BYIA 2ITXA 4I94A 3E64A 2GQSA 1VYWA 4U80A 4BL1A 2A4LA 2JAVA 2JKMA 4NM3A 4UXQA 2QOOA 5H2UA 4C7TA 3E93A 4XV9A
chains in the Genus database with same CATH superfamily
3G33A 3HMIA 3PIZA 5L2WA 3W16A 2C3IB 5KMLA 3NSZA 3ZONA 4F6WA 1ZYCA 2UW0A 2HZNA 2Z7QA 4YZDA 3RCJA 3TZ9A 3UZPA 2GS7A 3IDPA 5AIRA 3VQHA 2NO3A 1ST4A 2ZOQA 4V05A 5AMNA 1U5QA 3FLNC 1OVEA 2CLQA 2X4FA 3PY3A 5D9HA 3IK3A 3OFMA 4R1YA 1XBBA 5GIPE 3S3IA 4FE2A 1DS5A 2X2LA 2CJMA 4L00A 2BHEA 5C1QB 4RX8A 3FPQA 4YJVA 4HCVA 2NP8A 3OHTA 2C0IA 2PVHA 2V7OA 2YM5A 3EN6A 1S9IA 2C6LA 3UMWA 1SM2A 5L6OA 3G0FA 4IB0A 4H39A 5CEMA 1OGUA 2IVUA 3EN9A 4DG2E 4I0RA 3F2AA 3QF9A 3HLLA 1QPJA 3I6UA 4U81A 2PVKA 4FTUA 3F3TA 3DLZA 4X7QA 4C4HA 5CAQA 2XKEA 2HY81 4IWQA 5DOSA 3R00A 3VS4A 3BU5A 3EJ1A 3W0OA 1DAYA 1A9UA 3VRYA 4JAJA 4AZTA 3L8PA 2W4KA 1WCCA 3QXPA 5CSVA 4G3GA 3GU8A 3AGLA 2B4SB 3R04A 3FSFA 3GEQA 3DV3A 3RZBA 3H9FA 4YC3A 5M56A 4ZSJA 2C1BA 2VTMA 4UB7A 4GV1A 3W55A 3H30A 4XYFA 1KUTA 3VF9A 3SLSA 4NYEA 3MH3A 4FSZA 3Q04A 4O7LA 4O1PA 4O7NA 5FP6A 3A8XA 3I4BA 4UBAA 4YJSA 3UG2A 3ORTA 4U97A 4YO6A 3C1XA 4KKEA 5B7VA 4DG3E 2C69A 4CFNA 3IOKA 2VWXA 5CVHA 3GC9A 5D7AA 2WO6A 4O91A 5KZIA 3UZRA 5I0BA 3FAAA 1GZOA 3EFJA 2XAMA 3PTGA 1YDRE 4S32A 5KNJA 4XOZA 3Q6UA 2O64A 3FMJA 4MXAA 2J0IA 2X8EA 4UYNA 5GJDA 3VO3A 4L7FA 4PL3A 1YVJA 4RIOA 4MXCA 4Y83A 4FSTA 2WZJA 2XYNA 4BTMA 3BU3A 2BROA 2XIKA 4QTEA 4NH1A 2R4BA 2WPAA 4WSQA 5F95A 3IPHA 3ZLWA 4EBVA 3DKOA 3EQRA 3C51A 4BCIA 4LI5A 4Y85A 4IVAA 3VVHA 4JDJA 4E4LA 2V62A 2OG8A 3REPA 3PFQA 3U9CA 1JWHA 3DK3A 2P3GX 4BDGA 1KV2A 4AE9A 1O6KA 1QPDA 4X6RA 4YHTA 4ALWA 4PDOA 4R1VA 2GHMA 4QMMA 3PSDA 5DGZA 3POOA 5J95A 4FZDB 3PDTA 3RI1A 5CF4A 3HRFA 3Q5ZA 5EHLA 3O0GA 2W1FA 3QCQA 1Z9XA 4Z7HA 4L67A 4UXLA 4H1MA 5AUYA 2EB2A 1F0QA 1SMHA 3F66A 3BQCA 5BUJA 2YM7A 4IAFA 5HGIA 2HK5A 3DJ7A 3R9RA 4ZY5A 3KF7A 4M69A 4RZWA 4LYNA 4JX3A 2VTNA 4XV2A 4XG3A 1KE5A 3BHYA 5K5XA 4FF8A 3C7QA 1ZRZA 2YDIA 4APPA 4PNKA 3NUSA 3PE2A 4J8MA 4C3FA 5CSPA 3D15A 2JBOA 2VO0A 3D14A 3GQLA 1CM8A 1HCLA 4RWJA 2JD5A 2W1EA 4RIXA 1XO2B 4YC8A 3VW6A 3GCSA 3C9WA 4NK9A 5JSMA 4D2TA 4OR5A 4WG4A 4FNYA 1QMZA 4K2RA 4FKTA 2B9HA 4RC4A 1ZOEA 2ZFYA 4F78A 5IEVA 5C03A 5ETAA 3UVRA 5I4NA 1KWPA 5HLWA 2OFVA 4E7WA 2UZTA 3KXHA 2QODA 3ZM4A 4ZLOA 4AOJA 4GKHA 3UBDA 2VUWA 4FSUA 2JITA 3PY1A 3QX4A 4AU8A 3TWJA 4BDIA 2B1PA 4ZMEA 5JFXA 4G2FA 4R5YA 1K2PA 4FKQA 3RPYA 3TN8A 3HVCA 5A54A 4K6ZA 2Y4IB 4U9AA 4L6QA 4QT1A 3B8QA 1O6YA 3EQDA 4UMUA 4BCFA 5DBXA 4K18A 3V5QA 4MQ1A 3OW3A 2YERA 4KWPA 4RC3A 3P1AA 3KVWA 5IUGA 2R3QA 4FKUA 4BZDA 1BX6A 1OGYA 2WTKB 3PE1A 4QMYA 2ITQA 1IR3A 1H00A 4ZOGA 3D2IA 2UW8A 4FZFB 3EMGA 4L46A 3HUCA 5CT0A 3CSVA 3HMOA 1UU7A 1ZOGA 2J7TA 3MVMA 3WOWA 2JEDA 3HV3A 3R02A 3TNIA 3U4WA 2W99B 4GKIA 4IJPA 4KS8A 2PMIA 3FQHA 4AQKA 4AWIA 4QP2A 2RG5A 4CYIA 2JC6A 3L9PA 2YIYA 3BEAA 3N4TA 3E8CA 1OL6A 3OEFX 1JKTA 4EK6A 5ETFA 5CALA 1RDQE 2XIYA 3A8WA 5LMKC 5K4JA 3PRFA 4OTRA 2ITPA 4L3JA 4AZSA 2PZYA 2XP2A 3BQRA 1YI6A 4FKLA 2X8DA 2BHHA 3MVJA 3E87A 3ZO1A 4C3PA 3DNEA 3RWPA 3AKKA 2UW9A 2WU7A 2I0EA 4I93A 4KIQA 2QOCA 2WKMA 3NW6A 4AP7A 5FRIA 1Q99A 4GIIA 3LMGA 1GJOA 5HE0A 4DTKA 4FT3A 4OBQA 5IH5A 3UP7A 2PMNX 4J52A 3B2WA 3MI9A 4JG6A 4M84A 4WG5A 5AV0A 4DH3A 5IEYA 2HELA 2ITVA 5EDPA 4HVGA 5E92A 5JEBA 4XRJA 4U5JA 4I22A 3C4CA 1FMOE 3KXMA 2P33A 4EI4A 2Y6MA 1T45A 4C4IA 2XF0A 3L9LA 1ZY4A 3NYOA 3R8ZA 1Y6AA 4OTPA 3D5VA 4GH2A 3GP0A 4ZLYA 3NZ0A 3R8VA 4KB8A 4EOQA 5CAVA 1IAHA 3RK5A 3RPRA 4LM5A 4C8BA 4F9CA 5BX0A 5I3OA 5A4TA 2BFYA 1Q5KA 1ZYJA 3Q9ZA 4ZJVA 2XAOA 5FTGA 2I7QA 1ZYLA 4QMTA 4B9DA 4CZUA 4A4OA 4RBLA 5ETIA 4BR3A 3WBLA 3UYSA 4EBWA 4D2VA 2YCSA 1H1WA 4B7TA 4I5PA 2IVTA 4DT9A 1ATPE 3QX2A 1ND4A 1Q61A 4UZDA 4EOSA 4BIEA 1MRVA 3QTQA 4RQVA 4X0MA 3PZHA 5DMZA 4Y5QA 2RG6A 3L1SA 2G9XA 4XOYA 4TWCA 4ACMA 5FM2A 1H26A 3E62A 3QWJA 3PJ3A 1VLRA 2BDWA 4ITIA 4FJVA 1Q3WA 4LUDA 3SC1A 3ZOSA 4RVTA 5IH6A 3RJCA 3MGYA 2ZAZA 3BU6A 4DGOA 2XM8A 1G8JA 4PRJA 2PULA 3OT8A 2W17A 3QALE 3P5JC 2W05A 4AOIA 4QTDA 2HYYA 2WXVA 4CKJA 3QLFA 4MYGA 3IW6A 2XS0A 4F99A 1OECA 4QMQA 2B7AA 4YTCA 2VTJA 4IB5A 4F70A 3QZIA 3ORLA 5HCXA 3NUAA 4FI1A 1OKZA 3Q60A 4K77A 1ZOHA 4UEUA 2O2UA 4EL9A 4ACGA 4FEXA 5HE2A 4DHIB 3LFDA 3B2TA 1OPJA 4H3BA 4BTFA 4ZJJA 2B53A 3ZRMA 2PUPA 3R8PA 5M4FA 4JR7A 4HNIA 4FK6A 3D4QA 5C27A 5HBEA 5IQCA 4WNOA 3SOCA 3FDNA 2BIYA 4FZ6A 3HKOA 3COIA 4EQMA 4ORKA 2G2IA 1P4OA 4WOVA 4CTCA 2XIXA 3PIXA 4XJ0A 4O4DA 1RJBA 4IJ9A 1YXTA 5CWZA 3KXXA 1P4FA 1Q8TA 2GTNA 5A46A 4CLJA 4FL1A 4G17A 5EYCA 3VUGA 4AN3A 1G8AA 5CAPA 2R3NA 4EJ7A 2PE0A 2XA4A 3DGKA 3WARA 5AAFA 2IG7A 2GS2A 4CD0A 2R7IA 4JIAA 2WMXA 1XH8A 3MTFA 2VN9A 4AX8A 3FC2A 4HYUA 5DRBA 3RCDA 1U54B 3RGFA 5HU3A 3GU7A 3OF0A 3U6IA 5AP4A 4HYSA 3TUCA 4FNZA 2NYAA 3V51A 4GEOA 5M08A 3KL8A 4G6OA 3DZQA 5FG8A 4MKCA 2OH4A 3R1SA 1I44A 3M42A 5CX9A 3IG7A 3SXFA 2RL5A 2JIUA 5CS6A 4FBXA 4IAKA 4HPUE 4BBEA 4J53A 5IA2A 2Y4PA 3NYNA 4CQGA 1UKIA 1OL1A 4QPMA 5KMIA 5EM8A 3QC4A 4D5KA 4EK8A 2UW4A 4YJTA 5DIAA 3VHKA 5KHXA 4DFLA 4JQ7A 4QP8A 2VWWA 1FMKA 4AG8A 2R64A 3H10A 3DCVA 2XNGA 3GB2A 2DQ7X 3LW0A 3V04A 1MUOA 1OIUA 4DEGA 4LFIA 1IG1A 3DBFA 3PVGA 4H36A 4UWCA 2PVLA 5CXHA 5T6KA 4RX5A 2X0QA 1ZMWA 1YOLA 2RFEA 5M4IA 4YHJA 5GINE 1H4LA 3BHHA 1G8SA 1PXPA 4QDEA 3FMMA 2WB8A 4ZY6A 3WF5A 1KSWA 3FXZA 3WYXA 3UZTA 4HW7A 3S4QA 1WZYA 2JDSA 3V6SA 3BZ3A 4G16A 4GG7A 5CEIA 4CXAA 1S9JA 3PA4A 2OJFE 4NIFA 3II5A 1TKIA 3I81A 3QFVA 2HY0A 2WQMA 2WTDA 4ENYA 4XV1A 5HO6A 5JN2A 5JGAA 3M1SA 4GCJA 4O82A 5EQPA 3CTQA 5DT4A 4PV0A 3OS3A 3KQ7A 4FNWA 3W8QA 2X4ZA 2UVXA 2JIIA 2YDJA 4L3LA 4YLJA 3TKIA 3BCEA 4HGLA 4AT4A 4O0SA 3VUHA 3NAYA 5HIDA 3OG7A 5EKOA 3R9NA 3HA8A 2OIDA 1Q8ZA 2BTRA 3ZSIA 5AR2A 3UQFA 1OKYA 3LLTA 3DT1A 3ORNA 2XBJA 4PMMA 2JKQA 4L52A 4LQMA 3QRKA 4BCHA 2AUHA 1STCE 3DOGA 3JS2A 4BJJB 4BZNA 3DTWA 3NUPA 5BVEA 1ZMUA 5HG7A 3NMUF 5CXZA 4FMQA 2PU8A 4JVGA 4EQCA 3D5XA 2OW3A 4TRLA 2XB7A 2PZIA 2XZSA 3DB6A 5IDNA 5IG1A 1G3NA 4JIKA 4N57A 2ZB0A 4A9UA 3ELJA 4FZAB 2IVVA 4GUEA 4XG6A 3ZTXA 4DYMA 2E9UA 4XMOA 3DKGA 5EYMA 4R77A 3FZPA 3ENMA 5CF6A 4F9BA 4A7CA 3Q4TA 1JQHA 3MA6A 4AQCA 4AXFA 2ZB1A 4XG7A 2RFNA 5CU2A 3BYUA 2VTSA 4ANOA 4QMWA 3RINA 5K4IA 2YHVA 4UX9A 4IZYA 2OKRA 2XBAA 2QLUA 4E5BA 2I6LA 2OZAB 4MX9A 3FMNA 3RKBA 3UVPA 3W0QA 3UODA 4EH3A 1H24A 2C3LA 2PZPA 4R7IA 3ZUUA 4M3QA 1WAKA 1IASA 5D41A 2BDJA 5EOLA 3C13A 1ZYDA 4NZWB 4A9TA 3CEKA 4FYOA 1WBOA 2OJ9A 4GT4A 3OWLA 4RX9A 4D2WA 4G1WA 4X3FA 1JSUA 4I3ZA 1GY3A 5I9VA 3Q2MA 5HX8A 3CC6A 2JKKA 3BHUA 3TACA 3BLAA 3A60A 5ANIA 3DY7A 3F88A 4ZSLA 3OEZA 4IB1A 4DAWA 3IDBA 5LOHA 1NVSA 2CHLA 3EHAA 5KHWA 4ASZA 1OIQA 2ITUA 3U6HA 3AC4A 1Z57A 4QQ5A 4Z7GA 3ENHA 3JR1A 3L9NA 5ANOA 2QURA 3HV6A 4G31A 4XLIA 4JG8A 3FI8A 3LXPA 2XK3A 5ITAA 2XNOA 1W83A 2F2CB 3ZUVA 4QMUA 3TZ7A 2EU9A 2R3JA 5A4EA 2XK7A 4FT7A 3BPRA 2CLXA 2OIBA 5AP3A 4V0GA 3SW7A 5HVJA 2FUMA 4L7SA 4XG9A 3RP9A 5CEOA 3D5WA 4EONA 1CKPA 4CYJA 1OUYA 5JT2A 2PSQA 2GMXA 2QO7A 3R2YA 3V8SA 2YJRA 3FMLA 4G6LA 2X0PA 4ID7A 4O4FA 1UU8A 2BRHA 2BZIB 4BYJA 2CN5A 2RF9A 3JPVA 5BPYA 1HCKA 3I7BA 4RZVA 3PFYA 4BDKA 4XHKB 4UWBA 4XRLA 1O6LA 2WOTA 5D12A 4J98A 3N9XA 3WE8A 2B52A 3OCSA 1E1XA 1FVTA 2SRCA 3LAUA 5L8KA 4AN9A 1SVHA 4DA5A 4BGHA 5AA9A 4A06A 4BTJA 4HNFA 5ETCA 5JZNA 2JAMA 3EB0A 4G3EA 4O7VA 3LKMA 3FMKA 3KCFA 1V0PA 3MPAA 4HOKA 4IVCA 2ZVAA 4U3ZA 3UYTA 3SV0A 4CCBA 3UQCA 4IAIA 4OAUC 3FLZA 1YHWA 3PUPA 2VU3A 5E4HA 5EM7A 2IZSA 2QHMA 3IW4A 3OCTA 5CNNA 2VTPA 1KE8A 5AR3A 5BMSA 3BBWA 4TXCA 2BDFA 4D4VA 1J7UA 3A7HA 5FWKK 3V5JA 3BE9A 3U55A 1GIJA 5IF1A 3KULA 4FIEA 4AT5A 4OT6A 4KKGA 2R7BA 2BRBA 3MSSA 4KUJA 4UMTA 3FL5A 1MP8A 3SRVA 4R3PA 4IQ6A 4C4JA 2WTJA 4RSSA 1MRYA 3HNGA 4FEUA 2VD5A 3UVQA 4BIDA 5EM5A 3VNTA 1WMKA 4BGQA 5CASA 1NVQA 4A9RA 4NL0A 2YABA 5CZIA 2ITYA 3K2LA 3A7IA 3DU8A 2ITOA 3DK7A 4FV3A 5CY3A 3W0NA 5IQAA 5AFVA 3D83A 4OT5A 1XKKA 3ORKA 1M17A 1Y6BA 2XJ0A 3HMMA 5FTOA 5I3RA 4RLLA 1BYGA 2IZRA 4R7BA 5E1SA 4CZYB 1JNKA 3KMWA 1J91A 4L01A 1IEPA 4LGDA 3W18A 4G6NA 3ZDUA 5IA1A 2YJSA 4RJ5A 2JGZA 4AGWA 4X3FB 3P7AA 4BI1A 3TI1A 2XK8A 4X2NA 2Y7JA 5LCJA 3DLSA 1H01A 4LV8A 3K5VA 3OMVA 3PIYA 4DGNA 1AD5A 5EQYA 1K9AA 2CKPA 2HXLA 4YPSA 1R0PA 5E8VA 4M8TA 2BZHB 3C4FA 1V1KA 3I5ZA 4LOOA 5CU3A 5DHJA 3ZCLA 3KGAA 5CEQA 5CSHA 3FY2A 3P78A 4WO5A 4Y72A 3ZO2A 4TL0A 4O0XA 4O0UA 4OLIA 5C8MA 4C58A 2AEGA 3UIUA 3SKCA 5EDQA 2VTAA 4AAAA 2UW7A 3LIJA 5L6PA 4IIRA 2C3JA 5HLPA 2VTHA 4ZSEA 3CJFA 5M53A 5C8KA 5FEEA 1LEZA 2YM3A 3QTIA 4ZS0A 3WZKA 5LJJA 4LOQA 5HO7A 4R8QA 4LV7A 4FRFA 3EFLA 3IONA 1LPUA 2QG7A 4O84A 1Q24A 4QRCA 1A48A 4ERKA 5FDPA 3UOJA 2QR7A 3OWPA 4W4YA 4IM3A 1FQ1B 4KSPA 2XKCA 1FBNA 2WIHA 5D11A 4MBJA 4W4WA 4BN1A 3GU4A 4DC2A 2HW7A 3P5KA 4ACCA 3KRXA 4BBMA 5ANGA 2G01A 2YIWA 2XKFA 3A2CA 3OBGA 3VS2A 5I9WA 5BUIA 1Q62A 4MXYA 4DH7A 3BBTB 4XP2A 3HMPA 3ULZA 3DAJA 5DR9A 2QLQA 2OLCA 2ERKA 5IA4A 2Y9QA 1IA8A 4WBBB 4R78A 2RIOA 2X7GA 3ODYX 4UV0A 5AR7A 4QQJA 4XG8A 4C4GA 2R3HA 4MK0A 1MQ4A 2O5KA 4TN6A 1BMKA 3H0ZA 4FEWA 2B9FA 3DS6A 3VN9A 2B9JA 3IS5A 3QYZA 3FBVA 3VAPA 1H27A 2YIXA 5DT0A 5C9CA 4ZTHA 4QTAA 3NUXA 4AXEA 3R01A 2VWZA 4JJRA 4EHZA 3O96A 4QPSA 4DEIA 2XMYA 3DXQA 3IW8A 3HGKA 2X9EA 5AV3A 4EKKA 1PMUA 3S1HA 4K11A 3ZUTA 3KKVA 4OTHA 4CMOA 3H4JA 1PXLA 2GFCA 2ZV2A 3LXKA 1KE7A 4S31A 3HZTA 1YKRA 3R9DA 4BCGA 5JFWA 2GPHA 4FT9A 2X0OA 5AR5A 2XYUA 4K1BA 4BWXA 2GHLA 3DBEA 3MV5A 4JBPA 5IQIA 4BWKA 2V55A 3LCKA 3DTCA 4JDKA 2UZBA 4Y8DA 4LL0A 3RNYA 2IZTA 3A7FA 1XWSA 4KBKA 2YM8A 3TXOA 4HVSA 5JGDA 1PXJA 2UZLA 2R3FA 3R8LA 3R83A 2ITZA 3GQIA 2RKUA 3JXWA 3U87A 4XCUA 3VBYA 4IB3A 4S30A 2PVYA 5H9BA 5HI2A 1GZNA 1Q4LA 2OSCA 3HYHA 4BDEA 3BELA 3C50A 4O7WA 3EIDA 3QQFA 3QGWA 4QMXA 5K3YA 4YLKA 3JY0A 5A3XA 1RE8A 1TQMA 1XJDA 5L8LA 5CZHA 5J87A 4FTRA 3S00A 4BGGA 3TIYA 1FGIA 3C4ZA 5ICPA 2UZEA 2UZNA 5J1VA 3EKNA 4CZTA 3ALOA 5IQDA 1J1BA 3MH1A 4EH6A 2HWOA 4TYGA 5HU9A 2VTIA 3OC1A 3OXIA 2LGCA 3KN6A 4YTHA 2UZDA 3VS5A 4C33A 5L4QA 3D0EA 5IA3A 3QRIA 4F65A 2EUFB 4IADA 3HV4A 4FOBA 4JRVA 5M57A 1QCFA 4NFNA 4FGBA 2XK9A 3DA6A 3KF4A 5GNKA 3COMA 4UY9A 2A27A 1U46A 2P55A 4E6QA 2A2AA 4O4EA 3ZHPC 1E1VA 3FZOA 3V01A 3MJ2A 4AA0A 4FKPA 4IBMA 5ANDA 3KXNA 3NNXA 2BKKA 4FKSA 5G1XA 2QOQA 3G6GA 4EZ5A 3CPCA 1SZMA 4JMQA 2WEVA 5LVLA 4ASEA 3SA0A 2W96B 4LRKA 5HBHA 4BCKA 3FLWA 3HRBA 5AUWA 2X6DA 4II5A 4MNFA 4IH8A 2EXMA 2CNQA 5AUUA 4U0IA 5T68A 3W32A 4KRCA 5AM7A 3EQGA 2E9PA 4QQTA 3G90X 5B2MA 4MNEB 3P08A 3MYGA 4DT8A 1PYXA 1M2PA 5AAEA 2LAVA 4XH6A 3R7YA 5KBQA 2UZVA 1FVVA 3QTRA 3R73A 4RIYA 4DITA 2QC6A 3EKKA 4IW0A 5AUTA 4JOAA 4ITJA 4HVDA 4D5HA 4QMVA 4GK3A 4J71A 2J0LA 3L8SA 2G2FA 3PPZA 5LVMA 5LARA 2OICA 4RQKA 2C1AA 3Q4UA 1YWVA 4ERWA 4MUQA 3B8RA 4O6EA 3DK6A 4OTFA 5EDRA 3GT8A 3MH0A 1WBTA 4FSWA 3GU6A 4U8ZA 3SW4A 3R8MA 4CG9A 3OD6X 4RIWA 1YDSE 2GDOA 1V0OA 4AW1A 3WF7A 5CAUA 4DEDA 1MQBA 3VHEA 4FSMA 5HG8A 2UVZA 2PZRA 5E91A 5M44A 2GNLA 3AT3A 3W0MA 4D1ZA 4B0GA 4BVUA 3E92A 4FV0A 4N4SA 5DR6A 4EHGA 2ZV8A 5FXRA 2O0UA 4FT5A 4DDGA 5DRDA 3PJ2A 4BZOA 4YZ9A 5AP5A 1O9UA 1V0BA 4E6CA 1ZYSA 3MB6A 5DVRA 4O7RA 3OCBA 5BQ0A 4LL5A 4TYHB 3DKFA 2H9VA 2W4OA 3QHWA 4ZTSA 4P4CA 5TO8A 1PF8A 4YJNA 5HESA 3ORZA 5IZFA 4ANLA 3R7IA 2R3PA 4JBOA 3DAEA 2IW6A 2P4IA 2XIZA 3LCDA 1WVWA 5JFSA 2BTSA 4M0YA 4C4FA 3MIAA 1NT2A 4L8MA 2VWVA 4R6VA 3AC1A 3GOKA 4RGJA 5HE3A 3VONA 3QU0A 4RFYA 3QKKA 2VNWA 4CGAA 4DLJA 3RTPA 3I79A 1FOTA 3MA3A 1SNXA 4I4EA 3KY2A 4NCTC 2XVDA 4F6UA 5EI8A 3EFWA 3TKHA 1YWNA 4XX9A 3EFKA 4CMTA 2CCHA 2VX0A 3EQIA 5C8NA 2JFMA 4QMLA 4BDAA 4DF3A 4W4XA 4ALVA 4TWNA 3MFSA 1GAGA 4WIHA 3SX9A 3DB8A 3LE6A 4YC6A 3NUYA 4RLKA 3GOPA 4R5SA 3FZRA 1GIIA 2W4JA 1W7HA 4UALA 4E5AX 4J97A 1ZARA 4GUBA 5HNIX 4MD7E 4BI0A 1XH9A 2BMCA 4IWPA 1YQJA 4F7LA 3QKMA 4MBLA 4KIPA 4W8DA 4BF2A 4PWNA 1OPLA 1JAMA 1REKA 2HZ0A 3PP0A 2IF8A 1H1PA 3QBNA 3W2OA 4EYMA 3D2KA 3NIZA 2Z02A 4EKLA 2AC3A 4TW9A 2OH0E 3AD5A 1M14A 4DBXA 3K5UA 4O7TA 4E3CA 3GFWA 4I21A 3F7WA 3PJCA 5CI6A 2H34A 2C5XA 4FTTA 3DFCB 3ORIA 3KULB 3R21A 2YA9A 4QP9A 4B99A 2ZV9A 3KREA 2WMVA 2VWUA 3TTJA 5A4CA 5E8TA 3GC8A 1DM2A 2F7ZE 3ACJA 3WIKA 3VBVA 3R1YA 4GMYA 1G8KA 3QA8A 3IW7A 4YHFA 4EEVA 1K3AA 3CTJA 5M4UA 2IJMA 1JSVA 5TKDA 4FV8A 3R7OA 4EJNA 2YM6A 4CNHA 4CFXA 5BV3A 3ZZWA 5FXSA 5KMNA 1DI8A 2J6MA 3PA3A 5JQ8A 3NFGB 1JKSA 3EL8A 1UU9A 5J5TA 5B2KA 1R0EA 4PTGA 3GCQA 5BNJA 5AM6A 5FDXA 4BICA 4WHZA 1JKLA 1R78A 4FODA 4FSRA 4TTHB 3VS1A 2WMRA 3K3JA 5CF5A 2QO9A 4I20A 2WEIA 3D7TB 1W98A 3DDQA 3R0TA 4FIGA 3VBQA 3ZBXA 4Z3VA 3F2RA 4F7JA 3HA6A 4AW0A 3T9IA 3TL8A 1U59A 3F3WA 4M13A 5IISA 4S2ZA 2QG5A 3P7CA 1P5EA 4I24A 2PVMA 3QGYA 4OBPA 4XNEA 5AUZA 5ANKA 3UTOA 4E93A 4W9XA 2VWIA 3E8DA 1PY5A 3C0HA 3TDVA 2ERZE 4BDHA 2R3OA 3PRIA 2J51A 4NFMA 5CYIA 3PSCA 3ZZEA 4WNPA 3FPMA 4LMUA 4JX7A 4ANNA 2J9MA 5CF8A 2VTOA 5L2IA 1H0WA 1KE6A 1URWA 5EI2A 4AS0A 4A07A 5DE2A 3DQXA 2VZ6A 3LOKA 4F0FA 3ZRLA 1VYZA 5E7RA 3O5AA 4EZ7A 3QZGA 5KBRA 3GC0A 3V8WA 3TT0A 5EW3A 4O86A 2GU8A 4ZMFA 3UQGA 4D4RA 1OPKA 1YHSA 4GJ3A 3RBWA 3U9NA 1YOJA 2VWBA 1WBPA 2PHKA 2W5AA 1W2FA 3KXZA 3PY0A 2YDKA 3CD8A 3KMUA 3Q2JA 4E6AA 4EHEA 4NJ3A 4FV9A 4BDJA 4DEBA 3HDNA 2E9OA 3KRRA 4RJ4A 1YI3A 3VS7A 3ZXZA 1KV1A 3F69A 4L42A 5EG3A 4NW6A 4D4SA 4LGHA 4S34A 3BL7A 2VGOA 2VO3A 4DH5A 3PPKA 4JL9A 5EW9A 2YLEA 3TNQB 2X6EA 3QTXA 5CNOA 4X3JA 3Q5IA 4QYEA 4UMRA 4GSBA 4UZHA 3MY5A 2XNMA 4CLIA 4DH1A 5AP7A 3OY1A 1T46A 2B9IA 3LXLA 4EH4A 4WA9A 3SVVA 3BEGA 5M07A 3ZLXA 5GIOE 4CQEA 3R1NA 3QZFA 2YEXA 4H3PA 4M14A 4EQUA 2BRNA 4MAOA 3MVHA 4YBKA 2FGIA 2G15A 3FI3A 3PWDA 3MFUA 5IUIA 1Q8UA 3G6HA 4EK3A 4F08A 2DS1A 4ZEGA 4LDTA 2F49A 4ZXTA 4RWLA 1OM1A 4QPAA 5HG5A 3PVBA 2JDOA 3OOMA 1OKWA 4GJ2A 5DEWA 2VTRA 3F3UA 3NAXA 3NEWA 4HGTA 4YZNA 3VBXA 2XALA 2A98A 4I5HA 4FNXA 3RMFA 5B2LA 1TFFA 4RJ3A 1PKGA 3W33A 4U41A 2PL0A 3BGPA 3NUNA 4YSMA 3MY1A 3U8WA 3DFAA 5A4LA 3VRZA 4QOXA 1PXMA 3T8OA 4MHAA 2FSLX 5M55A 3O8UA 1J7IA 4JXFA 5EM6A 1H8FA 3U6JA 4JDIA 1PXIA 2E2BA 1I09A 3AD6A 3IDCA 2WTIA 4U45A 1MRUA 5CT7A 1JSTA 2W1GA 4KKHA 2OWBA 4CG8A 3ETAA 3ZC6A 2G2HA 3NCZA 5LVPA 1R3CA 3EH9A 2CGXA 4BFMA 1U54A 4TWPA 4IACA 4XP0A 5F94A 2NRUA 2DYLA 3C5UA 2YZLA 3ITZA 2QOLA 4MD9E 4FEQA 5IQEA 4I0TA 5G6VA 2WTKC 2R3R