3FXZA

Crystal structure of pak1 kinase domain with ruthenium complex lambda-fl172
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
292
Chain Sequence
SDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PAK 1
publication title Targeting Large Kinase Active Site with Rigid, Bulky Octahedral Ruthenium Complexes
pubmed rcsb
source organism Homo sapiens
total genus 99
structure length 292
sequence length 293
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fxzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fxzA01
5GZ9A 3KXXA 4UMQA 2J0KA 1W7HA 4I6HA 4CFFA 1HOWA 2PVMA 3VN9A 4F1MA 3UZRA 3GQLA 4KA3A 3HMPA 1UU8A 3EFLA 5DLSA 4LOOA 5I9VA 5HCZA 1BL7A 5EYKA 3KEXA 4HGEA 3D2IA 4JVGA 5CAVA 4C61A 4O7LA 3DB8A 1MRYA 5C9CA 3V01A 1NVQA 2RG5A 2BZHB 4G3EA 1Q4LA 5EH0A 1ATPE 1PXNA 2QURA 2H9VA 2W5BA 2HCKA 2XNOA 3LAUA 3GOKA 2AYPA 2UW3A 4X3FA 4XG2A 3E5AA 3WF6A 4O82A 2OIQA 2VTHA 1YWRA 2FSMX 2VWUA 5L8KA 4O7WA 1CM8A 2WMVA 4BCPA 2C0IA 2XJ1A 3OCBA 2W1DA 3E7VA 3AD4A 3NSZA 1Q41A 3R22A 4M97A 4WT6A 5AR4A 5HIDA 5M08A 3O0GA 2C30A 2E9UA 2JDOA 5HNIX 4FV3A 5M09A 4U3ZA 5B7VA 3VUIA 4BWXA 1R0EA 4DH8A 3QBNA 4IADA 3O71A 4PTEA 5DH3A 4GL9A 2HK5A 2WPAA 3QRJA 1P14A 4AOIA 2WTJA 4G3GA 2QU6A 3NUUA 3HV7A 1WVXA 2VO6A 5HO7A 3ORMA 2QU5A 4ZP5A 1GNGA 5GJFA 3UC4A 2C6EA 4GVJA 3TNWA 3C7QA 1PXJA 3SXFA 2DS1A 4EOPA 3CE3A 1GIIA 1OKZA 3VC4A 3ANRA 4KIKA 2QR8A 3Q60A 4FTMA 4U41A 4S33A 2VTPA 4W9XA 3W8QA 4S32A 2BDFA 3R8LA 4CNHA 3GCVA 2WTVA 1OL2A 1S9IA 3MW1A 2X6DA 3Q9XA 2VWXA 3R8PA 4QYYA 3RALA 4OT5A 4BCJA 5JSMA 5K0XA 2WU7A 2B53A 5HG5A 2VX1A 4O7RA 2JFLA 2BHHA 4MEDA 4AN3A 5M4CA 4IZYA 3D2KA 3ACJA 3OMVA 1BMKA 3FWQA 3GP0A 3KRWA 5D41A 4MCVA 4CYJA 4O7ZA 2H34A 1SZMA 3MVJA 4U40A 4M69A 4DTBA 4DGMA 5HG7A 3PA5A 2CNUA 2FVDA 3I7CA 4XG3A 3MFRA 1DS5A 2F4JA 2VWIA 2EB3A 5FQDC 4E6DA 2VWBA 2Y4IC 4FSUA 4FKJA 4G3DA 1VYZA 1YOJA 3AMAA 3BYMA 3NW5A 4I20A 3PJ1A 4U97A 2Y9QA 3ZBFA 4DF3A 3OBGA 4YNEA 4XV9A 2Z60A 3FHIA 3GNIB 3KVWA 3KXMA 3PRIA 4MXZA 2OF4A 3ORNA 4RJ3A 5DOSA 3AOXA 4I0RA 1QPCA 3QZHA 3SQQA 4IB1A 3MI9A 3ZXZA 1YXVA 5CAOA 3RAWA 1MP8A 2R3NA 4ZTMA 3GT8A 3CD8A 3ODZX 3EQGA 1CMKE 2REIA 2GHMA 4AFEA 3ZRLA 3R7VA 1H01A 1KV2A 4KKHA 4BCHA 3QKMA 1WMKA 4F1OA 4XLIA 4UXLA 4HVGA 4YLKA 3UE4A 4JG7A 3QQGA 4FTOA 5I9YA 5DEYA 2WTWA 5EYDA 3R02A 2I0VA 1JKSA 5CY3A 3ZSIA 1U54A 3LCOA 4ANNA 3PXYA 3R2YA 3FXZA 3FZSA 5K0KA 2PE0A 3V04A 2XM8A 1QCFA 3C4CA 5T68A 4DFLA 4EK4A 4FEUA 4IVCA 2YM4A 4PPBA 1ZOGA 4E6QA 3V8TA 4XG8A 2R3LA 3RPOA 2FYSA 1J7IA 4YJRA 1IAJA 3DZOA 3S00A 2XIRA 3D5VA 3TEIA 3VIDA 2ZM1A 5L6WL 5EQPA 3KVXA 5I3RA 5HLPA 4YZBA 4O0YA 2CN5A 3NR9A 4E4XA 3EHAA 2XNGA 4DLJA 5JGDA 3B2TA 1ZAOA 1FMKA 3ZFXA 1ZZLA 3AQVA 3DY7A 2WFYA 4ZZMA 4TTHB 3PIYA 4QQJA 4F9WA 4D55A 4TYHA 3EZVA 3RK7A 2WHBA 1SYKA 1UNGA 3KF7A 4RJ8A 3DJ5A 1VEBA 3NIEA 4C3RA 4BCOA 3DQXA 3LOKA 1KE6A 4ZXTA 3QTQA 1R39A 1JQHA 2CMWA 2OJFE 4FKRA 3W2CA 4IZAA 4ZIMA 3MFTA 1FVTA 2GNHA 4FKQA 4MD7E 5HVYA 3EIDA 4DTAA 2CGWA 2JBOA 3QUPA 4QMYA 4G3CA 4G5JA 2JAMA 5I4NA 4A7CA 5LQFA 5I9ZA 4YNOA 3C4ZA 5KMIA 4FL2A 2J0LA 2E9OA 3EN7A 4OT6A 4LRJA 4EOQA 3TTIA 2OO8X 5KUPA 4N6ZA 2OF2A 4EH5A 2HZ4A 4WO5A 3TTJA 5JFSA 2YIQA 4Q2AA 5BX0A 2W4KA 4G5PA 2WMAA 4D1ZA 2CPKE 4DEBA 2XCHA 2ITPA 3C1XA 4M66A 4J71A 5HBJA 5LCJA 2RG6A 4JG8A 5EDRA 3EQFA 3ORXA 2YDKA 3PUPA 3QTZA 3CS9A 3JPVA 5F1ZA 3G5DA 1FVVA 3BBTB 4C33A 3QGYA 4XP0A 4EHEA 1XH9A 4FTAA 4NW5A 2DYLA 5HBHA 4KIKB 2WQEA 3FKNA 3KMMA 4FEVA 5IQDA 3M11A 3S95A 4D2RA 1PXPA 4G9RA 2VWWA 3BE2A 5DT3A 4BDCA 3FHRA 3VVHA 4RPVA 2GNLA 1JPAA 2HENA 3EZRA 5FXRA 4A9UA 2UZBA 1ZWSA 1KSWA 2VTLA 2R5TA 4J96A 2UZTA 4E73A 5AUTA 4E5BA 4AW1A 4EBVA 5F20A 4WBBB 3ROCA 5EW8A 4BTFA 4FSNA 2FSLX 2Y4PA 4QYEA 5CU3A 4WUNA 4M69B 3MVMA 4FSWA 5I5ZA 3KL8A 2ZV9A 3Q9WA 4LGGA 4RWLA 2QC6A 3GOPA 5CANA 4NZWB 1Q3DA 2DWBA 1GZNA 4U43A 1W84A 4AQCA 4EZ3A 3W2OA 3L8XA 3QKLA 4FSRA 2PZ5A 3VUDA 3A99A 4AW0A 4D2SA 3GEQA 4IX5A 2EXMA 3NUYA 4ITJA 4YBJA 3VUMA 4BDEA 3MDYA 3FDNA 2W5AA 4HZSA 1NVSA 3P9JA 3VW6A 2QO9A 2YABA 1UWJA 3LFFA 4BC6A 4A9RA 2C5YA 4JIAA 5EK7A 4XP3A 4EWQA 3SV0A 1XKKA 1UNLA 1DI8A 3D4QA 4Y46A 1SNXA 4HOKA 5CEPA 4USEA 2YAKA 1WVWA 3I0OA 1ZRZA 4FT3A 4CMTA 3GC8A 5CQWA 4NTTA 4UV0A 2ZVAA 3UO6A 5KKRB 4BL1A 4EH4A 3BHYA 3EFKA 2F2CB 1W82A 2IZTA 3IG7A 3VS2A 2XIZA 3LFBA 4YGAA 4TNBA 3UNKA 4RA4A 3UDBA 5GJGA 2CHLA 3CQWA 3R2BA 1OL5A 3ZSGA 4BDGA 2YFXA 4CTBA 4E6AA 3HAVA 1V0BA 3GENA 4CFNA 2PE2A 4I41A 3W2RA 3ZU7A 1XH5A 2J0IA 2QCSA 3W16A 3WZEA 4K2RA 5E1EA 3QZIA 4WSQA 3VUGA 2XK3A 3VRZA 1YOLA 2J9MA 4ALWA 1LUFA 3MFUA 4S34A 5JGBA 3BYVA 3QQFA 1SMHA 2FSTX 4D2WA 4XBRA 3D0EA 3HV3A 4U3YA 1KUTA 2B9JA 2WIHA 4FIJA 4JR3A 3MTFA 3RZFA 5BPYA 5JZJA 5LMBA 3ZLSA 4XP2A 3FXWA 3R73A 2RKUA 3K5VA 1KE5A 2XK8A 4TYHB 3SXSA 3V5JA 5J5SA 5J9LA 2OXYA 2GHGA 2UW6A 3UIMA 4D2TA 3ZFMA 5BUJA 4YSJA 2V22A 1OIUA 4FIIA 4AX8A 4BCMA 5B2LA 4I4FA 3SVVA 2ONLC 4FGBA 1U46A 3CXWA 4GYIA 3R83A 4ACDA 3K3IA 5EOLA 2XH5A 1H1QA 4MVFA 1KE8A 1OPLA 4G17A 2JDSA 4MHAA 2W9FB 4M84A 3UVQA 3PIXA 3DAKA 3NNUA 1OKWA 2UZEA 4QPMA 2W1FA 2GFSA 4O1OA 4AUAA 4BKJA 5E92A 4I5HA 1G8AA 3UODA 3DXQA 1OVEA 1H0WA 2Z7SA 3WF8A 4D9UA 5IDNA 5DR6A 5JKGA 1W8CA 4M14A 4PRJA 4QMOA 3II5A 2JKMA 5CALA 2VNWA 4FKSA 3F6XA 3LVPA 3NUPA 4FSYA 4Q5EA 3IOPA 5KMNA 1Q8UA 1R1WA 4HVIA 3LM5A 3PWDA 4RWKA 4DEGA 5CS6A 2IPXA 3I79A 5E8ZA 4V01A 3CY3A 3KCKA 3OCGA 2Y6MA 4USDA 1JNKA 4J8MA 2P2IA 3LXNA 5J7HA 1A48A 5H8EA 1Q97A 3NPCA 4FT0A 3FMKA 5BYZA 3F5GA 3NEWA 2C3LA 3PPJA 4YPDA 4G3FA 3UQFA 3BLQA 3ORKA 3LXLA 3W1FA 2GNGA 4FSZA 4LYNA 3DB6A 2A2AA 2ETKA 4AXAA 4R78A 4RJ6A 3DAEA 4JJRA 3NAYA 2W05A 2XIYA 3VUTA 3RI1A 1HCLA 4BTMA 4WNOA 4QT1A 4I0SA 3E62A 5DIAA 4LV5A 3G51A 3W18A 4EKLA 5BNJA 3W2QA 3VUKA 2HXLA 2EU9A 4ID7A 4JL9A 3TV4A 4RIWA 4EH2A 4PP7A 4BI0A 1MRVA 2PULA 5BVNA 3BHUA 2W1EA 4AGDA 2J50A 3F2NA 2UV2A 4XYFA 1A06A 3UOLA 4G2FA 1QPJA 5IA5A 3NWWA 3IS5A 3L9LA 4TNDA 2VTIA 4V05A 4DINA 2ITOA 4IAKA 5J87A 3PIZA 4K18A 3U9NA 3W33A 2CKOA 1APME 3G9LX 4KSPA 5KZ0A 5M07A 2ITUA 2W0JA 3LFCA 4ZSEA 3JVRA 1UNHA 4K8AA 4K11A 2WMUA 3FMHA 3AG9A 4UMPA 3H4JA 3K54A 5AUVA 4ZEGA 1WZYA 2HAKA 3IK3A 1YHWA 2C3JA 3KF4A 3KU2A 3Q5IA 4FV2A 4LV8A 4E4MA 2WZJA 4X3JA 5C03A 4IEBA 4N6YA 3A2CA 2ITQA 3G33A 4WRSA 4AT4A 4C0TA 2PYWA 3IW5A 4NFNA 3AC8A 5E8VA 4IWDA 5HTCA 2C69A 4UALA 3U6IA 3BZ3A 5BVOA 4U44A 5JGAA 3DTWA 2X9FA 3R30A 3C4XA 2ZMDA 3MWUA 3QA0A 3O2MA 5CI6A 3S3IA 2BRBA 3BI6A 3OXZA 5HG8A 3BQCA 3ZONA 1WAKA 5FP6A 5A6OA 3AT2A 4O0WA 2XK9A 4V04A 4AGCA 3QD0A 2YM3A 3IW8A 2BAKA 2BRMA 4J95A 3G6HA 3GFEA 3EB0A 2QOLA 2YLEA 3OEFX 4KB8A 5E8UA 3RPSA 5AIRA 5M4UA 1G8SA 4C3FA 1YRPA 5CEOA 1XBAA 3KN6A 2H96A 4LI5A 3PLSA 4Y83A 4HYUA 4R5SA 5FBOA 4EONA 3NVMB 5A4CA 5DT4A 1J1CA 3F2AA 2W4JA 3IW6A 4G6NA 4EHVA 3IONA 4WG5A 4NTSA 3RHXA 3QXPA 3R0TA 4GYGA 2A0CX 2R3JA 2HW6A 2X6EA 4GT3A 2XNMA 2XZSA 4J99A 2YZAA 4PDOA 5AP1A 4DYMA 5CEMA 3EQHA 5ANGA 3ZUTA 1H07A 3C13A 5CX9A 3UP7A 4BDHA 2PMOX 4E20A 5AA9A 4RLLA 4CXAA 3HECA 4GJ3A 3O51A 1RE8A 4OBPA 5CEIA 4Z55A 5DMZA 3A8WA 4YSMA 4OBOA 1X8BA 3ZOSA 3LFNA 3QFVA 3ZLXA 4EH3A 4DH5A 4IB0A 3VBWA 3KKVA 4F4PA 1LR4A 2UZWE 5ACKA 1ZXEA 4JBOA 4BTJA 3BEAA 1WBOA 4EYMA 3BYSA 3JUHA 2R3MA 3DJ7A 2QHMA 3AD5A 3MBLA 3QQLA 4V0GA 3V8SA 4PMPA 3OVVA 4IC7A 5JEBA 4L45A 3KULA 5CENA 1ERKA 3RINA 4RJ5A 4E8AA 3LLAA 2ZAZA 5A3XA 4EOJA 1BUHA 1XBBA 2BILB 3HVCA 4L68A 2JITA 4DGGA 4CQGA 4E93A 5LCKA 3EOCA 4PMSA 5CT0A 3DCVA 5AP6A 3RBWA 4BB4A 2BKKA 4AW2A 2OIBA 2X2KA 1Q99A 4WG4A 5AP5A 2HZIA 3MY1A 4FKVA 2PVHA 1JSUA 3BQRA 4QP9A 4R3RA 4ZTNA 3RZBA 3UJGA 3VBTA 3MA6A 4R7HA 3F66A 4M67A 3MH3A 4RC3A 3FLNC 2RSVA 2BPMA 5DNRA 2OLCA 3CY2A 3AC5A 4KKEA 2XS0A 3CKXA 1H8FA 3W10A 5CF8A 5IU2A 3UOJA 1F3MC 3HDNA 5A14A 5C26A 2EUFB 4ZTHA 4S30A 4FGRA 2C3KA 4S2ZA 3DDPA 3O8UA 5KE0A 3M42A 2PZRA 4BZOA 5HE0A 3H30A 5AV0A 4IM2A 2GQSA 4EJNA 3VHKA 4ANQA 5K4JA 5IQEA 2ZB1A 3RCJA 2C6DA 3GVUA 3MB7A 2XK4A 1YI4A 2OH4A 2WQOA 2X9EA 1OKYA 2CKQA 3ZDUA 3QU0A 5HNBA 1Y8GA 2UVZA 1L3RE 1JSVA 4AZWA 4APCA 3QC9A 4BZDA 1YWNA 2J5FA 2FSOX 2QOCA 3KK8A 2XNNA 3P7AA 4MD8E 1NT2A 4KINA 1GZOA 1P2AA 2BTRA 4FTCA 4I1ZA 4AN9A 4UX9A 1ZMWA 3HMIA 2VGOA 5AADA 4DE4A 2XRUA 1KOAA 3I7BA 4IB3A 4WNKA 4GVAA 1PXMA 2WELA 4Y95A 5CF4A 3NUAA 3V5TA 4QMUA 4EZ7A 2C0TA 2KTYA 3TM0A 2B7AA 4N57A 4ZZNA 5CLPA 5EKNA 4EK3A 3MJ1A 5EHLA 3FXXA 4FEXA 5KBRA 2IN6A 4QRCA 4XHKB 4WKQA 3R8MA 2UZLA 3WZDA 4MXYA 4ZS4A 1VJYA 3DNDA 3L1SA 3MIAA 3TKHA 3V8WA 5L2QA 1W83A 3DS6A 4LMUA 3I0QA 1PXIA 2XK6A 2Y6OA 3FQHA 1BI7A 3QQKA 1PJKA 5GJDA 1Z5MA 5J95A 4AT3A 4ANMA 2V7OA 3P1AA 1PXOA 2O8YA 4M13A 2CKPA 4RX8A 2RFEA 3C5UA 4YLLA 4R5YA 5E8XA 4GJ2A 4HVHA 4YC8A 1UVRA 4FR4A 3NCGA 3PSBA 3IOKA 2XKCA 3JYAA 3CTJA 2WQBA 2XM9A 4X7QA 3COHA 5AUYA 3RPYA 3SHEA 4XRJA 5IDPA 1DI9A 4IAIA 4EJ7A 5HO6A 4QD6A 5CU2A 4AAAA 4HYHA 5CWZA 3UIUA 4YC3A 5E8WA 2BTSA 3Q9YA 3NYOA 5JN2A 2W1CA 4BGGA 4RZVA 2J0JA 2W5HA 3LXKA 3KMUA 4F08A 1LP4A 4I0TA 4P2KA 3A60A 4D4VA 2I0YA 4EC8A 3COKA 4O91A 3FI4A 2YM7A 3PE2A 2A19B 4FNWA 3S2PA 4AF3A 5TO8A 2E9PA 1Y8YA 3LW0A 4L53A 4A4LA 3F82A 4BZNA 5EM6A 4LRKA 2HELA 3AD6A 2LGCA 3DAJA 3Q04A 4I24A 3DV3A 1AGWA 2VO7A 3CTQA 3JVSA 4NL0A 3D7ZA 4DEDA 2PL0A 4P4CA 2I6LA 4OTWA 4NUSA 5LVLA 3HA6A 2ACXA 3QF9A 4V0GB 4PWNA 3DJ6A 4IVBA 3KULB 4ZTLA 5E4HA 3VS5A 3GB2A 4PPCA 4RIOA 4GMYA 4AZTA 3BWFA 4ZOGA 2H8HA 4Y72A 4CLJA 2Y8OA 5KKRC 4H05A 2Z7LA 3Q4UA 2QOKA 5AM6A 4F0IA 3BEGA 2KULA 4OUCA 4GU6A 3PG1A 4I21A 4QTAA 4F9BA 4EQMA 3QC4A 4FC0A 4JX3A 1OUYA 4D2VA 4MBIA 2OBJA 2ETMA 2QKWB 4ZSAA 2OICA 2YCQA 2XRWA 4F6WA 4GRBA 5K4IA 2ZV7A 5HEZA 5F9EA 1NA7A 2FH9A 3E8NA 4ANSA 4X2JA 2CN8A 4IQ6A 4EEVA 4MNEB 3QX4A 4ENXA 2C6LA 5LVOA 2WIPA 2NRUA 3C5IA 4GV1A 2QLUA 1RDQE 2XF0A 5ITAA 4CG8A 2OFUA 3RP9A 2QNJA 3I1AA 4TZRA 3JR1A 3DKOA 2ZOQA 2OGVA 3TKIA 3O8PA 4FODA 4E6CA 2BFXA 4EOSA 4K1BA 4D4SA 1WBNA 1IASA 2UZUE 4WIHA 5L2IA 1OIYA 3HV4A 3KXNA 3OF0A 5DVRA 3U6HA 4RVKA 3TDWA 4CKIA 5KMKA 4BR3A 2PVJA 2GNFA 4CFVA 2BR1A 2P2HA 3A7HA 3GU8A 4I22A 4IAZA 3D7TA 1PMNA 4O2PA 1GOLA 2R0IA 4LUEA 5H8GA 3UIXA 3FY2A 3WF5A 3NS9A 4DTKA 1YW2A 4F99A 3TIZA 5IA0A 1M7QA 1J7LA 4TRLA 3PY3A 4JNWA 4FZAB 2B54A 2Q0NA 3KRRA 4FT5A 4QQCA 4UBAA 3R00A 3SW7A 2VWZA 4ZJIA 5A9UA 5AR2A 3QTSA 3Q4TA 3QYWA 4L46A 4DGNA 4F7JA 3FEGA 3LQ3A 5KMJA 2GPHA 3AMYA 2QOBA 3HP2A 2QOQA 1BYGA 1O6YA 4G31A 4QTEA 2ETRA 4QPAA 4JBVA 5ANOA 2VWYA 3S0OA 3ZDIA 2QG5A 3FMJA 1U59A 4U7ZA 5CXHA 5C8KA 3Q5ZA 3OROA 3E8EA 3BGZA 4FV9A 5HD7A 5CAQA 2OXXA 5HIEA 3ORLA 3UZPA 5G1XA 5JFVA 2VD5A 4KIOA 3D83A 2NP8A 3NW7A 5DRBA 3VS4A 4YO6A 2OZOA 3E63A 1FMOE 3TUBA 4LGHA 3FQSA 4TT7A 1OBDA 4PX6A 1Q5KA 2R2PA 1FBNA 4UY9A 4ZTQA 4OW8A 4O86A 1R78A 2HXQA 3QD4A 5A4LA 4OTPA 5KMLA 3GCQA 3HV5A 3FPQA 3KREA 1PXKA 3F5UA 3IECA 3ZLYA 4C57A 3SAYA 2GSFA 2ZMCA 4UEUA 3I6WA 4RJ4A 5AV3A 3UYTA 2BMCA 4BDBA 3EH9A 4YJUA 4AA4A 4HYIA 4O83A 4WNMA 4U79A 3PXRA 4ZMFA 4ZSGA 5IG1A 4MD9E 2CDZA 3HEGA 3AGMA 3E64A 4KBCA 4A07A 3EQDA 4RQVA 3TXOA 2O0UA 3ZO4A 4OTDA 5E8YA 2R3HA 3ZZWA 1YKRA 4TW9A 3RAKA 1JSTA 3RPVA 4A06A 2IW6A 2PVKA 2I0HA 3DK7A 4PV0A 1Q8WA 1YVJA 4IJPA 3Q2JA 2YN8A 4FE2A 4KWPA 4RIYA 1PYXA 3V6RA 4IFCA 1IR3A 2C5XA 1OPJA 3EN9A 4F1TA 2OSCA 4BDFA 2X7OA 2WQMA 4KRDA 3UNZA 2PVLA 4GT5A 2CGXA 4F70A 3E87A 3I81A 4TYGA 4ERWA 2YIXA 2WTIA 3NZ0A 4CKRA 2WTDA 3GCUA 2V7AA 4TPTA 5LMKC 4L3PA 1E1XA 3QLGA 1IRKA 3C0HA 5A4QA 3BGPA 1MQBA 2JIIA 3R7UA 4RT7A 5KNJA 2QG7A 3UGCA 1SVHA 2XBJA 4R6VA 2CNVA 2VTJA 4AGUA 4XEYA 2YCSA 4XNEA 3OG7A 4RBLA 4EL9A 2RL5A 3F61A 3PSCA 1J3HA 4FKLA 1UA2A 4RWJA 2X8DA 4BCIA 3WIGA 4C7TA 4H58A 5C4LA 3O96A 3GCSA 4L44A 5KCVA 1TQPA 3NX8A 5IQBA 2DUVA 3HA8A 4IDVA 5CXZA 4FKIA 3AC1A 3V5LA 1MQ4A 3LFQA 4FKTA 4QTBA 2CCHA 4QP7A 2GDOA 3PPZA 1JAMA 5DWRA 3IGOA 5DBXA 1YXTA 4MXCA 1GIJA 1G5SA 2YACA 5AP4A 5TOZA 3TNIA 3H9OA 3QKKA 4FNZA 1ZYJA 3VBVA 2UW0A 2ITWA 2O3PA 4JAIA 4P7EA 4YBKA 2IO6A 4FUXA 3D7TB 4J97A 3VQHA 3KRXA 1PMEA 3BV2A 1L8TA 2X2MA 1XWSA 4XCUA 4X3FB 4FKUA 3DT1A 4DG0E 2BRHA 4L6QA 1OL1A 2PZYA 3CEKA 2WMBA 3ZS5A 3EQIA 2XJ0A 3E7OA 2R3GA 3ERKA 3U8WA 4E5WA 5JRQA 3FLWA 5FTOA 4DHFA 3OWPA 4O7SA 1U5RA 1PYEA 2GNIA 5IMEA 3NDMA 4DH3A 5KHWA 2WMTA 5B0XA 4U8ZA 4EH8A 3P0MA 5E1SA 3B2WA 3UG1A 5CYIA 1WBSA 1WBTA 3DDQA 4RIXA 4W4YA 3PVWA 3V3VA 4I5CA 1YI3A 2HWOA 3GQIA 3Q53A 3UC3A 3P4KA 4AZFA 4GK4A 4JDIA 2C0OA 3HGKA 4LFIA 4MNFA 3F9NA 2V5QA 4BWKA 3S4QA 1PW2A 4ACMA 5CEKA 2BALA 4F64A 2QQ7A 3GFWA 1YQJA 3FZTA 4PQNA 3VUHA 2CLXA 3FZRA 4G16A 3R28A 3UNJA 3BIZA 1ZY5A 5AX9A 4Q9ZA 2OJIA 1URWA 4YURA 5JK3A 2XVDA 2FUMA 4ZS0A 2J4ZA 3SXRA 5AR5A 2WU6A 3F3ZA 4ITHA 4CGAA 4DBXA 1EH4A 1PF8A 1K2PA 2C1AA 5FD2A 4ZZOA 2UZDA 4GUEA 5IEVA 3D94A 1UWHA 5T3QA 3WZUA 3DBQA 4C62A 2YERA 5HE2A 4IB5A 5JFWA 3HDMA 4TWNA 5E7RA 3EQPA 4C38A 2Q83A 3OTUA 2GHLA 4HNIA 4XV2A 4QP6A 5AR3A 4RIYB 4HPTE 4FNXA 4KABA 4F09A 1YHVA 3U4WA 1XO2B 4MBJA 5H9BA 4C4GA 1QL6A 2F9GA 3FC2A 4GFOA 4EQUA 4A4OA 3R1SA 4EUTA 2QOOA 3FL5A 3MJ2A 4RRVA 4IDTA 3FKOA 3SD0A 3TKUA 4E3CA 2UUEA 3POZA 4YZCA 3SC1A 3MY5A 5F95A 3PE1A 5LWNA 4PTCA 3UYSA 3ZO1A 4FTJA 1FOTA 4OTHA 2LAVA 3QCSA 4Y85A 1H1RA 4W8EA 1GZ8A 2CJMA 4O7TA 5HKMA 3FYKX 3KC3A 3QTXA 3SA0A 4I6FA 1M2QA 1P5EA 3VNTA 5JH6A 3DPKA 5DYJA 3KCFA 3PJCA 3VWAA 1U54B 1YXSA 5IKWA 3A7FA 4QMXA 1GAGA 3BLHA 3MSSA 4QTCA 2PMNX 2BVAA 3IDCA 4H39A 3FJQE 4FT9A 4MQ2A 3UOKA 5BVFA 3OY3A 4HCUA 4MAOA 5HO8A 3LMHA 5CU0A 2QKRA 2O2UA 2PZIA 3HMOA 4TY1A 3HNGA 4TKSA 4XOYA 4OR5A 4E4LA 3C50A 4KBAA 3UO4A 4MTAA 3U9CA 2A1AB 3CGOA 3PPKA 4BCKA 3EN6A 3GBZA 5FRIA 3GC0A 5FWKK 3ZLWA 4BBMA 2CKEA 3CTHA 3I60A 5HLWA 5ETIA 2J90A 4II5A 4FKGA 5GNKA 3QD2B 5CVHA 2PTKA 2A4LA 3IQ7A 2FA2A 1M7NA 3OUNB 4YJVA 3C4FA 4B6LA 2QOIA 3RNYA 3K5UA 5CU6A 4IFGA 2PVNA 3ZBXA 4M0YA 4BGHA 2W1ZA 3F7WA 4JDKA 3HYHA 3MPMA 3OC1A 4FIGA 2XYNA 3Q6WA 3RCDA 4GK2A 3FI8A 1W0XC 3QHWA 2G15A 5AP0A 4MQ1A 4MWIA 4U6RA 5CF6A 4XOZA 5L2TA 2VX0A 3ZH8A 4L42A 1SVEA 2VTSA 4Q5HA 4BICA 1OUKA 4ANLA 4ZY4A 2YZLA 2C68A 2JLDA 1RW8A 1YWVA 4FNYA 5CQUA 4ASZA 2P33A 3U87A 4FTLA 2OJJA 3QUDA 4L01A 2ZJWA 3EMGA 4MWHA 5K5NA 3D5XA 3SOCA 5FXQA 5A6NA 4NT4A 4A9YA 4G34A 2X2LA 3LJ0A 4RIXB 3VO3A 1O6KA 5FBNC 3N4TA 2QO2A 4M15A 5CAUA 4FF8A 2VTOA 1STCE 5L8LA 4RX5A 3VW8A 4BCQA 2J7TA 2PHKA 4JBQA 1J7UA 4EOMA 1QPDA 2C5OA 2PUUA 5LARA 4QYGA 2BROA 4ZSLA 1BLXA 4UN0C 2F7XE 4A9SA 3OCTA 3FLZA 4QMQA 5A4TA 3LCTA 3T3UA 3KRLA 2WMSA 4BBEA 4YLJA 4DFNA 3OS3A 4ZTRA 5D11A 5HOAA 4EK8A 4C4JA 2XKDA 2XCKA 1KOBA 3CGFA 5AAFA 2BIKB 1T46A 2VO3A 3FYJX 3FZPA 4S31A 4TYIA 5IA2A 2GQRA 5HE1A 3MTLA 2IVVA 4BY9E 2J5EA 3IPHA 4F0GA 2WAJA 5ETFA 4F7SA 3SX9A 1PXLA 5ANIA 3E3PA 2PZPA 4AFJA 4CFWA 5FM2A 4B99A 2X7FA 4C3PA 2ERKA 5KX8A 2PWLA 3R1YA 4YTCA 2WTKB 3QALE 3SG9A 5C01A 4IH8A 5EI2A 1OM1A 1S9JA 5EM8A 5L4QA 4FSMA 4R7BA 3DQWA 2PUNA 4NIFA 1ZOHA 5FDXA 3ZC6A 3UPZA 4W8DA 4JRVA 5HU3A 1RQQA 4RFYA 4GW8A 3DKGA 1UU7A 4C02A 3A8XA 5H3QA 1JVPP 4RFMA 4DGOA 4BDKA 2B52A 2YWPA 4QO9A 4ZJJA 1SM2A 3UVPA 4UWYA 5IUGA 3LFDA 4NFMA 5EDPA 5D7VA 4YO4A 3DBFA 4B0GA 5L6OA 4K6ZA 4WSYA 4R3PA 2ZDTA 4YU2A 3OD6X 2HOGA 4YTHA 4KS7A 5JMSA 3HP5A 3VS6A 2Y7JA 1OIQA 2W06A 2YIYA 4ASEA 1PRYA 1FGIA 4FG8A 5J1WA 2VTRA 2Z8CA 3P7BA 4NM0A 5I3OA 3ZUVA 4UB7A 5DRDA 3BGQA 3HUBA 4JDHA 4LM5A 3VBQA 4YMJA 2VAGA 3DXPA 5AJQA 4C36A 2PPQA 3DFAA 5J8IA 3V5WA 2BZIB 4OTQA 4RC2A 4UWCA 4BTKA 1XH8A 3R7YA 3ROYA 4R7IA 3AT4A 3NNXA 4JG6A 4EH9A 3OBJA 3MGYA 3R9OA 4O1PA 4RX9A 2HY0A 2IZRA 4DAWA 4PL5A 3R8VA 5EFQA 1T45A 3TNHA 2J0MB 3TN8A 4EOOA 2QI8A 3OEZA 4Y5QA 2XYUA 1BI8A 3Q4ZA 3M1SA 2XBAA 2OIDA 3MVHA 3PVBA 4PDSA 4MKCA 1FPUA 1XH7A 2C47A 4IW0A 4F9CA 3HMNA 3LE6A 4FOBA 3L9NA 3BKBA 2BKZA 1Y6AA 3D5UA 3HL7A 5DG5A 1REJA 3CD3A 5CU4A 5L2SA 4FSTA 4GU9A 4MXXA 2W9ZB 1SVGA 3BWJA 3GGFA 3NUNA 4ZY6A 3SOAA 4AA5A 4UMRA 4BCGA 5IQIA 2ITNA 3A61A 3A7IA 2UW7A 4Z3VA 3MH1A 2PUPA 2JGZA 1Q61A 4XG4A 2FO0A 2XNEA 3E93A 3F2RA 3IO7A 2IG7A 4IXPA 4YJNA 3T3VA 4IZ7A 3UIBA 1AQ1A 4FG7A 1YI6A 4F6SA 4FZFB 4JQEA 5FXSA 2ONLA 3UG2A 3UQCA 4FG9A 4CT1A 2PMIA 5CSPA 1H1SA 4QMMA 1H08A 1TKIA 3BX5A 1ZMUA 2PMLX 2W4OA 1NXKA 4IWPA 5HIBA 2O5KA 2OWBA 4KUJA 4U5JA 4CSVA 5FGKA 4D9TA 4B8LA 3NYXA 3NCZA 4TN6A 4B4LA 4X2GA 5KO1A 1F5QA 3AMBA 3TL8A 4FKPA 4YJSA 1OIRA 4L7FA 3LFEA 3E8DA 4RX7A 4R77A 4HYSA 4BVUA 4BCNA 3QA8A 4AP7A 2IVTA 4IWQA 5HGIA 3ALOA 4TYEA 2VTAA 4DBNA 1JKKA 3CQEA 2O63A 3MVLA 2P55A 3ACKA 4ITIA 3TIYA 5GIOE 1GJOA 5D12A 4MF0A 1FGKA 2R64A 3GU4A 4KNBA 1NW1A 5AV2A 1YOMA 5IQFA 2IZUA 3ZFYA 5ANKA 1M17A 3F88A 3MN3A 2AC3A 2PUIA 4YHTA 4QMPA 4G6OA 3SRVA 4FT7A 1PKGA 3COMA 2C6TA 3MH0A 4FZDB 4RIWB 2G1TA 4F9YA 3QQUA 2ITXA 3QAME 4WUAA 3VULA 3CIKA 1YDSE 3BU6A 4NCTA 4L00A 4AOJA 4RJ7A 4CMOA 1H00A 2C5NA 4NSTA 4X3FC 4K33A 4O2ZA 4FTQA 3LIJA 2JC6A 2JIUA 4IE9A 2ZYBA 3Q32A 5FDPA 2BAJA 5FEQA 2HYYA 5CSVA 2C1BA 4LL0A 4AG8A 4NIFB 3V6SA 4IVAA 3N4UA 3EKNA 3HMMA 2F57A 3HV6A 4NEUA 4XX9A 4DFYA 4AACA 3LCDA 5BMMA 4FBXA 1CDKA 1B38A 3ETAA 4XV1A 3GU6A 4FICA 5K3YA 1BX6A 3NLBA 5HCXA 3WE4A 2ITYA 4EI4A 2VU3A 4HZRA 3BLRA 3TJDA 1M2RA 4CZYB 4AE6A 4QPSA 4YZ9A 4BRXA 3KFAA 3I5NA 5LVMA 3R9DA 4FK3A 5J9YA 3R8ZA 4BYJA 3FUPA 3AGLA 1B39A 2ITZA 3IW4A 4WRGA 5A46A 1ZYCA 3QRKA 4ENYA 3EFJA 4BKYA 4YPSA 2VNYA 5AUWA 3TI1A 4FEQA 1SNUA 4FV4A 3FPMA 3TG1A 4ALUA 4FKOA 1Q8YA 3TZ7A 4KIQA 3G0EA 3KXGA 3TZ9A 3RM6A 2W99B 2ZDUA 3WARA 3P86A 4DH7A 1CKPA 3JY0A 4RLKA 4XG7A 5AV1A 3DU8A 4M0ZA 3I6UA 5DR2A 2QLQA 3QTRA 5F94A 5FEEA 4C2VA 4DFBA 5AA8A 1V0PA 2VWVA 3P08A 3TJCA 4E1ZA 5I9WA 5HICA 4GKIA 2F2UA 3QRUA 2YIRA 4KSQA 4D58A 5EKOA 4FV0A 4L8MA 3ZRKA 4AZEA 3C4WA 5ANDA 2WKMA 3R7EA 4NM5A 2J51A 4XBUA 5H8BA 3PRFA 5EYCA 5IQAA 5DI1A 2YHVA 1DAYA 4DT9A 1E1VA 3LHJA 3R9RA 4PF4A 5CNOA 4L52A 3P5KA 3V51A 4ZLOA 4HVDA 3EKKA 2PVFA 3LCSA 2BAQA 4FV1A 4FVQA 4BIEA 1JBPE 1VZOA 4C8BA 4DEIA 4J98A 5EI8A 2F7ZE 2BZKB 3IDBA 3HRFA 3N4VA 2O65A 3U4UA 2NO3A 4DA5A 3NW6A 3VJOA 3RHKA 4F0FA 4X2FA 5CSXA 3CCNA 4Y8DA 5E9EA 5AIKA 1XH4A 4H36A 3R63A 4O0VA 5HBEA 4FYNA 3OFMA 4EK6A 5ANJA 4C58A 2XMYA 5AUUA 2XK7A 5M55A 2C3IB 2V0DA 2WEIA 2YCRA 4NJ3A 3R1NA 3C51A 2WXVA 2W1IA 2XJ2A 1I09A 4GUBA 4QYFA 5IQCA 4FZ6A 1A9UA 3QQJA 4D0XA 4YJQA 2CLQA 4CD0A 4ACCA 3NYNA 2BZJA 4IZ5A 2R3IA 4LUDA 2A27A 4GS6A 5IA1A 4UZHA 3SGCA 5CNNA 3UZTA 3DZQA 4EOLA 4EQCA 2JKOA 3VS3A 5ETAA 3DTCA 1ZZ2A 2WMWA 4M12A 5EW3A 3DXNA 4JT3A 3QZGA 3RM7A 3SRVB 2GQGA 4MXOA 3WF7A 2ZV2A 3NUSA 3NUXA 5FTGA 4C2WA 1Z57A 2VV9A 1OL7A 5J1VA 1H24A 2R7IA 3N9XA 4RZWA 4RGJA 4W4XA 5KMMA 3S1HA 2JDRA 4C35A 1KE7A 2G2IA 3DBDA 5L8JA 3R9NA 3TACA 1TVOA 4IX3A 4R8QA 3NAXA 4YJOA 4C4EA 4DFUA 5T6KA 2GU8A 4MBLA 5E8SA 3BU3A 3F3VA 4AW5A 1VYWA 4FV5A 3MH2A 4O0UA 4XV3A 4M7IA 4D0WA 2C4GA 3R7IA 4A4XA 3T8OA 5M4FA 2RGPA 4Y73A 1ZARA 5BVKA 4F6UA 5IEYA 3PWYA 4QMLA 1IG1A 3OHTA 5TR6A 1URCA 5LWMA 3ZTXA 2OU7A 2IWIA 4TWCA 3U6JA 3PVGA 4IM0A 4EYJA 3KGAA 3E8CA 2ZB0A 1JWHA 3O7LD 3Q2MA 3T9TA 3P79A 4WBOA 4ANOA 5AUXA 3AT3A 3BELA 4H1JA 4D5HA 3DBCA 3ET7A 3LPBA 4L43A 3WOWA 3PDTA 4TYJA 4ZY5A 1OKVA 4LGDA 1RJBA 5E90A 4DFZE 5EQYA 4AU8A 1GIHA 3E88A 3K2LA 3DKCA 4PL3A 4BI1A 3DLZA 4O0TA 4RVMA 2B1PA 5CF5A 2GFCA 3MY0A 2OK1A 3PA4A 1E9HA 3BU5A 1TQIA 4X2KA 4D28A 3MB6A 3ZEPA 1WBPA 5FLFA 5J5TA 1WBVA 1R3CA 2IVUA 3R04A 1K9AA 2HZ0A 1LEZA 4FL3A 4RVLA 5TF9A 2ERZE 2I40A 3F5PA 4XS2A 2WO6A 3OOGA 2OH0E 4LQMA 3AXWA 4IC8A 3TZMA 3CKWA 4MX9A 3RGFA 2YLFA 4NJDA 2JAVA 3FMMA 1O6LA 4NM7A 2OFVA 3KRJA 2E9NA 1ZLTA 2OJ9A 2W7XA 5IF1A 1YDTE 4YHJA 4CV9A 4GK3A 4QP8A 4U81A 4I4EA 5AP2A 2O64A 4UYNA 3CP9A 3GXLA 5AMNA 5LMAA 5CSHA 3OP5A 3RMFA 3QZFA 4ACGA 5EQEA 3W55A 4CV8A 4ZLYA 2ITTA 4RG0A 2QHNA 1H27A 3ZSHA 4I6BA 3FAAA 3OTVA 1Y6BA 2P3GX 4EH6A 4DEEA 2C5VA 3COIA 3POOA 5K5XA 3EQBA 5EDQA 3TUCA 4OTGA 4ONAA 5GHVA 5TKDA 2JDTA 3WZKA 2RFSA 2WTKC 2X0GA 4EC9A 4PPAA 3PA3A 3JS2A 4IX4A 4XG6A 4GFMA 4FIFA 3BV3A 2GMXA 4TL0A 2VN9A 5EHOA 1CKIA 3G2FA 2JBPA 2W1GA 1AD5A 4O84A 2WEVA 1Q24A 3DFCB 3SLSA 4BYIA 3C0IA 3ULZA 1FINA 3ZM4A 3OCSA 3QQHA 4BDJA 5IUHA 5EYMA 3VF9A 4RWIA 3KB7A 4CT2A 2BDJA 3JY9A 4CG9A 3L8SA 3VJNA 3GU7A 2PK9A 3MA3A 5AP3A 5EHYA 3PP0A 4N4SA 3UMXA 4B8MA 4AS0A 3PVUA 1KE9A 3H9FA 3H10A 5HZNA 3IGGA 4B7TA 5K9IA 3UTOA 4MXAA 4IAYA 4WOVA 5HESA 3QD3A 2UW8A 2E9VA 2UZNA 3EYGA 3FMDA 4I5MA 4PMTA 4PTGA 5FG8A 5KZIA 3V5PA 3WE8A 4CFXA 4CRSA 4JOAA 4AOTA 4C4HA 4USFA 3QCYA 5CVFA 4DG2E 4PNIA 3FE3A 5IPJA 1JOWB 1R0PA 1ZOEA 3NRMA 5AAGA 2B9IA 4O0XA 3ZM9A 2VX3A 5M57A 5JFXA 4DFXE 4O81A 2OXDA 5ANEA 3MPAA 5DA3A 4NK9A 5JT2A 4D1XA 4QMVA 3EN5A 3UO5A 3U55A 2RIOA 4FTNA 4BIDA 3WILA 3UQGA 2IJMA 3QRIA 3P7CA 1YXUA 3LFAA 4R1YA 3V5QA 3F7ZA 5IQHA 1JLUE 2ZM3A 3ZO3A 3ID6C 5GZAA 1H1WA 2XEYA 1OITA 4GG7A 3OZ6A 2YAAA 2PE1A 2WMXA 2JD5A 2WQNA 3ZZEA 4BBFA 3BHHA 4FV7A 5CZIA 4FUYA 3R8UA 4FA2A 1OB3A 5BUEA 3RKBA 4QP4A 3QRTA 4UMUA 4JS8A 1ZYLA 4I6QA 4NW6A 4KS8A 2Z7QA 4EWHA 3UVRA 3LQ5A 4MYGA 1BKXA 3KMWA 2C6IA 1LPUA 4HCTA 3VAPA 4M8TA 3RVGA 4PDPA 4FL1A 5HVKA 1OPKA 3FBVA 4ZSJA 5FUTA 4EZ5A 4QQ5A 2HIWA 2WGJA 3NYVA 2OG8A 2YM5A 3UPXA 3EL7A 3KK9A 4HGLA 4JIKA 3R7OA 3PYYA 3CR0A 1LEWA 4FTTA 4I5PA 2GS7A 3DA6A 3EFWA 3UMWA 5IQGA 4JQ8A 3FMLA 3GUBA 2NPQA 1ZYDA 5J79A 3FL4A 2R3OA 3MESA 4AT5A 5BQ0A 3L8PA 1V0OA 2H6DA 4FTRA 4CRLA 4O7YA 4KAOA 5HE3A 5IMXA 4FTIA 4X21A 2ZM4A 4TWPA 4JRNA 3QWJA 4G1WA 5D9HA 5E8TA 3TV7A 3ATSA 4LOQA 5B2MA 4YTFA 3G6GA 2UW4A 4FVRA 5M44A 3G15A 4FTKA 4I92A 2BDWA 4OTRA 2QR7A 4D2PA 2UVYA 4O6EA 4Z7GA 2R4BA 3GCPA 4BF2A 4L9IA 3MYGA 4O7VA 4CTCA 4JLCA 4RC4A 3HLLA 3OWKA 3CPCA 4H3PA 3H0YA 3ZXTA 2I7QA 4ASDA 5HORA 4W9WA 3ATTA 3F3TA 1UV5A 3A62A 4F7LA 5CAPA 3PZEA 3OT8A 3FLQA 5JRSA 3KQ7A 4YC6A 3ZMMA 5AR7A 4U0IA 5TT7A 1H0VA 3BYOA 1ZY4A 4X6QC 4J8NA 3C0GA 4O0SA 3FSFA 5ETCA 2EWAA 3KA0A 3Q6UA 5M56A 2B4SB 2WNTA 3AC3A 1UKIA 1DM2A 3Q52A 4BN1A 3L9PA 1YXXA 4BWPA 3W2SA 1NY3A 3F69A 3MPTA 4U80A 3W8LA 3VS0A 3H0ZA 1PKDA 4I93A 3H3CA 4NKSA 4L67A 2G01A 1TQMA 3NVKI 2QO7A 2NNWB 4BI2A 3QCQA 3LMGA 3CQUA 3BRBA 2X4ZA 2Y0AA 3ENMA 4DGLC 4RMZA 4OAUC 3GC9A 4OLIA 2R3RA 5J7BA 4ALVA 5IA4A 3UP2A 2X81A 2W1HA 1OECA 3OWJA 3DNEA 5M53A 4K9YA 1JKTA 3L9MA 4CCBA 1HCKA 4U9AA 4GG5A 4QYHA 4YTIA 1KV1A 2ITVA 2PU8A 1V1KA 4CMUA 3ORZA 3LFSA 3QLFA 4ANBA 5IUIA 4JQ7A 3QL8A 3VQUA 4IAFA 5LMKA 4O22A 3OT3A 5A54A 1J1BA 2DQ7X 2BFYA 4FMQA 4ERKA 3FQEA 1REKA 2Z2WA 5LJJA 2UW9A 4O96A 3QTIA 4N0SA 2YEXA 3DBEA 1MUOA 3E3BX 4RQKA 3SW4A 3RAIA 3DK6A 5J9ZA 3BPRA 1F0QA 2QVSE 3MV5A 4GFGA 4GIHA 4QQTA 5HD4A 2C6KA 4O7NA 3CC6A 3LLTA 4AZSA 4C59A 4DCEA 2XIXA 3D14A 3O8TA 4FK6A 4X2NA 3OY1A 3CPBA 3QXOA 4RFZA 4X0MA 3D15A 2B9FA 1H4LA 3TZ8A 2YM8A 1CSNA 3WF9A 3VHEA 5HG9A 3P78A 1ND4A 5EW9A 2BRGA 1Q3WA 1Y57A 2XNPA 4IJ9A 4JI9A 4O27B 3W32A 3RTPA 2WB8A 5D1JA 4B9DA 4HPUE 4WD5A 2ESMA 2X7GA 5GINE 2Z7RA 4UWBA 3QTUA 2XEZA 3OW4A 3QYZA 4BGQA 3O17A 4OTFA 5IEXA 3D5WA 4CZUA 3W2PA 5AFVA 4OGRA 4YHFA 3FMNA 4LG4A 4E7WA 5LVNA 3N51A 4JXFA 3L8VA 2W96B 3ZYAA 1GY3A 4D1SA 4W4WA 5HTIA 1K3AA 1XJDA 1J91A 3FMEA 3VS1A 3SDJA 5G6VA 4U42A 2GS6A 4FTUA 4QP3A 5M06A 4ARKA 3HX4A 2WOTA 3CBLA 3OWLA 5CTPA 3C4EA 4OAVB 2OZAA 3TT0A 4FVPA 3Q3BA 4L3JA 3RAHA 2B9HA 4CYIA 3TDVA 2YJRA 1U5QA 1W98A 4F7NA 4YZNA 1JKLA 1M52A 3I5ZA 4NH1A 4FV8A 4AA0A 5EOBA 1PMVA 3BBWA 4P5QA 1IAHA 4CFUA 4QMNA 3A4PA 3U51A 4KD1A 3O7LB 1IA8A 3EJ1A 4KBKA 4PUZA 3REPA 3VS7A 5BVWA 1XHAA 4IWOA 3QWKA 1H25A 1QMZA 5AP7A 4IVDA 2R0UA 3ZUUA 4CZTA 3RWQA 4P5ZA 3KXHA 4FOCA 5LXMA 4FX3A 1O9UA 3A7JA 4R1VA 5BYYA 4EBWA 2B55A 2OW3A 5HQ0A 3FI2A 4Y5HA 3PXZA 2BCJA 2G2FA 5TE0A 3UBDA 4FIEA 4DG3E 4EKKA 3I4BA 3CLYA 4ZTSA 2PSQA 4NCTC 3ZC5A 4AE9A 4IACA 2E2BA 4XH6A 2CGUA 3LQ8A 3VRYA 3FKLA 2OJGA 4NU1A 1Q8ZA 4ACHA 4HGSA 3TNPC 4UZDA 3MFSA 3PFQA 4Z16A 4M68A 4XUFA 1ZMVA 5CI7A 1U4DA 3R21A 1GZKA 4FV6A 5FP5A 5AM7A 4DT8A 4FZ7A 4IMYA 4IBMA 2X8IA 5HU9A 4FIHA 1XQZA 2XNBA 2EXEA 3R71A 4PL4A 5C8NA 3PTGA 2VTQA 3SG8A 4GH2A 4FSQA 3HUCA 4YUQA 2Y4IB 4D5KA 4CFMA 3DK3A 4ORKA 1P4OA 3PY1A 2CCIA 5L3AA 3ITZA 2YISA 2J2IB 2QONA 2RF9A 4JBPA 2YJSA 3WYXA 3F5XA 3FI3A 3ZCLA 5LOHA 5HX8A 3LCKA 3FLSA 4GIIA 4EHGA 4I3ZA 3VBYA 2HW7A 4N70A 2CNQA 4FEWA 3B8RA 4CCUA 2NRYA 5HCYA 4HCVA 4K0YA 3WI6A 1OGUA 2AC5A 3ULIA 2VTNA 4MH7A 3RJCA 2P4IA 2IZSA 1B6CB 3EN4A 4P90A 3QUEA 4Q9SA 4UXQA 4APPA 4I94A 4GT4A 1Z9XA 2R3FA 2VUWA 3ANQA 3TCPA 4RSSA 4EHZA 4BCFA 2J6MA 3EL8A 3SKCA 5CSWA 3H9RA 2PVRA 3F3WA 4TWOA 2BRNA 2I1MA 4IHPA 4EH7A 3ODYX 5M4IA 3GI3A 3R9HA 1OI9A 4HW7A 3BHVA 3G0FA 3PG3A 5CEQA 4DN5A 4J7BA 5L6PA 4Z7HA 4DLIA 3FZ1A 4QMTA 5BVDA 5FTQA 1OL6A 3JXWA 3VF8A 4AN2A 5C8MA 2B0QA 4AZVA 2X4FA 3EQRA 3LKMA 4YP8A 2VTTA 2UVXA 3A7GA 4NKAA 4O6LA 4QP1A 5GZ8A 2BHEA 4XG9A 4NWMA 2IVSA 4JDJA 3IW7A 4HGTA 4QMZA 2JEDA 5I9UA 3TNQB 1G3NA 4X6RA 2AUHA 2JFMA 3FLYA 1WVYA 2V62A 3T9IA 3NMUF 1WBWA 4BFMA 4QOXA 5DE2A 4C37A 3U54A 4KIPA 2CSNA 5JQ8A 5AV4A 3PXFA 1I44A 5HVJA 5JZNA 2F7EE 3QX2A 4UMTA 3QHRA 4DCAA 4LMNA 4E4NA 4F9AA 4KKGA 2R3KA 1Q8TA 2V55A 2BIYA 4BDDA 4DC2A 5CT7A 3CSVA 4J52A 2G9XA 3MIYA 4PY1A 3UOHA 2OZAB 4D4YA 2YM6A 3PJ2A 4U45A 5A4EA 5IH4A 2Z02A 4NYEA 2GTMA 4YJPA 2SRCA 3RNIA 1P4FA 4LRMA 3RK9A 3DLSA 5E91A 3A4OX 3AC4A 2WD1A 5DHJA 1H28A 5ACBC 3KN5A 4O21A 1KWPA 1M14A 2GNJA 3HRBA 3KY2A 4EK5A 5DN3A 2XP2A 5BUIA 4D4RA 3NGAA 1UU3A 4PNKA 5CVGA 2PY3A 3PSDA 4NM3A 5DT0A 4F65A 3OOMA 3PZHA 4O38A 4DH1A 3R01A 5EM5A 3ZHPC 1ZYSA 3Q4CA 4JAJA 3GC7A 3ORIA 4EOKA 3O23A 4YJTA 4EORA 4ZJVA 2RFNA 2XIKA 4PP9A 4RVTA 5HNGA 3M2WA 2HZNA 4QNYA 2YCFA 2HY81 4WG3A 2EXCX 4C4FA 4DITA 3RK5A 3NNVA 3BCEA 3C9WA 3RWPA 2YIWA 4C4IA 5HTBA 2JDVA 4QNAA 2YA9A 5IH6A 3LJ1A 4L7SA 4MNEA 5DGZA 3G90X 4IIRA 4WHZA 3HRCA 4LL5A 4O0RA 2PVYA 4KRCA 4G9CA 4BHNA 5IZFA 4EUUA 2YWVA 3LJ2A 3TWJA 3WZJA 2QOFA 2WMQA 4OBQA 4OTIA 3BE9A 3HZTA 4GCJA 4ZAUA 5KHXA 2VRXA 4IM3A 2XB7A 3DOGA 5C27A 1OZ1A 3R7GA 4R3CA 5B2KA 3FSKA 4BDAA 4E26A 2F49A 1WCCA 4EOIA 5C1QB 5BYLA 2R7BA 2C6OA 3K3JA 5EG3A 2FGIA 3PXQA 1BL6A 4BIBA 1YHSA 4G6LA 1FVRA 1H26A 2VTMA 4GEOA 4JR7A 5AAEA 3ZRMA 2R9SA 1OBGA 1Q62A 2UZVA 4PDYA 4ZK5A 3ENHA 3ORTA 5CZHA 4FYOA 3IDPA 3IKAA 3GU5A 4CVAA 4H3QA 2ZV8A 1M2PA 4UYAA 2W17A 4QMWA 2UW5A 5EI6A 3WYYA 2UZOA 4HVSA 3LXPA 1DAWA 5DEWA 2X1NA 3CJGA 3OW3A 2X8EA 1PMUA 4L3LA 2P0CA 3PY0A 2WOUA 1XH6A 3O50A 1VR2A 3R1QA 3HKOA 2GTNA 5HI2A 5L2WA 5ICPA 5KBQA 4ZLZA 2I0EA 5JQ5A 4RA5A 2C6MA 5FM3A 2IW8A 4XJ0A 4ASXA 4HNFA 5AX3A 2JKKA 5M51A 3TUDA 3BHTA 1XBCA 3EWHA 1XR1A 3MS9A 2XA4A 2BUJA 3F3UA 4AWIA 4JX7A 3CJFA 3WBLA 2G2HA 4W4VA 5FEDA 3NNWA 3ELJA 2YDIA 3KXZA 4QP2A 4LOPA 3E92A 2QD9A 3PXKA 3WIKA 2GCDA 5IH5A 3OXTA 1UU9A 4M3QA 1QPEA 1IEPA 2XKFA 3FZOA 3NIZA 5C4KA 3R6XA 4I23A 4H3BA 4FKWA 3OXIA 3LM0A 3DKFA 4IAAA 2HWPA 4PMMA 4XRLA 4J1RA 5BVEA 3RPRA 2Q0BA 4XLVA 4GSBA 4YZMA 4HJOA 4Z9LA 4J53A 3FC1X 5F4NA 3THBA 5CASA 5KMOA 2R3QA 3LZBA 5D10A 4QTDA 1WFCA 3D9VA 3DGKA 2VGPA 3PJ3A 1CKJA 3PP1A 3FY0A 4XMOA 4BKZA 2WMRA 2QOHA 3ORPA 4BDIA 1YDRE 4MK0A 4H1MA 4A9TA 1NVRA 5H2UA 3P23A 3EQCA 1CTPE 2XUUA 2QODA 5AWMA 4WA9A 4CQEA 2GS2A 2JIVA 4IANA 4K77A 4CKJA 3LMIA 2IW9A 2WTCA 3Q9ZA 4YR8A 5LVPA 2JKQA 4DEAA 5IA3A 2OKRA 3OUKA 2YITA 2X39A 1PHKA 5BMSA 2XKEA 3EYHA 5DR9A 4BHZA 4WNPA 1OMWA 2R3PA 2YDJA 4YZDA 4DEHA 5HLNA 1UKHA 4FI1A 3B8QA 3VBXA 3ALNA 4CLIA 3Q96A 1FQ1B 5HX6A 3TV6A 2OI4X 3AC2A 1H1PA 3QTWA 4IX6A 5I0BA 5IISA 4GKHA 4TXCA 5AR8A 2RFDA 4MF1A 4AGWA 3ZO2A 4C34A 5DFPA 4QMSA 3PLAE 1IA9A 2CGVA 3FV8A 5HHWA 3QCXA 3QGWA 5D7AA 5EM7A 3HAMA 2EVAA 5DPVA 5I9XA 5AUZA 1MRUA 5AEPA 5GIPE 4F63A 2FB8A 4CEGA 2VO0A 1PY5A 3BYUA 3PJ8A 4ZMEA 2VZ6A 4E5AX 3ZEWA 2EB2A 1Y91A 3G9NA
chains in the Genus database with same CATH superfamily
5GZ9A 3KXXA 4UMQA 2J0KA 1W7HA 4I6HA 4CFFA 1HOWA 2PVMA 3VN9A 4F1MA 3UDSA 3UZRA 3GQLA 4KA3A 3HMPA 1UU8A 3EFLA 5DLSA 4LOOA 5I9VA 5HCZA 1BL7A 5EYKA 3KEXA 4HGEA 3D2IA 4JVGA 5CAVA 4C61A 4O7LA 3DB8A 1MRYA 5C9CA 3V01A 1NVQA 2NYAA 2RG5A 2BZHB 4G3EA 1Q4LA 5EH0A 1ATPE 1PXNA 2QURA 2H9VA 2W5BA 2HCKA 2XNOA 3LAUA 3GOKA 2AYPA 2UW3A 4X3FA 4XG2A 3E5AA 3WF6A 4O82A 2OIQA 2VTHA 1YWRA 2FSMX 2VWUA 5L8KA 4O7WA 3W0MA 1CM8A 2WMVA 4BCPA 2C0IA 2XJ1A 3OCBA 2W1DA 3E7VA 3AD4A 3NSZA 1Q41A 3R22A 4M97A 4WT6A 5AR4A 5HIDA 5M08A 3O0GA 2C30A 2E9UA 2JDOA 5HNIX 4FV3A 5M09A 4U3ZA 5B7VA 3VUIA 4BWXA 1R0EA 4DH8A 3QBNA 4IADA 3O71A 4PTEA 5DH3A 4GL9A 2HK5A 2WPAA 3QRJA 1P14A 4AOIA 2WTJA 4G3GA 2QU6A 3NUUA 3HV7A 1WVXA 2VO6A 5HO7A 3ORMA 2QU5A 4ZP5A 1GNGA 5GJFA 3UC4A 2C6EA 4GVJA 3TNWA 3C7QA 1PXJA 3SXFA 2DS1A 4EOPA 3CE3A 1GIIA 1OKZA 3VC4A 3ANRA 4KIKA 2QR8A 3Q60A 4FTMA 4U41A 4S33A 2VTPA 4W9XA 3W8QA 4S32A 2BDFA 3R8LA 4CNHA 3GCVA 2WTVA 1OL2A 1S9IA 3MW1A 2X6DA 3Q9XA 2VWXA 3R8PA 4QYYA 3RALA 4OT5A 4BCJA 5JSMA 5K0XA 2WU7A 2B53A 5HG5A 2VX1A 4O7RA 2JFLA 2BHHA 4MEDA 4AN3A 5M4CA 4IZYA 3D2KA 3ACJA 3OMVA 1BMKA 3FWQA 3GP0A 3KRWA 5D41A 4MCVA 4CYJA 4O7ZA 2H34A 1SZMA 3MVJA 4U40A 4M69A 4DTBA 4DGMA 5HG7A 3PA5A 2CNUA 2FVDA 3I7CA 4XG3A 3MFRA 1DS5A 2F4JA 2VWIA 2EB3A 5FQDC 4E6DA 2VWBA 2Y4IC 4FSUA 4FKJA 4G3DA 1VYZA 1YOJA 3AMAA 3BYMA 3NW5A 4I20A 3PJ1A 4U97A 2Y9QA 3ZBFA 4DF3A 3OBGA 4YNEA 4XV9A 2Z60A 3FHIA 3GNIB 3KVWA 3KXMA 3PRIA 4MXZA 2OF4A 3ORNA 4RJ3A 5DOSA 3AOXA 4I0RA 1QPCA 3QZHA 3SQQA 4IB1A 3MI9A 3ZXZA 1YXVA 5CAOA 3RAWA 1MP8A 2R3NA 4ZTMA 3GT8A 3CD8A 3ODZX 3EQGA 1CMKE 2REIA 2GHMA 4AFEA 3ZRLA 3R7VA 1H01A 1KV2A 4KKHA 4BCHA 3QKMA 4AXCA 1WMKA 4F1OA 4XLIA 4UXLA 4HVGA 4YLKA 3UE4A 4JG7A 3QQGA 4FTOA 5I9YA 5DEYA 2WTWA 5EYDA 3R02A 2I0VA 1JKSA 5CY3A 3ZSIA 1U54A 3LCOA 4ANNA 3PXYA 3R2YA 3FXZA 3FZSA 5K0KA 2PE0A 3V04A 2XM8A 1QCFA 3C4CA 5T68A 4DFLA 4EK4A 4FEUA 4IVCA 2YM4A 4PPBA 1ZOGA 4E6QA 3V8TA 4XG8A 2R3LA 3RPOA 2FYSA 1J7IA 4YJRA 1IAJA 3DZOA 3S00A 2XIRA 3D5VA 3TEIA 3VIDA 2ZM1A 5L6WL 5EQPA 3KVXA 5I3RA 5HLPA 4YZBA 4O0YA 2CN5A 3NR9A 4E4XA 3EHAA 2XNGA 4DLJA 5JGDA 3B2TA 1ZAOA 1FMKA 1G8KA 3ZFXA 1ZZLA 3AQVA 3DY7A 2WFYA 4ZZMA 4TTHB 3PIYA 4QQJA 4F9WA 4D55A 4TYHA 3EZVA 3RK7A 2WHBA 1SYKA 1UNGA 3KF7A 4RJ8A 3DJ5A 1VEBA 3NIEA 4C3RA 4BCOA 3DQXA 3LOKA 1KE6A 4ZXTA 3QTQA 1R39A 1JQHA 2CMWA 2OJFE 4FKRA 3W2CA 4IZAA 4ZIMA 3MFTA 1FVTA 2GNHA 4FKQA 4MD7E 5HVYA 3EIDA 4DTAA 2CGWA 2JBOA 3QUPA 4QMYA 4G3CA 4G5JA 2JAMA 5I4NA 4A7CA 4DHJA 5LQFA 5I9ZA 4LDTA 4YNOA 3C4ZA 5KMIA 4FL2A 2J0LA 2E9OA 3EN7A 4OT6A 4LRJA 4EOQA 3TTIA 2OO8X 5KUPA 4N6ZA 2OF2A 4EH5A 2HZ4A 4WO5A 3TTJA 5JFSA 2YIQA 4Q2AA 5BX0A 2W4KA 4G5PA 2WMAA 4D1ZA 2CPKE 4DEBA 2XCHA 2ITPA 3C1XA 4M66A 4J71A 5HBJA 5LCJA 4AXFA 2RG6A 4JG8A 5EDRA 3EQFA 3ORXA 2YDKA 3PUPA 3QTZA 3CS9A 3JPVA 5F1ZA 3G5DA 1FVVA 3BBTB 4C33A 3QGYA 4XP0A 4EHEA 1XH9A 4FTAA 4NW5A 2DYLA 5HBHA 4KIKB 2WQEA 3FKNA 3KMMA 4FEVA 5IQDA 3M11A 3S95A 4D2RA 1PXPA 4G9RA 2VWWA 3BE2A 5DT3A 4BDCA 3FHRA 3VVHA 4RPVA 2GNLA 1JPAA 2HENA 3EZRA 5FXRA 4A9UA 2UZBA 1ZWSA 1KSWA 2VTLA 2R5TA 4J96A 2UZTA 4E73A 5AUTA 4E5BA 4AW1A 4EBVA 5F20A 4WBBB 3ROCA 5EW8A 4BTFA 4FSNA 2FSLX 2Y4PA 4QYEA 5CU3A 4WUNA 4M69B 3MVMA 4FSWA 5I5ZA 1ST0A 3KL8A 2ZV9A 3Q9WA 4LGGA 4RWLA 2QC6A 3GOPA 5CANA 4NZWB 1Q3DA 2DWBA 1GZNA 4U43A 1W84A 4AQCA 4EZ3A 3W2OA 3L8XA 3QKLA 4FSRA 2PZ5A 3VUDA 3A99A 4AW0A 4D2SA 3GEQA 4IX5A 2EXMA 3NUYA 4ITJA 4YBJA 3VUMA 4BDEA 3MDYA 3FDNA 2W5AA 4HZSA 1NVSA 3P9JA 3VW6A 2QO9A 2YABA 1UWJA 3LFFA 4BC6A 4A9RA 2C5YA 4JIAA 4O4FA 4XP3A 5EK7A 3SV0A 1XKKA 1UNLA 4EWQA 1DI8A 3D4QA 4Y46A 1SNXA 4HOKA 5CEPA 4USEA 2YAKA 1WVWA 3I0OA 1W2CA 1ZRZA 4FT3A 4CMTA 3GC8A 5CQWA 4NTTA 4UV0A 2ZVAA 3UO6A 5KKRB 4BL1A 4EH4A 3BHYA 3EFKA 2F2CB 1W82A 2IZTA 3IG7A 3VS2A 2XIZA 3LFBA 4YGAA 4TNBA 3UNKA 4RA4A 3UDBA 5GJGA 2CHLA 3CQWA 3R2BA 2XAMA 1OL5A 3ZSGA 4BDGA 2YFXA 4CTBA 4E6AA 3HAVA 1V0BA 3GENA 4CFNA 2PE2A 4I41A 3W2RA 3ZU7A 1XH5A 3AKLA 2J0IA 2QCSA 3W16A 3WZEA 4K2RA 5E1EA 3QZIA 4WSQA 3VUGA 2XK3A 3VRZA 1YOLA 2J9MA 4ALWA 1LUFA 3MFUA 4S34A 5JGBA 3BYVA 3QQFA 1SMHA 2FSTX 4D2WA 4XBRA 3D0EA 3HV3A 4U3YA 1KUTA 2B9JA 2WIHA 4FIJA 4JR3A 3MTFA 3RZFA 5BPYA 5JZJA 5LMBA 3ZLSA 4XP2A 3FXWA 3R73A 2RKUA 3K5VA 1KE5A 2XK8A 4TYHB 3SXSA 3V5JA 5J5SA 5J9LA 2OXYA 2GHGA 2UW6A 3UIMA 4D2TA 3ZFMA 5BUJA 4YSJA 2V22A 1OIUA 4FIIA 4AX8A 4BCMA 5B2LA 4I4FA 3SVVA 2ONLC 4FGBA 1U46A 3CXWA 4GYIA 3R83A 4ACDA 3K3IA 5EOLA 2XH5A 1H1QA 4MVFA 1KE8A 1OPLA 4G17A 2JDSA 4MHAA 2W9FB 4M84A 3UVQA 3PIXA 3DAKA 3NNUA 1OKWA 2UZEA 4QPMA 2W1FA 2GFSA 4O1OA 4AUAA 4BKJA 5E92A 4FJVA 4I5HA 1G8AA 3UODA 3DXQA 1OVEA 1H0WA 2Z7SA 3WF8A 4D9UA 5IDNA 5DR6A 5JKGA 1W8CA 4M14A 4PRJA 4QMOA 3II5A 2JKMA 5CALA 2VNWA 4FKSA 3F6XA 3LVPA 3NUPA 4FSYA 4Q5EA 3IOPA 5KMNA 1Q8UA 1R1WA 4HVIA 3LM5A 3PWDA 4RWKA 4DEGA 5CS6A 2IPXA 3I79A 3VONA 5E8ZA 3BL7A 4V01A 3CY3A 3KCKA 3OCGA 2Y6MA 4USDA 1JNKA 4J8MA 2P2IA 3LXNA 5J7HA 1A48A 5H8EA 1Q97A 3NPCA 4DHIB 4FT0A 3FMKA 5BYZA 3F5GA 3NEWA 2C3LA 3PPJA 4YPDA 4G3FA 3UQFA 3BLQA 3ORKA 3LXLA 3W1FA 2GNGA 4FSZA 4LYNA 3DB6A 2A2AA 2ETKA 4AXAA 4R78A 4RJ6A 3DAEA 4JJRA 3NAYA 2W05A 2XIYA 3VUTA 3RI1A 1HCLA 4BTMA 4WNOA 4QT1A 4I0SA 3E62A 5DIAA 4LV5A 3G51A 3W18A 4EKLA 5BNJA 3W2QA 3VUKA 2HXLA 2EU9A 4ID7A 4JL9A 3TV4A 4RIWA 4EH2A 4PP7A 4BI0A 1MRVA 2PULA 5BVNA 3BHUA 2W1EA 4AGDA 2J50A 3F2NA 2UV2A 4XYFA 1A06A 3UOLA 4G2FA 1QPJA 5IA5A 3NWWA 3IS5A 3L9LA 4TNDA 2VTIA 4V05A 4DINA 2ITOA 4IAKA 5J87A 3PIZA 4K18A 3U9NA 3W33A 2CKOA 1APME 3G9LX 4KSPA 5KZ0A 5M07A 2ITUA 2W0JA 3LFCA 4ZSEA 3JVRA 1UNHA 4K8AA 4K11A 2WMUA 3FMHA 3AG9A 4UMPA 3H4JA 3K54A 5AUVA 4ZEGA 1WZYA 2HAKA 3IK3A 1YHWA 2C3JA 3KF4A 3KU2A 3Q5IA 4FV2A 4LV8A 4E4MA 2WZJA 4X3JA 5C03A 4IEBA 4N6YA 3A2CA 2ITQA 3G33A 4WRSA 4AT4A 4C0TA 2PYWA 3IW5A 4NFNA 3AC8A 5E8VA 4IWDA 5HTCA 2C69A 4UALA 3U6IA 3BZ3A 5BVOA 4U44A 5JGAA 3DTWA 2X9FA 3R30A 3C4XA 2ZMDA 3MWUA 3QA0A 3O2MA 5CI6A 3S3IA 2BRBA 3BI6A 3OXZA 5HG8A 3BQCA 3ZONA 1OGYA 1WAKA 5FP6A 5A6OA 3AT2A 4O0WA 2XK9A 4V04A 4AGCA 3QD0A 2YM3A 3IW8A 2BAKA 2BRMA 4J95A 3G6HA 3GFEA 3EB0A 2QOLA 2YLEA 3OEFX 4KB8A 5E8UA 3RPSA 5AIRA 5M4UA 1G8SA 4C3FA 1YRPA 5CEOA 1XBAA 3KN6A 2H96A 4LI5A 3PLSA 4Y83A 4HYUA 4R5SA 5FBOA 4EONA 3NVMB 5A4CA 5DT4A 1J1CA 3F2AA 2W4JA 3IW6A 4G6NA 4EHVA 3IONA 4WG5A 4NTSA 3RHXA 3QXPA 3R0TA 4GYGA 2A0CX 2R3JA 2HW6A 2X6EA 4GT3A 2XNMA 2XZSA 4J99A 2YZAA 4PDOA 5AP1A 4DYMA 5CEMA 3EQHA 5ANGA 3ZUTA 1H07A 3C13A 5CX9A 3UP7A 4BDHA 2PMOX 4E20A 5AA9A 4RLLA 4CXAA 3HECA 4GJ3A 3O51A 1RE8A 4OBPA 5CEIA 4Z55A 5DMZA 3A8WA 4YSMA 4OBOA 1X8BA 3ZOSA 3LFNA 3QFVA 3ZLXA 4EH3A 4DH5A 4IB0A 3VBWA 3KKVA 4F4PA 1LR4A 2UZWE 5ACKA 1ZXEA 4JBOA 4BTJA 3BEAA 1WBOA 4EYMA 3BYSA 3JUHA 2R3MA 3DJ7A 2QHMA 3AD5A 3MBLA 3QQLA 4V0GA 3V8SA 4PMPA 3OVVA 4IC7A 5JEBA 4L45A 3KULA 5CENA 1ERKA 3RINA 4RJ5A 4E8AA 3LLAA 2ZAZA 5A3XA 4EOJA 1BUHA 1XBBA 2BILB 3HVCA 4L68A 2JITA 4DGGA 4CQGA 4E93A 5LCKA 3EOCA 4PMSA 5CT0A 3DCVA 5AP6A 3RBWA 4BB4A 2BKKA 4AW2A 2OIBA 2X2KA 1Q99A 4WG4A 5AP5A 2HZIA 3MY1A 4FKVA 2PVHA 1JSUA 3BQRA 4QP9A 4R3RA 4ZTNA 3RZBA 3UJGA 3VBTA 3MA6A 4R7HA 3F66A 4M67A 3MH3A 4RC3A 3FLNC 2RSVA 2BPMA 5DNRA 2OLCA 3CY2A 3AC5A 4KKEA 2XS0A 3CKXA 1H8FA 3W10A 5CF8A 5IU2A 3UOJA 1F3MC 3HDNA 5A14A 5C26A 2EUFB 4ZTHA 4S30A 4FGRA 2C3KA 4S2ZA 3DDPA 3O8UA 5KE0A 3M42A 2PZRA 4BZOA 5HE0A 3H30A 5AV0A 1TFFA 4IM2A 2GQSA 4EJNA 3VHKA 4ANQA 5K4JA 5IQEA 2ZB1A 3RCJA 2C6DA 3GVUA 3MB7A 2XK4A 1VLRA 3BLAA 1YI4A 2OH4A 2WQOA 2X9EA 1OKYA 2CKQA 3ZDUA 3QU0A 5HNBA 1Y8GA 2UVZA 1L3RE 1JSVA 4AZWA 4APCA 3QC9A 4BZDA 1YWNA 2J5FA 2FSOX 2QOCA 3KK8A 2XNNA 3P7AA 4MD8E 1NT2A 4KINA 1GZOA 1P2AA 2BTRA 4FTCA 4I1ZA 4AN9A 4UX9A 1ZMWA 3HMIA 2VGOA 5AADA 4DE4A 2XRUA 1KOAA 3I7BA 4IB3A 4WNKA 4GVAA 1PXMA 2WELA 4Y95A 5CF4A 3NUAA 3V5TA 4QMUA 4EZ7A 2C0TA 2KTYA 3TM0A 2B7AA 4N57A 4ZZNA 5CLPA 5EKNA 4EK3A 3MJ1A 5EHLA 3FXXA 4FEXA 5KBRA 2IN6A 4QRCA 4XHKB 4WKQA 3R8MA 2UZLA 3WZDA 4MXYA 4ZS4A 1VJYA 3DNDA 3L1SA 3MIAA 3TKHA 3V8WA 5L2QA 1W83A 3DS6A 4LMUA 3I0QA 1PXIA 2XK6A 2Y6OA 3FQHA 1BI7A 3QQKA 1PJKA 5GJDA 1Z5MA 5J95A 4AT3A 4ANMA 2V7OA 3P1AA 1PXOA 2O8YA 4M13A 2CKPA 4RX8A 2RFEA 3C5UA 4YLLA 4R5YA 5E8XA 4GJ2A 4HVHA 4YC8A 1UVRA 4FR4A 3NCGA 3PSBA 3IOKA 2XKCA 3JYAA 3CTJA 2WQBA 2XM9A 4X7QA 3COHA 5AUYA 3RPYA 3SHEA 4XRJA 5IDPA 1DI9A 4IAIA 4EJ7A 4F78A 5HO6A 4QD6A 5CU2A 4AAAA 5BV3A 4HYHA 5CWZA 3UIUA 4YC3A 5E8WA 2BTSA 3Q9YA 3NYOA 5JN2A 2W1CA 4BGGA 4RZVA 2J0JA 2W5HA 3LXKA 3KMUA 4F08A 1LP4A 4I0TA 4P2KA 3A60A 4D4VA 2I0YA 4EC8A 3COKA 4O91A 3FI4A 2YM7A 3PE2A 2A19B 4FNWA 3S2PA 4AF3A 5TO8A 2E9PA 1Y8YA 3LW0A 4L53A 4A4LA 3F82A 4BZNA 5EM6A 4LRKA 2HELA 3AD6A 2LGCA 3DAJA 3Q04A 4I24A 3DV3A 1AGWA 2VO7A 3CTQA 3JVSA 4NL0A 3D7ZA 4DEDA 2PL0A 4P4CA 2I6LA 4OTWA 4NUSA 5LVLA 3HA6A 2ACXA 3QF9A 4V0GB 4PWNA 1W2DA 2ZFYA 3DJ6A 4IVBA 3KULB 4ZTLA 5E4HA 3VS5A 3GB2A 4PPCA 4RIOA 4GMYA 4AZTA 3BWFA 4ZOGA 2H8HA 4Y72A 4CLJA 2Y8OA 5KKRC 4H05A 2Z7LA 3Q4UA 2QOKA 5AM6A 4F0IA 3BEGA 2KULA 4OUCA 4GU6A 3PG1A 4I21A 4QTAA 4F9BA 4EQMA 3QC4A 4FC0A 4JX3A 1OUYA 4D2VA 4MBIA 2OBJA 2ETMA 2QKWB 4ZSAA 2OICA 2YCQA 2XRWA 4F6WA 4GRBA 5K4IA 2ZV7A 5HEZA 5F9EA 1NA7A 2FH9A 3E8NA 4ANSA 4X2JA 2CN8A 4IQ6A 4EEVA 4MNEB 3QX4A 4ENXA 2C6LA 5LVOA 2WIPA 2NRUA 3C5IA 4GV1A 2QLUA 1RDQE 2XF0A 5ITAA 4CG8A 2OFUA 3RP9A 2QNJA 3I1AA 4TZRA 4O4BB 3JR1A 3DKOA 2ZOQA 2OGVA 3TKIA 3O8PA 4FODA 4E6CA 2BFXA 4EOSA 4K1BA 4D4SA 1WBNA 1IASA 2UZUE 4WIHA 5L2IA 1OIYA 3HV4A 3KXNA 3OF0A 5DVRA 3U6HA 4RVKA 3TDWA 4CKIA 5KMKA 4BR3A 2PVJA 2GNFA 4CFVA 2BR1A 2P2HA 3A7HA 3GU8A 4I22A 4IAZA 3D7TA 1PMNA 4O2PA 1GOLA 2R0IA 4LUEA 5H8GA 3UIXA 3FY2A 3WF5A 3NS9A 4DTKA 1YW2A 4F99A 3TIZA 5IA0A 1M7QA 1J7LA 4TRLA 3PY3A 4JNWA 4FZAB 2B54A 2Q0NA 3KRRA 4FT5A 4QQCA 4UBAA 3R00A 3SW7A 2VWZA 4ZJIA 5A9UA 5AR2A 3QTSA 3Q4TA 3QYWA 4L46A 4DGNA 4F7JA 3FEGA 3LQ3A 5KMJA 2GPHA 3AMYA 2QOBA 4FRFA 3HP2A 2QOQA 1BYGA 1O6YA 4G31A 4QTEA 2ETRA 4QPAA 4JBVA 5ANOA 2VWYA 3S0OA 3ZDIA 2QG5A 3FMJA 1U59A 4U7ZA 5CXHA 5C8KA 3Q5ZA 3OROA 3E8EA 3BGZA 4FV9A 5HD7A 5CAQA 2OXXA 5HIEA 3ORLA 3UZPA 5G1XA 5JFVA 2VD5A 4KIOA 3D83A 2NP8A 3NW7A 5DRBA 3VS4A 4YO6A 2OZOA 3E63A 1FMOE 3TUBA 4LGHA 3FQSA 4TT7A 1OBDA 4PX6A 1Q5KA 2R2PA 1FBNA 4UY9A 4ZTQA 4OW8A 4O86A 1R78A 2HXQA 3QD4A 5A4LA 4OTPA 5KMLA 3GCQA 3HV5A 3FPQA 3KREA 1PXKA 3F5UA 3IECA 3ZLYA 4C57A 3SAYA 2GSFA 2ZMCA 4UEUA 3I6WA 4RJ4A 5AV3A 3UYTA 2BMCA 4BDBA 3EH9A 4YJUA 4AA4A 4HYIA 4O83A 4WNMA 4U79A 3PXRA 4ZMFA 4ZSGA 5IG1A 4MD9E 2CDZA 3HEGA 3AGMA 3E64A 4KBCA 4A07A 3EQDA 4RQVA 3TXOA 2O0UA 3ZO4A 4OTDA 5E8YA 2R3HA 3ZZWA 1YKRA 4TW9A 3RAKA 1JSTA 3RPVA 4A06A 2IW6A 2PVKA 2I0HA 3DK7A 4PV0A 1Q8WA 1YVJA 4IJPA 3Q2JA 2YN8A 4FE2A 4KWPA 4RIYA 1PYXA 3V6RA 4IFCA 1IR3A 2AEGA 2C5XA 3TYKA 1OPJA 3EN9A 4F1TA 2OSCA 4BDFA 2X7OA 2WQMA 4KRDA 3UNZA 4AXEA 2PVLA 4GT5A 2CGXA 4F70A 3E87A 3I81A 4TYGA 4ERWA 2YIXA 2WTIA 3NZ0A 4CKRA 2WTDA 3GCUA 2V7AA 4TPTA 5LMKC 4L3PA 1E1XA 3QLGA 1IRKA 3C0HA 5A4QA 3BGPA 1MQBA 2JIIA 3R7UA 4RT7A 5KNJA 2QG7A 3UGCA 1SVHA 2XBJA 4R6VA 2CNVA 2VTJA 4AGUA 4XEYA 2YCSA 4XNEA 3OG7A 4RBLA 4EL9A 2RL5A 3F61A 3PSCA 1J3HA 4FKLA 1UA2A 4RWJA 2X8DA 4BCIA 3WIGA 4C7TA 4H58A 5C4LA 3O96A 3GCSA 4L44A 5KCVA 1TQPA 3NX8A 5IQBA 2DUVA 3HA8A 4IDVA 5CXZA 4FKIA 3AC1A 3V5LA 1MQ4A 3LFQA 3W0NA 4FKTA 4QTBA 2XALA 2CCHA 4QP7A 2GDOA 3PPZA 1JAMA 5DWRA 3IGOA 5DBXA 1YXTA 4MXCA 1GIJA 1G5SA 2YACA 5AP4A 5TOZA 3TNIA 3H9OA 3QKKA 4FNZA 1ZYJA 3VBVA 2UW0A 2ITWA 2O3PA 4JAIA 4P7EA 4YBKA 2IO6A 4FUXA 3D7TB 4J97A 3VQHA 3KRXA 1PMEA 3BV2A 1L8TA 2X2MA 1XWSA 4XCUA 4X3FB 4FKUA 3DT1A 4DG0E 2BRHA 4L6QA 1OL1A 2PZYA 3CEKA 2WMBA 3ZS5A 3EQIA 2XJ0A 3E7OA 2R3GA 3ERKA 3U8WA 4E5WA 5JRQA 3FLWA 5FTOA 4DHFA 3OWPA 4O7SA 1U5RA 1PYEA 2GNIA 5IMEA 3NDMA 4DH3A 5KHWA 2WMTA 4DDIA 5B0XA 4U8ZA 4EH8A 3P0MA 5E1SA 3B2WA 3UG1A 5CYIA 1WBSA 1WBTA 3DDQA 4RIXA 4W4YA 3PVWA 4BJJA 3V3VA 4I5CA 1YI3A 2HWOA 3GQIA 3Q53A 3UC3A 3P4KA 4AZFA 4GK4A 4JDIA 2C0OA 3HGKA 4LFIA 4MNFA 3F9NA 2V5QA 4BWKA 3S4QA 1PW2A 4ACMA 5CEKA 2BALA 4F64A 2QQ7A 3GFWA 1YQJA 3FZTA 4PQNA 3VUHA 2CLXA 3FZRA 4G16A 3R28A 3UNJA 3BIZA 1ZY5A 5AX9A 4Q9ZA 2OJIA 1URWA 4YURA 5JK3A 2XVDA 2FUMA 4ZS0A 2J4ZA 3SXRA 5AR5A 2WU6A 3F3ZA 4ITHA 4CGAA 4DBXA 1EH4A 1PF8A 1K2PA 2C1AA 5FD2A 4ZZOA 2UZDA 4GUEA 5IEVA 3D94A 1UWHA 5T3QA 3WZUA 3DBQA 4C62A 2YERA 5HE2A 4IB5A 5JFWA 3HDMA 4TWNA 5E7RA 3EQPA 4C38A 2Q83A 3OTUA 2GHLA 4HNIA 4XV2A 4QP6A 5AR3A 4RIYB 4HPTE 4FNXA 4KABA 4F09A 1YHVA 3U4WA 1XO2B 4MBJA 5H9BA 4C4GA 1QL6A 2F9GA 3FC2A 4GFOA 4EQUA 4A4OA 3R1SA 4EUTA 2QOOA 3FL5A 3MJ2A 4RRVA 4IDTA 3FKOA 3SD0A 3TKUA 4E3CA 2UUEA 3POZA 4QEBA 4YZCA 3SC1A 3MY5A 5F95A 3PE1A 5LWNA 4PTCA 3UYSA 3ZO1A 4FTJA 1FOTA 4OTHA 2LAVA 3QCSA 4Y85A 1H1RA 4W8EA 1GZ8A 2CJMA 4O7TA 5HKMA 3FYKX 3KC3A 3QTXA 3SA0A 4I6FA 1M2QA 1P5EA 3VNTA 5JH6A 3DPKA 5DYJA 3KCFA 3PJCA 3VWAA 1U54B 1YXSA 5IKWA 3A7FA 1G8JA 4QMXA 1GAGA 3BLHA 3MSSA 4QTCA 2PMNX 2BVAA 3IDCA 4H39A 3FJQE 4FT9A 4MQ2A 3UOKA 5BVFA 3OY3A 4HCUA 4MAOA 5HO8A 3LMHA 5CU0A 2QKRA 2O2UA 2PZIA 3HMOA 4TY1A 3HNGA 4TKSA 4XOYA 4OR5A 4E4LA 3C50A 4KBAA 3UO4A 4MTAA 3U9CA 2A1AB 3CGOA 4DDGA 3PPKA 4BCKA 3EN6A 4QDVA 3GBZA 5FRIA 3GC0A 5FWKK 3ZLWA 4BBMA 2CKEA 3TMOA 3CTHA 3I60A 5HLWA 5ETIA 2J90A 4II5A 4FKGA 5GNKA 3QD2B 5CVHA 2PTKA 2A4LA 3IQ7A 2FA2A 1M7NA 3OUNB 4YJVA 3C4FA 4B6LA 2QOIA 3RNYA 3K5UA 5CU6A 4IFGA 2PVNA 3ZBXA 4M0YA 4BGHA 2W1ZA 3F7WA 4JDKA 3HYHA 3MPMA 3OC1A 4FIGA 2XYNA 3Q6WA 3RCDA 4GK2A 3FI8A 1W0XC 3QHWA 2G15A 5AP0A 4MQ1A 4MWIA 4U6RA 5CF6A 4XOZA 5L2TA 2VX0A 3ZH8A 4L42A 1SVEA 2VTSA 4Q5HA 4BICA 1OUKA 4ANLA 4ZY4A 2YZLA 2C68A 2JLDA 1RW8A 1YWVA 4FNYA 5CQUA 4ASZA 2P33A 3U87A 4FTLA 2OJJA 3QUDA 4L01A 2ZJWA 3EMGA 4MWHA 5K5NA 3D5XA 3SOCA 5FXQA 5A6NA 4NT4A 4I6LA 4A9YA 4G34A 2X2LA 3LJ0A 4RIXB 3VO3A 1O6KA 5FBNC 3N4TA 4BJJB 2QO2A 4M15A 5CAUA 4FF8A 2VTOA 1STCE 5L8LA 4RX5A 3VW8A 4BCQA 2J7TA 2PHKA 4JBQA 1J7UA 4EOMA 1QPDA 2C5OA