2F2UA

Crystal structure of the rho-kinase kinase domain
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
391
structure length
386
Chain Sequence
b'QRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFCAFQDDKYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIKQHPFFKNDQWNWDNIRETAAPVVPELSSDIDSSNFDDIEVETFPIPKAFVGNQLPFIGFTYYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-associated protein kinase 2
publication title Molecular mechanism for the regulation of rho-kinase by dimerization and its inhibition by fasudil
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 122
structure length 386
sequence length 391
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2f2uA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2f2uA01
3DAEA 2Z8CA 3OCSA 2PZYA 4FSQA 1G8SA 2OI4X 3D4QA 2R3PA 4FV3A 2O3PA 3HMIA 1O9UA 5I3OA 3H9OA 4G2FA 2C4GA 3UG1A 4N70A 3NYNA 3WARA 2BUJA 3BHTA 5KKRB 3QBNA 3GU8A 2BKZA 2W1HA 4GT5A 4TYIA 2O0UA 2BFXA 2E9OA 3QALE 4FSUA 1ZRZA 2P2IA 5DN3A 4XBUA 5EYKA 4W4YA 4LM5A 2IZUA 4E4LA 1VYZA 5EM8A 2H8HA 2CLQA 3LFCA 4TNBA 2BRMA 3REPA 4I5HA 3R83A 3CGFA 1BL7A 3FPQA 4O0SA 2WQBA 1OIYA 3OCGA 5LVPA 4YLJA 3G15A 3E63A 2BALA 4OLIA 1ZYDA 2UW5A 4GUEA 4JQ8A 4CMOA 3BEAA 1NVQA 3LCKA 2OF4A 3GC7A 3HP5A 4E7WA 5D7VA 2EXCX 1SNUA 2R3LA 1JKLA 4C61A 4V01A 1GIHA 2XIXA 5DT0A 5TE0A 3WZKA 3S0OA 4HOKA 4Q9SA 3PDTA 3PE1A 1NVRA 5F1ZA 1OIUA 2XP2A 5HEZA 4X21A 2OICA 4U40A 4UX9A 1QCFA 1XBBA 3D2IA 3TACA 2C1BA 1J7IA 1WBPA 2XNBA 3TZ8A 2W1CA 3BV2A 3PXFA 2PPQA 5H2UA 3V8SA 3RJCA 2XZSA 4BGHA 4PTEA 2UZTA 2ZV9A 4AOTA 3C4FA 4AZFA 4AN9A 3RPSA 3CY2A 3FI8A 1JVPP 2RSVA 4I41A 3UIBA 3W2OA 5AADA 1WCCA 2HYYA 4J53A 4A9SA 4JS8A 1OITA 2ZOQA 2W4JA 4KSPA 3R7IA 3GGFA 3SHEA 2CKQA 3WYXA 1BKXA 3QYZA 4G3CA 1OL6A 4IFGA 4RRVA 5JFWA 5GINE 4QMZA 4UALA 4FTQA 2Y4IB 4IMYA 5L2IA 3BLQA 1MUOA 1ZY5A 3C0IA 4QYGA 5EYDA 5L8LA 3HAVA 4PF4A 5L3AA 1L3RE 3DS6A 3MW1A 4QTBA 3QD2B 3E93A 3MY5A 5KMJA 2GNIA 4R5SA 4U5JA 4B9DA 3FKLA 1H26A 5C4KA 3BWJA 5G1XA 4ARKA 5AR5A 5AA8A 4L45A 4FTOA 4D9TA 4D5KA 4AW1A 3V6RA 4HCVA 1H27A 3E64A 4QYFA 2WGJA 4M15A 3K3JA 3TEIA 4ANLA 4S32A 2P33A 4ACMA 1Q8UA 3MIYA 2XBAA 3NUXA 4I0SA 3AC8A 5HCYA 1UU3A 3SDJA 4DEDA 3EB0A 4UMRA 4WRSA 3RPYA 4D2TA 4FG7A 5BUIA 1VEBA 3UNKA 1B39A 1CSNA 1O6KA 4AFEA 3DKGA 3UVPA 2XNEA 4QMYA 3U6JA 5FEQA 4JIKA 1XBAA 4J8MA 4MXYA 1FVRA 3A8XA 3QUPA 5DIAA 1V0PA 4OTDA 4D4SA 1APME 4MBLA 4BCNA 3HV6A 2QR8A 3RZFA 4GK4A 2QNJA 2XF0A 2PYWA 3VQUA 3N4VA 1LEWA 4CMUA 4XRLA 3F2NA 5DHJA 2JKQA 3FMMA 3ID6C 3FZOA 1STCE 1PMNA 2GFSA 4GU6A 1XBCA 5IA2A 3H3CA 3L8XA 3TT0A 1XO2B 5J95A 5EH0A 2G01A 3BELA 5B2KA 4CCBA 4X3FC 4DFXE 5E8SA 4FEWA 1KV2A 2IVUA 1Q8ZA 2IVTA 3HUCA 3PJ2A 3QA0A 3CGOA 5C03A 4YC3A 1XH7A 3A62A 5FWKK 2UZWE 4PMSA 5LARA 4RGJA 4QQCA 3GU4A 4GVJA 4EH6A 4FBXA 4DBXA 3QRKA 1OKYA 2XRWA 4O6LA 3MS9A 3U6HA 2QONA 3AD6A 3W2QA 4BTFA 2CN5A 3QLFA 1IAHA 4QMNA 4JRNA 4I5MA 4JQ7A 5DWRA 3R9HA 2RFNA 3R1SA 3POZA 2WHBA 3PRIA 3W2CA 1GJOA 3FQEA 4EONA 2XK7A 2PVLA 2ZMDA 2X2LA 3TKIA 4AZTA 3TDVA 4M67A 4BCOA 1IEPA 2WU7A 4FTRA 3FQHA 4AW2A 3C13A 3QRUA 4OT5A 4QQ5A 3WOWA 2I6LA 3E62A 4PP7A 5I9ZA 1YHWA 3QU0A 5JK3A 5FDXA 4CD0A 2PTKA 5HLPA 5M4CA 2IJMA 2VGPA 4U0IA 4D2VA 2I40A 2IO6A 2VO0A 3FZSA 2OXXA 3PXRA 3Q32A 4GIIA 5M55A 3RZBA 1JKKA 3DK6A 4AW5A 4CG8A 4UXLA 1W84A 2OZAA 3E8EA 5IQIA 2W5BA 3AT3A 3OF0A 4ANSA 3NNVA 4RJ8A 4BCQA 4F7SA 5GZ9A 4DH3A 4EUTA 4LYNA 4Z7HA 3HVCA 4NTSA 2UUEA 2YDIA 2JLDA 4YC6A 3WIGA 3OCTA 1Q97A 4GW8A 2ACXA 3HA6A 3D7TB 4D4VA 1FMKA 4ZTSA 5CF6A 4ZTNA 3E7OA 2X7OA 2IZSA 5CEQA 3QZFA 3WI6A 2ZYBA 3PVGA 3PZEA 4RG0A 4ID7A 3FC1X 3BI6A 2X8EA 3U4UA 4IWPA 3V5JA 3I81A 2GNLA 4L6QA 4CYIA 3JR1A 4PNKA 3JPVA 3PJ1A 1S9IA 1TQIA 4MQ1A 4NKSA 3OT8A 5JQ5A 5L2TA 2BZJA 2H9VA 2OBJA 3HEGA 4YTHA 4JAJA 2JFMA 4QP7A 3QCQA 3QX2A 3UC3A 2QCSA 3L8VA 4B8MA 1EH4A 3EYGA 2FA2A 4F9YA 2Q83A 4QPSA 1YRPA 4QRCA 2C6OA 3LFDA 4LUEA 2WTJA 5AV3A 2YM7A 4BWKA 2ESMA 2REIA 3TL8A 4CZYB 1NY3A 4FL1A 1H1RA 4LV8A 4X6RA 2J6MA 3QTQA 4UYAA 4DCEA 3C5IA 2WIHA 3EZRA 2B53A 4U43A 4L52A 4LRJA 4IX3A 2H96A 2P55A 3IW6A 4V0GA 1UWJA 3B2WA 5JN2A 1VJYA 3D94A 3NUYA 2BZIB 3UVQA 5A54A 5GZAA 3AC5A 4QTAA 4N6ZA 4B8LA 1YI4A 3NNUA 4FIJA 1M2PA 4WNPA 3CXWA 4O2ZA 4JX3A 2X1NA 5LMKC 3QTIA 4OAVB 4XLIA 5IQHA 5CU0A 2RGPA 4YPDA 1O6YA 5HESA 3QYWA 3JVSA 4D1XA 2UVZA 3RCJA 3GOPA 4FZ6A 3SAYA 3BHUA 2VTRA 4CEGA 3JUHA 4WT6A 1HOWA 4BDJA 5CY3A 5DLSA 4EZ3A 3FDNA 3UG2A 1JWHA 4BZOA 2B52A 4GT3A 1YDTE 4IM0A 4IAAA 4XLVA 3VQHA 4FUYA 4XG6A 4GKHA 4MCVA 1YOMA 5H8EA 4UZHA 4S34A 4TYGA 3QGWA 2HY0A 4HYUA 4W9WA 5J7BA 2C3KA 2ZB0A 2ITOA 1MP8A 1YXUA 4RWKA 2JGZA 3ANRA 4UMTA 2HOGA 2CNUA 2UZBA 4L01A 4WNOA 3TZMA 3EJ1A 3PXQA 3NW6A 3PY1A 2YM4A 3ZC6A 2X39A 3JVRA 1ZYLA 4FKPA 3AT2A 3ROCA 4ANQA 3NW5A 3RHKA 5IDNA 4NK9A 3PSDA 3HRBA 4BCIA 4TXCA 4TRLA 5ANJA 2OWBA 3PFQA 4EHZA 4XBRA 5BMSA 3BU6A 2ZVAA 4GG5A 4IVAA 3QHWA 4U80A 4MAOA 3OTVA 2QI8A 3KRJA 2VO7A 2YCFA 4K6ZA 4ZJJA 4D4RA 5IPJA 4MKCA 2EU9A 3OXIA 4DEEA 5EYCA 3NIEA 2J9MA 2R3JA 2XNMA 4RFMA 3IQ7A 3ORPA 3GI3A 4FE2A 5M56A 3FI2A 5EK7A 3VW8A 4Z55A 3QUEA 5CVHA 4H58A 5DYJA 2V62A 4WA9A 3R9NA 4DLIA 3HA8A 4EORA 5IUHA 3O23A 3KULA 1OUKA 2B9HA 3LPBA 1Q8YA 4YZMA 2WQOA 2E9PA 2YAKA 2F7EE 1WBWA 4I6HA 4BWPA 5TR6A 4G3DA 4I0RA 3WF8A 4L46A 3IDBA 3HECA 4HPTE 4XG2A 4UMQA 5AAGA 1J7LA 4D2PA 3NAYA 3NUUA 3O8TA 3MVLA 2IW8A 3ZHPC 1F3MC 4AXAA 3EKKA 1YHSA 3Q9WA 5HE3A 3VS1A 3L9LA 1O6LA 4AUAA 4EOIA 3FL4A 5FBOA 3OFMA 4FF8A 5E8WA 4F64A 1OL7A 4AF3A 4EWQA 4ZY4A 2W1EA 3NYOA 2C6KA 2YWVA 5FXSA 4R8QA 5E8VA 1U5QA 5BVOA 5KZIA 3LE6A 1Z5MA 3N4TA 4OTIA 3LFSA 4MNEA 3KA0A 3Q6UA 3RKBA 3R30A 2ONLC 2OO8X 1AGWA 4JDKA 5J9YA 4XG7A 5DEYA 3FY2A 4YZDA 4NKAA 3QQUA 4NSTA 3VC4A 3PG1A 4RVLA 4X2GA 5AMNA 4UMUA 3P79A 4E93A 3VW6A 2Y7JA 4HGSA 4TWCA 4JDJA 3UC4A 3ZBXA 4FKJA 2CMWA 2DWBA 3KREA 3P5KA 2V0DA 3SRVA 3F2RA 3PXYA 5EW8A 3RBWA 4A07A 3QKLA 4IVDA 2YIQA 3ODYX 3LFFA 4V04A 5A3XA 3WBLA 3OWJA 2JFLA 3BE9A 5FRIA 4DFUA 2WPAA 3O7LB 1A9UA 4U7ZA 3ZYAA 4LRMA 4E6QA 3W2SA 3HMNA 3U6IA 3KEXA 2YISA 4CFWA 3O7LD 2HW6A 2J5EA 2QO2A 3OY1A 4OTHA 3KMUA 1OL1A 2VWZA 4EH3A 4IHPA 3KN6A 2QR7A 3E88A 4CCUA 1KE8A 3DJ6A 4IAIA 3LFNA 2W06A 3F9NA 2ZV2A 3UYTA 3QQGA 4BIDA 3DBQA 3QTWA 3ZZWA 1VZOA 4FK3A 4JVGA 4OUCA 5FEEA 4EKLA 3MH3A 3D9VA 4YJUA 4ZY5A 5A6NA 2YZLA 1ZYCA 1SVGA 5HVJA 4U81A 1GIIA 2X8DA 4ZTRA 1UNLA 3CCNA 5AP1A 3FZRA 3FQSA 4E6DA 2XK3A 2BHEA 3OC1A 4RIXB 2ZDUA 5H3QA 4EQMA 1JAMA 3LCOA 3TWJA 3IONA 4AE9A 2W0JA 2IVVA 1QPEA 4FKQA 3OWPA 4H1MA 5ANOA 3R71A 4JAIA 4YJNA 5FG8A 3AMYA 2BR1A 5JSMA 2YJSA 4ANBA 5CT0A 4Z9LA 4A9UA 3CD3A 4GFOA 4LOQA 4FEVA 3LJ0A 1AD5A 2PMNX 3AC1A 5AX9A 3UOKA 3OXTA 2UZUE 3QXOA 4DGGA 2SRCA 3E8CA 4ACHA 4BZNA 4C4FA 4DN5A 3E5AA 3ETAA 3MYGA 4M7IA 5M44A 2WTVA 4N0SA 4M0YA 5K4JA 1W98A 4JL9A 4DGLC 5T6KA 4O82A 3PJ3A 4BY9E 4MH7A 4CNHA 3UIMA 5FXRA 4HCUA 5D1JA 4R1YA 4YSMA 4I5PA 5EM6A 2GDOA 4FTAA 4LL5A 3T9IA 5DRDA 5FQDC 4ACGA 1SVHA 5KCVA 3PP0A 4BDIA 2UVXA 3FWQA 4O1PA 3VN9A 3BGZA 5FP5A 4FEUA 4F9AA 3ORXA 3ZLSA 5A14A 1KV1A 4KKGA 5HO8A 1H01A 1P4FA 4MF0A 1XH4A 2PZ5A 4PV0A 1JKTA 1J3HA 4O1OA 5EYMA 3VS3A 3L8PA 3KF7A 3COKA 4FTLA 4G9CA 4ZTHA 4C37A 1DI9A 4EI4A 3G33A 3E3PA 1JQHA 2R5TA 4YO6A 5ETAA 2ZM4A 2R3HA 1I44A 4CFNA 5B7VA 2JD5A 2C5XA 5J79A 2EUFB 3Q9XA 1JSTA 2PMLX 4G6NA 2J0IA 1PYEA 2W1ZA 5CTPA 3RMFA 4P5QA 3TN8A 1YHVA 3UO6A 3GQLA 5CAQA 3FMDA 5EW3A 3VBQA 4AACA 2YDJA 5J5SA 3NVKI 4XG8A 3Q9ZA 3BWFA 4E73A 4J7BA 3E8NA 4DITA 3W8LA 4FR4A 3DZQA 2RKUA 3DQXA 3HP2A 3BGPA 4K0YA 3R2YA 3V5PA 3BYSA 4RFYA 2A19B 2PE1A 5KO1A 5HTBA 3DJ5A 4IEBA 4C2WA 2VTMA 2HWOA 3KRXA 4XG9A 5CT7A 1CDKA 4WG5A 4WNKA 3S3IA 2XKEA 3VJOA 4CFMA 2PUPA 3R02A 3HL7A 4FKGA 4GSBA 3HAMA 2R7BA 3ZRKA 3DPKA 4E1ZA 3PE2A 1GNGA 4ITJA 3C0GA 1R1WA 2Y6MA 4BKJA 4Q9ZA 5I9XA 2C5VA 4G6OA 1V1KA 3ENMA 4KSQA 1M7NA 3QL8A 1B38A 4Y5HA 4R5YA 2XNNA 1GAGA 4BHZA 1M2QA 5TOZA 4LMNA 5L6PA 1DI8A 2R3RA 3BX5A 4ENXA 3MBLA 2HY81 2JIIA 4FOBA 2OF2A 4U3YA 2VWUA 5L2QA 4OTWA 4EC8A 3PIZA 5GHVA 4DYMA 3UOHA 5AAEA 2VAGA 3DDPA 2QOHA 3FI3A 4WKQA 3DQWA 2XJ1A 1J7UA 4PDPA 5KE0A 4FUXA 2FGIA 2YA9A 3VS2A 1IA8A 4YJTA 4GU9A 3D2KA 2VTPA 4O6EA 4RQKA 4PTCA 5IEYA 3W8QA 4TZRA 4BCPA 5HZNA 5M53A 3BHVA 2J2IB 3R6XA 2PVFA 3C9WA 2R3FA 4QP1A 2OIBA 1Q61A 2BZKB 2V7AA 4GVAA 3KXMA 2HZ4A 4L42A 3L9PA 4FKIA 4I93A 4RVMA 4KRDA 4EEVA 2VD5A 3NWWA 1LPUA 3KXNA 2VUWA 2O8YA 4PDSA 4NTTA 2HZ0A 4PRJA 3ZSIA 5AUWA 4AGUA 4WO5A 1K9AA 3FL5A 4PX6A 1BMKA 5BYZA 3EFKA 1OI9A 4L7FA 4XUFA 3VF8A 3D5XA 4DH7A 4ALVA 5T3QA 2XKFA 3JY0A 2YM5A 5JZJA 4DH5A 4R7BA 3L1SA 3LCTA 2V22A 5K4IA 4PDYA 2WMBA 4NYEA 5JRSA 3FUPA 4WBOA 4AGCA 2YAAA 3DBEA 3HV5A 1XWSA 1DS5A 1WBTA 2WIPA 1JSUA 3R00A 4HZSA 3O17A 3V5QA 2Z60A 4FNYA 4YJOA 1YI6A 5BX0A 3G0FA 3Q60A 2EB2A 3RAHA 3UO4A 5DT4A 4GH2A 2CSNA 4TYEA 5KMMA 3U87A 3DTCA 4BI0A 1E1VA 2UW8A 2WEIA 5HQ0A 1YQJA 4UMPA 4YU2A 4JJRA 3ZLYA 2I1MA 3VF9A 3FY0A 3G9NA 3EN7A 1FOTA 4LGGA 4P7EA 4BDBA 5F94A 4Y5QA 3P7CA 3S95A 1PXOA 4FV0A 3N51A 3PY3A 5C1QB 1BI7A 3JYAA 3ZO4A 3S2PA 4FTUA 3P1AA 4ZLOA 4C4EA 3MVHA 3VUIA 5HNIX 2BMCA 4JBVA 2RG6A 2R7IA 3PSBA 2B9FA 5HVKA 1F5QA 4NT4A 4C34A 4JG7A 5JFVA 1WAKA 3ZU7A 1H1SA 3MSSA 4CGAA 5ETIA 5D10A 3DV3A 2Y0AA 3TUDA 4YZBA 4APPA 4DGNA 4O84A 4FVQA 4HJOA 3Q9YA 4KAOA 4NM3A 4JBQA 1YXXA 2QURA 4XP0A 3QRIA 4C57A 2X4FA 2RF9A 1Q8TA 3FPMA 3K5UA 4ALUA 4J98A 5A4TA 4K1BA 2WQNA 1XH5A 4ASZA 2E9VA 1FVVA 3MV5A 3GC9A 5KUPA 3CR0A 3BGQA 1RE8A 3QFVA 1F0QA 4G6LA 4IACA 4RX7A 2PVMA 3MY1A 3SQQA 2VO6A 3T3UA 5FD2A 5BVDA 4IZ5A 4IXPA 2YHVA 2YCRA 4HGEA 3LFBA 1OIQA 2BILB 2QG5A 1TQMA 2JKKA 1QL6A 4NCTC 3LFQA 5E92A 2J0MB 2UVYA 3EL7A 2G1TA 1ZXEA 5BMMA 4R77A 5JGBA 4QMPA 2WTDA 3CP9A 4IVCA 4Z16A 3ZM9A 4FL3A 3QQJA 4YHTA 4EQUA 4OAUC 1X8BA 3C4EA 2WXVA 4CFVA 2PE0A 3FMHA 4D1SA 3QUDA 3G0EA 3IW7A 5HOAA 2B55A 3FKNA 4JR7A 4DFLA 5KMNA 3AOXA 2OIDA 4NH1A 1ZZ2A 5AEPA 3BCEA 3KMMA 4H39A 2W5HA 3ZFYA 4C3PA 3T8OA 4U42A 4G1WA 3ZONA 4RIYB 2B7AA 2VX3A 3RWQA 5HE2A 3UGCA 3LQ5A 5M4IA 2GNHA 3WF7A 3A7HA 4F63A 1NVSA 3II5A 4GFMA 4QNYA 1HCLA 1TKIA 4FVRA 2AUHA 2ETKA 4KBAA 3TG1A 2UW0A 4O21A 1Y6BA 1WBOA 1XH8A 4EH4A 4BN1A 3K5VA 1PMEA 5TF9A 3K54A 3LVPA 5L6WL 1ZY4A 4PTGA 3TTIA 5HTCA 4DTBA 1ZMUA 2UZDA 5HGIA 1QPCA 5ITAA 5LMBA 4FZFB 3DT1A 3OTUA 3UJGA 2C68A 1HCKA 4FT7A 4ANOA 1REJA 3QA8A 3NDMA 4LOPA 3O2MA 2AC3A 2VTOA 3QD4A 3COHA 4KS7A 5HCZA 4EK4A 4BGGA 4UWBA 5CS6A 2Q0NA 5EHOA 3TUCA 1R0PA 4RX9A 3LLAA 3M2WA 1KE7A 3PXKA 3NUSA 3EQGA 1BUHA 3EMGA 2BIKB 5DFPA 4JG8A 4C59A 2OXYA 5LJJA 3F5PA 1JSVA 1CTPE 5FXQA 4E6CA 4EZ7A 3I0OA 4BBMA 4O2PA 4FIFA 4RLLA 3D7TA 3DBCA 3QC4A 4AA4A 2ZB1A 2C0OA 3GFEA 1FVTA 4U97A 3TKUA 2WAJA 5JMSA 3GXLA 3DB6A 5FM2A 5IQDA 3O8PA 4J95A 5ICPA 2XK6A 1M14A 3V5LA 3LW0A 5ETFA 3RI1A 4L68A 2ITXA 3FAAA 4YHFA 5LVMA 2UW4A 3Q96A 4FYNA 4S2ZA 5IDPA 4TWNA 4IAZA 4DCAA 5K0KA 2BROA 4XX9A 1SNXA 4RZWA 3EQHA 3F3ZA 4KIPA 3V8TA 5I9UA 5IH5A 5EDPA 4JI9A 1Z57A 2QOIA 4OBQA 5E8YA 4BYIA 3CSVA 3U55A 3Q4ZA 3KXHA 4TT7A 5IUIA 2J0LA 5AP7A 4UWYA 1V0BA 2J0JA 4IB0A 4FSTA 3B8RA 4KIKA 4JR3A 3VUTA 5HCXA 5C8KA 4RT7A 3B2TA 2OJFE 2W4KA 5EKNA 3TNPC 3EZVA 2QOCA 4FI1A 3PJ8A 4U9AA 5EI2A 4CTCA 3PIXA 4DFNA 4J97A 4EQCA 4YTCA 5TT7A 5AR2A 4IAFA 5EM5A 2VX1A 4HW7A 4CZTA 2YZAA 4O0UA 2X4ZA 5AP5A 3TCPA 3FJQE 2IZRA 4FV5A 5CQWA 4W4WA 3UZRA 2ITUA 2WU6A 4FT9A 3C5UA 3P4KA 5A6OA 3ALOA 3KY2A 4PL5A 3W1FA 4C0TA 1OZ1A 1ZOHA 3F88A 5D7AA 4O7YA 4EYJA 3TDWA 1UU7A 3UNZA 4BBFA 4EUUA 4HYHA 4IWQA 2QD9A 4OTPA 2OJ9A 2BDWA 4FNXA 3R8LA 2NRUA 4YSJA 5IEXA 3W2PA 4IADA 5EQEA 4DE4A 2BDFA 5BYYA 3Q4CA 4AN2A 5IF1A 2BPMA 3OT3A 4BDAA 5BUJA 3R22A 3ET7A 4RC3A 2CKPA 4EK6A 2WFYA 4I0TA 3PPZA 5K9IA 3M11A 4I6FA 2J50A 4QMTA 3PLAE 4BICA 3F5UA 3HLLA 5AFVA 1SMHA 1WBSA 3FLZA 4A4OA 1E1XA 2G15A 2WMVA 1Q3DA 3CBLA 4TNDA 3EYHA 3IG7A 4ZJIA 4FKTA 4E6AA 1PXMA 2VO3A 4IANA 5BVFA 3A60A 3ZSHA 5J87A 4F70A 4NEUA 4MXOA 1H07A 1OL5A 3UQCA 3ITZA 5AR4A 5CEOA 4KRCA 1NA7A 4EOKA 5CSHA 4DG0E 4D5HA 4USDA 4Y8DA 5DNRA 4CT2A 2F4JA 5KMOA 3BU5A 3Q4TA 5HLWA 5EI8A 1UU8A 1AQ1A 3CEKA 3LMGA 2X9FA 5CU6A 5ANIA 4LV5A 4OGRA 3ZCLA 1ZMWA 5D11A 3FMJA 4C62A 4E3CA 4ZY6A 2VTTA 2WMRA 3RK7A 4AT5A 3EQCA 4AN3A 4ZMFA 4ZSLA 3QZGA 1G3NA 2CGXA 1KOBA 2YCQA 2PVKA 3Q3BA 2GPHA 3ZO2A 4XP3A 3U4WA 4RQVA 4KNBA 3DA6A 3SA0A 3LMHA 3K2LA 2WMSA 5EW9A 3V3VA 4RWIA 5FM3A 5ACKA 4EOSA 5B0XA 3BYVA 5AR8A 1IAJA 3ZZEA 3U9CA 4B99A 3F6XA 4C2VA 2OXDA 3R01A 4ZMEA 2PY3A 3VBVA 3VIDA 3DFCB 4LRKA 2X81A 1PMVA 3RPRA 4ZTMA 4CKRA 2O2UA 2QO7A 2OZOA 4O96A 4PWNA 3R28A 5LVNA 1FPUA 3DKOA 3LM5A 3UO5A 4Y72A 1R39A 5CSWA 1A48A 4M69B 2XUUA 4KIKB 5D12A 5LVLA 5AM7A 5C26A 5K5XA 3GQIA 2VWYA 4ZLYA 4AT3A 4AX8A 2GQGA 5KZ0A 4GIHA 1M7QA 4UN0C 3QQLA 4O0WA 5K3YA 2J7TA 3TTJA 4X3FB 3OROA 4YBJA 4AQCA 3ODZX 4BCMA 4CKIA 3PXZA 3GCVA 2W9FB 3CQWA 4GMYA 3BEGA 4LG4A 3DU8A 3F66A 2W1GA 2I0YA 3OS3A 4EOOA 3OXZA 4BR3A 4CZUA 2GU8A 4CT1A 2CNQA 4QMLA 4LUDA 4XNEA 1WMKA 4AU8A 3ZFMA 4F6UA 2UZOA 2HZIA 1XJDA 4R3CA 3QHRA 2QOOA 1YWVA 4RX5A 2BAQA 2VU3A 2FSLX 5JGAA 5CZHA 3C4CA 4GK3A 2QODA 3MPAA 1UKHA 2C6LA 4B0GA 3PPJA 4O38A 3EQIA 3SXSA 4EL9A 3MN3A 2FH9A 2BRBA 2XRUA 2W1DA 3AC2A 1DAWA 2GS2A 4D28A 4DFYA 5FUTA 3N9XA 4BDKA 5HI2A 3DFAA 3HDMA 4GV1A 3QRTA 3QTZA 2GMXA 3KGAA 4RPVA 2QOQA 3NW7A 4YZ9A 5E1EA 5H8GA 4WBBB 4R7HA 3R2BA 4FSRA 4IDTA 1IRKA 1DAYA 3EQFA 4RJ4A 4EBWA 4RIXA 1IG1A 1RDQE 3G90X 4BIEA 3G5DA 5JEBA 4XG3A 3G2FA 4C4HA 5HO7A 2ITVA 5BVKA 3A2CA 3DXNA 4NFNA 4QP6A 2FB8A 4L44A 4X7QA 2VX0A 1Y8GA 2QKRA 3ORLA 4FIHA 4GK2A 4NJ3A 3RM6A 2PUIA 1ZMVA 1PXPA 2PMIA 1A06A 1GZNA 2PVHA 1ZLTA 2RL5A 3Q53A 5KMLA 5AJQA 1MQBA 1T46A 2QOBA 4JRVA 3HMOA 3F3VA 4JX7A 4W8DA 4CV9A 5LCJA 4FV1A 3CD8A 2XIYA 3R1QA 4L00A 1P5EA 3CLYA 4MYGA 2J0KA 3DB8A 5ANGA 3GC8A 4OTRA 2R3MA 3DK7A 3F7ZA 2ZM1A 3FBVA 1H00A 3AG9A 3IO7A 2CDZA 3DAJA 5E9EA 3DKCA 4C38A 1XKKA 4J96A 3OUNB 5JGDA 4M0ZA 4CVAA 3UOLA 2W05A 5I4NA 4P90A 2XJ0A 1OBDA 5IQFA 4PPCA 3A4PA 2JAVA 4IM2A 5JH6A 4FSYA 2YCSA 3C0HA 5E8TA 3QF9A 5ETCA 4QPMA 4YLKA 4W4XA 5J7HA 3V6SA 2BVAA 3UTOA 4WG3A 4EKKA 2GFCA 4XCUA 4YC8A 3ZUTA 3A7IA 4CLJA 3LMIA 1Y8YA 4DEBA 1BI8A 4F99A 4Z7GA 3KU2A 2WKMA 4IX6A 3QTXA 1SYKA 3ZMMA 2RFEA 2WB8A 5E8UA 2AC5A 4NW5A 5CANA 4FTJA 4L3PA 5L4QA 2UW6A 5CAPA 4JG6A 3MJ1A 3PG3A 4H36A 3FZPA 5CYIA 4ASEA 1R3CA 3HUBA 3R9OA 4MD8E 5CNNA 2X2MA 2IVSA 3LZBA 4EOJA 3UZPA 2VN9A 3EQBA 4MD7E 3ORMA 4F08A 3H0YA 3BLHA 2P2HA 3VHEA 5K5NA 3DLSA 1NT2A 5A4CA 1GY3A 3C4XA 2NNWB 1ZZLA 3GCPA 1OKVA 4W4VA 4FSWA 5HHWA 5JKGA 3W33A 3BYUA 4WSQA 4ZTQA 5FGKA 3TV7A 2XA4A 4UWCA 4FSZA 5E91A 3AXWA 4FC0A 3MGYA 4BTMA 4ZZMA 4DAWA 5M09A 2O5KA 2GNJA 5AUVA 5BQ0A 1OVEA 3ORTA 2PE2A 3BZ3A 5B2MA 3O96A 5HBJA 3IW5A 4AW0A 5IQEA 2WEVA 3GCUA 5CI6A 1J1BA 3MA3A 2WTKC 4GCJA 3UBDA 4FA2A 2JKOA 5B2LA 4OTFA 5FBNC 4EOQA 4W9XA 4WSYA 2XNOA 3H4JA 5EFQA 5IH4A 1WVWA 1WVXA 2WMWA 2YM6A 4MTAA 4QYEA 4EHGA 5KNJA 4S30A 1WBNA 3R73A 5IQAA 4C3FA 4ZS4A 2WMXA 4AZVA 4FV6A 4E4XA 3VRYA 4FT5A 1L8TA 4EWHA 4O86A 4XP2A 2G9XA 4MBJA 3KRLA 3WE4A 2QKWB 1YXSA 2XK4A 3DAKA 3GVUA 4IE9A 4NWMA 4K11A 4WOVA 5CU3A 3PZHA 4BRXA 3VS0A 4WUNA 4ANMA 4EOLA 2P3GX 3CJGA 3KK9A 3CC6A 4E4MA 5GIPE 2UV2A 5CENA 4BCKA 2BCJA 3UZTA 4MHAA 2KULA 3MH1A 3NUPA 4ASDA 3EQPA 2HXQA 2WO6A 4GEOA 3Q2JA 4GFGA 4KIQA 3EN6A 4WNMA 4CFUA 3ATTA 3RM7A 5IZFA 2H6DA 4IFCA 4GRBA 4AS0A 4BI1A 3HRFA 2BDJA 2ITPA 5CF4A 2YABA 5TKDA 5AUUA 2A4LA 3F3UA 1WFCA 3F5GA 1PRYA 2QU5A 3EIDA 5I0BA 2WTWA 3FE3A 1XH6A 5IKWA 2C0IA 1REKA 2ZDTA 3CPBA 4FSNA 4K2RA 3P0MA 3VO3A 2YJRA 4JIAA 2VWIA 2IW9A 5DGZA 3I4BA 3D83A 3HV7A 4FX3A 1DM2A 1XHAA 4UZDA 3TIYA 2P0CA 4DLJA 5KBRA 3ROYA 5IQBA 3VUDA 4DINA 3CIKA 3ZBFA 2RFSA 2O64A 5CSPA 2CLXA 4NM5A 1G8AA 1UV5A 4U3ZA 4PY1A 4YJVA 3NCGA 4BDGA 5M4FA 4I6QA 3MDYA 4QMWA 1OL2A 3UYSA 5T68A 4D0WA 2FSOX 5F9EA 2C5YA 2YIXA 4YBKA 2XIZA 4IM3A 4XV9A 4CMTA 1YWNA 2GS7A 2JDSA 3ZXZA 1U54B 5CXHA 4F6WA 4FKRA 4OBOA 5AUYA 1OBGA 4CLIA 2OFVA 1SZMA 5CQUA 3UOJA 4I23A 2YN8A 5CZIA 4M84A 3L8SA 3P7BA 4M97A 4WUAA 4O7RA 5EOBA 1OB3A 2XMYA 1XH9A 3DNDA 3OW3A 5JQ8A 3UP7A 2VTQA 3FMKA 3AMBA 3U51A 3AD5A 4PNIA 2JIUA 5L8JA 1UA2A 2DYLA 3L9NA 5TO8A 3TNIA 2QOFA 1BYGA 3NAXA 3SKCA 3ZRLA 3LOKA 2JBOA 2JIVA 2Z7SA 3O50A 1MRUA 2ITZA 4ZZOA 3VUGA 5M57A 3EOCA 4QQTA 4MX9A 2JEDA 3SOAA 4A7CA 4H05A 2XCHA 2PVYA 2UZNA 4M66A 4DH1A 4XJ0A 4Y85A 2R4BA 1Q5KA 2BAKA 2XNGA 4FK6A 4HPUE 2VTSA 4QP2A 5AWMA 4IDVA 1RQQA 2C3IB 1B6CB 5AP3A 3RNIA 5AR3A 4FV7A 2J51A 4O0VA 2A2AA 1PXNA 4V05A 4IZYA 5L2WA 4O7NA 3HV3A 4O7LA 3SW7A 3ORKA 4PUZA 3LHJA 3W2RA 3ZRMA 4BCGA 4KINA 4LFIA 1W7HA 1QPDA 1J1CA 4A4LA 3AC3A 2FVDA 3UE4A 4BDFA 3D0EA 4MEDA 4D0XA 4N57A 3DOGA 3NGAA 4UEUA 3S00A 4ANNA 1YW2A 2ZJWA 4G16A 2O63A 4PPAA 1ERKA 3OEFX 4Y83A 1YI3A 3FLNC 4HVHA 3FSFA 3GU6A 4XV3A 3QQHA 4EH9A 5BVEA 1GIJA 4QYYA 3KXGA 3DBFA 3OWLA 4RX8A 3NNXA 5ANDA 3PVBA 4O7TA 3CPCA 1RW8A 3U9NA 4BBEA 2PVJA 4QPAA 4EH8A 2YLEA 4G3EA 2PL0A 2WMTA 1GZ8A 3QCYA 4BL1A 4EH5A 4ZSAA 4KB8A 3OOGA 5AP0A 1KE9A 1H28A 4QYHA 3RK5A 3I60A 4R1VA 4RIYA 3DNEA 4BI2A 3V01A 4HVGA 2PULA 2ERZE 4PL3A 1LR4A 3AT4A 5LMAA 3KXZA 3IECA 4FGBA 4FOCA 3T9TA 4EZ5A 2C5OA 3BBWA 3QTSA 4QMOA 5J1VA 3WZJA 4YJRA 3PVUA 3FLWA 2C1AA 3QKKA 4KBCA 2DS1A 5LQFA 4E5BA 2F7XE 3ZFXA 3KRWA 4FKWA 5CX9A 3BYOA 4H1JA 2RFDA 3RAIA 4HVIA 3ANQA 4IAYA 5IEVA 2A0CX 2XYNA 3VBXA 3B8QA 3ZO1A 3R7EA 4L9IA 5HG8A 4HZRA 3COMA 4D55A 4IZAA 2YIYA 5H8BA 2YFXA 4B4LA 2R3OA 3A99A 3BU3A 3EFJA 3NS9A 4AFJA 5KKRC 4TY1A 4KA3A 4C4IA 4O81A 3GUBA 4F9WA 4RA5A 3PSCA 4KUJA 3LQ8A 5KMKA 4AGDA 4DT9A 1E9HA 3A7JA 1PKGA 3Q4UA 4G3FA 3MPTA 4NIFB 3ZTXA 4BZDA 4K77A 4M3QA 5I9YA 3L9MA 1SM2A 4X6QC 5LOHA 4F09A 1Y6AA 3HDNA 2OLCA 3SXFA 1H1PA 4EJ7A 3HMPA 4DF3A 3P7AA 3VAPA 5L6OA 3BIZA 4DH8A 1K2PA 2EVAA 5HO6A 2W9ZB 3V5WA 4YMJA 5EHYA 3W16A 2CGWA 2QHMA 4G3GA 3FC2A 1KE6A 3BYMA 4M13A 2BZHB 4MWHA 2VZ6A 3DDQA 3ZDIA 3IGOA 2GTNA 3QC9A 4I4FA 4GS6A 3CE3A 2QG7A 3I5ZA 3RHXA 5AR7A 5AV4A 1H0VA 1U59A 2WZJA 4I6BA 3OCBA 3GB2A 3Q6WA 3OBJA 3ENHA 4FKOA 5AM6A 2UW7A 4EH2A 2VTNA 3EL8A 3EHAA 3RINA 2QO9A 4RJ7A 3ATSA 2HZNA 1FQ1B 3BV3A 4F9CA 4JDHA 2VNWA 3R8MA 2OH0E 4YP8A 1ZOGA 4C36A 2X8IA 5HG9A 5BNJA 3GU7A 3TNHA 1OPLA 3ERKA 4U44A 4A9TA 1BL6A 2WTIA 1PHKA 5BPYA 5IA3A 4MVFA 1LP4A 3OUKA 2EXMA 2XB7A 4RBLA 3LAUA 5HE0A 2O65A 1Q4LA 4YPSA 4MQ2A 5EKOA 4HGTA 5AV1A 2Y4IC 3KMWA 2GHLA 4QNAA 4R78A 4F0IA 3RPOA 3V51A 4EH7A 4OTGA 1URWA 1KSWA 2Y6OA 4J1RA 4CKJA 1OPJA 3VULA 5M51A 3UPZA 2CGUA 4JNWA 2LAVA 4AZWA 3F5XA 3ZH8A 2C6TA 1JOWB 2WD1A 4ORKA 3WE8A 4EK8A 3R7YA 5ANEA 4BYJA 4DFZE 4FSMA 1YOLA 4YZNA 3PVWA 1W83A 2XBJA 3P78A 2BFYA 5IQCA 2I7QA 3F69A 3HGKA 3LM0A 3ZDUA 4YO4A 2R3IA 3FSKA 5EDRA 2R64A 5ACBC 5F4NA 3UDBA 3DK3A 4DEAA 4FVPA 4Y73A 3UODA 4M8TA 5J1WA 4LL0A 1W82A 2FO0A 3BPRA 3R63A 2UZVA 2BRNA 2WOUA 3IDCA 1V0OA 3OP5A 4L8MA 4ZP5A 5AUXA 3C7QA 2BHHA 4D1ZA 3POOA 4FKLA 4JQEA 2GQRA 1XR1A 5CXZA 4UXQA 4R6VA 3NRMA 4FV9A 2YIRA 3WILA 3R8VA 5AV0A 3VBWA 3PA5A 4JT3A 4AWIA 5KHXA 4JDIA 3C51A 2I0HA 3H10A 4X0MA 3MIAA 5CAVA 4K9YA 3MH2A 4DEGA 2VWVA 2QLUA 4ACDA 4TYHB 3PLSA 1M2RA 1R78A 2V7OA 3NEWA 3CTHA 4TW9A 5CF8A 1U46A 1MQ4A 2B54A 1WBVA 3G51A 5C01A 4CFXA 5IA0A 1PKDA 4HYSA 3N4UA 3QCXA 2C6EA 4ALWA 4BDDA 4EK3A 5E90A 3NUNA 4F7NA 4USEA 2ETRA 3IW4A 4OR5A 2YACA 2Y8OA 4G9RA 4I94A 5EDQA 5FLFA 3SXRA 2UW9A 4X3JA 3WF5A 3TM0A 1SVEA 4G17A 1YKRA 1FINA 1PJKA 4O27B 1S9JA 4D2RA 4GKIA 4RZVA 5M07A 4U6RA 1LUFA 2VGOA 4HVSA 2IN6A 3K3IA 3PPKA 4DTKA 2W99B 3EFLA 3LFAA 2GNGA 4QTEA 1KWPA 1URCA 3AGMA 3F2AA 4PL4A 5AIRA 5EOLA 5HE1A 5JFXA 1U4DA 3A7FA 2ZV8A 4H3PA 1Q8WA 1U5RA 1R0EA 4D4YA 5EI6A 4ZSEA 4KWPA 3RWPA 3R8PA 5M4UA 5CEMA 2EWAA 5A9UA 5HNBA 2YDKA 3R1YA 5D41A 2HELA 3D15A 3E3BX 5IMXA 1TVOA 1UVRA 5CAOA 5LCKA 4IWDA 3FEGA 3KC3A 4BWXA 4FT3A 4D58A 4B6LA 2YLFA 4XMOA 4NL0A 4LMUA 1GZOA 4RWLA 3ZUVA 3KRRA 3MB6A 3VS4A 1PW2A 2XM8A 3FHIA 5AIKA 3TKHA 4DG3E 4MXXA 1PF8A 4RVTA 4DA5A 4QO9A 2YEXA 1MRVA 4YGAA 1ZWSA 4U41A 2PU8A 2GCDA 3HV4A 4M69A 2RIOA 2ZMCA 2XKCA 4FV4A 3C4ZA 4R3RA 5HICA 1YDRE 3FLQA 3MI9A 3OBGA 4PDOA 2BAJA 4H3QA 4S33A 5AUTA 4X3FA 2V5QA 3FLYA 1CKJA 3EQRA 4FZAB 1W0XC 5A4LA 5IG1A 4IB1A 1PY5A 2PSQA 4YNEA 2IWIA 4F4PA 5GJGA 3O51A 1T45A 3NNWA 4DFBA 4MK0A 4IWOA 1PYXA 3O0GA 4X2FA 4JOAA 4FV8A 4G31A 3TNQB 2C3JA 3QLGA 3D14A 5DR6A 4EOPA 3TUBA 4W8EA 3I0QA 4XYFA 5HBEA 5DOSA 3WF6A 5AV2A 4FG8A 4ZJVA 5J9LA 4FT0A 4IB5A 4CFFA 3ORIA 5LVOA 2FSMX 1H24A 4RIWB 3AMAA 2FSTX 2R2PA 3H9FA 3KB7A 4KD1A 2OGVA 3LXPA 4QMUA 4FIEA 4K18A 2PVRA 4OTQA 3D5VA 1KUTA 4LQMA 2HENA 4ITHA 3KQ7A 3TNWA 2BTSA 3QWKA 4CRSA 5I5ZA 5IH6A 3LFEA 1J91A 4HCTA 4GT4A 5HBHA 5AP6A 4K33A 4DC2A 3M1SA 2UZEA 2ZM3A 2PZPA 4FTKA 3SGCA 4YURA 3R8UA 3W10A 3P08A 5BVWA 4XOZA 4FYOA 5GNKA 2F7ZE 4AT4A 4H3BA 3OEZA 4M68A 3GP0A 4RWJA 3P23A 3QD3A 4YJPA 1GZKA 3ZUUA 5BVNA 3IGGA 2PMOX 2E9UA 3EWHA 3HMMA 4P5ZA 4UBAA 2X6EA 4EBVA 3DJ7A 2VWBA 4NW6A 4FL2A 4IX5A 1NXKA 3VHKA 3R8ZA 5HIEA 1YDSE 3ZLWA 4DBNA 4U79A 5JRQA 4IC8A 2CPKE 5HKMA 2FUMA 2H34A 3DGKA 2ITTA 2F2CB 4LGHA 4DEIA 5EQPA 3KN5A 3M42A 5DVRA 5GIOE 4FNZA 3IPHA 3AD4A 4Q2AA 5J8IA 4JXFA 3WZUA 4E26A 3NZ0A 3SX9A 4C02A 5L8KA 4FIIA 2R9SA 4RA4A 5JT2A 4UV0A 4F1OA 5M08A 2OFUA 3LJ2A 3BHHA 3MPMA 1UWHA 2R3GA 3IDPA 3ACKA 2C47A 4O7ZA 4BB4A 4XH6A 4OW8A 5GJFA 2R0IA 4FMQA 2G2IA 4NZWB 2GS6A 2NPQA 4I21A 1CKIA 3UVRA 3HKOA 3I1AA 1Q62A 3RVGA 4N4SA 2JDRA 3ULIA 1YXTA 3R7OA 5AA9A 1PXIA 2WMAA 4KS8A 2OH4A 3EN9A 5E8ZA 2CN8A 4F6SA 1OMWA 5HX8A 3U54A 2B4SB 3TV4A 4QP9A 3I6WA 3RK9A 3LQ3A 1MRYA 2VWWA 5C27A 2DUVA 5IA1A 3DCVA 3ZXTA 3TIZA 3HZTA 3DTWA 4RFZA 5D9HA 4BCHA 1H1QA 2F2UA 4I20A 4LGDA 2BRGA 5LMKA 5LXMA 3QCSA 3F3WA 4D2SA 2I0VA 2OKRA 3H30A 2WQEA 5CVGA 1JBPE 4TPTA 3IKAA 2QQ7A 3I5NA 5DPVA 5AP2A 5FTQA 5HLNA 1Q41A 3SC1A 4E5WA 5I9VA 2B9JA 2OJIA 4QTDA 4YUQA 4ZLZA 3CS9A 4QMMA 3R7GA 4IVBA 3E7VA 5AUZA 1Q3WA 1CKPA 4RSSA 4O0XA 5C8NA 1H1WA 2XYUA 3GC0A 3SVVA 3QQKA 3QGYA 5E7RA 4J52A 5CEKA 3A8WA 3UQGA 5DRBA 4GL9A 4AOJA 3GCSA 4AZEA 1UKIA 4EYMA 4M12A 3ZLXA 3FZ1A 3NMUF 1H4LA 3IS5A 2ITYA 4L7SA 4KIOA 3TZ9A 5CSVA 4F1MA 4MXZA 2UW3A 1P4OA 3MH0A 2X7GA 2BTRA 2Z7RA 3UMXA 4G5JA 3F7WA 3W18A 3WIKA 4FKUA 4A4XA 2VRXA 4C58A 2W7XA 4DHFA 2NO3A 2Y9QA 3FI4A 2HXLA 1P14A 2XKDA 2WTCA 3QAME 4C35A 4L3LA 3LKMA 4R7IA 5C8MA 2C3LA 4WIHA 4EHVA 2X2KA 5HIDA 1GOLA 5FP6A 1OIRA 2W17A 5EG3A 5CVFA 3S1HA 3DXQA 4XG4A 4GJ2A 5CALA 4O0YA 5HD4A 1OGUA 5HU3A 2C69A 3BLRA 3AGLA 3HRCA 3R1NA 4XS2A 3VWAA 3TJCA 3WZDA 2AYPA 5GJDA 4TL0A 2JC6A 4L53A 4A06A 2BIYA 2HWPA 4FTNA 4QD6A 4IB3A 4BDHA 4CSVA 4WD5A 4YTIA 4PMTA 1YWRA 2QLQA 2R0UA 1JKSA 3G9LX 4CXAA 1QPJA 2OK1A 3KKVA 4WRGA 4XV2A 3ORNA 4J71A 4AG8A 3E8DA 5C4LA 5CEIA 5FTOA 3VUHA 3QZIA 3R9DA 4I5CA 2FYSA 1IR3A 3U8WA 3MESA 4BVUA 2B0QA 2PVNA 1ZYJA 3GEQA 2WELA 4ZSGA 3LIJA 4USFA 3C50A 1OM1A 3FMLA 4I1ZA 5A46A 5LWNA 3NCZA 3PJCA 5CI7A 2VNYA 5KX8A 2Z2WA 3OMVA 3AC4A 4IIRA 3GT8A 3TV6A 2Z02A 2UZLA 4D2WA 2W1IA 4F7JA 4EC9A 3ZOSA 5A4EA 4J8NA 3I6UA 5DI1A 5JFSA 2W5AA 3OG7A 4RJ3A 5L2SA 4QQJA 4MNFA 4RIOA 4DGOA 3V5TA 1FMOE 4ZAUA 5HU9A 4FKSA 2ITWA 4EJNA 3SOCA 4IC7A 3UIXA 2OZAB 3EKNA 4O7WA 2OJGA 4FIGA 3UNJA 3OZ6A 4PPBA 2IW6A 5CASA 4WHZA 4BIBA 4BC6A 1G5SA 1U54A 2ONLA 2W1FA 2WMUA 4APCA 5IUGA 5JZNA 3MTLA 4QP8A 2Z7LA 4OBPA 2QOKA 3E87A 3RCDA 3NVMB 5E1SA 2WOTA 3I7BA 3VS5A 4BDCA 3RNYA 3IW8A 4B7TA 4F0FA 4XV1A 5KMIA 2HAKA 2QU6A 1PXJA 3IK3A 1Y91A 4FODA 2C6IA 2XEZA 4E20A 3FYJX 5H9BA 2V55A 4MXCA 4TKSA 5G6VA 5HVYA 2CJMA 1H25A 2OIQA 5IA4A 4ERKA 4FZ7A 2CHLA 2HW7A 3UMWA 2OU7A 4TYJA 4O0RA 2G2FA 4BTJA 1ND4A 2ZV7A 3BBTB 2Z7QA 5DG5A 4BKYA 4C4GA 4PMPA 1FBNA 1CM8A 3PA4A 1ZOEA 5EM7A 2GQSA 4F9BA 5CU2A 4FEQA 3GFWA 4R3PA 5AAFA 1WZYA 4DT8A 4F65A 3O8UA 2F49A 3ORZA 2XH5A 2YWPA 4L3JA 5C9CA 2JDVA 2RG5A 2HCKA 2YERA 3MFUA 3PWDA 1ATPE 4IQ6A 2CGVA 2F57A 4FNWA 4RC2A 5DEWA 4A9YA 1FGKA 3CTQA 2QC6A 3JS2A 4V0GB 5CSXA 5F20A 5M06A 3FLSA 2XS0A 3KFAA 4UY9A 2XK8A 3KXXA 4ERWA 3DXPA 3FZTA 1QMZA 5E8XA 3BHYA 3VS7A 1JLUE 5I3RA 3VRZA 5KHWA 3EQDA 4CV8A 4BDEA 4FTCA 5DH3A 3HX4A 3KK8A 3JY9A 3R04A 3RGFA 1UNHA 3JXWA 1YXVA 4UYNA 4LI5A 4NJDA 5HX6A 4GUBA 1XQZA 3ULZA 3NR9A 4C8BA 2ZAZA 3F3TA 5ANKA 5FEDA 4L67A 3THBA 5F95A 2R3KA 1IA9A 3VVHA 4YR8A 4E8AA 2QHNA 3GENA 3MVJA 3EH9A 3GNIB 2XIKA 3FXZA 4BKZA 1VYWA 4KBKA 4HNFA 4EK5A 1JPAA 4F1TA 5FTGA 2YITA 3H0ZA 2C0TA 3WYYA 4PP9A 4ZXTA 2EXEA 4AZSA 4CYJA 4G5PA 4KKEA 3ZEPA 2A1AB 1FGIA 3Q5IA 3QTRA 4CRLA 4HYIA 3SW4A 4HVDA 3IOKA 4HNIA 4O7SA 4TWPA 3OW4A 3G6HA 2LGCA 3ZO3A 2PUNA 2XNPA 3QXPA 2B9IA 2OG8A 3CKWA 3LCDA 3TXOA 4BCFA 3A61A 4EHEA 2JDOA 3ACJA 1LEZA 1Z9XA 3MFTA 4YTFA 5LWMA 3H9RA 1TQPA 4QP4A 3QQFA 4X2KA 4BHNA 4A9RA 4AGWA 3DKFA 5DE2A 2EB3A 1Q99A 1RJBA 2X9EA 3BRBA 3S4QA 3Q2MA 4QMSA 1PXKA 1ZAOA 4BCJA 3PUPA 5CWZA 4ITIA 4D9UA 3MFRA 3FMNA 4IAKA 3VJNA 3KVXA 3RALA 3ZM4A 3C4WA 1H0WA 4II5A 4NIFA 4Q5HA 3NIZA 4U8ZA 2WMQA 3QTUA 4O22A 2JITA 4O91A 2CCHA 3MY0A 3DY7A 3R0TA 2F9GA 2PZIA 3UQFA 2PWLA 1I09A 3RTPA 2GHGA 4YLLA 2W96B 4WG4A 3R9RA 1IASA 2P4IA 3MWUA 2G2HA 1CMKE 2VTHA 3DZOA 3FXXA 3PY0A 4PQNA 5DBXA 3RAWA 3NUAA 3SG8A 4IZ7A 2PHKA 4NM7A 3KULB 2W4OA 4JBPA 2WQMA 3MVMA 5HG7A 4YHJA 5E4HA 2C5NA 3EN4A 3PRFA 2CKEA 3MJ2A 3Q52A 4GG7A 4E4NA 4FGRA 2BKKA 5EHLA 4K8AA 4GJ3A 4GYIA 4MWIA 4RC4A 4JLCA 3OD6X 3OOMA 5CEPA 2YM3A 3FHRA 4I3ZA 3QWJA 5GZ8A 2GNFA 4PMMA 3D5UA 4BGQA 2WTKB 5CAUA 2DQ7X 4BFMA 4YJQA 4N6YA 2GTMA 2B1PA 3GBZA 3WZEA 1H8FA 5KBQA 4CG9A 3FXWA 3ZSGA 3HNGA 2JDTA 2VTJA 3AQVA 3NYVA 4X2NA 2GSFA 3C1XA 3R7UA 4ZS0A 2ERKA 3KCFA 2XIRA 3OHTA 3LLTA 4Q5EA 4FTTA 3NX8A 4DG2E 1ZARA 5AP4A 2VTAA 3QZHA 4QP3A 4MNEB 3PTGA 2ETMA 1WVYA 1YVJA 3LXKA 3FKOA 3WF9A 3PP1A 4KKHA 2NP8A 3SD0A 2GHMA 3ELJA 3OY3A 4G34A 4BF2A 4ZSJA 4ZOGA 4DGMA 4QT1A 2J90A 5K0XA 1OKWA 2VV9A 2XEYA 3VNTA 4AAAA 3SRVB 4I24A 5IU2A 3T3VA 4NU1A 4TWOA 3R21A 1YOJA 4IH8A 4C33A 3TJDA 2X0GA 2KTYA 4BTKA 4L43A 2OJJA 4FTIA 3O71A 3PWYA 4GYGA 5CF5A 3VBTA 3ZS5A 4RVKA 2JBPA 2QOLA 4P4CA 4IJ9A 4DTAA 3MB7A 5DMZA 1ZYSA 3KVWA 3VUKA 3SLSA 4ACCA 5BUEA 4RJ6A 3ZEWA 3BE2A 2IPXA 4IX4A 3MTFA 3RPVA 3LXNA 4TTHB 1P2AA 4MBIA 4OT6A 3CJFA 2E2BA 2VTIA 3QKMA 2ITNA 4FEXA 4NUSA 2NRYA 4QMVA 4YJSA 1W8CA 3I79A 3NPCA 2X7FA 3FV8A 3KCKA 4QTCA 3OVVA 3W32A 4ASXA 3KL8A 3PA3A 2IG7A 5AX3A 4CQGA 4FG9A 5I9WA 1M17A 4EOMA 3LXLA 3PYYA 4RLKA 4XOYA 2JKMA 4UB7A 3MFSA 3UP2A 2XK9A 4Y95A 2R3QA 4IJPA 4TYHA 3Q5ZA 2J4ZA 2PK9A 4U45A 3F82A 4FICA 5DT3A 4M14A 4AOIA 4CTBA 3SG9A 2OW3A 3A7GA 3LCSA 3DLZA 3NYXA 3EFWA 2QVSE 3TI1A 3EN5A 5HNGA 2HIWA 3FYKX 3COIA 4C3RA 4FV2A 3FMEA 2BRHA 2IZTA 3NLBA 2VWXA 3VBYA 4MF1A 2E9NA 4O0TA 1UNGA 4LOOA 4NM0A 2JAMA 4F7LA 3LJ1A 5DR2A 3V8WA 4AP7A 1BX6A 5J5TA 4TN6A 2VTLA 3HYHA 5IISA 3QX4A 3F61A 4ONAA 2R3NA 4MD9E 4XEYA 4FKVA 4F0GA 4QMQA 4E5AX 2PZRA 4YNOA 3I7CA 4AE6A 2X6DA 5DA3A 2A27A 4ZIMA 1Q24A 4Y46A 4DEHA 5IQGA 2CNVA 4XRJA 3P9JA 2J5FA 3QRJA 4C7TA 2XM9A 1Y57A 3GCQA 3QD0A 2Q0BA 4ENYA 5IMEA 1M52A 5CNOA 4NFMA 1H08A 1K3AA 1KE5A 3GOKA 5HORA 4I22A 1UU9A 4IW0A 4X2JA 3ZC5A 2CCIA 3G6GA 3OWKA 2XJ2A 4I4EA 2XVDA 3TZ7A 3CQEA 3GU5A 3D7ZA 5DR9A 4AA0A 3CKXA 4ZEGA 2I0EA 4ZZNA 5A4QA 2YIWA 5HTIA 5BYLA 4NCTA 4FTMA 5HG5A 1OUYA 3V04A 3D5WA 3MA6A 1PMUA 1OPKA 5EQYA 3DBDA 3P86A 1BLXA 5CLPA 4QMXA 4O7VA 3UIUA 3IOPA 2C6DA 3RP9A 4YZCA 4IBMA 5FDPA 3RAKA 4ZTLA 1PXLA 4C4JA 5J9ZA 3ALNA 4FZDB 2CKOA 1OECA 5CU4A 4AA5A 2C30A 3BKBA 1OKZA 3BQRA 3PIYA 3UPXA 2ITQA 4KABA 1JNKA 4P2KA 3CQUA 4Z3VA 4S31A 3BQCA 4MXAA 3R7VA 4O83A 2OSCA 3NSZA 4I92A 2YM8A 5HIBA 5HD7A 4HGLA 4QOXA 2WNTA 3VUMA 2PUUA 4JBOA 3SV0A 2XCKA 1KOAA 2HK5A 3Q04A 4XHKB 1NW1A 4J99A 2C6MA 3A4OX 4RMZA 3CY3A 4RIWA 1VR2A 3E92A 5IA5A 2Y4PA 3KF4A 3CTJA 4RJ5A 4ZK5A 3VS6A 4CQEA 3W55A
chains in the Genus database with same CATH superfamily
3DAEA 2Z8CA 3OCSA 2PZYA 4FSQA 1G8SA 2OI4X 3D4QA 4FJVA 2R3PA 4FV3A 2O3PA 3HMIA 1O9UA 5I3OA 3H9OA 4G2FA 2C4GA 3UG1A 4N70A 3NYNA 3WARA 2BUJA 3BHTA 5KKRB 3QBNA 3GU8A 2BKZA 2W1HA 4GT5A 4TYIA 2O0UA 2BFXA 2E9OA 3QALE 4FSUA 1ZRZA 2P2IA 5DN3A 4XBUA 5EYKA 4W4YA 4LM5A 2IZUA 4E4LA 1VYZA 5EM8A 2H8HA 2CLQA 3LFCA 4TNBA 2BRMA 3REPA 4I5HA 3R83A 3CGFA 1BL7A 3FPQA 4O0SA 2WQBA 1OIYA 3OCGA 5LVPA 4YLJA 3G15A 3E63A 2BALA 4OLIA 1ZYDA 2UW5A 4GUEA 4JQ8A 4CMOA 3BEAA 1NVQA 5M06A 3LCKA 2OF4A 3GC7A 3HP5A 4E7WA 5D7VA 2EXCX 1SNUA 2R3LA 1JKLA 4C61A 4V01A 1GIHA 2XIXA 5DT0A 5TE0A 3WZKA 3S0OA 4HOKA 4Q9SA 3PDTA 3PE1A 1NVRA 5F1ZA 1OIUA 2XP2A 5HEZA 4X21A 2OICA 4U40A 4UX9A 1QCFA 1XBBA 3D2IA 3TACA 1W2CA 2C1BA 1J7IA 1WBPA 2XNBA 3TZ8A 2W1CA 3BV2A 3PXFA 2PPQA 5H2UA 3V8SA 3RJCA 2XZSA 4BGHA 4PTEA 2UZTA 2ZV9A 4AOTA 3C4FA 4AZFA 4AN9A 3RPSA 1ST4A 3CY2A 3FI8A 1JVPP 2RSVA 4I41A 3UIBA 3W2OA 5AADA 1WCCA 2HYYA 4J53A 4A9SA 4JS8A 1OITA 2ZOQA 2W4JA 4KSPA 3R7IA 3GGFA 3SHEA 2CKQA 3WYXA 1BKXA 3QYZA 4G3CA 1OL6A 4IFGA 4RRVA 5JFWA 5GINE 4QMZA 4UALA 4FTQA 2Y4IB 4IMYA 5L2IA 3BLQA 1MUOA 1ZY5A 3C0IA 4QYGA 5EYDA 5L8LA 3HAVA 4PF4A 5L3AA 1L3RE 2A98A 3DS6A 3MW1A 4QTBA 2NYAA 3QD2B 3E93A 3MY5A 5KMJA 2GNIA 4R5SA 4U5JA 4B9DA 3FKLA 1H26A 5C4KA 3BWJA 5G1XA 4ARKA 5AR5A 5AA8A 4L45A 4FTOA 4D9TA 4D5KA 4AW1A 3V6RA 4HCVA 1H27A 3E64A 4QYFA 2WGJA 4M15A 3K3JA 3TEIA 4ANLA 4S32A 2P33A 4ACMA 1Q8UA 3MIYA 2XBAA 3NUXA 4I0SA 3AC8A 5HCYA 1UU3A 3SDJA 4DEDA 3EB0A 4UMRA 4WRSA 3RPYA 4D2TA 4FG7A 5BUIA 1VEBA 3UNKA 1B39A 1CSNA 1O6KA 4AFEA 3DKGA 3UVPA 2XNEA 4QMYA 3U6JA 5FEQA 4JIKA 1XBAA 4J8MA 4MXYA 1FVRA 3A8XA 3QUPA 5DIAA 1V0PA 4OTDA 4D4SA 1APME 4MBLA 4BCNA 3HV6A 2QR8A 3RZFA 4GK4A 2QNJA 2XF0A 2PYWA 3VQUA 3N4VA 1LEWA 4CMUA 4XRLA 3F2NA 5DHJA 2JKQA 3FMMA 3ID6C 3FZOA 1STCE 1PMNA 2GFSA 4GU6A 1XBCA 5IA2A 3H3CA 3L8XA 3TT0A 1XO2B 5J95A 5EH0A 2G01A 3BELA 5B2KA 4CCBA 4X3FC 4DFXE 5E8SA 4FEWA 1KV2A 2IVUA 1Q8ZA 2IVTA 3HUCA 3PJ2A 3QA0A 3CGOA 5C03A 4YC3A 1XH7A 3A62A 5FWKK 2UZWE 4PMSA 5LARA 4RGJA 4QQCA 3GU4A 4GVJA 4EH6A 4FBXA 4DBXA 3QRKA 1OKYA 2XRWA 4O6LA 3MS9A 3U6HA 2QONA 3AD6A 3W2QA 4BTFA 2CN5A 3QLFA 1IAHA 4QMNA 4JRNA 4I5MA 4JQ7A 5DWRA 3R9HA 2RFNA 3R1SA 3POZA 2WHBA 3PRIA 3W2CA 1GJOA 3FQEA 4EONA 2XK7A 2PVLA 2ZMDA 2X2LA 3TKIA 4AZTA 3TDVA 4M67A 4BCOA 1IEPA 2WU7A 4FTRA 3FQHA 4AW2A 3C13A 3QRUA 4OT5A 4QQ5A 3WOWA 2I6LA 3E62A 4PP7A 5I9ZA 1YHWA 3QU0A 5JK3A 5FDXA 4CD0A 2PTKA 5HLPA 5M4CA 2IJMA 2VGPA 4U0IA 4D2VA 2I40A 2IO6A 2VO0A 3FZSA 2OXXA 3PXRA 3Q32A 4GIIA 5M55A 3RZBA 1JKKA 3DK6A 4AW5A 3AKKA 4UXLA 1W84A 2OZAA 3E8EA 5IQIA 2W5BA 3AT3A 3OF0A 4ANSA 1ST0A 3NNVA 4RJ8A 4BCQA 4F7SA 5GZ9A 4DH3A 4EUTA 4LYNA 4Z7HA 3HVCA 4NTSA 2UUEA 2YDIA 2JLDA 4YC6A 3WIGA 3OCTA 1Q97A 4GW8A 2ACXA 3HA6A 3D7TB 4D4VA 1FMKA 4ZTSA 5CF6A 4ZTNA 3E7OA 2X7OA 2IZSA 5CEQA 3QZFA 3WI6A 2ZYBA 3PVGA 3PZEA 4RG0A 4ID7A 3FC1X 3BI6A 2X8EA 3U4UA 4IWPA 3V5JA 3I81A 2GNLA 4L6QA 4CYIA 3JR1A 4PNKA 3JPVA 3PJ1A 1S9IA 1TQIA 4MQ1A 4NKSA 3OT8A 5JQ5A 5L2TA 2BZJA 2H9VA 2OBJA 3HEGA 4YTHA 4JAJA 2JFMA 4QP7A 3QCQA 2X0OA 3QX2A 3UC3A 2QCSA 3L8VA 4B8MA 1EH4A 3EYGA 2FA2A 4F9YA 2Q83A 4QPSA 1YRPA 4QRCA 2C6OA 3LFDA 4LUEA 2WTJA 5AV3A 2YM7A 4BWKA 2ESMA 2REIA 3TL8A 4CZYB 1NY3A 4FL1A 1H1RA 4LV8A 4X6RA 2J6MA 3QTQA 4UYAA 4DCEA 3C5IA 2WIHA 3EZRA 2B53A 4U43A 4L52A 4LRJA 4IX3A 2H96A 2P55A 3IW6A 2XALA 4V0GA 1UWJA 3B2WA 5JN2A 1VJYA 3D94A 3NUYA 2BZIB 3UVQA 5A54A 5GZAA 3AC5A 4QTAA 4N6ZA 4B8LA 1YI4A 3NNUA 4FIJA 1M2PA 4WNPA 3CXWA 4O2ZA 4O4EA 3W0RA 4JX3A 2X1NA 5LMKC 3QTIA 4OAVB 4XLIA 5IQHA 5CU0A 2RGPA 4YPDA 1O6YA 5HESA 3QYWA 3JVSA 4D1XA 2UVZA 3RCJA 3GOPA 4FZ6A 3SAYA 3BHUA 2VTRA 4CEGA 3JUHA 4WT6A 1HOWA 4BDJA 5CY3A 5DLSA 4EZ3A 3FDNA 3UG2A 1JWHA 4BZOA 2B52A 4GT3A 1YDTE 4IM0A 4IAAA 4XLVA 3VQHA 4FUYA 4XG6A 4GKHA 4MCVA 1YOMA 5H8EA 4UZHA 4S34A 4TYGA 3QGWA 2HY0A 4HYUA 4W9WA 5J7BA 2C3KA 2ZB0A 2ITOA 1MP8A 1YXUA 4RWKA 2JGZA 3ANRA 4UMTA 2HOGA 2CNUA 2UZBA 4L01A 4WNOA 3TZMA 3EJ1A 3PXQA 3NW6A 3PY1A 2YM4A 3ZC6A 2X39A 3JVRA 1ZYLA 4FKPA 3AT2A 3ROCA 4ANQA 3NW5A 3RHKA 5IDNA 4NK9A 3PSDA 3HRBA 4BCIA 4TXCA 4TRLA 5ANJA 2OWBA 3PFQA 4EHZA 4XBRA 5BMSA 3BU6A 2ZVAA 4GG5A 4IVAA 3QHWA 4U80A 4MAOA 3OTVA 2QI8A 3KRJA 2VO7A 2YCFA 4K6ZA 4ZJJA 4QDEA 4D4RA 5IPJA 4MKCA 2EU9A 3OXIA 4DEEA 5EYCA 3NIEA 2J9MA 2R3JA 2XNMA 4RFMA 3IQ7A 3ORPA 3GI3A 4FE2A 5M56A 3FI2A 5EK7A 3VW8A 4Z55A 3QUEA 5CVHA 4H58A 5DYJA 2V62A 4WA9A 3R9NA 4DLIA 3HA8A 4EORA 5IUHA 3O23A 3KULA 1OUKA 2B9HA 3LPBA 1Q8YA 4YZMA 2WQOA 2E9PA 2YAKA 2F7EE 1WBWA 4I6HA 4BWPA 3P5JC 5TR6A 4G3DA 4I0RA 3WF8A 4L46A 3IDBA 3HECA 4HPTE 4XG2A 4UMQA 5AAGA 1J7LA 4D2PA 3NAYA 3NUUA 3O8TA 3MVLA 2IW8A 3ZHPC 1F3MC 4AXAA 3EKKA 1YHSA 3Q9WA 5HE3A 3VS1A 3L9LA 1O6LA 4AUAA 4EOIA 3FL4A 5FBOA 3OFMA 4FF8A 5E8WA 4F64A 1OL7A 4AF3A 4EWQA 4ZY4A 2W1EA 3NYOA 2C6KA 2YWVA 5FXSA 4R8QA 5E8VA 1U5QA 5BVOA 5KZIA 3LE6A 1Z5MA 3N4TA 4OTIA 3LFSA 4MNEA 3KA0A 3Q6UA 3RKBA 3R30A 2ONLC 2OO8X 1AGWA 4JDKA 5J9YA 4XG7A 5DEYA 3FY2A 4YZDA 4NKAA 3QQUA 4NSTA 3VC4A 3PG1A 4RVLA 4X2GA 5AMNA 4UMUA 3P79A 4E93A 3VW6A 2Y7JA 4HGSA 4TWCA 4JDJA 3UC4A 3ZBXA 4FKJA 2CMWA 2DWBA 3KREA 3P5KA 2V0DA 3SRVA 3F2RA 3PXYA 5EW8A 3RBWA 4A07A 3QKLA 4IVDA 2YIQA 3ODYX 3LFFA 4V04A 5A3XA 3WBLA 3OWJA 2JFLA 3BE9A 5FRIA 4DFUA 2WPAA 3O7LB 1A9UA 4U7ZA 3ZYAA 4LRMA 4E6QA 3W2SA 4AXEA 3HMNA 3U6IA 3KEXA 2YISA 4CFWA 3O7LD 2HW6A 2J5EA 2QO2A 3OY1A 4OTHA 3KMUA 1OL1A 2VWZA 4EH3A 4IHPA 3KN6A 2QR7A 3E88A 4CCUA 1KE8A 3DJ6A 4IAIA 3LFNA 2W06A 3F9NA 2ZV2A 3UYTA 3QQGA 4BIDA 3DBQA 3QTWA 3ZZWA 1VZOA 4FK3A 4JVGA 4OUCA 5FEEA 4EKLA 3MH3A 3D9VA 4YJUA 4ZY5A 5A6NA 2YZLA 1ZYCA 1SVGA 5HVJA 4U81A 1GIIA 2X8DA 4ZTRA 1UNLA 3CCNA 5AP1A 3FZRA 3FQSA 4E6DA 2XK3A 2BHEA 3OC1A 4RIXB 2ZDUA 5H3QA 4EQMA 1JAMA 3LCOA 3TWJA 3IONA 4AE9A 2W0JA 2IVVA 1QPEA 4FKQA 3OWPA 4H1MA 5ANOA 3R71A 4JAIA 4YJNA 5FG8A 3AMYA 2BR1A 5JSMA 2YJSA 4ANBA 5CT0A 4Z9LA 4A9UA 3CD3A 4GFOA 4LOQA 4FEVA 3LJ0A 1AD5A 1W2FA 2PMNX 3AC1A 5AX9A 3UOKA 3OXTA 2UZUE 3QXOA 4DGGA 2SRCA 3E8CA 4ACHA 4BZNA 4C4FA 4DN5A 3E5AA 3ETAA 3MYGA 4M7IA 5M44A 2WTVA 4N0SA 4M0YA 5K4JA 1W98A 4JL9A 4DGLC 5T6KA 4O82A 3PJ3A 3W0QA 4BJJB 4MH7A 4CNHA 4BY9E 3UIMA 5FXRA 4HCUA 5D1JA 4R1YA 4YSMA 4I5PA 5EM6A 2GDOA 4FTAA 4LL5A 3T9IA 5DRDA 5FQDC 4ACGA 1SVHA 5KCVA 3PP0A 4BDIA 2UVXA 3FWQA 4O1PA 3VN9A 3BGZA 5FP5A 4FEUA 4F9AA 3ORXA 3ZLSA 5A14A 1KV1A 4KKGA 5HO8A 1H01A 1P4FA 4MF0A 1XH4A 2PZ5A 4PV0A 1JKTA 1J3HA 4O1OA 5EYMA 3VS3A 3L8PA 3KF7A 3COKA 4FTLA 4G9CA 4ZTHA 4C37A 1DI9A 4EI4A 3G33A 3E3PA 1JQHA 2R5TA 4YO6A 5ETAA 2ZM4A 2R3HA 1I44A 4CFNA 5B7VA 2JD5A 2C5XA 5J79A 2EUFB 3Q9XA 1JSTA 2PMLX 4G6NA 2J0IA 1PYEA 2W1ZA 5CTPA 3RMFA 4P5QA 3TN8A 1YHVA 3UO6A 3GQLA 5CAQA 3FMDA 5EW3A 3VBQA 4AACA 2YDJA 5J5SA 3NVKI 4XG8A 3Q9ZA 3BWFA 4E73A 4J7BA 3E8NA 4DITA 3W8LA 4FR4A 3DZQA 2RKUA 3DQXA 3HP2A 3BGPA 4K0YA 3R2YA 3V5PA 3BYSA 4RFYA 2A19B 2PE1A 5KO1A 5HTBA 3DJ5A 4IEBA 4C2WA 2VTMA 2HWOA 3KRXA 4XG9A 5CT7A 1CDKA 4WG5A 4WNKA 3S3IA 2XKEA 3VJOA 4CFMA 2PUPA 3R02A 3HL7A 4FKGA 4GSBA 3HAMA 2R7BA 3ZRKA 3DPKA 4E1ZA 3PE2A 1GNGA 4ITJA 3C0GA 1R1WA 2Y6MA 4BKJA 4Q9ZA 5I9XA 2C5VA 4G6OA 1V1KA 3ENMA 4KSQA 1M7NA 3QL8A 1B38A 4Y5HA 4R5YA 2XNNA 1GAGA 4BHZA 1M2QA 5TOZA 4LMNA 5L6PA 1DI8A 2R3RA 3BX5A 4ENXA 3MBLA 2HY81 2JIIA 4FOBA 2OF2A 4U3YA 2VWUA 5L2QA 4OTWA 4EC8A 3PIZA 5GHVA 4DYMA 3UOHA 5AAEA 2VAGA 3DDPA 2QOHA 3FI3A 4WKQA 3DQWA 2XJ1A 1J7UA 4PDPA 5KE0A 4FUXA 2FGIA 2YA9A 3VS2A 1IA8A 4YJTA 4GU9A 3D2KA 2VTPA 4O6EA 4RQKA 4PTCA 5IEYA 3W8QA 4TZRA 4BCPA 5HZNA 5M53A 3BHVA 2J2IB 3R6XA 2PVFA 3C9WA 2R3FA 4QP1A 2OIBA 1Q61A 2BZKB 2V7AA 4GVAA 3KXMA 2HZ4A 4L42A 3L9PA 4FKIA 4I93A 4RVMA 4KRDA 4EEVA 2VD5A 3NWWA 1LPUA 3BLAA 3KXNA 2VUWA 2O8YA 4PDSA 4NTTA 2HZ0A 4PRJA 3ZSIA 5AUWA 4AGUA 4WO5A 1K9AA 3FL5A 4PX6A 1BMKA 5BYZA 4AXDA 3EFKA 1OI9A 4L7FA 4XUFA 3VF8A 3D5XA 4DH7A 4ALVA 5T3QA 2XKFA 3JY0A 2YM5A 5JZJA 4DH5A 4R7BA 3L1SA 3LCTA 2V22A 5K4IA 4PDYA 2WMBA 4NYEA 5JRSA 3FUPA 2XAMA 4WBOA 4AGCA 2YAAA 3DBEA 3HV5A 1XWSA 1DS5A 1WBTA 2WIPA 1JSUA 3R00A 4HZSA 3O17A 3V5QA 2Z60A 4FNYA 4YJOA 1YI6A 5BX0A 3G0FA 3Q60A 2EB2A 3RAHA 3UO4A 5DT4A 4GH2A 2CSNA 4TYEA 5KMMA 3U87A 4DHZA 3DTCA 4BI0A 1E1VA 2UW8A 2WEIA 5HQ0A 1YQJA 4UMPA 4YU2A 4JJRA 3ZLYA 2I1MA 3VF9A 3FY0A 3G9NA 3EN7A 1FOTA 4LGGA 4P7EA 4BDBA 5F94A 4Y5QA 3P7CA 3S95A 1PXOA 4FV0A 3N51A 3PY3A 5C1QB 1BI7A 3JYAA 3ZO4A 3S2PA 4FTUA 3P1AA 4ZLOA 4C4EA 3MVHA 3VUIA 5HNIX 3BL7A 2BMCA 3W0NA 4JBVA 2RG6A 2R7IA 3PSBA 2B9FA 5HVKA 1F5QA 4NT4A 4C34A 4JG7A 5JFVA 1WAKA 3ZU7A 1H1SA 3MSSA 4CGAA 5ETIA 5D10A 3W0PA 3DV3A 2Y0AA 3TUDA 4YZBA 4APPA 4DGNA 4O84A 4FVQA 4HJOA 3Q9YA 4KAOA 4NM3A 4JBQA 1YXXA 2QURA 4XP0A 3QRIA 4C57A 2X4FA 2RF9A 1Q8TA 3FPMA 3K5UA 4ALUA 4J98A 5A4TA 4K1BA 2WQNA 1XH5A 4ASZA 2E9VA 1FVVA 3MV5A 3GC9A 5KUPA 3CR0A 3BGQA 1RE8A 3QFVA 1F0QA 4G6LA 4IACA 4RX7A 2PVMA 3MY1A 3SQQA 2VO6A 3T3UA 5FD2A 5BVDA 4IZ5A 4IXPA 2YHVA 2YCRA 4HGEA 3LFBA 1OIQA 2BILB 2QG5A 1TQMA 2JKKA 1QL6A 4NCTC 3LFQA 5E92A 2J0MB 2UVYA 3EL7A 2G1TA 1ZXEA 5BMMA 4R77A 5JGBA 4QMPA 2WTDA 3CP9A 4IVCA 4Z16A 3ZM9A 4FL3A 3QQJA 4YHTA 4EQUA 4OAUC 1X8BA 3C4EA 2WXVA 4CFVA 2PE0A 3FMHA 4D1SA 3QUDA 3G0EA 3IW7A 5HOAA 2B55A 3FKNA 4JR7A 4DFLA 5KMNA 3AOXA 2OIDA 4NH1A 1ZZ2A 5AEPA 3BCEA 3KMMA 4H39A 2W5HA 3ZFYA 4C3PA 3T8OA 4U42A 4G1WA 3ZONA 4RIYB 2B7AA 2VX3A 3RWQA 5HE2A 3UGCA 3LQ5A 5M4IA 2GNHA 3WF7A 3A7HA 4F63A 1NVSA 3II5A 4GFMA 4QNYA 1HCLA 1TKIA 4FVRA 2AUHA 2ETKA 4KBAA 3TG1A 2UW0A 4O21A 1Y6BA 1WBOA 1XH8A 4EH4A 4BN1A 3K5VA 1PMEA 5TF9A 3K54A 3LVPA 5L6WL 1ZY4A 4PTGA 3TTIA 5HTCA 4DTBA 1ZMUA 2UZDA 5HGIA 1QPCA 5ITAA 5LMBA 4FZFB 3DT1A 3OTUA 3UJGA 2C68A 1HCKA 4FT7A 4ANOA 1REJA 3QA8A 3NDMA 4LOPA 3O2MA 2AC3A 2VTOA 3QD4A 3COHA 4KS7A 5HCZA 4EK4A 4BGGA 4UWBA 5CS6A 2Q0NA 4MUQA 5EHOA 2XAOA 3TUCA 1R0PA 4RX9A 3LLAA 3M2WA 1KE7A 3PXKA 3NUSA 3EQGA 1BUHA 3EMGA 2BIKB 5DFPA 4JG8A 4C59A 2OXYA 5LJJA 3F5PA 1JSVA 1CTPE 5FXQA 4E6CA 4EZ7A 3I0OA 4BBMA 4O2PA 4FIFA 4RLLA 3D7TA 3DBCA 3QC4A 4AA4A 2ZB1A 2C0OA 4O4CA 3GFEA 1FVTA 4U97A 3TKUA 2WAJA 5JMSA 3GXLA 3DB6A 5FM2A 5IQDA 3O8PA 4J95A 5ICPA 2XK6A 1M14A 3V5LA 3LW0A 5ETFA 3RI1A 4L68A 2ITXA 3FAAA 4YHFA 5LVMA 2UW4A 3Q96A 4FYNA 4S2ZA 5IDPA 4TWNA 4IAZA 4DCAA 3W0MA 5K0KA 2BROA 4XX9A 1SNXA 4RZWA 3EQHA 3F3ZA 4KIPA 3V8TA 5I9UA 5IH5A 5EDPA 4JI9A 1Z57A 2QOIA 4OBQA 5E8YA 4BYIA 3CSVA 3U55A 3Q4ZA 3KXHA 4TT7A 5IUIA 2J0LA 5AP7A 4UWYA 4AXCA 1V0BA 2J0JA 4IB0A 4FSTA 3B8RA 4KIKA 4JR3A 3VONA 3VUTA 5HCXA 5C8KA 4RT7A 3B2TA 2OJFE 2W4KA 5EKNA 3TNPC 3EZVA 2QOCA 4FI1A 3PJ8A 4U9AA 5EI2A 4CTCA 3PIXA 4DFNA 4J97A 4EQCA 4YTCA 5TT7A 5AR2A 4IAFA 5EM5A 2VX1A 4HW7A 4CZTA 2YZAA 4O0UA 2X4ZA 5AP5A 3TCPA 3FJQE 2IZRA 4FV5A 1VLRA 5CQWA 4W4WA 3TMOA 3UZRA 2ITUA 2WU6A 4FT9A 3C5UA 3P4KA 5A6OA 3ALOA 3KY2A 4PL5A 3W1FA 4C0TA 1OZ1A 1ZOHA 3F88A 5D7AA 4O7YA 4EYJA 3TDWA 1UU7A 3UNZA 4BBFA 4EUUA 4HYHA 4IWQA 2QD9A 4OTPA 2OJ9A 2BDWA 4FNXA 3R8LA 2NRUA 4YSJA 5IEXA 3W2PA 4IADA 5EQEA 4DE4A 2BDFA 5BYYA 3Q4CA 4AN2A 5IF1A 2BPMA 3OT3A 4BDAA 5BUJA 3R22A 3ET7A 4RC3A 2CKPA 4EK6A 2WFYA 4I0TA 3PPZA 5K9IA 3M11A 4I6FA 2J50A 4QMTA 3PLAE 4BICA 4I6LA 3F5UA 3HLLA 5AFVA 1SMHA 1WBSA 3FLZA 4A4OA 1E1XA 2G15A 2WMVA 1Q3DA 3CBLA 4TNDA 3EYHA 3IG7A 4ZJIA 4FKTA 4E6AA 1PXMA 2VO3A 4IANA 5BVFA 3A60A 4JMQA 3ZSHA 5J87A 4F70A 4NEUA 4MXOA 1H07A 1OL5A 3UQCA 3ITZA 5AR4A 5CEOA 4KRCA 1NA7A 4EOKA 5CSHA 4DG0E 4D5HA 4USDA 4Y8DA 5DNRA 4CT2A 2F4JA 5KMOA 3BU5A 3Q4TA 5HLWA 5EI8A 1UU8A 1AQ1A 3CEKA 3LMGA 2X9FA 5CU6A 5ANIA 4LV5A 4OGRA 3ZCLA 1ZMWA 5D11A 3FMJA 4C62A 4E3CA 4ZY6A 2VTTA 2WMRA 3RK7A 4AT5A 3EQCA 4AN3A 4ZMFA 4ZSLA 3QZGA 1G3NA 2CGXA 1KOBA 2YCQA 2PVKA 3Q3BA 2GPHA 3ZO2A 4XP3A 3U4WA 4RQVA 4KNBA 3DA6A 3SA0A 3LMHA 3K2LA 2WMSA 5EW9A 3V3VA 4RWIA 5FM3A 5ACKA 4EOSA 5B0XA 3BYVA 5AR8A 1IAJA 3ZZEA 3U9CA 4B99A 3F6XA 4C2VA 2OXDA 2X0QA 3R01A 4ZMEA 2PY3A 3VBVA 3VIDA 3DFCB 4LRKA 2X81A 1PMVA 3RPRA 4ZTMA 4CKRA 2O2UA 2QO7A 2OZOA 4O96A 4PWNA 3R28A 5LVNA 1FPUA 3DKOA 3LM5A 3UO5A 4Y72A 1R39A 5CSWA 1A48A 4M69B 2XUUA 4KIKB 5D12A 5LVLA 5AM7A 5C26A 5K5XA 3GQIA 2VWYA 4ZLYA 4AT3A 4AX8A 2GQGA 5KZ0A 4GIHA 1M7QA 4UN0C 3QQLA 4O0WA 5K3YA 2J7TA 3TTJA 4X3FB 3OROA 4YBJA 4AQCA 1XMMA 3ODZX 4BCMA 4CKIA 3PXZA 3GCVA 2W9FB 3CQWA 4GMYA 3BEGA 4LG4A 3DU8A 3F66A 2W1GA 2I0YA 3OS3A 4EOOA 3OXZA 4BR3A 4CZUA 2GU8A 4CT1A 2CNQA 4QMLA 4LUDA 4XNEA 1WMKA 4AU8A 3ZFMA 4F6UA 2UZOA 2HZIA 1XJDA 4R3CA 3QHRA 2QOOA 1YWVA 4RX5A 2BAQA 2VU3A 2FSLX 5JGAA 5CZHA 3C4CA 4GK3A 2QODA 3MPAA 1UKHA 2C6LA 4B0GA 3PPJA 4O38A 3EQIA 3SXSA 4EL9A 3MN3A 2FH9A 2BRBA 2XRUA 2W1DA 3AC2A 1DAWA 2GS2A 4D28A 4DFYA 5FUTA 3N9XA 4BDKA 5HI2A 3DFAA 3HDMA 4GV1A 3QRTA 3QTZA 2GMXA 3KGAA 4DHJA 3AKJA 4RPVA 2QOQA 3NW7A 4YZ9A 5E1EA 5H8GA 4WBBB 4R7HA 3R2BA 4FSRA 4IDTA 1IRKA 1DAYA 3EQFA 4RJ4A 4EBWA 4RIXA 1IG1A 1RDQE 3G90X 4BIEA 3G5DA 5JEBA 4XG3A 3G2FA 4C4HA 5HO7A 2ITVA 5BVKA 3A2CA 3DXNA 4NFNA 4QP6A 2FB8A 4L44A 4X7QA 2VX0A 1Y8GA 2QKRA 3ORLA 4FIHA 4GK2A 4NJ3A 3RM6A 2PUIA 1ZMVA 1PXPA 2PMIA 1A06A 1GZNA 2PVHA 1ZLTA 2RL5A 3Q53A 5KMLA 5AJQA 3UDZA 1MQBA 1T46A 2QOBA 4BJJA 4JRVA 3HMOA 3F3VA 4JX7A 4W8DA 4CV9A 5LCJA 4FV1A 3CD8A 2XIYA 3R1QA 4L00A 1P5EA 3CLYA 4MYGA 2J0KA 3DB8A 5ANGA 3GC8A 4OTRA 2R3MA 3DK7A 3F7ZA 2ZM1A 3FBVA 1H00A 3AG9A 3IO7A 2CDZA 3DAJA 5E9EA 3DKCA 4C38A 1XKKA 4J96A 3PUFC 3OUNB 5JGDA 4M0ZA 4CVAA 3UOLA 2W05A 5I4NA 4P90A 2XJ0A 1OBDA 5IQFA 4PPCA 3A4PA 2JAVA 4IM2A 5JH6A 4FSYA 2YCSA 2AQXA 3C0HA 5E8TA 3QF9A 5ETCA 4QPMA 4YLKA 4W4XA 5J7HA 3V6SA 2BVAA 3UTOA 4WG3A 4EKKA 2GFCA 4XCUA 4YC8A 3ZUTA 3A7IA 4CLJA 3LMIA 1Y8YA 4DEBA 1BI8A 4F99A 4Z7GA 3KU2A 2WKMA 4IX6A 3QTXA 1SYKA 3ZMMA 2RFEA 2WB8A 5E8UA 2AC5A 4NW5A 5CANA 4FTJA 4L3PA 5L4QA 2UW6A 5CAPA 4JG6A 3MJ1A 3PG3A 4H36A 3FZPA 5CYIA 4ASEA 1R3CA 3HUBA 3R9OA 4MD8E 5CNNA 2X2MA 2IVSA 3LZBA 4EOJA 3UZPA 2VN9A 3EQBA 4MD7E 3ORMA 4F08A 3H0YA 3BLHA 2P2HA 3VHEA 5K5NA 3DLSA