5GHVA

Crystal structure of an inhibitor-bound syk
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
273
structure length
265
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Crystal structures of spleen tyrosine kinase in complex with novel inhibitors: structural insights for design of anticancer drugs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 79
structure length 265
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ghvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ghvA01
2PHKA 3W2RA 4MWHA 2FA2A 2F2UA 3HKOA 2GDOA 4HYUA 5EFQA 3CXWA 2JLDA 1H28A 5CQUA 5EDRA 4L45A 2CKEA 4BDCA 3CQWA 3LZBA 1DI8A 4K18A 4F65A 1F5QA 5CX9A 3R30A 3ZBXA 4DEHA 4BCJA 4FUYA 3EIDA 3HMNA 3QFVA 3BHHA 4DEEA 5DR2A 5E8ZA 2CHLA 2CNQA 4ALVA 4BF2A 2GS6A 4IAZA 2O65A 1TKIA 1PY5A 4I22A 1RQQA 1KE7A 2ONLC 3NW7A 4DFYA 3LM0A 4Z16A 4FV0A 2RFDA 3R7GA 4YR8A 1STCE 3OWKA 1WVYA 2ITOA 2BRMA 4BCKA 1FMKA 2XKFA 3SX9A 4BCPA 2OFUA 4C3RA 5CVFA 2P2HA 2VO0A 3IOPA 4AGDA 5BMSA 5AP5A 5DHJA 4I24A 4NZWB 2DYLA 5HOAA 5BYZA 1AQ1A 4E8AA 3QQHA 4DC2A 2CGVA 4GYIA 4R3RA 2VWBA 2BKZA 3B2TA 3BLHA 5C9CA 4MVFA 2PUNA 1OMWA 4HYHA 3ZO3A 3AG9A 3HGKA 1V1KA 3QZHA 3I5NA 1PHKA 4NT4A 1PXIA 4TY1A 4O6EA 2ZJWA 3C4EA 5D7AA 4DH5A 4CV8A 3Q5IA 4Y5QA 5CI7A 2PVYA 3FI8A 3PA3A 3TKHA 4UXLA 3C5UA 4IX6A 2YZAA 4QNAA 3R7YA 5EKNA 3FHRA 4N0SA 5FTOA 3W16A 4ZMFA 2YERA 5I3RA 2BDJA 2VTIA 3VS6A 3QRTA 5C27A 3DFCB 2RGPA 1GOLA 1Y91A 2IWIA 1ZXEA 4CFMA 4F99A 4R6VA 3UP7A 3OZ6A 1XJDA 5FDPA 2OIBA 2WTKC 2YABA 4DTBA 4DF3A 4XJ0A 4EL9A 4LRMA 2XIZA 4LOQA 4CSVA 3OOGA 4ZK5A 3BV3A 3NNWA 5E8XA 1KE6A 4YC8A 3EWHA 5EI2A 2ZDTA 5M56A 3K3IA 5ETIA 2I0HA 2J2IB 3M42A 4JRVA 3KXHA 4Z55A 5M07A 1GZNA 4GRBA 4JBPA 3B8RA 5DR6A 2QOBA 3N4UA 4TWCA 3UC3A 2GFCA 1Y57A 4USEA 3OMVA 4YO6A 5AV2A 3BWFA 3WF9A 3PYYA 3QWKA 4EC9A 4QMPA 4IB0A 4FNXA 4IX4A 2UUEA 2HCKA 3GU4A 5EM8A 4RMZA 4FSZA 1E9HA 3BLQA 3DV3A 3DBEA 3V6SA 4HVGA 2YCSA 3PA4A 1GNGA 2OXYA 2YAKA 1KV2A 4AX8A 4M66A 4ZLYA 2VAGA 2B55A 2XS0A 5CZHA 4LUEA 4UEUA 3MJ2A 4B99A 4BZNA 3QF9A 1KWPA 3UZTA 5K0KA 3E8NA 5HO6A 2HIWA 4YNOA 5KO1A 5ANKA 1CKJA 4FTJA 5CEOA 3E87A 4YZ9A 5EW9A 4FVRA 5LCJA 2I0YA 2W4OA 3R63A 4RC2A 2BRGA 4EQMA 3KF7A 3VS5A 3GFEA 4U44A 5CAUA 3C1XA 3GC7A 2VO6A 3ZDIA 3HP2A 4FICA 1JKKA 5EDQA 3T9TA 4L43A 2G15A 4L53A 2R3PA 2BTSA 2YLFA 5D1JA 3SOCA 3WIGA 4AT5A 4NM0A 3LFSA 1JAMA 3PE1A 4QP9A 4O7WA 4FTQA 5BVNA 2JKOA 3HV5A 5C26A 4AZEA 4CTBA 2J4ZA 4WBOA 3FC2A 4RJ3A 4IW0A 4NIFA 4O91A 4QTBA 2C4GA 4AU8A 3V5TA 3BIZA 4D28A 5KKRC 5JK3A 5IA3A 2V7AA 2RG5A 4FI1A 2WU7A 3PLSA 5JFVA 2RF9A 3TEIA 4C62A 4IQ6A 1ZY5A 3U55A 3COHA 5C4KA 2HXLA 3TJDA 1JSTA 4W4YA 2PUUA 3MIAA 2AC3A 3VHEA 1YOLA 3DJ7A 4FIJA 3E7VA 3RPOA 2X7GA 4R5YA 4TT7A 5HLNA 4OBQA 5C4LA 3QCYA 3SOAA 3N4VA 2EU9A 5DT3A 1WFCA 5H2UA 4CKIA 3M1SA 3FLSA 3P86A 3U87A 3G9NA 2QO2A 1YOMA 4ONAA 2Q83A 3LXNA 1UNGA 2UW7A 4NK9A 4HOKA 3R8LA 3WOWA 4BGHA 4CFNA 3FDNA 4AZVA 3ZS5A 3IKAA 3LW0A 3MY0A 3COIA 2UZVA 2R3MA 4ZTRA 1ZYDA 5KUPA 1VEBA 4FTAA 2Z7RA 4B8LA 3FI4A 2XIXA 1URWA 5BUIA 3NLBA 1XH5A 4N6YA 3BEAA 1BUHA 2E9VA 5ITAA 1NVSA 4C7TA 3OD6X 1ZYCA 4PRJA 4YLJA 5KBRA 4WG5A 4FBXA 4DH1A 2Y6MA 3V51A 2VTHA 1CKPA 3MTLA 1Q8UA 3A7IA 2J9MA 4R7BA 2WQBA 1YQJA 3QC4A 4FIGA 2KULA 4IH8A 1KSWA 4YC6A 3FUPA 4WRGA 3EZVA 4FKOA 5L2SA 2VX3A 1ZY4A 3QALE 3VS7A 4GW8A 4IJPA 4R77A 4FE2A 1OI9A 4BKYA 2CKOA 4IMYA 5D7VA 3I81A 1H07A 4LGDA 3E5AA 1P14A 4GU9A 4FYNA 4D0WA 5GHVA 4F4PA 2GNFA 2CLXA 2WB8A 1YDRE 2W9FB 2YDJA 2ZM1A 2UZDA 4FT9A 4F7JA 1JKSA 2R0IA 4JIAA 4PPCA 3DY7A 4E93A 3I7BA 3UIXA 3EN9A 2C69A 4Y72A 5IEXA 4M68A 5HG5A 3G2FA 3GGFA 5AAFA 4AZFA 1LP4A 3UE4A 5LMBA 4FC0A 5HBJA 5A14A 4XBUA 2WEVA 5HTIA 3QD4A 1BI8A 3R83A 1OPJA 4J96A 4BDGA 5AR5A 5AP2A 4GFOA 4BWKA 2Y4IB 4E6DA 4DTKA 4M3QA 2XIYA 2O0UA 3ZLWA 3D2KA 4DGOA 2YDIA 3PPZA 5I9WA 3GC9A 4FMQA 3F5XA 5HCYA 4IADA 2ITVA 3UZRA 2EXCX 4ZTHA 3A99A 3BU5A 4DLJA 2YHVA 4UX9A 4I92A 4EWQA 2PTKA 1PXMA 3ERKA 4I6QA 1SM2A 4QMLA 3KC3A 4TYHA 2GS2A 4X2NA 2W06A 3R22A 4O96A 5DA3A 1OL1A 4X6RA 3CKXA 1O6YA 2E9UA 2R5TA 3NW6A 5IA2A 5AUXA 1WMKA 2QLQA 3K5UA 4XG6A 4CD0A 5LVOA 2GHLA 3PXQA 5FP5A 2R0UA 2ZMCA 3A62A 4EC8A 3N4TA 1Y8YA 1ZYSA 3C4CA 3CPCA 3R9DA 4GVAA 1PKDA 1QPDA 3LOKA 4FV7A 5H9BA 4HCVA 4O1OA 5BX0A 2PMOX 2ITXA 4CMUA 4APCA 2WOTA 2OZOA 4RIWB 4I41A 4YJSA 1OPKA 1K9AA 2X2LA 2YLEA 4LMUA 4S31A 5FXSA 4FNYA 4A4LA 4RIXB 4CVAA 3F3VA 3LFQA 3VW8A 4ANQA 1IASA 4KSQA 3QLGA 3VRZA 4FTTA 4V0GA 3VUIA 4EWHA 1W0XC 1Y8GA 3F3UA 4YZNA 3R7VA 4JS8A 4PL4A 2FH9A 3NX8A 4U7ZA 3DBCA 3PJ1A 3WF5A 3W2OA 3HV3A 4V01A 2C1BA 5JRSA 3PVWA 5AUTA 4FG7A 2J0MB 3QD2B 3RCDA 3FPQA 2RSVA 2PY3A 4D1XA 3OCTA 4YBJA 4L01A 2ITQA 3KULA 3OEFX 2OF2A 2XK6A 3P08A 4XP0A 3UVPA 4FV8A 4MNEB 3CCNA 4QMXA 3MFTA 4HZRA 1W7HA 1UA2A 4AA0A 3UGCA 3IDBA 2R3LA 3HNGA 4GS6A 4QRCA 5HO7A 2OSCA 4BHNA 5JT2A 3W2PA 4ANLA 3ULIA 4JBVA 4TZRA 3G15A 2WAJA 4BCOA 5CEMA 3IGOA 3VWAA 4CRLA 3TUCA 3MB7A 2UW3A 2OG8A 2ZB1A 3QQFA 3QTUA 3UVQA 3DKGA 3W33A 3UPZA 4D5KA 3QTXA 2VTSA 5EI8A 3R2YA 3VF8A 4P5QA 4M7IA 5AJQA 5AV3A 4E6QA 2J0KA 3T8OA 2VTQA 2VTMA 5CNOA 3UO6A 1FOTA 1CMKE 4FODA 4BKJA 1OBDA 1U54B 4MD9E 4O86A 2FGIA 1Q41A 4F64A 5E4HA 1FQ1B 3BELA 4S2ZA 5CVHA 4E26A 1WBNA 3D83A 3PJ2A 3QXPA 4LQMA 3U4UA 3TDWA 3WZJA 1G8AA 4I5MA 5LWNA 2FVDA 3CY3A 4YJRA 3HRBA 3MVMA 4EHVA 1NY3A 1PYEA 2BZHB 3H4JA 4JDKA 2XNEA 4WT6A 3VIDA 1YXTA 5DVRA 5HKMA 2VX1A 2BUJA 2XK9A 3R7UA 1PMEA 1XH6A 4UBAA 1WBTA 2CSNA 2VZ6A 2IO6A 5DH3A 1R1WA 5ETAA 1Q8TA 4FOCA 3U54A 4BZOA 4X2JA 4M67A 4KRDA 4OGRA 4FKJA 4IC8A 4PF4A 5IF1A 4L68A 4EHEA 1XHAA 4KBAA 5C8NA 4ZS4A 4ZEGA 1FVVA 3R8PA 1A06A 1ZYLA 1GJOA 4XUFA 4R8QA 4YZBA 3BWJA 1KOAA 2P4IA 2R9SA 4FSYA 4IANA 5KMLA 3PY0A 2VWWA 3FZSA 3Q3BA 4O7YA 1OIUA 1OL2A 2WMQA 3EFJA 4IEBA 1KV1A 4MQ2A 4RT7A 3PWYA 4FTNA 3S4QA 3VBWA 3DXPA 5T3QA 3BYSA 4X2FA 5FXQA 3LCTA 2IW8A 2Y0AA 4YTIA 5BVFA 3IPHA 3CR0A 4OLIA 3EN5A 4EHZA 1YI3A 3A61A 4G3EA 1WBOA 3DDPA 5CF5A 3UJGA 5DMZA 5JSMA 4USDA 4GT4A 4FT7A 4J8MA 3VS2A 5L6WL 3OW4A 4RJ4A 4JR7A 4LYNA 4F0IA 4FNZA 4RG0A 2UW6A 4TYEA 4DTAA 1IA8A 3H30A 2XKDA 5TF9A 4A9SA 4O0RA 4CT1A 2QOFA 4QTDA 4OBPA 3ZC6A 1UU7A 4EKKA 2W17A 4W8DA 2VO7A 1ZARA 3UDBA 5F95A 4F08A 4BYJA 5HD4A 3FKLA 4BCIA 3LFBA 1XH8A 4J99A 2XRUA 3EQGA 2W1HA 4A9RA 4GUEA 5HORA 4A9TA 3NVKI 5M55A 2W1CA 4J98A 5I3OA 2ITZA 3KK9A 3T3UA 5HX6A 1UWJA 4ITHA 3OEZA 5B2KA 1KE9A 2X7FA 5HIBA 4R7HA 4MYGA 3C0IA 3NYOA 3DK7A 2I7QA 3EH9A 3AD5A 3GI3A 2H9VA 4YPDA 1E1VA 2J5FA 3HRFA 3ACKA 4XRJA 3ZH8A 4PL3A 4OAUC 3BCEA 5EM7A 4OUCA 3JR1A 3MESA 2R3HA 3ZZEA 2PUIA 2W1DA 2YCQA 2VWZA 4OT6A 5CU3A 4F7NA 5EYKA 1XWSA 3DLZA 4HYSA 3DJ6A 3C0HA 4FUXA 3R2BA 4QYFA 1JNKA 4DG2E 1ZMUA 4MK0A 1WVXA 1IA9A 3Q32A 4LV8A 5KBQA 3GC8A 4C4IA 3L8SA 4BDDA 4AOTA 2CNUA 4PY1A 3QA0A 2FO0A 3TL8A 2XUUA 4HW7A 3R73A 4D1ZA 5HG9A 5CWZA 1YDTE 3E8DA 2HZ4A 4GT5A 3WIKA 3F7ZA 3K54A 4UYAA 3AXWA 5EYMA 4L42A 4UWCA 3TG1A 4BBFA 1NW1A 5CNNA 4C2VA 1PXNA 1UKHA 5J7HA 3EKNA 3E63A 3LXKA 3B2WA 2HXQA 2Y4PA 4DG0E 3H9RA 4WNPA 3NNVA 4XP3A 3ANRA 3SC1A 3E92A 3EFLA 1QMZA 5CS6A 2WMTA 3MFRA 4KABA 1FVTA 3KMUA 4II5A 1WBVA 3OT3A 5F4NA 2G2IA 4FEXA 2ITYA 4Y73A 1PF8A 4V05A 3MW1A 2OJFE 3QQJA 4G1WA 3V5QA 4RX5A 5BPYA 4OAVB 5AWMA 2GNJA 3O51A 4I93A 3UQCA 3P9JA 2C5VA 4MD7E 5EK7A 3P79A 4ENYA 3QX2A 3RK7A 3IO7A 3QCQA 3AC2A 2F7EE 4KIOA 3SRVB 4M15A 5BVDA 2QVSE 2XNNA 4XHKB 4ACMA 2YM6A 2ZV7A 4KWPA 4C3PA 3QCXA 5JFWA 3D5UA 2CKPA 3PJ3A 4IB3A 4E73A 2JIUA 1Q99A 5A4CA 4WIHA 4C36A 5G6VA 4EONA 5M4CA 3DBFA 4DE4A 1YI4A 4CT2A 4ZIMA 3QTSA 2NNWB 3F7WA 3PXZA 3QGWA 4U41A 4B9DA 3KRWA 3TWJA 4X0MA 3GVUA 4DINA 2R3OA 4KS8A 5HNIX 5IEVA 2X0GA 4WA9A 3FYJX 4OTDA 4F09A 5BUEA 2R3FA 1O6LA 2C6MA 3P7CA 4FTKA 5KNJA 3PG1A 3MA6A 3ATSA 1GZKA 3CD8A 4V04A 4MF0A 5AUZA 3RZFA 3TUBA 4BDKA 3W2QA 5EQYA 3F2NA 2PSQA 2YAAA 4RA5A 3PY3A 3Q5ZA 5KHWA 3AMBA 3CY2A 3UO5A 3LCSA 5LJJA 1ZOGA 4L3LA 3CS9A 3EN4A 5FXRA 4CV9A 3OVVA 4DN5A 5E90A 4AN2A 4X3FC 3L1SA 2J0IA 4H1MA 4LV5A 4WBBB 3C13A 5E8VA 3MWUA 3TV7A 4CGAA 4NM3A 3EQIA 4TTHB 4AWIA 4DGGA 4EK5A 5JGAA 4C61A 3VBQA 3JS2A 4QOXA 1APME 4QPMA 5AX3A 2C6KA 1VZOA 2X39A 4TKSA 3CIKA 4FZFB 4RLKA 4UYNA 5M4FA 4CMOA 4CZYB 2HW6A 2YEXA 2J50A 3LJ1A 4JG8A 3ATTA 4DBXA 4PP9A 4YZCA 3D2IA 3QHRA 4UMPA 3QKMA 4QPSA 3M11A 3CEKA 4NFNA 4PL5A 3FXXA 1FGIA 3F2RA 1IAJA 4AQCA 3V3VA 2F9GA 4QMZA 3PRFA 4IAKA 3G9LX 1Q5KA 5GZ9A 2OICA 3L8VA 3DZQA 2IVSA 4C0TA 4PPBA 1MRUA 4ZJIA 5EHLA 1W84A 2VWIA 5EKOA 4D5HA 5JFXA 3PTGA 5EOLA 2C6TA 4Y46A 5HNBA 2KTYA 5ACBC 4CFUA 3H0YA 4AGCA 4HVDA 4KIKB 2I0VA 3DQXA 3AC1A 4D4YA 2EB3A 4IAYA 5LQFA 5J7BA 2VTRA 3NGAA 3Q4TA 1CTPE 1Q61A 1G3NA 2WGJA 4JDHA 4CEGA 5IQEA 3FZRA 4DEAA 3HMOA 4C57A 4DFLA 3FZPA 3S0OA 2HW7A 3MH3A 1W98A 2JDTA 4IAFA 3QTZA 3BYMA 4AUAA 4XRLA 4BDFA 5AUUA 5DI1A 3UBDA 5J5TA 5F1ZA 3F9NA 3PZHA 3D5VA 1BLXA 4HYIA 2IG7A 4G3CA 2R3JA 5HEZA 4FX3A 2QO7A 4QT1A 1OPLA 2YM7A 4NJDA 4X3FB 4JX7A 4YHJA 4OW8A 4BTMA 4C3FA 2F7XE 4EOJA 2VNYA 3FC1X 1B39A 2HZIA 3C4ZA 1TVOA 3GU8A 2OIQA 1J91A 3OXZA 4R5SA 4BCNA 4F9BA 1XBCA 3IONA 4QP7A 1OL6A 4E4LA 4UB7A 4YJNA 4IVDA 3N51A 2C6IA 2W9ZB 1OECA 4C8BA 4CKJA 4FTLA 2ETMA 4AP7A 5IEYA 5HBHA 4A9UA 4MX9A 2OKRA 2VWXA 4RLLA 4F1OA 4NM7A 2ZM4A 1H0VA 4HGTA 5DOSA 2J5EA 2QD9A 4O81A 3OF0A 3UO4A 4GEOA 3VW6A 2FSTX 4I5HA 4FT5A 3S00A 2EXEA 4CNHA 3RM6A 3RVGA 3LQ8A 2XF0A 4FIEA 4HJOA 4BTKA 4G5JA 4D4RA 2ZV2A 3VUMA 2G2HA 3BV2A 5M53A 2DUVA 4W9XA 3G0FA 3NAXA 4FEVA 3A7JA 2WZJA 4EH6A 3DGKA 3R0TA 2NP8A 4ASXA 2UZLA 4LL5A 3Q53A 3W18A 4GV1A 3FI2A 3V5LA 4F7SA 4IZAA 4YPSA 4ENXA 2JBOA 5K5NA 3ZEPA 5IH5A 1JOWB 5AIKA 4EJ7A 1WVWA 3CLYA 3MFSA 3BQCA 1KOBA 4QYYA 4APPA 3ZZWA 4FK3A 1G8SA 4FVPA 2VD5A 3Q2JA 3COMA 2VN9A 2BZIB 2LGCA 3DQWA 3P5KA 4X6QC 4BDBA 5HIEA 4BDHA 4LL0A 5LXMA 2PVFA 2FUMA 4S34A 1ERKA 2YWVA 5J95A 2OWBA 5AADA 4CFFA 2A19B 3BHUA 2Z7SA 2C3KA 4XG7A 2WIPA 1YWVA 3WZEA 3KREA 3FKNA 2EXMA 3ZLYA 5F9EA 3JXWA 4CTCA 3I6WA 3UQGA 2A27A 2CN8A 2PVJA 5CXHA 5J87A 3C51A 4L44A 4KKGA 1PYXA 2YISA 3R01A 5B0XA 2WQNA 2W1ZA 2JBPA 4IIRA 4DEIA 3KQ7A 4BDIA 3LFAA 5CSXA 5AP4A 3H10A 3FQSA 3R6XA 4IWQA 4XEYA 2GS7A 1SNUA 3KN6A 4O2ZA 1UU8A 2IPXA 4YZMA 4FSRA 1W8CA 2X9EA 5IA4A 3EMGA 4R3PA 4JR3A 4FA2A 5ACKA 4EQUA 4XBRA 3TNHA 2P0CA 2XIRA 2C3JA 3O96A 1JVPP 5JKGA 2ITWA 2WHBA 4ASDA 2C1AA 3DXQA 2R3KA 2WMWA 2OO8X 3W55A 1DI9A 1PXKA 3QC9A 5HU3A 1E1XA 4HVHA 3KY2A 1QL6A 4FTOA 4Q9SA 3RAHA 1ZWSA 2WD1A 4IWDA 4XNEA 4P7EA 3BYOA 2WQMA 5E8WA 3QA8A 5AV0A 3RHKA 4CQGA 2V22A 5JEBA 2BFYA 3R1QA 4MXOA 4M69B 5HG7A 4EORA 4RVTA 4RWKA 4NYEA 3TZMA 3LJ2A 4J1RA 1SVEA 4IHPA 2RG6A 3TIZA 1H0WA 4D9UA 5IISA 4F0FA 1REKA 4FV2A 3SXFA 1V0PA 3ORIA 4GK3A 4O21A 4F63A 3LVPA 4N70A 4OTGA 5AUVA 3WE8A 4PNKA 5DT0A 5C1QB 3TJCA 2QC6A 3R00A 3RK5A 4ASZA 1QPCA 4LMNA 4RA4A 1L8TA 4DHFA 2WO6A 2OJ9A 5K4IA 3GCSA 3G33A 3RWPA 4GIHA 4UMUA 4I0TA 4A7CA 3TUDA 1XH9A 3V5JA 4DH7A 1ZRZA 3QRJA 4HCUA 5AR3A 5IQBA 1L3RE 1IEPA 3L9PA 5DLSA 5CENA 3WE4A 4I21A 2VTNA 2XEYA 5F94A 1LPUA 5HCZA 2PPQA 4H05A 4AAAA 5JN2A 4G6LA 2VX0A 3CGFA 5CYIA 1S9JA 4ZY5A 3KB7A 1UWHA 4H36A 3U9CA 5AUWA 5E92A 3HZTA 3D94A 4O22A 3MI9A 5L8KA 3VQHA 4E1ZA 2F4JA 3NW5A 5M57A 2H6DA 4QQCA 3E7OA 4AT3A 3TNQB 2YM4A 1XH7A 3MV5A 1YXUA 1PMNA 2IZTA 1LEZA 1CDKA 3AC4A 2P3GX 1JBPE 1M2PA 2BAQA 4QMOA 4ALUA 3UVRA 4ZTMA 3E3PA 2BAJA 2XKCA 2O5KA 4DEGA 5LVPA 2R3NA 3DAKA 2BZJA 3FZTA 1GZ8A 4XS2A 2QR8A 3I0QA 3FY0A 3E64A 1JKTA 2IW9A 5HE0A 3KRRA 5KZ0A 4D2WA 3DB6A 3RCJA 1GIIA 2B54A 2CLQA 4IB5A 3RWQA 4KUJA 3ZO4A 3F3ZA 4BGQA 5CU0A 3ZO1A 3RAWA 4BVUA 4AS0A 2WTKB 3FY2A 1YHVA 5FP6A 1O6KA 1ZOEA 4NW5A 3OXIA 4ZS0A 3D7ZA 4Y8DA 1JPAA 1RE8A 4CFXA 5JZNA 3S95A 5BYLA 5CY3A 2R3IA 2ZAZA 3ZONA 2JDSA 1ND4A 1Q3DA 4PX6A 5E9EA 1WBSA 5EG3A 1UNHA 4MEDA 1GY3A 3ZBFA 3T9IA 4LFIA 3E93A 4CYJA 1FMOE 4EK4A 2BMCA 3EQRA 3QZGA 3GQIA 2ETKA 2XYUA 3F61A 3F88A 2ITNA 3HVCA 3FSKA 3KVXA 4NW6A 3C50A 3ORZA 4D9TA 2C6OA 3EQBA 1UU3A 3IW5A 5I9VA 2QI8A 2WIHA 3NYVA 4YGAA 4JAJA 4O7VA 2VTTA 4QNYA 3FHIA 4NSTA 4B0GA 3PVGA 4RGJA 4EOIA 1H26A 4KIPA 3ZFMA 4C35A 1TQIA 3VBYA 3ORXA 4UZDA 1WZYA 2XBAA 2VO3A 4QD6A 4YJOA 3HECA 3SXRA 3EFWA 4JQ8A 2F7ZE 3CGOA 3VBVA 4JBOA 4ID7A 4BDEA 3DNEA 4RRVA 4BCGA 4E5AX 3C5IA 4DT8A 3DCVA 3UIBA 5HVJA 4RJ8A 5DN3A 3GB2A 4XV2A 5CASA 1TQMA 1H27A 3UODA 4G3GA 3FQEA 3PRIA 3GU6A 3ULZA 4USFA 5C01A 3VNTA 4RX8A 4RIOA 3ZCLA 5KMJA 4C4HA 1BKXA 3RNYA 4HZSA 5L2IA 3NSZA 2W99B 3BEGA 3OXTA 3OWLA 3H3CA 1KUTA 5KZIA 3KF4A 5I9YA 3PP0A 5AAGA 3EHAA 2VWVA 3AT2A 1YHWA 3ZMMA 3UQFA 3C4WA 3JVSA 4L7FA 3RZBA 3KMWA 3JVRA 4WNOA 4JL9A 5KKRB 3SVVA 5HVYA 5IUHA 5H8EA 1Q4LA 3RP9A 4EH5A 3LQ3A 4RVLA 2JKQA 3OUNB 3W8QA 4P5ZA 4W4WA 4ACHA 4DGLC 3Q60A 4FTRA 3G5DA 4O0WA 2C6DA 5DPVA 4U79A 2F2CB 3D7TA 4CG9A 4GKIA 3DZOA 5HI2A 3PJCA 5AEPA 5DIAA 2W1EA 3O8TA 4K77A 2XNPA 4I4FA 4U97A 1OKZA 4PP7A 4ZJVA 4NCTA 3UOLA 2C5XA 3U9NA 3FI3A 4AOIA 1F3MC 4QO9A 2BILB 3UNJA 4EOQA 5HCXA 3ZO2A 1REJA 5IQFA 3R71A 4IVCA 4RQVA 5CAOA 2HY0A 3ORTA 4FEWA 3RJCA 1RDQE 4P90A 2WU6A 2OBJA 2CGXA 2OH4A 3LFCA 4L9IA 3UMXA 2QO9A 4PNIA 4ZTNA 3NRMA 1ZYJA 2CMWA 3D15A 2YACA 2WMRA 3RHXA 4F9YA 3PG3A 3OW3A 3QTIA 2YIXA 2OGVA 4OTHA 2XRWA 3NUYA 4P4CA 1HCLA 4FKSA 1QPJA 2RKUA 5DRDA 2BRHA 4BHZA 3D9VA 4XV3A 5E1SA 2CN5A 2XNBA 3NIZA 3Q04A 3UP2A 2PVHA 1NVQA 4EZ5A 3JY9A 5LCKA 3BU3A 3QWJA 2ITTA 2RFNA 4L46A 5EW3A 2VTAA 3OBGA 2X8EA 2DQ7X 3P1AA 4BI0A 3GT8A 2P55A 3DNDA 2O64A 4CLIA 1U59A 4G6OA 3LKMA 4PUZA 2B9HA 3BRBA 4AACA 4Y83A 3RGFA 3CP9A 4ZSLA 5FEDA 5IUGA 3VUKA 4C4GA 3ANQA 4FL1A 3DKCA 4DYMA 4EOMA 5EDPA 2XJ2A 5CSPA 4I0RA 3F5GA 3G90X 1FBNA 2PZPA 3EOCA 2G9XA 4FZAB 1R0PA 3TNWA 4I20A 1DS5A 4AN9A 3EN7A 4YJTA 4RJ5A 5ANIA 2X4ZA 3I60A 1T46A 4BIBA 3R02A 3GCUA 4FTMA 4U6RA 2Z02A 3TV6A 4BDJA 5GINE 4LUDA 5J8IA 5IQDA 3PXKA 1Q97A 2BR1A 3Q4ZA 3LCOA 4WSQA 4WUAA 4PMTA 3DXNA 3S1HA 3HA6A 5BVKA 5M09A 4QP4A 4JI9A 5DE2A 4YSMA 4LGHA 2W1IA 5I9UA 3EYGA 2CKQA 3VS0A 4EYMA 5HZNA 4LI5A 4O0YA 3E62A 3B8QA 1SVHA 2UZOA 2WFYA 3F5UA 3FYKX 3MSSA 4QMVA 2VTLA 2VRXA 3QXOA 4M14A 3V6RA 4D55A 4OTIA 4ITIA 5ANGA 5FGKA 4Q9ZA 4MXCA 5KMIA 4YLLA 5ANEA 3GCQA 5I9ZA 2PVRA 4EOSA 3RTPA 4TN6A 3KEXA 3QUEA 2ZYBA 3A7FA 1PXPA 3AGMA 1DAYA 2QOLA 4BWXA 4E4MA 5IA5A 5LWMA 4PMSA 4JXFA 4WG3A 4JDJA 4F6SA 3FZ1A 3Q96A 4UV0A 4MNFA 4QTCA 5DR9A 4AG8A 3UPXA 2WQEA 3THBA 5EQPA 4C58A 1AD5A 4K6ZA 2UZNA 2C3IB 3AGLA 2OXDA 5BMMA 4FSWA 2FSOX 2VUWA 3HUCA 3KRXA 3OBJA 4O0SA 4RWJA 1VYZA 2CCHA 3BX5A 1AGWA 3O7LD 4HGSA 1YHSA 5CQWA 4L00A 4MWIA 4XX9A 5AV1A 5BVEA 4BI1A 1Z57A 2OF4A 4J95A 4JT3A 1OL5A 5AP0A 3FPMA 2UZTA 2JAVA 3HLLA 4IBMA 4JOAA 4RIYA 4IFCA 3O23A 1K2PA 4RC3A 1CM8A 4EK6A 3EJ1A 4KKHA 3ZC5A 5IQCA 4N6ZA 3ZSIA 5I9XA 4BGGA 5FBNC 4KAOA 4PPAA 3BHVA 3GOKA 3TT0A 5TKDA 2R7IA 4H3QA 3RAIA 3QCSA 3UOJA 5M51A 1J7LA 3QUPA 2P33A 5IG1A 3PVUA 4A9YA 3DKOA 3HA8A 3KU2A 5DWRA 3VF9A 3REPA 3NVMB 4U3YA 2PVKA 4FKUA 2JGZA 4C34A 4OTPA 5H8GA 3OCGA 2UV2A 2GCDA 4ITJA 4EH4A 2XB7A 2UVYA 4W4VA 1H1WA 4E4NA 3DBDA 5L3AA 2R3RA 5CF8A 3SG8A 2RIOA 2UZEA 3NPCA 3C7QA 4MXAA 2X9FA 3VRYA 3NUPA 3GENA 2HZ0A 2HWPA 2BDFA 2BFXA 5ETCA 4OTWA 1U5QA 4PDPA 4QMNA 4RFMA 4DA5A 2WPAA 4N57A 1PW2A 5L2QA 4AFEA 4YUQA 2UZBA 1OKYA 2PUPA 4JBQA 5GJGA 1JSVA 4UMRA 2GQSA 4G17A 3TXOA 3P0MA 4NKAA 4F7LA 2RFEA 3F5PA 4FEQA 3FMMA 4U5JA 1PJKA 3LLTA 4F1TA 4IAIA 4J8NA 1M2RA 3LMIA 3ORLA 4FV3A 1P2AA 4UZHA 4A07A 2JD5A 1XBAA 5AM6A 3NUNA 4RX9A 4B4LA 5I4NA 4BTFA 2JIVA 2W1GA 3IGGA 1WBPA 3IG7A 5JRQA 1J7UA 5L6OA 4O82A 3ZM4A 2H8HA 5FRIA 4Q5EA 3TTJA 4QPAA 2OZAB 4LG4A 4I6HA 3GFWA 3R9NA 4ACGA 4C59A 5CALA 3ZSHA 4EOLA 3F6XA 3GUBA 4MF1A 5AUYA 1YVJA 4PDSA 3MY1A 4E5WA 1NXKA 4G34A 1H24A 3ZXTA 1H1QA 2OK1A 4IJ9A 3NAYA 3BBTB 4M69A 2WELA 4ZJJA 2C5NA 4BICA 2OFVA 4FT3A 3DTWA 4BY9E 4BDAA 2PE1A 3AQVA 1VJYA 3PE2A 4O6LA 2XM8A 2IJMA 4ZZNA 4EOOA 1S9IA 2P2IA 4U3ZA 4J71A 3F66A 3KRJA 5LVLA 5IA0A 4FSQA 3A2CA 1IG1A 3II5A 4J53A 3CTQA 5DGZA 3TKUA 4GK4A 5AA8A 2FB8A 1YW2A 5IQHA 3WBLA 1YI6A 2BDWA 3Q9WA 3HEGA 3QBNA 4NCTC 4S33A 2QOOA 3WYXA 3I5ZA 4BN1A 2Y8OA 3LE6A 3O50A 5CAPA 2OLCA 4A4OA 4G9CA 1SNXA 2X8IA 4IC7A 1YXSA 4XOYA 4CRSA 2XH5A 2NO3A 4O27B 3OHTA 4ERWA 5L8LA 1JKLA 2GSFA 4HNIA 4JVGA 2XZSA 4GH2A 3KGAA 2PVMA 5AMNA 4IB1A 5LARA 4FSUA 4BB4A 4A06A 3EFKA 2QNJA 3PFQA 4FKPA 4MKCA 2BALA 4H3PA 4TRLA 5J9YA 4O7ZA 5AR8A 2HZNA 4TYJA 4JIKA 1FINA 3D0EA 4KD1A 2ZDUA 4ZLZA 4GVJA 3CC6A 3EQPA 2O3PA 2OJIA 3FL5A 3V8SA 2WMSA 3IK3A 4AZTA 3BU6A 1ZLTA 2G1TA 3FE3A 3UYSA 4I5PA 3W32A 2GMXA 4G3FA 5CANA 1WAKA 4FL3A 5B2MA 4BFMA 3MPMA 3TZ7A 4TNBA 4UN0C 2VGOA 3PXYA 1DAWA 2J0JA 1URCA 2YWPA 1V0BA 3TDVA 3QRUA 4M84A 1MP8A 3O0GA 3DT1A 2X7OA 3SHEA 4AGUA 3W2CA 5BNJA 5K4JA 5LMKA 2REIA 5ICPA 5HVKA 2QU6A 1MQBA 3BYVA 4IE9A 2PMNX 3E3BX 4RWIA 5E8UA 3MBLA 4YURA 4EKLA 2YN8A 4QQ5A 1PRYA 3NZ0A 4Z3VA 3EZRA 4PMPA 3HRCA 4BCFA 3O71A 2JFMA 3VULA 2WMVA 3OCBA 4DFXE 4EYJA 3FL4A 4O7SA 3BE9A 3G51A 2OW3A 4FV5A 3VUDA 3ET7A 3KRLA 1M7NA 5CSHA 2VWUA 2IZRA 1BMKA 3NUUA 3ODYX 3OROA 1XKKA 4IWPA 2VWYA 4RJ7A 1M17A 2UW4A 4B8MA 3HX4A 3PIZA 3UIMA 5CI6A 5AV4A 1PMUA 5L6PA 3SD0A 2J90A 3DK6A 4FV4A 2JDVA 3V5PA 4TYHB 3U4WA 1KE8A 3WZUA 2ZB0A 5EQEA 4E4XA 4EH7A 1XQZA 3AD4A 5M4UA 4Z7GA 3O2MA 3U6JA 4DCAA 5AFVA 3ZYAA 3ZFXA 2PMLX 4B7TA 5CAQA 4EH2A 2QHMA 4K2RA 2C47A 2X1NA 3BQRA 2WXVA 3NIEA 4CLJA 2YIRA 4AE6A 4KB8A 4TW9A 4QMYA 2ZV9A 3EL7A 4PDOA 2PZ5A 2YITA 2FSLX 4IVAA 4Z7HA 2XMYA 2Q0NA 4KS7A 2X6DA 3SLSA 2NPQA 3EB0A 4BRXA 5A3XA 1OIRA 3VVHA 4QQTA 2PMIA 3F69A 1FVRA 2UVZA 3JPVA 2AUHA 3OUKA 4X7QA 4IXPA 3QL8A 5M08A 5A6NA 3BGPA 2ZMDA 4H39A 4G31A 4KSPA 4V0GB 3FMDA 3ZLSA 4RVMA 1U46A 5IU2A 1HCKA 2HAKA 2V62A 2OIDA 2QQ7A 2XEZA 3MYGA 3FZOA 2UZUE 3R7EA 2WTWA 3FJQE 5EYDA 1OVEA 3PLAE 2B53A 3COKA 5FTQA 3R8ZA 4FSMA 5LVNA 3QU0A 4Z9LA 3AC3A 3MH2A 3CKWA 3A8XA 3ORKA 4MXXA 5FQDC 1UU9A 1R78A 4AN3A 4XG4A 3ZRKA 4FR4A 2XJ0A 3KULB 3KXNA 1JLUE 2X81A 5L8JA 3PSDA 2XA4A 2GHGA 5GIOE 5JH6A 3H0ZA 4RFYA 4G16A 2X8DA 3AT3A 5CSWA 3GU5A 3BGQA 4KIQA 5TE0A 4YHTA 5EHYA 2O63A 3AOXA 4D0XA 5IQGA 1MQ4A 5J1WA 1OITA 2W5HA 2YIQA 2Z7QA 4PTEA 5CT0A 1VR2A 3OTUA 4C02A 5L2TA 3DB8A 3EQHA 3SGCA 5GJDA 4YMJA 2XK3A 3PZEA 2X2MA 4EK8A 3D4QA 3SV0A 2ERKA 3VO3A 1R3CA 3RAKA 5A4QA 4HVIA 2AYPA 3VQUA 3LAUA 3U8WA 4WOVA 3QZIA 3UOHA 4W8EA 2FYSA 1JQHA 3FMJA 3VHKA 1HOWA 1ZOHA 3AMAA 4XH6A 4R7IA 4AE9A 2BVAA 2QG5A 4YJQA 3SAYA 3TZ9A 4C33A 3UTOA 1A48A 4MH7A 3KXZA 3PVBA 3BBWA 5KHXA 2RFSA 4FT0A 3WYYA 2G2FA 1QPEA 3EKKA 3QRKA 4RZVA 4D4VA 1A9UA 3W2SA 4ZMEA 2OU7A 3VS1A 4AXAA 3SXSA 4O7LA 2JKMA 3IW6A 3OTVA 2UW8A 3TZ8A 3OG7A 2YIYA 4XCUA 2V0DA 2PVNA 4FNWA 2V55A 3FQHA 2EVAA 4L7SA 4WD5A 1OIQA 2V5QA 3NYXA 4YC3A 5AR4A 2WTDA 3QTRA 3R7OA 3RMFA 4RIWA 3FMKA 2XNOA 4HGEA 4WHZA 4CZUA 3ORNA 4IM3A 4IM2A 4BKZA 4RIXA 3HP5A 4WKQA 5G1XA 3O8PA 3RNIA 3VAPA 4PDYA 5DT4A 2OJJA 3MPAA 5KMOA 2BZKB 4GSBA 4I4EA 5CEQA 1JWHA 5DRBA 2VV9A 4L8MA 2QCSA 2I40A 2BAKA 2GNGA 1WCCA 5ANOA 2PU8A 2X2KA 3P78A 4EH8A 2O2UA 3I79A 1H00A 3PIXA 4MBLA 4NUSA 4IM0A 5E7RA 4YZDA 3FLNC 2GHMA 2B0QA 2R3QA 4XV1A 4F9WA 2ERZE 4ZTQA 4FTCA 3KVWA 4EBWA 3V01A 5IQAA 4RJ6A 3P7AA 5HBEA 3TCPA 4MNEA 3CJGA 4ZZOA 3VN9A 3OS3A 3TTIA 4GT3A 5A9UA 1G5SA 3F82A 4TWNA 3TN8A 2R4BA 3POOA 3LMGA 3F3TA 5TT7A 2J0LA 4FKQA 4F1MA 1P4OA 4H58A 3R21A 3O8UA 3D5XA 4UY9A 3KL8A 2Z2WA 3QQKA 3MVHA 3OT8A 5HO8A 5A54A 3QD0A 3PWDA 4RZWA 5HTBA 4E5BA 3FLZA 3CSVA 4FOBA 3Q9YA 4D2PA 4AFJA 4GK2A 1Q8WA 3BE2A 3ETAA 2IVVA 5AP1A 4F6UA 5JGBA 2J6MA 5DEWA 2XK7A 5HNGA 2BIYA 4U8ZA 2C6EA 2HYYA 3D14A 4AW2A 4IFGA 2CNVA 1J7IA 3IW7A 3ID6C 1ZAOA 3VUGA 3RPSA 1YXXA 3Q4UA 2ESMA 2IZUA 4ORKA 3ITZA 1U54A 3DAEA 3TNIA 3OP5A 4KKEA 4AW5A 4MHAA 2C0TA 3KFAA 1Q62A 3F3WA 4O0UA 4UMQA 1YWNA 5EH0A 2B7AA 2GNIA 1H08A 3ZDUA 5IQIA 2XKEA 4FV6A 3JYAA 1NVRA 4JQ7A 2WNTA 4ZZMA 4EUTA 4EEVA 1YKRA 1H8FA 3PJ8A 4IVBA 4QMQA 4NL0A 3WILA 1BL7A 4X3JA 4EUUA 4L67A 4I0SA 5FLFA 1F0QA 3RALA 3W1FA 4XG8A 1OM1A 5LMKC 4FVQA 3HV4A 4YJVA 2GQGA 4AOJA 4FEUA 1W82A 2YZLA 4YJPA 3CPBA 3DJ5A 4GFMA 4TPTA 3VBTA 2OXXA 4EZ7A 3R9HA 2WKMA 4FKIA 3DKFA 3UMWA 3LLAA 2BROA 3LM5A 3O17A 2W7XA 2YCRA 2BCJA 1Q8ZA 4GMYA 4JAIA 3R8MA 3UG1A 4AW1A 4AZWA 4O0XA 5E1EA 4R1YA 2NRUA 2XM9A 5H3QA 4M13A 2XVDA 4O1PA 2GQRA 4Q2AA 2B52A 4F9AA 4I6BA 4H3BA 2YJRA 3G6GA 2YIWA 2XK8A 2B9JA 3JUHA 4O83A 4DFUA 2XP2A 3NS9A 2QOIA 4JG7A 4XV9A 4HPUE 5IH4A 3FEGA 2W5BA 3ZHPC 5FG8A 5L4QA 4IDTA 3PUPA 3PA5A 1W83A 4O7TA 3NUSA 4QTAA 4E6AA 1K3AA 4MBJA 5HTCA 3OFMA 4FV9A 3DS6A 1SYKA 4XOZA 4CFVA 1NA7A 4FKRA 3ENHA 5KMKA 2G01A 1M7QA 2QU5A 3P23A 1IR3A 1I09A 3MH1A 2Y7JA 5IDNA 2W5AA 1SMHA 3DFAA 4NTSA 4M0YA 5JZJA 4NFMA 3FLWA 3CTHA 3PP1A 2WQOA 3DOGA 2EWAA 3LFDA 2XBJA 5BQ0A 1OB3A 5D10A 2A2AA 4BCMA 3SQQA 3L9LA 3MDYA 4BBEA 4TWOA 3SKCA 4PTGA 4QYEA 3SW4A 3C4XA 4GG7A 4Y5HA 4DEBA 2JIIA 3R04A 3W8LA 3L8XA 4YJUA 3UG2A 2XNMA 2QURA 3A60A 3RM7A 2OZAA 2BHEA 3R28A 3UZPA 5JMSA 5BVWA 4O84A 3MN3A 5I5ZA 4CYIA 2DWBA 5AX9A 1ZMVA 2C30A 3CE3A 2UW5A 3DA6A 4QMWA 4U45A 5T6KA 4BR3A 4CXAA 3MGYA 1GAGA 4DH8A 1BYGA 3DPKA 4NKSA 5FM3A 3RBWA 3BKBA 2QOHA 4O0TA 2PL0A 5A4EA 3K5VA 3NUXA 2Z8CA 4IACA 4WSYA 2JAMA 4EI4A 5A4LA 4U0IA 5HE3A 4TNDA 1FPUA 3FXZA 5TOZA 4FG9A 3L9NA 2Y4IC 2VNWA 5GZAA 4ASEA 3ZEWA 4RBLA 5F20A 3AMYA 1BL6A 3QQLA 3NCZA 3HMMA 4BL1A 2C0OA 1MUOA 5HICA 4JNWA 5HU9A 2XJ1A 2VTPA 3KA0A 2QKWB 3ORMA 3BHYA 1FGKA 3LQ5A 3SDJA 5FUTA 4HCTA 4O0VA 5CU4A 5B7VA 2JDRA 2F49A 1BX6A 3U6IA 2Q0BA 4F9CA 2YCFA 3R1SA 4OTFA 2GU8A 3EQDA 4WNKA 2ZM3A 4CG8A 3ROYA 5EI6A 3DBQA 4D2RA 3OC1A 2W05A 3VBXA 4DBNA 4DEDA 4DH3A 3FAAA 5GIPE 3ALOA 3P4KA 4U9AA 5AR2A 4D58A 5CVGA 4EZ3A 3SRVA 5DBXA 5ANJA 4PMMA 4YTCA 2YDKA 1XBBA 4DLIA 5CAVA 4G2FA 2OI4X 3ZUTA 2JFLA 2Y6OA 4QP2A 4ZLOA 5HQ0A 2PZYA 5FD2A 3HV6A 3LJ0A 3VS4A 4RSSA 3KXMA 4QYHA 3GEQA 2PE0A 3QTQA 4GFGA 5E91A 4C2WA 3A4PA 4L52A 4ANMA 3TNPC 4QP8A 4DG3E 5FWKK 4GUBA 2E9PA 3HAMA 5DEYA 2BTRA 3AT4A 5T68A 4O7NA 2B9IA 2QONA 4L3PA 4FGRA 1OZ1A 3NEWA 4D2SA 4E7WA 1R0EA 3V5WA 3R1NA 3MFUA 4QMUA 5EM5A 4ANNA 2XIKA 3GCPA 3FLQA 1Q8YA 3HL7A 4G9RA 4OBOA 4Y85A 3UC4A 1CSNA 3LFFA 4AF3A 5HE1A 3OY1A 5BUJA 4GCJA 2IVTA 3K2LA 3R9OA 5IUIA 2HOGA 4FZ6A 2H96A 3MJ1A 3NWWA 2GNLA 4X2GA 3R8VA 4FL2A 1XR1A 4QMSA 4JRNA 4LM5A 1UVRA 2HENA 3UNZA 3GU7A 4IX3A 2UW9A 3GP0A 5HG8A 3AC8A 4G5PA 5JFSA 2J51A 1QCFA 3LCDA 4G6NA 4I1ZA 5CXZA 4RFZA 5CU6A 4I94A 2HWOA 4TYIA 4IAAA 4D2TA 1LEWA 3WI6A 2B4SB 3HMIA 5E8TA 4IZ7A 1M2QA 5DG5A 3QGYA 5EYCA 3PIYA 4CQEA 1UV5A 4BBMA 5IZFA 2O8YA 4ZSGA 2XCHA 2OH0E 4ANOA 3RPRA 3CQUA 5CZIA 5IA1A 4EH9A 4I5CA 2WMUA 4CZTA 4ZSJA 4RPVA 1GZOA 3TM0A 3WF6A 5FTGA 1R39A 4BZDA 3A7GA 2YA9A 3FXWA 4AGWA 1KE5A 4K1BA 1LUFA 5J79A 5IMEA 4RVKA 4FZDB 3I0OA 4KIKA 3ELJA 3DLSA 1XO2B 4J97A 3QKKA 2A1AB 2R64A 4I6FA 1H1RA 5J1VA 3NUAA 4XLIA 4ERKA 2QHNA 3EN6A 2FSMX 4E20A 3R1YA 1OKVA 1ZMWA 2HY81 2XK4A 3BYUA 5AP3A 4BCHA 4CKRA 2CDZA 5IKWA 5TO8A 5DYJA 4PTCA 4NJ3A 3QQGA 3BHTA 4BYIA 2PULA 5D41A 3OWJA 2V7OA 2XNGA 3GCVA 4NTTA 4QQJA 5D12A 4ZSEA 4NEUA 4AA4A 3LXPA 4AZSA 5A4TA 2X4FA 2E2BA 3CD3A 3Q6UA 4M8TA 5LOHA 4X3FA 3EL8A 3PSBA 3LCKA 5HIDA 5AP7A 3AC5A 1RJBA 3RPVA 4PQNA 3GBZA 3QD3A 5CEIA 3ZLXA 3TIYA 1CKIA 3UOKA 4YNEA 4M12A 3LMHA 4UXQA 4OTRA 3FMNA 4YBKA 5D9HA 2BKKA 4EH3A 3FSFA 2C0IA 3QYWA 4LRJA 3HV7A 4JX3A 3ZRLA 4GG5A 4RC4A 4MCVA 1O9UA 3FBVA 2E9OA 2HELA 3W10A 1J1CA 3T3VA 1YDSE 2C5OA 3OCSA 3KXXA 5E8SA 4PWNA 3SG9A 5GJFA 3S2PA 3FMEA 3PDTA 3TKIA 3WZKA 4F6WA 3R8UA 3P7BA 4YLKA 3BZ3A 3MTFA 4GJ3A 3HUBA 4XYFA 2ZV8A 4X21A 1UKIA 2PK9A 1H1SA 3PXRA 4WG4A 1B6CB 2NRYA 3DDQA 3DAJA 5ETFA 1V0OA 3NCGA 3KKVA 3Q2MA 4MAOA 4DITA 5JQ5A 2YJSA 3IQ7A 3ZU7A 2QOQA 2YFXA 1XH4A 4JDIA 4ALWA 2PVLA 1UNLA 5BYYA 3BGZA 4UWBA 5BVOA 4Q5HA 3PPKA 4RX7A 3KXGA 3OOMA 3RI1A 3Q6WA 2A0CX 3DK3A 2ITUA 4P2KA 3QTWA 5EW8A 3MH0A 1SZMA 4BC6A 5IMXA 3EQCA 5A6OA 3U51A 3IOKA 2C5YA 5KCVA 2ACXA 3QRIA 4K9YA 2B1PA 3PPJA 1PXLA 5HLPA 4K11A 3I7CA 1P4FA 5HD7A 2WEIA 4Y95A 1PKGA 5CTPA 2RL5A 4XMOA 3ZFYA 4B6LA 2JDOA 4FGBA 2I1MA 5LMAA 3VJOA 5CEPA 3UNKA 4ZY4A 3OWPA 4QMTA 2F57A 3QZFA 5HE2A 4YHFA 3MPTA 2GTNA 4TL0A 1P5EA 1TQPA 4D4SA 1BI7A 2GTMA 2H34A 3MY5A 4TWPA 3AD6A 3VUHA 4BI2A 3QHWA 4EHGA 4EJNA 3QUDA 2B9FA 4DGMA 3WZDA 2JITA 4HNFA 4MBIA 2ZOQA 1YOJA 2VTJA 3ZOSA 2C6LA 3LXLA 4GKHA 4GIIA 1IRKA 3A8WA 5IDPA 1PXJA 3S3IA 2CGWA 2VGPA 3I4BA 2WMXA 1GIJA 1B38A 3IDPA 1NT2A 4FTUA 4QP1A 2GNHA 4O38A 3SA0A 3HDNA 4NU1A 5H8BA 4ZXTA 3KCKA 4QP3A 4UWYA 4W9WA 3ZXZA 3FKOA 5EM6A 5I0BA 2WTJA 1OUKA 4IZ5A 4LGGA 3V8WA 2ETRA 4ANSA 5CT7A 2I0EA 4NIFB 2CGUA 1H25A 2I6LA 2QKRA 3HDMA 4OTQA 1Q3WA 4R3CA 2JC6A 4ACCA 3LPBA 4M0ZA 3V04A 5HLWA 3MB6A 3TACA 3WARA 3ZUVA 4BCQA 5HGIA 3POZA 3ODZX 2CJMA 4D1SA 5JQ8A 4RQKA 4KNBA 1YRPA 4NWMA 3R9RA 4KA3A 4YU2A 4E3CA 2WTIA 4IDVA 4HPTE 3PSCA 2QOKA 3LFNA 3RKBA 3EYHA 2YM3A 3NDMA 3HMPA 4YTFA 2IN6A 1SVGA 4NH1A 3Q4CA 3E88A 5GNKA 4BIEA 4XG3A 3E8CA 4L3JA 3ALNA 2GPHA 2W0JA 3OY3A 3CJFA 5HHWA 4YSJA 2Z7LA 3IS5A 4UALA 4LRKA 3GNIB 2ONLA 4C38A 2QOCA 1T45A 4FIFA 4JQEA 1Y6AA 2ZVAA 2BPMA 3GC0A 4U80A 2VU3A 1YWRA 3RPYA 4MD8E 4DFZE 1MRYA 3E8EA 3MIYA 3IW8A 3V8TA 5K5XA 4CCUA 2PZIA 5M4IA 4MTAA 1H1PA 1OIYA 2SRCA 2IZSA 4U40A 3KCFA 3QLFA 1M14A 4EQCA 5DNRA 5C8KA 3L9MA 2QG7A 2DS1A 4JLCA 5DFPA 3G6HA 4DFBA 4FG8A 4XG9A 2UZWE 3FMHA 4FYOA 3I6UA 5FDXA 4YP8A 4FSNA 1GIHA 5J9ZA 3LFEA 4FIIA 5AP6A 5CF4A 4FV1A 4EOPA 4TXCA 2W96B 2IVUA 3FV8A 3GXLA 2CPKE 2VTOA 4XG2A 3QYZA 1H4LA 4FKLA 2BRNA 2UW0A 4GJ2A 3ZTXA 5A46A 4ZP5A 2BIKB 1H01A 4W4XA 4M97A 5JGDA 4C4JA 3ZRMA 3A4OX 4ZSAA 3FWQA 4FKVA 4ZAUA 1M52A 5AIRA 5FEEA 5K3YA 3LHJA 3VS3A 4QMMA 4S30A 3D7TB 4F0GA 4U42A 3TV4A 1Z5MA 4QP6A 4ZTSA 5D11A 3GOPA 4ANBA 3IECA 4JJRA 3QX4A 1J3HA 2AC5A 3H9FA 4TYGA 2EUFB 5AAEA 3SW7A 3Q9ZA 4KRCA 5KMNA 5KE0A 1PMVA 4MQ1A 4AW0A 2GFSA 3VJNA 4R78A 3IW4A 4MXZA 5CU2A 4ACDA 5LVMA 3BPRA 3DTCA 2W4KA 3MS9A 3U6HA 2PYWA 4FKWA 2E9NA 4K8AA 1JSUA 5CLPA 3RK9A 5IPJA 5K0XA 3LIJA 4KINA 3VUTA 3ORPA 1Z9XA 4XLVA 3RINA 4EOKA 4U81A 1ZZ2A 2PWLA 3F2AA 2C3LA 2R3GA 3C0GA 4IZYA 5IH6A 3BLRA 5AR7A 3KN5A 5CEKA 4FTIA 4AA5A 4WNMA 3HAVA 5HX8A 1U4DA 4C4EA 2W4JA 3BI6A 1OBGA 3ZUUA 4ZTLA 1I44A 4FKTA 3R7IA 4WO5A 5KMMA 4EBVA 3I1AA 3NMUF 2XCKA 2OJGA 4I23A 4R1VA 5K9IA 4K0YA 4NM5A 5C8MA 2WMBA 4C37A 3UYTA 3MVJA 4WRSA 4CCBA 4FIHA 4KBKA 3VC4A 4HGLA 4BTJA 4EK3A 3D5WA 5J5SA 3EQFA 3WF7A 4S32A 3TI1A 4BWPA 5M06A 4BIDA 5EOBA 4IX5A 5KX8A 5J9LA 2BHHA 2PZRA 3O7LB 4GYGA 4DGNA 1VYWA 2JKKA 3A7HA 3MA3A 3PY1A 5ANDA 3DU8A 2YM5A 1Q24A 3KK8A 2LAVA 5B2LA 5M44A 4O2PA 2R7BA 2A4LA 3L8PA 4YTHA 1IAHA 4J7BA 3C4FA 3HYHA 3KMMA 4QTEA 4L6QA 4N4SA 5GZ8A 5AA9A 1LR4A 3G0EA 4XP2A 2W1FA 5FEQA 4O7RA 1Y6BA 3JY0A 2WTCA 1EH4A 4DAWA 3C9WA 2HK5A 5HESA 2Y9QA 4YO4A 3NNXA 3CBLA 1OKWA 1X8BA 4DT9A 4ARKA 3MVLA 4IWOA 4WUNA 4QYGA 1WBWA 5EHOA 2WOUA 2WTVA 2C68A 3QAME 4LOPA 1DM2A 2EB2A 4GU6A 5E8YA 3M2WA 3IDCA 4D2VA 4X2KA 4OR5A 1MRVA 3Q9XA 3H9OA 2UVXA 3N9XA 3QQUA 5CSVA 2JEDA 4LOOA 4K33A 4ZOGA 4HVSA 2QODA 1ATPE 5FM2A 5TR6A 1U5RA 2QLUA 3CQEA 5FBOA 3QKLA 4A4XA 3ACJA 5L2WA 3FMLA 4RWLA 3FLYA 4FZ7A 4AT4A 2QR7A 3NYNA 4H1JA 3ROCA 2PE2A 2R2PA 2X6EA 4J52A 4OT5A 4G3DA 4ZY6A 3CTJA 2ITPA 2YM8A 4E6CA 5C03A 3ZSGA 2J7TA 2Z60A 5AM7A 4MXYA 4F70A 1ZZLA 1OL7A 3NR9A 2BRBA 4FSTA 4GL9A 4C4FA 3GQLA 3ENMA 1OGUA 4JG6A 1J1BA 4RIYB 3UIUA 2WMAA 4KBCA 1YXVA 3PXFA 4FKGA 4UMTA 3WF8A 4CFWA 3NNUA 2CCIA 3K3JA 3Q52A 4I3ZA 4FF8A 1OUYA 2XYNA 1RW8A 4DFNA 4CMTA 4U43A 3ZM9A 5CF6A 4PV0A 4DCEA 1PXOA 4FK6A 2IW6A
chains in the Genus database with same CATH superfamily
2PHKA 3W2RA 4MWHA 2FA2A 2F2UA 3HKOA 2GDOA 4HYUA 5EFQA 3CXWA 2JLDA 1H28A 5CQUA 5EDRA 4L45A 2CKEA 4BDCA 3CQWA 3LZBA 1DI8A 4K18A 4F65A 1F5QA 2XAMA 5CX9A 3R30A 3ZBXA 4DEHA 4BCJA 4FUYA 3EIDA 3HMNA 3QFVA 3BHHA 4DEEA 5DR2A 5E8ZA 2CHLA 2CNQA 4ALVA 4BF2A 2GS6A 4IAZA 2O65A 1TKIA 1PY5A 4I22A 1RQQA 1KE7A 2ONLC 3NW7A 4DFYA 3LM0A 4Z16A 4FV0A 2RFDA 3R7GA 4YR8A 1STCE 3OWKA 1WVYA 2ITOA 2BRMA 2X0QA 4BCKA 1FMKA 2XKFA 3SX9A 4BCPA 2OFUA 4C3RA 5CVFA 2P2HA 2VO0A 3IOPA 4AGDA 5BMSA 5AP5A 5DHJA 4I24A 4NZWB 2DYLA 5HOAA 5BYZA 1AQ1A 4E8AA 3QQHA 4DC2A 2CGVA 4GYIA 4R3RA 2VWBA 2BKZA 3B2TA 3BLHA 5C9CA 4MVFA 2PUNA 1OMWA 4HYHA 3ZO3A 3AG9A 3HGKA 1V1KA 3QZHA 3I5NA 1PHKA 4NT4A 1PXIA 4TY1A 4O6EA 2ZJWA 3C4EA 5D7AA 4DH5A 4CV8A 3Q5IA 4Y5QA 5CI7A 2PVYA 3FI8A 3PA3A 3TKHA 4UXLA 1XMLA 3C5UA 4IX6A 2YZAA 4QNAA 3R7YA 5EKNA 3FHRA 4N0SA 5FTOA 3W16A 4ZMFA 2YERA 5I3RA 2BDJA 2VTIA 3VS6A 3QRTA 5C27A 3DFCB 2RGPA 1GOLA 1Y91A 2IWIA 1ZXEA 4CFMA 4F99A 4R6VA 3UP7A 3OZ6A 1XJDA 5FDPA 2OIBA 2WTKC 2YABA 4DTBA 4DF3A 4XJ0A 4EL9A 4LRMA 2XIZA 4LOQA 4CSVA 3OOGA 1W2DA 4ZK5A 3BV3A 3NNWA 5E8XA 1KE6A 4YC8A 3EWHA 5EI2A 2ZDTA 5M56A 3K3IA 5ETIA 2I0HA 2J2IB 3M42A 4JRVA 3KXHA 4Z55A 5M07A 1GZNA 4GRBA 4JBPA 3B8RA 5DR6A 2QOBA 3N4UA 4TWCA 3UC3A 2GFCA 1Y57A 4USEA 3OMVA 4YO6A 5AV2A 3BWFA 3WF9A 3PYYA 3QWKA 4EC9A 4QMPA 4IB0A 4FNXA 4IX4A 2UUEA 2HCKA 3GU4A 5EM8A 4RMZA 4FSZA 1E9HA 3BLQA 3DV3A 3DBEA 3V6SA 4HVGA 2YCSA 3PA4A 1GNGA 2OXYA 2YAKA 1KV2A 4AX8A 4M66A 4ZLYA 2VAGA 2B55A 2XS0A 5CZHA 4LUEA 4UEUA 3MJ2A 4B99A 4BZNA 3QF9A 1KWPA 3UZTA 5K0KA 3E8NA 5HO6A 2HIWA 4YNOA 5KO1A 5ANKA 1CKJA 4FTJA 5CEOA 3E87A 4YZ9A 5EW9A 4FVRA 5LCJA 2I0YA 2W4OA 3R63A 4RC2A 2BRGA 4EQMA 3KF7A 3VS5A 3GFEA 4U44A 5CAUA 3C1XA 3GC7A 2VO6A 3ZDIA 3HP2A 4FICA 1JKKA 5EDQA 3T9TA 4L43A 2G15A 4L53A 2R3PA 2BTSA 2YLFA 5D1JA 3SOCA 3WIGA 4AT5A 4NM0A 3LFSA 1JAMA 3PE1A 4QP9A 4O7WA 4FTQA 5BVNA 2JKOA 3HV5A 5C26A 4AZEA 4CTBA 2J4ZA 4WBOA 3FC2A 4RJ3A 4IW0A 4NIFA 4O91A 4QTBA 2C4GA 4AU8A 3V5TA 3BIZA 4D28A 5KKRC 5JK3A 5IA3A 2V7AA 2RG5A 4FI1A 2WU7A 3PLSA 5JFVA 2RF9A 3TEIA 4C62A 4IQ6A 1ZY5A 3U55A 4BJJB 3COHA 5C4KA 2HXLA 3TJDA 1JSTA 4W4YA 2PUUA 3MIAA 2AC3A 3VHEA 1YOLA 3DJ7A 4FIJA 3E7VA 3RPOA 2X7GA 4R5YA 4TT7A 5HLNA 4OBQA 5C4LA 3QCYA 3SOAA 3N4VA 2EU9A 5DT3A 1WFCA 5H2UA 4CKIA 3M1SA 3FLSA 4DHJA 3P86A 3U87A 3G9NA 2QO2A 1YOMA 4ONAA 2Q83A 3LXNA 1UNGA 2UW7A 4NK9A 4HOKA 3R8LA 3WOWA 4BGHA 4CFNA 3FDNA 4AZVA 3ZS5A 3IKAA 3LW0A 3MY0A 4DHIB 3COIA 2UZVA 2R3MA 4ZTRA 1ZYDA 5KUPA 1VEBA 4FTAA 2Z7RA 4B8LA 3FI4A 2XIXA 1URWA 5BUIA 3NLBA 1XH5A 4N6YA 3BEAA 1BUHA 2E9VA 5ITAA 1NVSA 4C7TA 3OD6X 1ZYCA 4PRJA 4YLJA 5KBRA 4WG5A 4FBXA 4DH1A 2Y6MA 3V51A 2VTHA 1CKPA 3MTLA 1Q8UA 3A7IA 2J9MA 2XARA 2WQBA 1YQJA 4R7BA 3QC4A 4FIGA 2KULA 4IH8A 1KSWA 4YC6A 3FUPA 4WRGA 3EZVA 4FKOA 5L2SA 2VX3A 1ZY4A 3QALE 3VS7A 4GW8A 4IJPA 4R77A 4FE2A 1OI9A 4BKYA 2CKOA 4IMYA 5D7VA 3I81A 1H07A 4LGDA 3E5AA 1P14A 4GU9A 4FYNA 4D0WA 5GHVA 4F4PA 2GNFA 2CLXA 2WB8A 1YDRE 2W9FB 2YDJA 2ZM1A 2UZDA 4FT9A 4F7JA 1JKSA 2R0IA 4JIAA 4PPCA 3DY7A 4E93A 3I7BA 3UIXA 3EN9A 2C69A 4Y72A 5IEXA 4M68A 5HG5A 3G2FA 3GGFA 5AAFA 4AZFA 1LP4A 3UE4A 5LMBA 4FC0A 5HBJA 5A14A 4XBUA 2WEVA 5HTIA 3QD4A 1BI8A 3R83A 1OPJA 4J96A 4BDGA 5AR5A 5AP2A 4GFOA 4BWKA 2Y4IB 4E6DA 4DTKA 4M3QA 2XIYA 2O0UA 3ZLWA 3D2KA 4DGOA 2YDIA 3PPZA 5I9WA 3GC9A 4FMQA 3F5XA 5HCYA 4IADA 2ITVA 3UZRA 2EXCX 4ZTHA 3A99A 3BU5A 4DLJA 2YHVA 4UX9A 4I92A 4EWQA 2PTKA 1PXMA 3ERKA 4I6QA 1SM2A 4QMLA 3KC3A 4TYHA 2GS2A 4X2NA 2W06A 3R22A 4O96A 5DA3A 1OL1A 4X6RA 3CKXA 1O6YA 2E9UA 2R5TA 3NW6A 5IA2A 5AUXA 3W0SA 1WMKA 2QLQA 3K5UA 4XG6A 4CD0A 5LVOA 2GHLA 3PXQA 5FP5A 2R0UA 2ZMCA 3A62A 4EC8A 3N4TA 1Y8YA 1ZYSA 3C4CA 3CPCA 3R9DA 4GVAA 1PKDA 1QPDA 3LOKA 4FV7A 5H9BA 4HCVA 4O1OA 5BX0A 2PMOX 2ITXA 4CMUA 4APCA 2WOTA 2OZOA 4RIWB 4I41A 4YJSA 1OPKA 1K9AA 2X2LA 2YLEA 4LMUA 4S31A 5FXSA 4FNYA 4A4LA 4RIXB 4CVAA 3F3VA 3LFQA 3VW8A 4ANQA 1IASA 4KSQA 3QLGA 3VRZA 4FTTA 4V0GA 3VUIA 4EWHA 1G8KA 1W0XC 1Y8GA 3F3UA 4YZNA 3R7VA 4JS8A 4PL4A 2FH9A 3NX8A 4U7ZA 3DBCA 3PJ1A 3WF5A 3W2OA 3HV3A 4V01A 2C1BA 5JRSA 3PVWA 5AUTA 4FG7A 2J0MB 3QD2B 3RCDA 3FPQA 2RSVA 2PY3A 4D1XA 2XALA 3OCTA 4YBJA 4L01A 2ITQA 3KULA 3OEFX 2OF2A 2XK6A 3P08A 4XP0A 3UVPA 4FV8A 4MNEB 3CCNA 4QMXA 3MFTA 4HZRA 1W7HA 1UA2A 4AA0A 3UGCA 3IDBA 2R3LA 3HNGA 4GS6A 4QRCA 5HO7A 2OSCA 4BHNA 5JT2A 3W2PA 4ANLA 3ULIA 4JBVA 4TZRA 3G15A 2WAJA 4BCOA 5CEMA 3IGOA 3VWAA 4CRLA 3TUCA 3MB7A 2UW3A 2OG8A 2ZB1A 3QQFA 3QTUA 3UVQA 3DKGA 3W33A 3UPZA 4D5KA 3QTXA 2VTSA 5EI8A 3R2YA 3VF8A 4P5QA 4M7IA 5AJQA 5AV3A 4E6QA 2J0KA 3T8OA 2VTQA 2VTMA 5CNOA 3UO6A 1FOTA 1CMKE 4FODA 4BKJA 1OBDA 1U54B 4MD9E 4O86A 2FGIA 1Q41A 4F64A 5E4HA 1FQ1B 3BELA 4S2ZA 5CVHA 4E26A 1WBNA 3D83A 3PJ2A 3QXPA 4LQMA 2A98A 3U4UA 3TDWA 3WZJA 1G8AA 4I5MA 5LWNA 2FVDA 3CY3A 4YJRA 2IEWA 3HRBA 3MVMA 4EHVA 3W0NA 1NY3A 1PYEA 2BZHB 3H4JA 4JDKA 2XNEA 4WT6A 3VIDA 1YXTA 5DVRA 5HKMA 2VX1A 2BUJA 2XK9A 3R7UA 1PMEA 1XH6A 4UBAA 1WBTA 2CSNA 2VZ6A 2IO6A 5DH3A 1R1WA 5ETAA 1Q8TA 4FOCA 3U54A 4BZOA 4X2JA 4M67A 4KRDA 4OGRA 4FKJA 4IC8A 4PF4A 5IF1A 4L68A 4EHEA 1XHAA 4KBAA 5C8NA 4ZS4A 4ZEGA 1FVVA 3R8PA 1A06A 1ZYLA 1GJOA 4XUFA 4R8QA 4YZBA 3BWJA 1KOAA 2P4IA 2R9SA 4FSYA 4IANA 5KMLA 3PY0A 2VWWA 3FZSA 3Q3BA 4O7YA 1OIUA 1OL2A 2WMQA 3EFJA 1W2FA 1KV1A 4IEBA 4MQ2A 4RT7A 3PWYA 4FTNA 3S4QA 3VBWA 3DXPA 5T3QA 3BYSA 4X2FA 5FXQA 3LCTA 2IW8A 2Y0AA 4YTIA 5BVFA 3IPHA 3CR0A 4OLIA 3EN5A 4EHZA 1YI3A 3A61A 4G3EA 1WBOA 3DDPA 5CF5A 3UJGA 5DMZA 5JSMA 4USDA 4GT4A 4FT7A 4J8MA 3VS2A 5L6WL 3OW4A 4RJ4A 4JR7A 4LYNA 4F0IA 4FNZA 4RG0A 2UW6A 4TYEA 4DTAA 1IA8A 3H30A 2XKDA 5TF9A 4A9SA 4O0RA 4CT1A 2QOFA 4QTDA 4OBPA 3ZC6A 1UU7A 4EKKA 2W17A 4W8DA 2VO7A 1ZARA 3UDBA 5F95A 4F08A 4BYJA 5HD4A 3FKLA 4BCIA 3LFBA 1XH8A 4J99A 2XRUA 3EQGA 2W1HA 4A9RA 4GUEA 5HORA 4A9TA 3NVKI 5M55A 2W1CA 4J98A 5I3OA 2ITZA 3KK9A 3T3UA 5HX6A 1UWJA 4ITHA 3OEZA 5B2KA 1KE9A 2X7FA 5HIBA 4R7HA 2AQXA 4MYGA 3C0IA 3NYOA 3DK7A 2I7QA 3EH9A 3AD5A 3GI3A 2H9VA 4YPDA 1E1VA 2J5FA 3HRFA 3ACKA 4XRJA 3ZH8A 4PL3A 4OAUC 3BCEA 5EM7A 4OUCA 3JR1A 3MESA 2R3HA 3ZZEA 2PUIA 2W1DA 2YCQA 2VWZA 4OT6A 5CU3A 4F7NA 5EYKA 1XWSA 3DLZA 4HYSA 3DJ6A 3C0HA 3NFGB 4FUXA 3R2BA 4QYFA 1JNKA 4DG2E 1ZMUA 4MK0A 1WVXA 1IA9A 3Q32A 4LV8A 5KBQA 3GC8A 4C4IA 3L8SA 4BDDA 4AOTA 2CNUA 4PY1A 3QA0A 2FO0A 3TL8A 3BLAA 2XUUA 4HW7A 3R73A 4D1ZA 4DHZA 5HG9A 5CWZA 1YDTE 3E8DA 2HZ4A 4GT5A 3WIKA 3F7ZA 3K54A 4UYAA 3AXWA 5EYMA 4L42A 4UWCA 3TG1A 4BBFA 1NW1A 5CNNA 4C2VA 1PXNA 1UKHA 5J7HA 3EKNA 3E63A 3LXKA 3B2WA 2HXQA 2Y4PA 4DG0E 3H9RA 4WNPA 3NNVA 4XP3A 3ANRA 3SC1A 3E92A 3EFLA 1QMZA 5CS6A 2WMTA 3MFRA 4KABA 1FVTA 3KMUA 4II5A 1WBVA 3OT3A 5F4NA 2G2IA 4FEXA 2ITYA 4Y73A 1PF8A 4V05A 3MW1A 2OJFE 3QQJA 4G1WA 3V5QA 4RX5A 5BPYA 4OAVB 5AWMA 2GNJA 3O51A 4I93A 3UQCA 3P9JA 2C5VA 4MD7E 5EK7A 3P79A 4ENYA 3QX2A 3RK7A 3IO7A 3QCQA 3AC2A 2F7EE 4KIOA 3SRVB 4M15A 5BVDA 2QVSE 2XNNA 4XHKB 4ACMA 2YM6A 2ZV7A 4KWPA 4C3PA 3QCXA 5JFWA 3D5UA 2CKPA 3UDSA 3PJ3A 4IB3A 4E73A 2JIUA 1Q99A 5A4CA 4WIHA 4C36A 5G6VA 4EONA 5M4CA 3DBFA 4DE4A 1YI4A 4CT2A 4ZIMA 3QTSA 2NNWB 3F7WA 3PXZA 3QGWA 4U41A 4B9DA 3KRWA 3TWJA 4X0MA 3GVUA 4DINA 2R3OA 4KS8A 5HNIX 5IEVA 2X0GA 4WA9A 3FYJX 4OTDA 4F09A 5BUEA 2R3FA 1O6LA 2C6MA 3P7CA 4FTKA 5KNJA 3PG1A 3MA6A 3ATSA 1GZKA 3CD8A 4V04A 4MF0A 5AUZA 3RZFA 3TUBA 4BDKA 3W2QA 5EQYA 3F2NA 2PSQA 2YAAA 4RA5A 3PY3A 3Q5ZA 5KHWA 3AMBA 3CY2A 3UO5A 3LCSA 5LJJA 4LV7A 1ZOGA 4L3LA 3CS9A 3EN4A 5FXRA 4CV9A 3OVVA 4DN5A 5E90A 4AN2A 4X3FC 3L1SA 2J0IA 4H1MA 4LV5A 4WBBB 3C13A 5E8VA 3MWUA 3TV7A 4CGAA 4NM3A 3EQIA 4TTHB 4AWIA 4DGGA 4EK5A 5JGAA 4C61A 3VBQA 3JS2A 4QOXA 1APME 4QPMA 5AX3A 2C6KA 1VZOA 2X39A 4TKSA 3CIKA 4FZFB 4RLKA 4UYNA 5M4FA 4CMOA 4CZYB 2HW6A 4AXEA 2YEXA 2J50A 3LJ1A 4JG8A 3ATTA 4DBXA 4PP9A 4YZCA 3D2IA 3QHRA 4UMPA 3QKMA 4QPSA 3M11A 3CEKA 4NFNA 4PL5A 3FXXA 1FGIA 3F2RA 1IAJA 4AQCA 3V3VA 2F9GA 4QMZA 3PRFA 4IAKA 3G9LX 1Q5KA 5GZ9A 2OICA 3L8VA 3DZQA 2IVSA 4C0TA 4PPBA 1MRUA 4ZJIA 5EHLA 1W84A 2VWIA 5EKOA 4D5HA 5JFXA 3PTGA 5EOLA 2C6TA 4Y46A 5HNBA 2KTYA 5ACBC 4CFUA 3H0YA 4AGCA 4HVDA 4KIKB 2I0VA 3DQXA 3AC1A 4D4YA 2EB3A 4IAYA 5LQFA 5J7BA 2VTRA 3NGAA 3Q4TA 1CTPE 1Q61A 1G3NA 2WGJA 4JDHA 4CEGA 5IQEA 3TYKA 3FZRA 4DEAA 3HMOA 4C57A 4DFLA 3FZPA 3S0OA 2HW7A 3MH3A 1W98A 2JDTA 4IAFA 3QTZA 3BYMA 4AUAA 4XRLA 4BDFA 5AUUA 5DI1A 3UBDA 5J5TA 5F1ZA 3F9NA 3PZHA 3D5VA 1BLXA 4HYIA 2IG7A 4G3CA 2R3JA 5HEZA 4FX3A 2QO7A 4QT1A 1OPLA 2YM7A 4NJDA 4X3FB 4JX7A 4YHJA 4OW8A 4BTMA 4C3FA 2F7XE 4EOJA 2VNYA 3FC1X 1B39A 2HZIA 3C4ZA 1TVOA 3GU8A 2OIQA 1J91A 3OXZA 4R5SA 4BCNA 4F9BA 1XBCA 3IONA 4MUQA 4QP7A 1OL6A 4E4LA 4UB7A 4YJNA 4IVDA 3N51A 2C6IA 2W9ZB 1OECA 4C8BA 4CKJA 4FTLA 2ETMA 4AP7A 5IEYA 5HBHA 4A9UA 4MX9A 2OKRA 2VWXA 4RLLA 4F1OA 4NM7A 2ZM4A 1H0VA 4HGTA 5DOSA 2J5EA 2QD9A 4O81A 3OF0A 3UO4A 4GEOA 3VW6A 2FSTX 4I5HA 4FT5A 3S00A 2EXEA 4CNHA 3RM6A 3RVGA 3LQ8A 2XF0A 4FIEA 4HJOA 4BTKA 4G5JA 4D4RA 2ZV2A 3VUMA 2G2HA 3BV2A 5M53A 2DUVA 4W9XA 3G0FA 3NAXA 4FEVA 3A7JA 2WZJA 4EH6A 3DGKA 3R0TA 2NP8A 4ASXA 2UZLA 4LL5A 3Q53A 3W18A 4GV1A 3FI2A 3V5LA 4F7SA 4IZAA 4YPSA 4ENXA 2JBOA 5K5NA 3ZEPA 5IH5A 4BJJA 1JOWB 5AIKA 4EJ7A 1WVWA 3CLYA 3MFSA 3BQCA 1KOBA 4QYYA 4APPA 3ZZWA 4FK3A 1G8SA 4FVPA 2VD5A 3Q2JA 3COMA 2VN9A 2BZIB 2LGCA 3DQWA 3P5KA 4X6QC 4BDBA 5HIEA 4BDHA 4LL0A 5LXMA 2PVFA 4FRFA 2FUMA 4S34A 1ERKA 2YWVA 3W0OA 5J95A 2OWBA 5AADA 4CFFA 2A19B 3BHUA 2Z7SA 2C3KA 4XG7A 2WIPA 1YWVA 3WZEA 3KREA 3FKNA 2EXMA 3ZLYA 5F9EA 3JXWA 4CTCA 3I6WA 3UQGA 2A27A 2CN8A 2PVJA 5CXHA 5J87A 3C51A 4L44A 4KKGA 1PYXA 2YISA 3R01A 5B0XA 2WQNA 2W1ZA 2JBPA 4IIRA 4DEIA 3KQ7A 4BDIA 3LFAA 5CSXA 5AP4A 3H10A 3FQSA 3R6XA 4IWQA 4XEYA 2GS7A 1SNUA 3KN6A 4O2ZA 1UU8A 2IPXA 4YZMA 4FSRA 1W8CA 2X9EA 5IA4A 3EMGA 4R3PA 4JR3A 4FA2A 5ACKA 4EQUA 4XBRA 3TNHA 2P0CA 2XIRA 2C3JA 3O96A 1JVPP 5JKGA 2ITWA 2WHBA 4ASDA 2C1AA 3DXQA 2R3KA 2WMWA 2OO8X 3W55A 1DI9A 1PXKA 3QC9A 5HU3A 1E1XA 4HVHA 3KY2A 1QL6A 4FTOA 4Q9SA 3RAHA 1ZWSA 2WD1A 4IWDA 4XNEA 4P7EA 3BYOA 2WQMA 5E8WA 3QA8A 5AV0A 3RHKA 4CQGA 2V22A 2X0PA 5JEBA 4I6LA 2BFYA 3R1QA 4MXOA 4M69B 5HG7A 4EORA 4RVTA 4RWKA 4NYEA 3TZMA 3LJ2A 4J1RA 1SVEA 4IHPA 2RG6A 3TIZA 1H0WA 4D9UA 5IISA 4F0FA 1REKA 4FV2A 3SXFA 1V0PA 3ORIA 4GK3A 4O21A 4F63A 3LVPA 4N70A 4OTGA 5AUVA 3WE8A 4PNKA 5DT0A 5C1QB 3TJCA 2QC6A 3R00A 3RK5A 4ASZA 1QPCA 4LMNA 4RA4A 1L8TA 4DHFA 2WO6A 2OJ9A 5K4IA 3GCSA 3G33A 3RWPA 4GIHA 4UMUA 4I0TA 4A7CA 3TUDA 1XH9A 1TZDA 3V5JA 4DH7A 1ZRZA 3QRJA 4HCUA 5AR3A 5IQBA 1L3RE 1IEPA 3L9PA 5DLSA 5CENA 3WE4A 4I21A 2VTNA 2XEYA 5F94A 1LPUA 5HCZA 2PPQA 4H05A 4AAAA 5JN2A 4G6LA 2VX0A 3CGFA 5CYIA 1S9JA 4ZY5A 3KB7A 1UWHA 4H36A 3U9CA 5AUWA 5E92A 3HZTA 3D94A 4O22A 3MI9A 5L8KA 3VQHA 4E1ZA 2F4JA 3NW5A 5M57A 2H6DA 4QQCA 3E7OA 4AT3A 3TNQB 2YM4A 1XH7A 3MV5A 1YXUA 1PMNA 2IZTA 1LEZA 1CDKA 3AC4A 2P3GX 1JBPE 1M2PA 2BAQA 4QMOA 4ALUA 3UVRA 4ZTMA 3E3PA 2BAJA 2XKCA 2O5KA 4DEGA 5LVPA 2R3NA 3DAKA 2BZJA 3FZTA 1GZ8A 4XS2A 2QR8A 3I0QA 1W2CA 3FY0A 3E64A 1JKTA 2IW9A 5HE0A 3KRRA 5KZ0A 4D2WA 3DB6A 3RCJA 1GIIA 2B54A 2CLQA 4IB5A 3RWQA 4KUJA 3ZO4A 3F3ZA 4BGQA 5CU0A 3ZO1A 3RAWA 4BVUA 4AS0A 2WTKB 3FY2A 1YHVA 5FP6A 1O6KA 1ZOEA 4NW5A 3OXIA 4ZS0A 3D7ZA 4Y8DA 1JPAA 1RE8A 4CFXA 5JZNA 3S95A 5BYLA 5CY3A 2R3IA 2ZAZA 3ZONA 2JDSA 1ND4A 1Q3DA 4PX6A 5E9EA 1WBSA 5EG3A 1UNHA 4MEDA 1GY3A 3ZBFA 3T9IA 4LFIA 3E93A 4CYJA 1FMOE 4EK4A 2BMCA 3EQRA 3QZGA 3GQIA 2ETKA 2XYUA 3F61A 3F88A 2ITNA 3HVCA 3FSKA 3KVXA 4NW6A 3C50A 3ORZA 4D9TA 2C6OA 3EQBA 1UU3A 3IW5A 5I9VA 2QI8A 2WIHA 3NYVA 4YGAA 4JAJA 4O7VA 2VTTA 4QNYA 3FHIA 4NSTA 4B0GA 3PVGA 4RGJA 4EOIA 1H26A 4KIPA 3ZFMA 4C35A 1TQIA 3VBYA 3ORXA 4UZDA 1WZYA 2XBAA 2VO3A 4QD6A 4YJOA 3HECA 3SXRA 3EFWA 4JQ8A 2F7ZE 3CGOA 3VBVA 4JBOA 4ID7A 4BDEA 3DNEA 4RRVA 4BCGA 4E5AX 3C5IA 3KIOC 3UDTA 4DT8A 3DCVA 3UIBA 5HVJA 4RJ8A 5DN3A 3GB2A 4XV2A 5CASA 1TQMA 1H27A 3UODA 4G3GA 3FQEA 3PRIA 3GU6A 3ULZA 4USFA 5C01A 3VNTA 4RX8A 4RIOA 3ZCLA 5KMJA 4C4HA 1BKXA 3RNYA 4HZSA 5L2IA 3NSZA 2W99B 3BEGA 3OXTA 3OWLA 3H3CA 1KUTA 5KZIA 3KF4A 5I9YA 3PP0A 5AAGA 3EHAA 2VWVA 3AT2A 1YHWA 3ZMMA 3UQFA 3C4WA 3JVSA 4L7FA 3RZBA 3KMWA 3JVRA 4WNOA 4DDGA 4JL9A 5KKRB 3SVVA 5HVYA 5IUHA 5H8EA 1Q4LA 3RP9A 4EH5A 3LQ3A 4RVLA 2JKQA 3OUNB 3W8QA 4P5ZA 4W4WA 4ACHA 4DGLC 3Q60A 4FTRA 3G5DA 4O0WA 2C6DA 5DPVA 4U79A 2F2CB 3W0RA 3D7TA 4CG9A 4GKIA 3DZOA 5HI2A 3PJCA 5AEPA 5DIAA 2W1EA 3O8TA 4K77A 2XNPA 4I4FA 4U97A 1OKZA 4PP7A 4ZJVA 4NCTA 3UOLA 2C5XA 3U9NA 3FI3A 4AOIA 1F3MC 4QO9A 2BILB 3UNJA 4EOQA 5HCXA 3ZO2A 1REJA 5IQFA 3R71A 4IVCA 4RQVA 5CAOA 3TMOA 2HY0A 3ORTA 4FEWA 3RJCA 1RDQE 4P90A 2WU6A 2OBJA 2CGXA 2OH4A 3LFCA 4L9IA 3UMXA 2QO9A 4PNIA 4ZTNA 3NRMA 1ZYJA 2CMWA 3D15A 2YACA 2WMRA 3RHXA 4F9YA 3PG3A 3OW3A 3QTIA 2YIXA 2OGVA 4OTHA 2XRWA 3NUYA 4P4CA 1HCLA 4FKSA 1QPJA 2RKUA 5DRDA 2BRHA 4BHZA 3D9VA 4XV3A 5E1SA 2CN5A 2XNBA 3NIZA 3Q04A 3UP2A 3W0PA 2PVHA 1NVQA 4EZ5A 3JY9A 5LCKA 3BU3A 3QWJA 2ITTA 2RFNA 4L46A 5EW3A 2VTAA 3OBGA 2X8EA 2DQ7X 3P1AA 4BI0A 3GT8A 2P55A 3DNDA 2O64A 4CLIA 1U59A 4G6OA 3LKMA 4PUZA 2B9HA 3BRBA 4AACA 4Y83A 3RGFA 3CP9A 4ZSLA 5FEDA 4AXCA 5IUGA 3VUKA 4C4GA 3ANQA 4FL1A 3DKCA 4DYMA 4EOMA 5EDPA 2XJ2A 5CSPA 4I0RA 3F5GA 3G90X 1FBNA 2PZPA 3EOCA 2G9XA 4FZAB 1R0PA 3TNWA 4I20A 1DS5A 4AN9A 3EN7A 4YJTA 4RJ5A 5ANIA 2X4ZA 3I60A 1T46A 4BIBA 3R02A 3GCUA 4FTMA 4U6RA 2Z02A 3TV6A 4BDJA 5GINE 4LUDA 5J8IA 5IQDA 3PXKA 1Q97A 2BR1A 3Q4ZA 3LCOA 4WSQA 4WUAA 4PMTA 3DXNA 3S1HA 3HA6A 5BVKA 2AEGA 5M09A 4QP4A 4JI9A 5DE2A 4YSMA 4LGHA 2W1IA 5I9UA 3EYGA 2CKQA 3VS0A 4EYMA 5HZNA 4LI5A 4O0YA 3E62A 3B8QA 1SVHA 2UZOA 2WFYA 3F5UA 3FYKX 3MSSA 4QMVA 2VTLA 2VRXA 3QXOA 4M14A 3V6RA 4D55A 4OTIA 4ITIA 5ANGA 5FGKA 4Q9ZA 4MXCA 5KMIA 4YLLA 5ANEA 3GCQA 5I9ZA 2PVRA 4EOSA 3RTPA 4TN6A 3KEXA 3QUEA 2ZYBA 3A7FA 1PXPA 3AGMA 1DAYA 2QOLA 4BWXA 4E4MA 5IA5A 5LWMA 4PMSA 4JXFA 4WG3A 4JDJA 4F6SA 3FZ1A 3Q96A 4UV0A 4MNFA 4QTCA 5DR9A 4AG8A 3UPXA