5GHVA

Crystal structure of an inhibitor-bound syk
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
273
structure length
265
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase SYK
publication title Crystal structures of spleen tyrosine kinase in complex with novel inhibitors: structural insights for design of anticancer drugs
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 265
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ghvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ghvA01
4FTUA 2FGIA 4DFLA 5M07A 1JSUA 2XJ1A 2XKDA 4G16A 4LGGA 5HQ0A 2V7AA 3ACJA 1AGWA 3RHXA 3EKNA 4BCFA 4RPVA 3F7ZA 2WELA 4W4WA 5HBJA 4DGLC 3H10A 3SX9A 2PZIA 5E8YA 4HVGA 3C51A 5A4TA 4NU1A 1LEZA 3IPHA 4BKZA 2PE2A 3IO7A 4O7LA 3IW7A 2QKWB 2UZOA 3HGKA 4FICA 3FQHA 2CNQA 4JLCA 4WO5A 1O6LA 2WEIA 3TZMA 2XF0A 3LCDA 4QP1A 4X21A 5M55A 5HTCA 4M66A 4C7TA 3VF9A 2W4KA 3O23A 2J9MA 1XBCA 1Y6BA 4I5MA 3D7TA 4JBQA 2WPAA 2YJRA 3Q52A 4QPMA 4ZXTA 4ZJIA 2WNTA 5DE2A 2NO3A 3UPXA 1KE7A 4WBBB 2WGJA 4G6LA 3FLYA 4FSTA 4NFMA 2XVDA 2YAAA 3FZSA 4IAFA 3RM7A 5T3QA 2WZJA 4ASXA 3LKMA 1DI8A 3EFLA 3C4WA 4YTFA 4NCTA 4RJ7A 4V04A 2BDWA 3A99A 3R8MA 5DOSA 4AAAA 4ZIMA 4DEBA 1PMUA 5GIPE 2JDSA 3RWQA 2QURA 4EH4A 4E6QA 3D5VA 4FA2A 5C8MA 3VW6A 1XQZA 1QCFA 3N4TA 4DT8A 5IU2A 1GOLA 3K54A 4AA4A 2JIUA 2GFSA 2YEXA 3COMA 5CQUA 1K2PA 4D1XA 4MK0A 5J7BA 1ZY5A 4FI1A 4J1RA 5AM6A 3SXFA 2G2FA 3C50A 4ZEGA 2C5OA 4AOTA 3HVCA 4NIFB 1J1CA 3SW7A 3QLFA 3F5XA 4DGGA 4U42A 3OUNB 2B9IA 2HWPA 2J5EA 3R1NA 4AN9A 2XIXA 1AD5A 1XH7A 4MHAA 4DEEA 3GCUA 2IVTA 4FR4A 3DS6A 4XV1A 5FM2A 4FK3A 2IZUA 3TNWA 4FV8A 2OXDA 4O0UA 4PDPA 3LPBA 3QBNA 4FTOA 1PXKA 4IFCA 3TDWA 2WTKC 4IX3A 4DG0E 5JFXA 5CENA 5AAEA 3OEFX 4IWQA 5IH5A 4GUEA 3HAVA 4FTIA 5EHLA 4U79A 4EK8A 3L1SA 1UU7A 4OT5A 3LFNA 5F1ZA 2XNPA 2XIRA 2PZRA 4FEVA 1IA9A 4FL3A 3AOXA 3I7CA 3OBGA 3OWLA 4FSUA 4M13A 5CS6A 1S9IA 5EDPA 4IAIA 4E93A 3QGWA 2HY81 4ZLZA 2YZAA 3BKBA 2ITPA 4LGHA 3UMXA 4D4VA 2YIWA 4QP6A 4U45A 2RF9A 1K9AA 5FP6A 4AA0A 5J95A 5HGIA 4AOJA 3R30A 2WTCA 4K11A 5AUVA 3MY0A 4U5JA 4A06A 4CKRA 3PXRA 3GQLA 5JN2A 3HMPA 2G2IA 5T6KA 4QMVA 4D55A 4DYMA 4AW0A 4CFUA 5LVOA 1MQBA 4J99A 3UNKA 3ZLXA 3LCTA 3EKKA 1J1BA 3VUDA 1GIIA 4GJ3A 5D1JA 4FIHA 4JQ8A 4M0ZA 5AV4A 3PXFA 4HOKA 3A7JA 3GU7A 5EM8A 1KUTA 4TWPA 3ZUVA 5FG8A 3B8RA 3VS2A 5DYJA 3VUGA 3N9XA 2GCDA 4BGHA 1SNUA 3PIYA 3OOMA 2W05A 4JAIA 5H8BA 3V8WA 3RK5A 4GK2A 3HZTA 1Y57A 3RAWA 3L8VA 1JSVA 2YIXA 3LMHA 4O0WA 3DFCB 4FV6A 4DH5A 4IWPA 2C6TA 2OJJA 3N4VA 1GIHA 1LEWA 2WMTA 3KN6A 4L00A 4AZTA 2VTMA 4EOKA 4BCMA 3PXYA 4P4CA 5DPVA 4S33A 4C34A 5KMLA 4ARKA 3TXOA 3DGKA 3DXNA 3Q2MA 3W2QA 2OJGA 4IFGA 4EOMA 2BDJA 2EXEA 3P79A 1O9UA 4I20A 4A9TA 4KKGA 3Q9ZA 3KXHA 4BIEA 3VO3A 3W1FA 2B0QA 3CJFA 1E1VA 5CU6A 4FTNA 4PTGA 3DZOA 5IQAA 5IPJA 4BCGA 5BUEA 3TUBA 1K3AA 3E88A 3FJQE 4X2FA 2UV2A 4PTCA 3OS3A 2VWUA 3RPSA 5GZ9A 4U97A 4N4SA 4FK6A 5FM3A 4J52A 3IG7A 1BI7A 3DXPA 4IVDA 4FTKA 4GU9A 4PPBA 1ZYCA 4G9RA 3EQFA 4O0RA 1I09A 4I4FA 4ZS0A 4MKCA 2BTRA 1YDSE 5M06A 1M2PA 1IRKA 3VS3A 4XX9A 5E8VA 4F99A 4DF3A 1O6YA 4M3QA 3E63A 4EOPA 2JDTA 2RKUA 3GI3A 1WVWA 5KE0A 1URWA 4IVCA 3UIUA 4ZZMA 2P0CA 4BB4A 5AR4A 4BIBA 4I1ZA 2F2CB 2B9JA 3I0QA 5FUTA 1G8AA 3B2WA 3EFJA 2RG5A 3ULZA 4ZMFA 4G2FA 3H4JA 2A0CX 4I94A 4YLJA 3BYMA 4ACGA 3EN6A 4C3PA 4DFXE 4IWOA 3PVBA 4GRBA 4RJ8A 2XNMA 5AAGA 4F4PA 4JG6A 5CAUA 3PJ3A 3RALA 4PL5A 3MFSA 2LAVA 3TTIA 4A4OA 4DFNA 1CDKA 2BILB 2BR1A 3WILA 2CPKE 4RJ5A 3AC5A 3P7AA 4J71A 2W17A 3BYUA 3IQ7A 5EI2A 4EUUA 3GU6A 4PMMA 4FEWA 4AACA 1WVXA 4QYFA 3U8WA 4FV4A 2WTDA 5JGDA 3TUDA 4ALWA 4FKJA 3V5QA 5L6PA 2IWIA 3NAYA 2QLUA 3PY1A 1SYKA 2OWBA 5ANEA 2JAVA 2PZYA 4RQKA 3DCVA 5K0KA 3QUPA 4Q5EA 4YZBA 4I6QA 3G0EA 5ANDA 1VZOA 3EFWA 4Y85A 2ZOQA 2XH5A 2LGCA 3DU8A 3EWHA 1PJKA 4APCA 4BDJA 5A4LA 4MEDA 1CMKE 4DCEA 4IAZA 3I6UA 2NRYA 4IACA 4O84A 2GNGA 3HECA 4I5PA 1KSWA 2YM3A 3PSDA 1CKPA 3OROA 4P7EA 4RIYB 4L53A 5AUYA 5BVOA 2OG8A 3AC3A 4XV2A 2XNNA 3ZOSA 5IKWA 1UU8A 1YHVA 1Q8YA 2WMWA 4JT3A 4F7SA 3Q60A 5JZJA 2B53A 4WRSA 5FD2A 2UW7A 3AGLA 3MJ1A 2QO9A 4F6UA 4PQNA 5H2UA 2VTTA 2C6IA 2JAMA 1X8BA 3E92A 3FLQA 4CFMA 4BI1A 4DINA 2Z7RA 5CF8A 5LMKC 2PPQA 3BWFA 3QTUA 4EKKA 4AW2A 5IA5A 4EYJA 3R7VA 2QG5A 2V7OA 3TV7A 2Y9QA 5BVNA 4JDJA 3UVPA 1UWJA 4ACMA 3TZ7A 4NJ3A 1IAHA 1M2RA 4FTRA 3MH2A 3TL8A 4XG2A 3UYSA 2H96A 3TUCA 1XH9A 3W16A 1YHWA 4TYGA 2OGVA 3AC8A 5M51A 1NY3A 1YOMA 1WZYA 3Q9YA 4JDKA 4JBPA 4MF0A 4YJTA 2W9FB 3FI4A 4HPUE 2IO6A 3QU0A 1B6CB 2R0UA 4AN3A 5J9ZA 2WOTA 1YOLA 2R3QA 4EBVA 4NIFA 4C0TA 3B2TA 4ZOGA 1H28A 5GNKA 4XMOA 4WOVA 4PDYA 1JKLA 1XR1A 1M14A 3HMIA 4FTTA 4V0GB 1Q4LA 4EH7A 2H6DA 3E62A 3HRBA 4G34A 5CSXA 3NWWA 2ZYBA 4O7RA 3VBYA 4RQVA 3FKLA 4I23A 3W8QA 5CI7A 3SQQA 3WOWA 3GQIA 5I0BA 1HCLA 4XCUA 4BCIA 1PRYA 2FUMA 2DWBA 3PDTA 3JY9A 5AP0A 5KMIA 4ACDA 3QXPA 3LAUA 5HEZA 2C6LA 5AA8A 4OLIA 5KZ0A 5J79A 4D9UA 4BDIA 5IEVA 4XG4A 4FIIA 2WEVA 3RZBA 3GC8A 5BUJA 3CS9A 4RWJA 4XP2A 5LXMA 5CF4A 5M53A 2BAKA 2YERA 4BL1A 4HYHA 3OWPA 3NUSA 3UIXA 3O71A 5KBRA 3C4EA 1PKGA 1UVRA 3E87A 3GC0A 2OZOA 5ACBC 3PY3A 4RX5A 5CALA 2Q0NA 2WHBA 4AZFA 2HZNA 4YLLA 3WZUA 4FX3A 5CY3A 1P2AA 1FVVA 4EOSA 4FG8A 4GVJA 5E8XA 3MPTA 3PA4A 4WT6A 2C5YA 4FNZA 4YJPA 3DAEA 3I4BA 4BDBA 4I21A 4XLVA 3I6WA 3JVSA 5CVGA 4QD6A 3W2RA 5HNIX 4M15A 4XV9A 4FKIA 3FMLA 5J5TA 3OCTA 3FXZA 1GIJA 3OF0A 4QTCA 2J0JA 5D11A 3EQCA 3HRCA 1YHSA 2PZPA 5AR2A 1JKTA 2WMQA 2VTOA 4AZVA 3RVGA 3LXNA 4BZOA 4O81A 1CTPE 4E6DA 3HV5A 4YLKA 2FVDA 4WUNA 4RVKA 3C0GA 3K3IA 2VX1A 5IA0A 2GNIA 5AFVA 3KULB 3LCKA 5HBHA 2BMCA 3L8XA 4KBCA 5IA4A 1LR4A 1H1RA 3V51A 1NW1A 4EZ5A 4AG8A 3MB7A 5L8LA 5AV0A 4CLJA 1W82A 3UOKA 2XK8A 3ZLSA 3H0ZA 4ASZA 1A48A 4DT9A 2V0DA 5HI2A 4C36A 3W32A 4DFBA 3TACA 3V01A 4YO4A 3ZRLA 5HCYA 5LMAA 4X2JA 4EOLA 4IM2A 4TN6A 4FKGA 4WA9A 4FEQA 4YC6A 3WZJA 4CKIA 4FT3A 1OKWA 4EH3A 5I5ZA 4C61A 1KE5A 2CGUA 4WKQA 1PKDA 1IG1A 2R5TA 3RPVA 4YJVA 1YXSA 5J7HA 4HGEA 2RGPA 3V3VA 5HU3A 2Q83A 3CGOA 4XG3A 3CKXA 3KXMA 3QA0A 1YWNA 4EHVA 3A7IA 4NK9A 4B8LA 4UWCA 4OTHA 2Q0BA 3MH3A 4U6RA 4XG6A 3MPMA 3GENA 4KWPA 3WE4A 4NZWB 5AEPA 4R1YA 1YI6A 3JXWA 3AC4A 3GEQA 3L8SA 3P1AA 4FV5A 4U9AA 4O6EA 1DS5A 3O50A 5CWZA 5HIEA 1PYEA 5A3XA 2GTMA 3SW4A 1SM2A 4ANBA 4D2VA 4JX7A 3OT8A 4DTBA 2GHMA 2YAKA 4R7HA 5CAVA 2R3GA 2PK9A 4CT2A 2C3IB 1ATPE 2UZEA 1GZNA 5CEOA 2EB3A 3E3BX 3DK7A 3PJ2A 4ASDA 4HVSA 3B8QA 2OXYA 5LWNA 5CEKA 4O0YA 2HXQA 4C58A 1OVEA 1Q97A 2HCKA 2R3NA 3IS5A 4YNEA 4TPTA 1ZMWA 3FKOA 3FSKA 5C8NA 2ITWA 3ENHA 1OBGA 3S95A 5F95A 2OICA 4RIXB 2IW8A 2XUUA 4APPA 1A9UA 4K8AA 3TEIA 1F5QA 4AXAA 1ZXEA 1AQ1A 4MTAA 4EZ3A 4C4IA 4F9BA 1OGUA 4QMWA 4NW6A 1Y6AA 2RFEA 2UZUE 4NWMA 3U6HA 4CV8A 4FIFA 4XP3A 4F08A 3GUBA 5CXHA 4HYSA 5J87A 4MBLA 3COIA 4CGAA 2QU5A 2YITA 1DAWA 2WQNA 4OAVB 4ZJJA 3WZEA 4YR8A 4IX4A 4XUFA 3TNQB 3BZ3A 5EDQA 4M97A 3GVUA 1J91A 4FSQA 4E3CA 5KCVA 2PVRA 3WARA 1OPKA 3TJCA 2ZVAA 2E9UA 3QRTA 5BVKA 4CYJA 2V22A 1KV1A 4B7TA 2X8IA 4H58A 4EWHA 3PA5A 4RGJA 3MH1A 2UZNA 1YXTA 3KXXA 1XBBA 4CTCA 2UZWE 4QYEA 3ETAA 2FH9A 3NAXA 3R8VA 3HDNA 3RBWA 4M14A 1XH5A 2CN8A 4I93A 4L3JA 3E7OA 4RIOA 4U43A 5C8KA 2GQRA 2DS1A 3S4QA 3UJGA 3R9OA 3VIDA 1ZOGA 4MQ1A 1WBPA 4ANLA 4JDIA 4XHKB 2YM4A 1P4FA 3QHWA 4E5WA 3S1HA 3R00A 1YI4A 4CXAA 3A2CA 4WNPA 2CSNA 3ZRKA 2XNEA 1OKVA 4L68A 3GC9A 1RE8A 5JFWA 4OTPA 5EW9A 1H1PA 3L9NA 2UVXA 4TTHB 3MVJA 4DFYA 2CCHA 4DGNA 2BZJA 3ZM9A 3QFVA 4BTMA 2OFVA 4LV5A 5HNBA 3OEZA 2YA9A 3KK8A 2GNHA 5LMBA 3DBQA 5BVDA 5LCKA 5TOZA 3PUPA 3EJ1A 5D12A 4UX9A 5ETAA 4BCQA 4QTBA 3LFCA 3F3UA 4LOPA 5H8GA 4ZTSA 2GS7A 2O8YA 4JBVA 5HVYA 1PXMA 4TWNA 4LRJA 3KREA 3I7BA 3FY0A 2R7BA 4NYEA 2IN6A 4DA5A 2ITZA 3QALE 3SKCA 5IQGA 2XK9A 4YUQA 1HOWA 3QQFA 4HZRA 1M2QA 3UZTA 4YTCA 1OUYA 2ZV7A 4ZK5A 3GGFA 4BBMA 5AUUA 1PYXA 4TKSA 5I9VA 3DK3A 4NTSA 2Z60A 4EJ7A 5M09A 1R78A 5AR8A 1IAJA 2RFNA 5JH6A 5E9EA 2W9ZB 5A4QA 3S2PA 5EQEA 4O7ZA 4K1BA 5L6OA 4B4LA 3K5VA 3QZIA 3NRMA 3FZPA 1YRPA 3MV5A 5AR5A 1SVGA 2QOIA 3DJ6A 3ZLYA 4Q2AA 2JKKA 3LJ2A 3CR0A 4NFNA 3KQ7A 1XH8A 4LOOA 3ATSA 3MH0A 2P2IA 4KS7A 1WBTA 3AC1A 4OTRA 1P5EA 4YPDA 2XIKA 1OKZA 5DMZA 3I81A 3FZTA 5IUHA 4FZ6A 5M08A 2VTHA 3FPMA 4HVIA 2H8HA 3D5XA 4QNAA 4E7WA 4U7ZA 5M4FA 4EJNA 4QMUA 3ALNA 3Q6UA 5E4HA 2Z2WA 4GV1A 2CKOA 2XS0A 1U4DA 1BYGA 2OW3A 3AD6A 3ZCLA 3DKFA 4BKYA 1J7UA 4JX3A 2XJ2A 2C47A 4J95A 3F69A 3E64A 5D10A 5B7VA 4ERKA 5CAQA 5HVJA 4YSMA 3M1SA 3WYYA 2A1AB 4XJ0A 4JI9A 1UNGA 3H0YA 3TNIA 5CF5A 3MDYA 5JT2A 2CGVA 3AT2A 2BFXA 3MGYA 5CYIA 4B99A 4EH5A 1CM8A 4AQCA 2WB8A 1MRYA 1GZKA 5EM5A 2E9OA 5ITAA 4CZYB 2R0IA 3RINA 4D4RA 3O8TA 5BUIA 2QOHA 3KVWA 4FEXA 4PP9A 4L6QA 4QMXA 3OWKA 2P4IA 4KNBA 5C03A 5JK3A 3GCSA 3NCGA 5BYLA 4FT0A 4AFJA 1IEPA 3EFKA 4QP7A 5I9XA 1UU9A 4XEYA 5C01A 4O7TA 2BTSA 4WG5A 4FNWA 4BCHA 4J98A 3U6JA 3R73A 5FEQA 1YWRA 4U0IA 4G6OA 4Z3VA 1P4OA 2XP2A 3KMWA 1L3RE 2P2HA 3MFUA 3EQGA 3Q4TA 1R0EA 3ZZEA 3QZHA 1ZAOA 1PXPA 4N70A 5A6NA 3BX5A 2XNOA 3LFAA 3OXZA 1UU3A 3DJ5A 5AP3A 1R3CA 4CQGA 3KCFA 4M68A 4Z7HA 3UP2A 4GUBA 4UMQA 5FBOA 5HO6A 3VUTA 3UC3A 3FZRA 3UTOA 4FV7A 2JIVA 4O96A 2HENA 3ZBXA 5AUXA 4NM5A 4FEUA 4MXAA 4FZAB 3QA8A 4DGOA 4Z16A 1OMWA 3FC1X 5J5SA 4ORKA 4CD0A 3UYTA 3ORIA 4I6FA 3IOPA 1LP4A 4DEAA 3HMMA 2ESMA 2FSLX 2G2HA 2V62A 4IB0A 4NKSA 5FRIA 3WE8A 3AD5A 5M4IA 4CFXA 4KIKB 5H3QA 3HYHA 4AZSA 2VWVA 3MBLA 5IA2A 3UOHA 3DZQA 1GJOA 2OXXA 4KA3A 4D28A 3KRJA 3NYVA 1ZWSA 4FTCA 4AT5A 1JOWB 3COHA 2QONA 4HW7A 3G90X 1OL2A 5L6WL 1M17A 4DHFA 4IB5A 1Q61A 4GU6A 1MP8A 2GS2A 4BIDA 4BN1A 4IZ7A 4WSYA 2OH4A 4RIXA 3ZRMA 4BRXA 3ORNA 5E1SA 5BYYA 1PW2A 3F7WA 4FODA 5AIKA 4CMTA 3PFQA 3VS7A 5HX8A 4CCUA 3POOA 4R77A 5AIRA 4CEGA 4XV3A 3UIMA 5CQWA 2Y4IB 4MD9E 4HYUA 4BDHA 3VVHA 5DLSA 4TW9A 1LUFA 2C5XA 5D7AA 4CFVA 4C37A 4IADA 3UP7A 3D4QA 4XG9A 3CD8A 3ZO1A 4C02A 3QRKA 4OTIA 3G9NA 4U40A 4XP0A 4FNXA 4H1JA 3P78A 3PE2A 4DFZE 2NPQA 4K0YA 3LZBA 4ID7A 1TQPA 3PVUA 4BC6A 4EQMA 1ZOHA 5JRSA 5IMEA 3PA3A 2CLXA 3R02A 4D0XA 1WVYA 3QX4A 3R1QA 4QO9A 3VC4A 4FKTA 4C35A 3TTJA 4EKLA 4YTIA 2QG7A 3I5NA 3KKVA 5ETIA 5LQFA 2OZAA 2IJMA 2B52A 5DT0A 5DGZA 4KUJA 4BWKA 4ERWA 2GS6A 3BHYA 5CXZA 3AMYA 1FQ1B 1OI9A 3NEWA 4G17A 5E92A 4UMPA 1KOAA 3F2AA 3MYGA 3W10A 4ZZOA 5E91A 3EHAA 5B2MA 5IZFA 5HD7A 1L8TA 5ETFA 2EU9A 3BYVA 1XHAA 4BYIA 3P7CA 2BROA 3OMVA 4LFIA 4FL1A 4BCNA 3GCVA 3I60A 4IANA 2JDOA 3G15A 1OECA 2XK6A 4QQTA 1G8SA 3ZUUA 5L2WA 1YW2A 2NRUA 5AP5A 3QCSA 3DKCA 3S0OA 1H01A 4WNOA 4BDAA 4UWBA 3H30A 4PL4A 2WQMA 4R7BA 3EQIA 2VX3A 3FLSA 4M67A 3R9NA 2BPMA 2UW5A 4YHFA 2CNVA 5J9YA 1RQQA 2YN8A 3MN3A 1ZZ2A 4TYIA 1V1KA 3VQHA 1DI9A 2ETKA 3VAPA 3WIKA 2C30A 4GCJA 4GT3A 3LJ1A 4RSSA 4Y8DA 4AZWA 5IDNA 3F2RA 3D5UA 4LOQA 4YJSA 1PHKA 4DH1A 5L3AA 3TV6A 3Q04A 3TZ9A 3GCQA 4IHPA 3KL8A 2R3HA 1Q3WA 5BYZA 5EOBA 3F5PA 3BI6A 5AP4A 4FV2A 3AQVA 3C7QA 3PJCA 4IZAA 4GG7A 4E4NA 5HIDA 3ZS5A 4NUSA 4RFYA 2Y4PA 4E20A 2XYNA 3DLZA 4F65A 5A46A 4PTEA 4R3CA 5DHJA 2R3LA 3D15A 2OIDA 4QP2A 2R3JA 2F4JA 2ZV8A 5FDXA 4U8ZA 5AP6A 4BCKA 3UZPA 5L8KA 3ANQA 5JFSA 1ZRZA 2VWZA 4E26A 1H27A 4A9YA 3GXLA 4C2WA 5ANGA 3U51A 2HELA 4B9DA 2YISA 3MFTA 4F64A 5BVEA 2BCJA 4IDTA 5TT7A 3G0FA 3ZONA 4IAKA 3LLAA 4L3LA 3BEGA 5TKDA 3ATTA 2H9VA 3KGAA 3QD4A 4FVPA 4Q9SA 3PG3A 5CAOA 4A4XA 3OOGA 4IVAA 5CEIA 3ORZA 2X8DA 4QYGA 4UMTA 2JIIA 4WNMA 5D7VA 2JBOA 2WTJA 3BGPA 5BMMA 3ZSHA 3JYAA 4GL9A 5AJQA 5KUPA 4RZVA 4DGMA 3AMAA 3LCOA 4H3PA 5CEQA 4AS0A 4UZDA 3R1YA 4NEUA 2OI4X 3V8SA 4YJNA 3D2KA 2ITXA 1TQMA 4QPAA 4WUAA 4X6QC 5EYCA 3VQUA 2OSCA 2X7OA 4FKUA 5DNRA 4MXZA 2F49A 3BWJA 1YXVA 3AG9A 3KXGA 1UNHA 4L52A 3DBFA 2X2MA 2VO6A 3TT0A 2ZB0A 1J7LA 3EB0A 4IX5A 1NA7A 4QP3A 2VNYA 4BY9E 4BDCA 4QMNA 4Y73A 4YZ9A 1APME 5E8UA 3VS0A 4RJ4A 5DT4A 4UB7A 3SD0A 4EOQA 4RFMA 4EC9A 4KBKA 2GPHA 2UZDA 3CTJA 4UY9A 4QMOA 2YCQA 3R04A 4AE6A 3HDMA 3TKUA 4G3FA 4ZTRA 3KFAA 4BCJA 4UALA 4JS8A 3RCDA 4AW1A 2YZLA 1F3MC 2XCHA 3MW1A 4HCTA 4O0XA 4ANOA 5LVNA 4IAYA 4FTMA 5JZNA 1IASA 4A9RA 4EL9A 2R3RA 5CX9A 5I3OA 3RK9A 2JKMA 3IDBA 2BDFA 4MQ2A 4AW5A 4O86A 3MY1A 3WF6A 2PWLA 3R7IA 3QWJA 1WBWA 4X2GA 2PVLA 3ORTA 5LVPA 4FSYA 3UQCA 2XIZA 3VJNA 1FOTA 3V6RA 1VJYA 4FT7A 5DI1A 4HNIA 4F9WA 1Y91A 3PSBA 4PMSA 2R3IA 3BU6A 3DKGA 3WF8A 1BL7A 3QTQA 2J7TA 4BTFA 5IUGA 3LIJA 3MB6A 3VN9A 1SMHA 2Y4IC 4CFNA 4F0IA 4I0TA 4O0VA 5AWMA 2W1CA 3PZEA 1Q8TA 2VWYA 3LFSA 4HGSA 2ITVA 4RX8A 2B9FA 1XKKA 3DBDA 2W5BA 2VU3A 2DQ7X 2W7XA 2VTRA 3DB6A 2R3OA 3QKKA 2CLQA 3E7VA 4KIKA 3QRIA 2HZ4A 2VO7A 2XK4A 4RVMA 5DBXA 3W2PA 4EOJA 2OIQA 3NUUA 4X0MA 3VRYA 2R9SA 4FOCA 4AF3A 5J1VA 3QUDA 3G6GA 4ZZNA 4IW0A 2R7IA 2PVKA 2HY0A 4QMSA 5F4NA 4CSVA 2QOKA 3BCEA 2VV9A 3EMGA 2YLFA 4DH3A 4R1VA 3CQEA 2J0LA 3BRBA 2H34A 3SG8A 5DH3A 3SHEA 5C26A 4JNWA 5HU9A 5A4EA 4RZWA 2JLDA 2WU7A 2W1IA 4ASEA 4W4YA 3PRFA 2F7XE 4CYIA 5IQIA 3MIYA 4QMTA 2A2AA 3H9RA 3NSZA 5DIAA 5IQBA 3KRRA 2WQBA 3E93A 3VBQA 5K5XA 3FSFA 3C4FA 2JKQA 3KF4A 3NW6A 4GK4A 5GJFA 4I41A 4LGDA 2XRWA 4TNDA 4YZDA 5EHOA 4YJRA 2BRMA 3U9NA 3WF9A 4TWOA 2ONLC 5ACKA 2PL0A 2VWXA 3LFEA 2XRUA 4W4VA 5EYDA 3G33A 2Y6MA 2P55A 1B39A 1GZOA 3ORLA 2QOLA 4C4GA 5IQFA 5DT3A 1XH4A 2VZ6A 3LFDA 4H36A 3QKMA 3AT3A 4G3CA 3R8PA 3VF8A 4B6LA 5BVFA 3EZRA 4D2RA 1VYZA 3GU8A 4NM7A 5HCXA 4GFGA 2VTAA 3QCQA 2ERKA 1OB3A 4K2RA 3LXPA 2F57A 1RJBA 1XBAA 1ZMVA 2J0KA 4EK6A 3OBJA 4JOAA 1M7QA 2BRBA 4H3QA 3OC1A 2PVHA 1URCA 1U59A 3BEAA 3KC3A 4ANNA 5K4IA 3OTUA 3U4UA 4DBXA 3A7HA 2G15A 3IW6A 4PV0A 4RBLA 3EQDA 4HCUA 4P5QA 4YNOA 4C4EA 3QX2A 2B54A 2VWIA 4BBEA 5J9LA 3G2FA 3BQCA 4LYNA 1FMOE 4KB8A 1WBOA 4Y5HA 3RNIA 3MESA 2Y7JA 3P08A 2WQEA 4W8DA 3BBTB 4FKLA 4YJOA 5C9CA 3LFFA 4QTEA 5LMKA 2GHLA 3LCSA 3PLSA 3V5WA 4LUEA 4Z7GA 2ETRA 2OFUA 2VWWA 5CF6A 3R71A 5IH4A 2OF2A 3MS9A 4IJ9A 1QMZA 3OCSA 5JQ8A 4LV8A 4FKVA 4S34A 5CTPA 4CT1A 3KU2A 4O22A 4QRCA 3PP1A 4WD5A 2HAKA 5CNNA 4IX6A 4KABA 3R8ZA 2X9EA 3TDVA 4LQMA 4D1ZA 3SA0A 4BDEA 4FG7A 4RMZA 4PDOA 3GFWA 4ENXA 4L8MA 2EWAA 1FBNA 2BKKA 5KX8A 5BPYA 4MAOA 4CRSA 4D4YA 3KF7A 4OBPA 3ZDIA 3S3IA 2HZIA 4PX6A 2PU8A 4D2TA 3H3CA 4JBOA 4RA4A 3QTXA 2I0YA 3BBWA 1H26A 4XRLA 1Y8GA 3E8CA 3FI2A 3WIGA 2WTVA 4YTHA 2W4JA 4MD8E 4DBNA 5FTQA 1VYWA 3Q6WA 2JDVA 3TN8A 4C3FA 3GOKA 5CVHA 4FIGA 2NNWB 3POZA 3TIZA 3QD3A 4FKWA 3A4PA 4ZY6A 4QYYA 3BGZA 3ZSGA 2B9HA 3QTZA 4MH7A 2HXLA 3ZFXA 2ZAZA 4BHNA 1REJA 2W1EA 5A9UA 2I6LA 1CKJA 3BHHA 4O0SA 5FXRA 1JQHA 5HG9A 5T68A 4ZTQA 5CEPA 4ITHA 3AXWA 4FSZA 3RAKA 3KXZA 2O5KA 4EK4A 4TL0A 2WD1A 2QODA 4UYNA 4AGWA 3RNYA 4I5HA 3V5PA 4C3RA 1YWVA 2W5HA 3UOJA 3M11A 5HG8A 3FMNA 4DAWA 3QQLA 4EONA 4OBQA 2O2UA 5HZNA 5HORA 2VNWA 5IDPA 3ZFYA 2HYYA 3UVQA 4FVQA 4MX9A 2E9PA 4IE9A 4O1PA 3TKHA 4ANSA 4CQEA 5IQHA 3KEXA 3FI8A 4YO6A 1WBVA 1BI8A 4Y83A 3CPBA 3R2YA 4QNYA 2QU6A 3KMUA 3Q3BA 3RP9A 3LQ3A 4W8EA 4TT7A 3JR1A 3RPRA 1GY3A 2CCIA 4C4JA 2B1PA 3EL7A 3THBA 4AGCA 3DDQA 4QMLA 2UZBA 2XBJA 3MJ2A 4ANMA 4DEHA 5IH6A 5EQPA 4O2PA 2WMXA 4PMPA 2RSVA 5GHVA 1T45A 2A27A 3PWDA 2C1AA 4IMYA 3QL8A 2VTLA 1B38A 3OCBA 1MQ4A 5DG5A 2OJFE 4KINA 4QPSA 5GZAA 5CZHA 3HLLA 5KNJA 4LL5A 2BKZA 4TYHB 4X3FB 1FGKA 3Q2JA 4FVRA 1M52A 1KE9A 4E5AX 3A60A 4K6ZA 1Q8WA 2OU7A 3D2IA 3G6HA 3RWPA 2P3GX 1OM1A 3R22A 4ZY4A 3IOKA 4IDVA 4O82A 2C6KA 2J50A 4FSMA 4ZTMA 4F1MA 1UKHA 3N51A 4GFMA 5I4NA 1KWPA 3C5UA 5BX0A 3TWJA 1Q8ZA 1Z57A 3SGCA 1G3NA 4ZP5A 3SOCA 3ZO3A 4KAOA 2UW9A 3C4XA 4JR3A 3W8LA 2YACA 3QRJA 4JQEA 4S31A 5ANJA 5TO8A 2NP8A 3UG2A 3D14A 4EH8A 4AT3A 1OL7A 4C2VA 4ANQA 3NDMA 3R8UA 5JGAA 2QOQA 3ODYX 4NW5A 4MF1A 2CJMA 5GJGA 3FMEA 4O1OA 3DT1A 2E2BA 3V5LA 3PPKA 4IZ5A 2VO0A 3VHEA 2CNUA 3KB7A 4U81A 1RDQE 4OTWA 3NUAA 2Z8CA 3R83A 3TZ8A 2WMBA 3TCPA 3ET7A 3ALOA 3I79A 5CU2A 4ZSLA 3FQSA 3MFRA 2QOCA 4O38A 3ZU7A 4U80A 3MSSA 4QMYA 3OVVA 3D7ZA 4HGTA 3DPKA 3R28A 1JBPE 4OTDA 3RMFA 4CKJA 5HTIA 2XZSA 3Q4ZA 3KK9A 4IC7A 4UWYA 3W18A 5KHWA 1REKA 3FL5A 4FV0A 2R3MA 2R3PA 3GU4A 5DA3A 4RIYA 1T46A 4QP9A 3UNJA 3QYZA 2CGXA 2B7AA 1PXNA 4XOZA 5BVWA 3O7LD 5JMSA 3ERKA 5E8WA 2UUEA 5E8ZA 1OL1A 3OW4A 4IXPA 1HCKA 4L9IA 1DM2A 3ZC5A 2UVZA 3NZ0A 4J7BA 3C9WA 3QWKA 4WG4A 2PVYA 3OTVA 3O8PA 4I3ZA 4XYFA 3CTQA 2XB7A 3AT4A 3HV3A 3ROCA 4BYJA 3QRUA 2C0IA 3PPZA 2C0TA 4GT4A 4HNFA 5L2QA 2X6EA 2R3FA 3QXOA 1H8FA 3KRXA 2G9XA 4Y46A 3PIXA 4FV1A 2VTNA 1U5QA 1PXOA 2X6DA 4RWKA 3R8LA 4DG3E 3IW8A 4EUTA 1H00A 3W33A 2OO8X 4E1ZA 1JPAA 3PE1A 4BDDA 2A19B 2EVAA 2ZV2A 1V0PA 1ZY4A 3FHIA 3NYXA 3VUHA 3WZKA 4D2PA 5C1QB 5B0XA 5I9YA 2Z02A 2BRNA 3OD6X 5F20A 4ACCA 1OIQA 5KMNA 2JITA 3FXXA 4FKPA 3ORMA 4BDGA 3E3PA 3RGFA 3CEKA 2BHHA 5AX9A 3R2BA 1M7NA 3O17A 4V0GA 4L45A 3ZUTA 4ZLYA 3LLTA 3BIZA 5LCJA 3ID6C 4H05A 3COKA 4Y5QA 4G3GA 1KOBA 4J8MA 4G9CA 4OTQA 4PF4A 4QP4A 1YI3A 2XYUA 3TNPC 2QC6A 3BV3A 2QNJA 4XG7A 2Y6OA 3F66A 2PMOX 5FEEA 3DB8A 3GT8A 5HE1A 5B2LA 4LRMA 5ANOA 2QO2A 4MD7E 4IVBA 4AU8A 3K3JA 5FXQA 2VGOA 4NM0A 2R4BA 3DXQA 4AZEA 3EN9A 4JRVA 3A61A 2AC5A 3Q96A 3SC1A 3TJDA 3DY7A 3IGGA 4MNFA 3P0MA 4FT9A 4RC4A 4PDSA 1FINA 3F61A 3O2MA 4GEOA 3DV3A 3I5ZA 4RT7A 3R7UA 2HWOA 4BTKA 2VRXA 1U54B 5CVFA 5KO1A 2GU8A 1ZZLA 2YHVA 5M44A 2PMLX 4LMNA 5K5NA 3ZYAA 5JRQA 1V0BA 2XNGA 3A8WA 5EM6A 4O6LA 1W98A 4O7WA 3T9IA 3CKWA 4GYIA 3UIBA 2F7ZE 3DKOA 4UEUA 4RFZA 4HVHA 2DYLA 3HMOA 4OR5A 5LVLA 4AGDA 5EW3A 3VUMA 2W99B 4QQ5A 4OGRA 4ZAUA 5DN3A 2QD9A 1BX6A 4MXXA 4RG0A 4YC3A 4TYJA 3C5IA 5I9WA 2GNJA 3QC9A 2PVNA 4EOOA 3QYWA 3ZMMA 3FMJA 2G01A 3CLYA 1KE6A 4MXCA 1Q62A 2XK7A 4O7YA 4L43A 3NPCA 3D0EA 2XBAA 3ITZA 3UQFA 2YWVA 2WKMA 4CMUA 3NW5A 2OKRA 3UOLA 2R3KA 4IB3A 4M84A 1JLUE 5M4UA 3U55A 5FLFA 3ZZWA 4EWQA 3C1XA 4ALUA 3ZDUA 5LOHA 4GS6A 2WFYA 4RIWB 3KULA 4IQ6A 4EK5A 5ICPA 3OY3A 3CXWA 3Q4UA 3Q9WA 4Y72A 3ZFMA 2UVYA 4YMJA 4X3FC 2WMSA 5EI8A 5B2KA 2WIPA 3CJGA 3PTGA 4P2KA 1JWHA 4RWLA 5KZIA 1PMEA 4YZNA 5IUIA 3LQ8A 4DTKA 4FV3A 4ITJA 4YC8A 5F9EA 3E8NA 2PUIA 1QPJA 3CY2A 3NNUA 4BDFA 2CN5A 1H0VA 4WHZA 3UC4A 1KE8A 4N57A 3QQJA 3FWQA 4XOYA 5HLNA 4F1TA 4G1WA 4ACHA 5E7RA 1XWSA 2W0JA 4FNYA 4D4SA 3W2CA 2BRHA 3ZLWA 3RAIA 4YJQA 3WF5A 2CMWA 3FC2A 4FGRA 5EH0A 4ZSAA 3LVPA 4KSPA 4YJUA 5KKRB 2XKFA 3PIZA 4DN5A 4RX7A 2QO7A 5CT7A 3VWAA 1FGIA 3BELA 3BHTA 5HCZA 1STCE 3GB2A 4MBIA 3TM0A 3FUPA 2FA2A 3M2WA 3VBTA 4YZCA 4MYGA 4C4HA 3PZHA 3TI1A 4PP7A 3H9FA 5HO7A 4TYHA 2OJIA 2RIOA 3LM0A 2X0GA 3CSVA 3G5DA 4LL0A 5HE2A 2JGZA 4I6HA 3II5A 4Y95A 2EB2A 2G1TA 3BE2A 5AV3A 4Q9ZA 5J8IA 3PWYA 3P23A 2PE1A 2KTYA 1OITA 2RFDA 2X4ZA 2X8EA 3RCJA 1JSTA 2WMRA 2FO0A 2XIYA 2HK5A 5EHYA 3R0TA 5JKGA 4CG8A 3IW4A 2O64A 4BCPA 1ZLTA 2XM9A 3RHKA 2W96B 4GIHA 2C6EA 4FTAA 5AP2A 2BZHB 2QQ7A 5G1XA 3F88A 3PRIA 3MA3A 4NCTC 2C4GA 3E8DA 3FMKA 3NNXA 5CI6A 4FUXA 3U6IA 3KY2A 3RPOA 2F7EE 2IVUA 4GFOA 4V05A 3UQGA 4BI2A 3UE4A 2BZKB 4S30A 4A07A 4A4LA 2O63A 3HRFA 1R0PA 3FV8A 3CD3A 3C0IA 2J0IA 5A4CA 2QLQA 3NR9A 3O8UA 2YWPA 3ZSIA 4MCVA 5EDRA 4R8QA 5H9BA 3PVGA 4K33A 4D2WA 4KKEA 3LHJA 5AV1A 4L3PA 5TF9A 2ETMA 3DOGA 4OAUC 3IK3A 1TKIA 1WMKA 2O65A 4FZDB 3GBZA 4UMRA 2YIQA 2A4LA 2I7QA 2PUNA 1PXLA 3R01A 5LARA 3PLAE 4NJDA 4F9CA 3C4CA 4GMYA 5FXSA 2W5AA 4HZSA 2ACXA 5E1EA 2C3KA 5CSPA 3HAMA 5DR6A 4FIEA 3LW0A 3HA8A 4F09A 2UW4A 3PG1A 3QC4A 1BMKA 2UW6A 3R63A 1GNGA 4CVAA 2XM8A 3C4ZA 3UVRA 2GHGA 2I40A 3R1SA 4QTDA 4F7NA 4D5HA 4IWDA 2QR7A 2GNFA 4ALVA 5A6OA 4DE4A 4BVUA 3JY0A 4FSNA 4G31A 4YP8A 4EORA 5L2IA 2EUFB 5TE0A 4AE9A 5IEYA 4DITA 4YGAA 5CEMA 3FBVA 5DRDA 3NUXA 3EYHA 4B8MA 3R9DA 2UW0A 4E73A 2VTSA 5CLPA 5BQ0A 4RA5A 4AP7A 4BFMA 1I44A 4Z55A 2IG7A 3N4UA 4RJ6A 2HW6A 4E4LA 4QTAA 3U87A 4CFFA 5KMKA 3Q53A 4PNIA 5EM7A 4O7NA 5EI6A 2V55A 3V6SA 3R7GA 4KKHA 2WMUA 4JR7A 3OG7A 4WRGA 4QYHA 4FYNA 4CZTA 2WIHA 2GQGA 4DC2A 5ANKA 2UW8A 1WFCA 3BV2A 5CASA 2PZ5A 3O0GA 4O2ZA 4TZRA 3EL8A 3A62A 1SVEA 5LJJA 4IAAA 2GFCA 2IVVA 3BGQA 3QCYA 4DFUA 2HZ0A 3ORKA 4OUCA 1NT2A 3LXKA 3F82A 3CC6A 4B0GA 5HE0A 3LMIA 2WMVA 5JSMA 4NL0A 3PXKA 3AGMA 2B55A 3QUEA 3QQGA 5K3YA 4FBXA 3R7YA 5HNGA 3SRVB 4IC8A 4KSQA 2VTPA 3RTPA 4I22A 3GP0A 3CY3A 4PY1A 5GJDA 3BHVA 1JVPP 3BLQA 1Q24A 4HYIA 3F2NA 5ANIA 4BZDA 3KCKA 2GDOA 1QPDA 5IEXA 3R21A 3WF7A 3ENMA 3FXWA 3P9JA 3VS5A 5IA1A 4NM3A 4HVDA 3GFEA 1W84A 2ZV9A 3IDCA 3HX4A 4YHTA 4AT4A 3BQRA 3PSCA 4NH1A 3V5JA 4GSBA 4FL2A 3HP2A 3TNHA 2I0HA 1U54A 3KA0A 4BTJA 4M7IA 5L4QA 3JUHA 4JIAA 3ZEPA 3V5TA 2JKOA 4KD1A 3FEGA 4GYGA 4HJOA 3C13A 3MA6A 4PWNA 5EYKA 3SV0A 4YHJA 3ELJA 3MIAA 3U9CA 3MWUA 4A7CA 3L9MA 4J96A 2F2UA 3TG1A 3UZRA 3DBEA 3MTLA 3UO4A 4DLIA 4AGUA 3OUKA 5HX6A 2J90A 3MPAA 4X2KA 4FGBA 3ZO4A 4E6AA 1ZOEA 2CKEA 3F9NA 3FZ1A 3WI6A 4ENYA 5A54A 2JD5A 3HUBA 3W55A 3A8XA 3KXNA 5AM7A 5I9UA 1ZYLA 3LM5A 3EIDA 3FKNA 3VUIA 5KKRC 3UPZA 2PUPA 5IQDA 3PXZA 3IW5A 4X6RA 4BCOA 4UBAA 2YABA 3DNDA 3M42A 4GKIA 2UW3A 3BYSA 4N0SA 4F7JA 2YIYA 3CCNA 3NLBA 2BIYA 3BYOA 4RIWA 3CIKA 3QD0A 4PL3A 5GIOE 5HG5A 4FYOA 3ZH8A 4F6SA 4F0GA 4F70A 2IVSA 3NVMB 2XA4A 3R7OA 5LWMA 3ANRA 3FDNA 5I9ZA 2XMYA 2YCSA 3HNGA 2QR8A 5I3RA 5KMOA 5FTOA 3T3VA 3VULA 3ULIA 2VN9A 3CTHA 4BDKA 3D83A 5HKMA 2J5FA 4BGQA 5HLPA 4AA5A 3QLGA 1A06A 3MI9A 1OIYA 2VX0A 4JIKA 2OLCA 5CU3A 5DR2A 4USEA 3EOCA 1SNXA 1YKRA 2YM7A 3BHUA 2J0MB 3TKIA 5FTGA 4QQCA 5HO8A 1KV2A 2BIKB 4EK3A 4ZSGA 5JGBA 3RPYA 4HPTE 2DUVA 3BU5A 3T8OA 4GT5A 4CZUA 4OTGA 3ZEWA 4EQUA 2XEYA 2UZVA 3LJ0A 3AC2A 5CZIA 4I4EA 4F63A 4R3PA 3ORPA 2J4ZA 2I0VA 2PMNX 2X2LA 1UKIA 3HV7A 2VUWA 3ZHPC 4QMMA 4ONAA 1WBSA 2ZDTA 4QP8A 4XRJA 4FTLA 3HV6A 1MUOA 4HCVA 1WBNA 5AMNA 5F94A 3BLHA 3SAYA 5AUTA 2CKPA 4ZS4A 5M57A 5IA3A 3JS2A 4W4XA 4CLIA 3FLWA 4X2NA 4BZNA 3D5WA 4NSTA 1YOJA 3FMHA 3FQEA 3JPVA 4FKOA 4ZTHA 4CCBA 2XCKA 3V8TA 3WZDA 2VAGA 2BAJA 2ITTA 1GAGA 2RG6A 3EYGA 3E5AA 4LG4A 4CTBA 4JXFA 4PMTA 2O3PA 4XLIA 2QVSE 4O0TA 5EFQA 2FSTX 5G6VA 2IW9A 1H1WA 2YM5A 2CGWA 4YURA 3HV4A 4FKQA 4JG8A 2XNBA 2ZM1A 2W1GA 3FLNC 3DAJA 2GSFA 2IW6A 3DQWA 2GQSA 4YZMA 3OCGA 1FMKA 5IQCA 4DTAA 2X7FA 1ZYDA 3KMMA 3BU3A 5FWKK 2QI8A 2ZJWA 3PYYA 1OUKA 5CSWA 1U5RA 4DEIA 3OY1A 2C5VA 5L8JA 2J51A 1FVTA 5A14A 4X7QA 4M69B 4R5SA 4WG3A 3O51A 5AX3A 4D58A 5E8SA 4I92A 2X81A 4C38A 2I0EA 4GW8A 3U4WA 4FTQA 3EN5A 4W9XA 1H1QA 3FLZA 4M12A 1J7IA 4R6VA 2CKQA 1PF8A 1XO2B 5DR9A 5DWRA 5C4LA 4FOBA 1VEBA 1FVRA 1ZARA 2FYSA 3FHRA 3HMNA 4U44A 3A4OX 2VO3A 3DJ7A 2W1DA 3R9HA 5EK7A 3R9RA 3GCPA 2C5NA 4ZLOA 4F9YA 3ZTXA 3JVRA 3ZXZA 1H07A 5TR6A 4L67A 4YSJA 4ZSJA 4CMOA 2WOUA 5HTBA 1BLXA 4KIPA 3NIZA 1OIRA 1TVOA 4IJPA 2C6MA 2ZM4A 3W2SA 2PSQA 4PPCA 4P5ZA 4AX8A 2ERZE 3A7GA 2ONLA 2QCSA 2QKRA 2ZB1A 3WYXA 3RJCA 5AA9A 2HOGA 4D9TA 5JFVA 3MVHA 4R3RA 3PVWA 4BGGA 2GNLA 4NTTA 3VBXA 4TRLA 2B4SB 3IONA 4FTJA 4YU2A 3RK7A 2C3JA 3BE9A 4UV0A 2BVAA 1H08A 4LI5A 4F6WA 5CU4A 3QTSA 4XBRA 4EH6A 4IH8A 5IG1A 3NUPA 1MRUA 4TNBA 4MNEB 3NIEA 3DAKA 5DRBA 2CDZA 4FSWA 3GNIB 4ZSEA 5HESA 3CQUA 2OIBA 4O7SA 3ZC6A 4RVTA 4K9YA 3MVMA 2PY3A 5EOLA 2PUUA 2X2KA 2JFMA 2C68A 2W06A 3FMDA 3LMGA 4R5YA 4EHEA 4DCAA 4F0FA 3NW7A 4FF8A 2X7GA 4FKSA 4ZMEA 1PMNA 4XBUA 2X1NA 4E6CA 3ODZX 4C33A 4HGLA 2V5QA 3QF9A 4O91A 4PNKA 2YM6A 3RZFA 3R6XA 4A9UA 4I5CA 4QMQA 3GOPA 3NS9A 4O83A 3PP0A 3SRVA 3IGOA 4OBOA 5DEYA 3S00A 3OWJA 4QT1A 2PHKA 3MVLA 4L44A 1E9HA 1LPUA 5IF1A 1YDTE 2PMIA 4M8TA 5CANA 4EHGA 3HKOA 4XH6A 1Y8YA 1R39A 3F5GA 1OZ1A 2AC3A 3F5UA 4Z9LA 2YDIA 4G3EA 1NXKA 1YXXA 4P90A 3E8EA 3UBDA 1W8CA 1H1SA 3DA6A 3FI3A 4FKRA 4E8AA 2OK1A 2XKEA 3H9OA 5AUWA 5AUZA 5DFPA 4MXYA 1H24A 3BPRA 4EH2A 3VS1A 3ZBFA 4H3BA 4TYEA 1ERKA 1UNLA 5IISA 4NKAA 4DLJA 2C1BA 2EXCX 2WTIA 3Q9XA 1NVRA 1PXJA 2J2IB 3D94A 4FIJA 3LE6A 4D0WA 4FZ7A 3LQ5A 4N6YA 3UNZA 1F0QA 2JDRA 3HEGA 3CBLA 3QTRA 2GMXA 1P14A 3F6XA 3I0OA 3O7LB 3F3ZA 4U41A 3VBWA 2Z7QA 1H25A 2WMAA 4C8BA 1UV5A 4F1OA 4UN0C 4PRJA 2RL5A 3DFAA 4BICA 5HLWA 3W2OA 4DEGA 4RLLA 3OW3A 3HUCA 4R7IA 4RVLA 5M56A 5KBQA 5EKOA 2OF4A 3FYJX 3QQKA 2SRCA 3FAAA 3O96A 3IKAA 3OP5A 5L2SA 3OXTA 3P7BA 4ZY5A 5JQ5A 5EKNA 3F3VA 5FGKA 3DLSA 5CAPA 2WTWA 1O6KA 4MVFA 5FEDA 5EQYA 3G9LX 1CKIA 3LOKA 2ITOA 4FZFB 5AP7A 2X9FA 4S32A 3QAME 3I1AA 2C3LA 5C27A 4L42A 4WSQA 3PJ8A 3LXLA 4XG8A 3NNWA 2YDJA 5HG7A 2BRGA 5HE3A 3SVVA 4GJ2A 4KIOA 1BL6A 2YCFA 5E90A 3SXRA 1W83A 2PVMA 2UZLA 5FBNC 4BR3A 2ITUA 4MWHA 2OH0E 2VD5A 2YDKA 5K4JA 2IPXA 4FG9A 1NVSA 5K9IA 1WAKA 2YM8A 4W9WA 1OIUA 1TQIA 3SXSA 3C0HA 1V0OA 2XEZA 1ZYSA 1JAMA 4JDHA 3IDPA 3VRZA 2YCRA 4LRKA 5HHWA 3SLSA 1WCCA 4E4MA 2EXMA 5AADA 1YXUA 5FDPA 1J3HA 1UWHA 2VTJA 3EQBA 3KVXA 4CV9A 1UA2A 3MTFA 3NNVA 3PXQA 4KRDA 4GKHA 3EN7A 5GZ8A 3DNEA 3OFMA 4PUZA 1U46A 2PULA 3HA6A 4S2ZA 5FQDC 1R1WA 4J97A 2HW7A 3FZOA 4O27B 3NUYA 4QMPA 4USFA 4K77A 4E4XA 4J8NA 4EOIA 3T3UA 1YVJA 1S9JA 2HIWA 4RX9A 4BKJA 5HIBA 1RW8A 3KRLA 1YDRE 4UMUA 1Q99A 4OW8A 1QL6A 4JJRA 2ZMDA 4MWIA 2YJSA 2W1HA 4CG9A 5D9HA 3K2LA 2UZTA 2BALA 2XJ0A 3CQWA 2E9VA 3D7TB 4QMZA 1PY5A 3REPA 4QOXA 3QHRA 4UZHA 4JL9A 1PXIA 3EZVA 4FUYA 3NYOA 3RAHA 4NT4A 1OL6A 3QKLA 4AOIA 1BUHA 3L9PA 1Q5KA 4G5JA 1PMVA 4TY1A 4O7VA 2VGPA 1DAYA 4F7LA 5AP1A 5L2TA 4L7FA 4BWPA 4KBAA 4JAJA 3QTIA 4RC2A 2OZAB 5HOAA 4UYAA 1NVQA 4F9AA 2KULA 3EH9A 4ZTLA 5EYMA 2O0UA 4FE2A 2BZIB 3EQHA 3OXIA 4I0SA 4M69A 2VTQA 4PPAA 2W4OA 4EHZA 5IQEA 4BWXA 4RC3A 4TWCA 3QQHA 4X3JA 5GINE 4EC8A 4I6BA 3CGFA 3NYNA 3CE3A 4CFWA 3OT3A 3VNTA 4V01A 1JKSA 4AFEA 4WIHA 4IM3A 3NGAA 3LFBA 5CNOA 3RI1A 4EH9A 3UO5A 3G51A 3F3TA 5CU0A 3SDJA 5KMMA 4DH8A 5BMSA 3K5UA 2QHNA 1JKKA 1Z9XA 3RM6A 2F9GA 2PTKA 3UMWA 3D9VA 4C59A 1G5SA 2BUJA 3WBLA 1ND4A 3SOAA 1H4LA 1IR3A 4EBWA 2ITYA 2JEDA 1ZYJA 3FPQA 3VJOA 5J1WA 2WU6A 2PVFA 3QQUA 4RWIA 2C69A 3Q32A 2ITNA 2YIRA 4BF2A 4D1SA 4IBMA 4H39A 2X39A 2QHMA 3UGCA 4E5BA 2WO6A 4D5KA 4ZTNA 3GC7A 2W1ZA 3CPCA 4U3YA 4BBFA 3Q5IA 3VS6A 5D41A 1MRVA 3Q4CA 2FB8A 4O21A 3FMMA 4GH2A 3AMBA 3DDPA 4BHZA 2QOFA 3NMUF 3UODA 4IZYA 3DQXA 4MNEA 2VTIA 4IEBA 4II5A 5JEBA 4JVGA 3ACKA 4JG7A 4JRNA 2BFYA 2R64A 3VUKA 3F3WA 3BLRA 4MBJA 2Z7SA 2R2PA 2AUHA 4A9SA 2BAQA 1YQJA 3QZGA 3NUNA 2QOOA 4GIIA 5CSHA 4JQ7A 3QGYA 3KN5A 1Q41A 3EQPA 4USDA 3Q5ZA 4CRLA 3QTWA 4I0RA 4RRVA 2WTKB 3P4KA 5AR3A 5AAFA 4KRCA 2ZMCA 2YLEA 3QCXA 3PPJA 2C0OA 5HICA 2IZSA 4J53A 5AV2A 1E1XA 1XH6A 1W7HA 4YPSA 4KS8A 1SZMA 4Q5HA 3L8PA 1FPUA 1QPEA 2OBJA 3OZ6A 3P86A 4LM5A 4MXOA 5EG3A 4L01A 4G3DA 5E8TA 5HD4A 2WXVA 3DTCA 4WBOA 2PYWA 2Y8OA 2FSMX 3KRWA 1EH4A 3UDBA 4ZJVA 3DTWA 4U3ZA 3NVKI 3AD4A 1OBDA 5AR7A 4EZ7A 4KIQA 5EW8A 4UXQA 5KMJA 2BHEA 1OPLA 2Y0AA 3NX8A 2ITQA 2FSOX 5KHXA 4AWIA 2ZM3A 3NCZA 3CP9A 2WQOA 2PVJA 3PJ1A 3VHKA 4IM0A 2IZRA 2VWBA 2J6MA 2Z7LA 4M0YA 2QOBA 4IIRA 3DBCA 4DH7A 5H8EA 4EYMA 1Z5MA 1XJDA 2REIA 2CHLA 2OJ9A 2IZTA 5CT0A 2AYPA 5ETCA 3UG1A 3LFQA 4ITIA 4TXCA 4BI0A 3FE3A 2XK3A 4GK3A 3ZM4A 4DG2E 4G5PA 5HBEA 4XNEA 3L9LA 3VBVA 4XS2A 1OL5A 3SG9A 2E9NA 4FMQA 4WNKA 1ZMUA 2JBPA 4CNHA 4RLKA 5LVMA 1JNKA 5K0XA 4QQJA 3PY0A 3QZFA 4C62A 4L46A 4AUAA 1W0XC 5DVRA 5IMXA 3ROYA 3FYKX 1Q8UA 2XKCA 3FY2A 4RJ3A 4UXLA 4YBJA 3MY5A 4R78A 4OTFA 2ZDUA 3DK6A 4EEVA 4C4FA 5M4CA 3U54A 4LUDA 5CSVA 3TIYA 3VW8A 2C6DA 3QD2B 5HVKA 4FC0A 3HL7A 2YFXA 3RKBA 4GVAA 4IB1A 4X3FA 5DEWA 1IA8A 2P33A 4L7SA 1OKYA 3EN4A 3ORXA 2JFLA 2GTNA 3IECA 4FV9A 1Q3DA 1BKXA 1SVHA 4GG5A 4DEDA 2RFSA 2X4FA 1OPJA 3P5KA 3T9TA 3VS4A 3GU5A 5FP5A 1H0WA 2I1MA 2W1FA 3A7FA 3ZXTA 3FL4A 4FSRA 1CSNA 4EQCA 2C6OA 1GZ8A 4OT6A 3UO6A 4EI4A 3OHTA 1QPCA 4C57A 3EQRA 5C4KA 2JC6A 4H1MA 3TV4A 2PE0A 4I24A 4N6ZA 4YBKA 4G6NA 2WAJA 4D2SA 1VR2A 4AN2A 4K18A 3R7EA 4LMUA 3V04A 3HP5A 3ZO2A 5BNJA 4FT5A
chains in the Genus database with same CATH superfamily
4FTUA 2FGIA 4DFLA 5M07A 1JSUA 2XJ1A 2XKDA 4G16A 4LGGA 5HQ0A 2V7AA 3ACJA 1AGWA 3RHXA 3EKNA 4BCFA 4RPVA 3F7ZA 2WELA 4W4WA 5HBJA 4DGLC 3H10A 3SX9A 2PZIA 5E8YA 4HVGA 3C51A 5A4TA 4NU1A 1LEZA 3IPHA 4BKZA 2PE2A 3IO7A 4O7LA 3IW7A 2QKWB 2UZOA 3HGKA 4FICA 3FQHA 2CNQA 4JLCA 4WO5A 1O6LA 2WEIA 3TZMA 2XF0A 3LCDA 4QP1A 4X21A 5M55A 5HTCA 4O4DA 4M66A 4C7TA 3VF9A 2W4KA 3BL9A 3O23A 2J9MA 1XBCA 1Y6BA 4I5MA 3D7TA 4JBQA 2WPAA 2YJRA 3Q52A 4QPMA 4ZXTA 4ZJIA 2WNTA 5DE2A 2NO3A 3UPXA 1KE7A 4WBBB 2WGJA 4G6LA 3FLYA 4FSTA 4NFMA 2XVDA 2YAAA 3FZSA 4IAFA 3RM7A 5T3QA 2WZJA 4ASXA 3LKMA 1DI8A 3EFLA 3C4WA 4YTFA 1W2FA 4NCTA 4RJ7A 4V04A 2BDWA 3A99A 3R8MA 5DOSA 4AAAA 4ZIMA 4DEBA 1PMUA 5GIPE 2JDSA 3RWQA 2QURA 4EH4A 4E6QA 3D5VA 4FA2A 5C8MA 3VW6A 1XQZA 1QCFA 3N4TA 4DT8A 5IU2A 1GOLA 3K54A 4AA4A 2JIUA 2GFSA 2YEXA 1ST0A 3COMA 5CQUA 1K2PA 4D1XA 4MK0A 5J7BA 1ZY5A 4FI1A 4J1RA 5AM6A 3SXFA 2G2FA 3C50A 4ZEGA 2C5OA 4AOTA 3HVCA 4NIFB 1J1CA 3SW7A 3QLFA 3F5XA 4DGGA 4U42A 3OUNB 2B9IA 2HWPA 2J5EA 3R1NA 4AN9A 2XIXA 1AD5A 1XH7A 4MHAA 4DEEA 3GCUA 2IVTA 4FR4A 3DS6A 4XV1A 5FM2A 4FK3A 2IZUA 3TNWA 4FV8A 2OXDA 4O0UA 4PDPA 3LPBA 3QBNA 4FTOA 1PXKA 4IFCA 3TDWA 2WTKC 4IX3A 4DG0E 5JFXA 5CENA 5AAEA 3OEFX 4IWQA 5IH5A 4GUEA 3HAVA 4FTIA 5EHLA 4U79A 4EK8A 3L1SA 1UU7A 4OT5A 3LFNA 5F1ZA 2XNPA 2XIRA 2PZRA 4FEVA 1IA9A 4FL3A 3AOXA 3I7CA 3OBGA 3OWLA 4FSUA 4M13A 5CS6A 1S9IA 5EDPA 4IAIA 4E93A 3QGWA 2HY81 4ZLZA 2YZAA 3BKBA 2ITPA 4LGHA 3UMXA 4D4VA 2YIWA 4QP6A 4U45A 2RF9A 1K9AA 5FP6A 4AA0A 5J95A 5HGIA 4AOJA 3R30A 2WTCA 4K11A 5AUVA 3MY0A 4U5JA 4A06A 4CKRA 3PXRA 3GQLA 5JN2A 3HMPA 2G2IA 5T6KA 4QMVA 4D55A 4DYMA 4AW0A 4CFUA 5LVOA 1MQBA 4J99A 3UNKA 3ZLXA 3LCTA 3EKKA 1J1BA 3VUDA 1GIIA 4GJ3A 5D1JA 4FIHA 4JQ8A 4M0ZA 5AV4A 3PXFA 4HOKA 3A7JA 3GU7A 5EM8A 1KUTA 4TWPA 3ZUVA 5FG8A 3B8RA 3VS2A 5DYJA 3VUGA 3N9XA 2GCDA 4BGHA 1SNUA 3PIYA 3OOMA 2W05A 4JAIA 5H8BA 3V8WA 3RK5A 4GK2A 3HZTA 1Y57A 3RAWA 3L8VA 1JSVA 2YIXA 3LMHA 4O0WA 3DFCB 4FV6A 4DH5A 4IWPA 2C6TA 2OJJA 3N4VA 1GIHA 1LEWA 2WMTA 3KN6A 4L00A 4AZTA 2VTMA 4EOKA 4BCMA 3PXYA 4P4CA 5DPVA 4S33A 4C34A 5KMLA 4ARKA 3TXOA 3DGKA 3DXNA 3Q2MA 3W2QA 2OJGA 4IFGA 4EOMA 2BDJA 2EXEA 3P79A 1O9UA 4I20A 4A9TA 4KKGA 3Q9ZA 3KXHA 4BIEA 3VO3A 3W1FA 2B0QA 3CJFA 1E1VA 5CU6A 4FTNA 4PTGA 3DZOA 5IQAA 5IPJA 4BCGA 5BUEA 3TUBA 1K3AA 3E88A 3FJQE 4X2FA 2UV2A 4PTCA 3OS3A 2VWUA 3RPSA 5GZ9A 4U97A 4N4SA 4FK6A 5FM3A 4J52A 3IG7A 1BI7A 3DXPA 4O4BB 4IVDA 4FTKA 4GU9A 4PPBA 1ZYCA 4G9RA 3EQFA 4O0RA 1I09A 4I4FA 4ZS0A 4MKCA 2BTRA 1YDSE 5M06A 1M2PA 1IRKA 3VS3A 4XX9A 5E8VA 4F99A 4DF3A 1O6YA 4M3QA 3E63A 4EOPA 2JDTA 2RKUA 3GI3A 1WVWA 5KE0A 1URWA 4IVCA 3UIUA 4ZZMA 2P0CA 4BB4A 5AR4A 4BIBA 4I1ZA 2F2CB 2B9JA 3I0QA 1OGYA 1G8AA 5FUTA 3B2WA 3EFJA 2RG5A 3ULZA 4ZMFA 4G2FA 3H4JA 2A0CX 4I94A 4YLJA 3BYMA 4ACGA 3NFGB 3EN6A 4C3PA 4DFXE 4IWOA 3PVBA 4GRBA 4RJ8A 2XNMA 5AAGA 4F4PA 4JG6A 5CAUA 3PJ3A 3RALA 4PL5A 3MFSA 2LAVA 3TTIA 4A4OA 4DFNA 1CDKA 2BILB 2BR1A 3WILA 2CPKE 4RJ5A 3AC5A 3P7AA 4J71A 2W17A 3BYUA 3IQ7A 5EI2A 4EUUA 3GU6A 4PMMA 4FEWA 4AACA 1WVXA 4QYFA 3U8WA 4FV4A 2WTDA 5JGDA 3TUDA 4ALWA 4FKJA 3V5QA 5L6PA 2IWIA 3NAYA 2QLUA 3PY1A 1SYKA 2OWBA 5ANEA 2JAVA 2PZYA 4RQKA 3DCVA 5K0KA 3QUPA 4Q5EA 4YZBA 4I6QA 3G0EA 5ANDA 3BL7A 1VZOA 3EFWA 4Y85A 2ZOQA 2XH5A 2LGCA 3DU8A 3EWHA 1PJKA 4APCA 4BDJA 5A4LA 4MEDA 1CMKE 4DCEA 4IAZA 3I6UA 2NRYA 4IACA 4O84A 2GNGA 3HECA 4I5PA 1KSWA 2YM3A 3PSDA 1CKPA 3OROA 4P7EA 4RIYB 4L53A 5AUYA 5BVOA 2OG8A 3AC3A 4XV2A 2XNNA 3ZOSA 5IKWA 1UU8A 1YHVA 1Q8YA 2WMWA 4JT3A 4F7SA 3Q60A 5JZJA 3P5JC 2B53A 4WRSA 5FD2A 2UW7A 3AGLA 3MJ1A 2QO9A 4F6UA 4PQNA 5H2UA 2VTTA 2C6IA 2JAMA 1X8BA 3E92A 3FLQA 4CFMA 4BI1A 4DINA 2Z7RA 5CF8A 5LMKC 2PPQA 3BWFA 4QEBA 3QTUA 4EKKA 4AW2A 5IA5A 4EYJA 3R7VA 2QG5A 2V7OA 3TV7A 2Y9QA 5BVNA 4JDJA 3UVPA 1UWJA 4ACMA 3TZ7A 4NJ3A 1IAHA 1M2RA 4FTRA 3MH2A 3TL8A 4XG2A 3UYSA 2H96A 3TUCA 1XH9A 3W16A 1YHWA 4TYGA 2OGVA 3AC8A 5M51A 1NY3A 1YOMA 1WZYA 3Q9YA 4JDKA 4JBPA 4MF0A 4YJTA 2W9FB 3FI4A 4HPUE 2IO6A 3QU0A 1B6CB 2R0UA 4AN3A 5J9ZA 2WOTA 1YOLA 2R3QA 4EBVA 4AXFA 4NIFA 4C0TA 3B2TA 4ZOGA 1H28A 5GNKA 4XMOA 4WOVA 4PDYA 1JKLA 1XR1A 1M14A 3HMIA 4FTTA 4V0GB 1Q4LA 4EH7A 2H6DA 3E62A 3HRBA 4G34A 5CSXA 3NWWA 2ZYBA 4O7RA 3VBYA 4RQVA 3FKLA 4I23A 3W8QA 5CI7A 3SQQA 3WOWA 3TMOA 3GQIA 5I0BA 1HCLA 4XCUA 4BCIA 1PRYA 2FUMA 2DWBA 3PDTA 3JY9A 5AP0A 5KMIA 4ACDA 3QXPA 3LAUA 5HEZA 2C6LA 5AA8A 4OLIA 5KZ0A 5J79A 4D9UA 4BDIA 5IEVA 4XG4A 4FIIA 2WEVA 3RZBA 3GC8A 5BUJA 3CS9A 4RWJA 4XP2A 5LXMA 5CF4A 5M53A 2BAKA 2YERA 4BL1A 4HYHA 3OWPA 3NUSA 3UIXA 3O71A 5KBRA 3C4EA 1PKGA 1UVRA 3E87A 3GC0A 2OZOA 5ACBC 3PY3A 4RX5A 5CALA 2Q0NA 2WHBA 4AZFA 2HZNA 4YLLA 3WZUA 4FX3A 5CY3A 1P2AA 1FVVA 4EOSA 4FG8A 4GVJA 5E8XA 3MPTA 3PA4A 4WT6A 2C5YA 4FNZA 4YJPA 3DAEA 3I4BA 4BDBA 4I21A 4XLVA 3I6WA 3JVSA 5CVGA 4QD6A 3W2RA 5HNIX 4M15A 4XV9A 4FKIA 3FMLA 5J5TA 3OCTA 3FXZA 1GIJA 3OF0A 4QTCA 2J0JA 5D11A 3EQCA 3HRCA 1YHSA 2PZPA 2AEGA 5AR2A 1JKTA 1W2DA 2VTOA 2WMQA 3RVGA 4AZVA 3LXNA 4BZOA 4O81A 1CTPE 4E6DA 3HV5A 4YLKA 2FVDA 4WUNA 4RVKA 3C0GA 3K3IA 2VX1A 5IA0A 2GNIA 5AFVA 3KULB 3LCKA 5HBHA 2BMCA 3L8XA 4KBCA 5IA4A 1LR4A 1H1RA 3V51A 1NW1A 4EZ5A 4AG8A 3BLAA 3MB7A 5L8LA 5AV0A 4CLJA 1W82A 3UOKA 2XK8A 3ZLSA 3H0ZA 4ASZA 1A48A 4DT9A 2V0DA 5HI2A 4C36A 3W32A 4DFBA 3TACA 3V01A 4YO4A 3ZRLA 5HCYA 5LMAA 4X2JA 4EOLA 4IM2A 4TN6A 4FKGA 4WA9A 4FEQA 4YC6A 3WZJA 4CKIA 4FT3A 1OKWA 4EH3A 5I5ZA 4C61A 1KE5A 2CGUA 4WKQA 1PKDA 1IG1A 2R5TA 3RPVA 4YJVA 1YXSA 3W0OA 5J7HA 4HGEA 2RGPA 3V3VA 5HU3A 2Q83A 3CGOA 4XG3A 3CKXA 3KXMA 3QA0A 1YWNA 4EHVA 3A7IA 4NK9A 4B8LA 4UWCA 4OTHA 2Q0BA 3MH3A 4U6RA 4XG6A 3MPMA 3GENA 4KWPA 3WE4A 4NZWB 5AEPA 4R1YA 1YI6A 3JXWA 3AC4A 3GEQA 3L8SA 3P1AA 4FV5A 4U9AA 4O6EA 1DS5A 3O50A 5CWZA 5HIEA 1PYEA 5A3XA 2GTMA 3SW4A 1SM2A 4ANBA 4D2VA 4JX7A 3OT8A 4JMQA 4DTBA 2GHMA 2YAKA 4R7HA 5CAVA 2R3GA 2PK9A 4CT2A 2C3IB 1ATPE 2UZEA 1GZNA 5CEOA 2EB3A 3E3BX 3DK7A 3PJ2A 4ASDA 4HVSA 3B8QA 2OXYA 5LWNA 5CEKA 4O0YA 2HXQA 4C58A 1OVEA 1Q97A 2HCKA 2R3NA 3IS5A 4YNEA 4TPTA 1ZMWA 3FKOA 3FSKA 5C8NA 2ITWA 3ENHA 1OBGA 3S95A 5F95A 2OICA 4RIXB 2IW8A 2XUUA 4APPA 1A9UA 4K8AA 3TEIA 1F5QA 4AXAA 1ZXEA 1AQ1A 4MTAA 4EZ3A 4C4IA 4F9BA 1OGUA 4QMWA 4NW6A 1Y6AA 2RFEA 2UZUE 4NWMA 3U6HA 4CV8A 4FIFA 4XP3A 4F08A 3GUBA 5CXHA 4HYSA 5J87A 4MBLA 3COIA 4CGAA 2QU5A 2YITA 1DAWA 2WQNA 4OAVB 4ZJJA 3WZEA 4YR8A 4IX4A 4XUFA 3TNQB 3BZ3A 5EDQA 4M97A 3GVUA 1J91A 4FSQA 4E3CA 5KCVA 2PVRA 3WARA 1OPKA 3TJCA 2ZVAA 2E9UA 3QRTA 5BVKA 4CYJA 2V22A 1KV1A 4B7TA 2X8IA 4H58A 4EWHA 3PA5A 4RGJA 3MH1A 2UZNA 1YXTA 3KXXA 1XBBA 4CTCA 2UZWE 4QYEA 3ETAA 2FH9A 3NAXA 3R8VA 3HDNA 3RBWA 4M14A 1XH5A 2CN8A 4I93A 4L3JA 3E7OA 4RIOA 4U43A 5C8KA 2GQRA 2DS1A 3S4QA 3UJGA 3R9OA 3VIDA 1ZOGA 4MQ1A 1WBPA 4ANLA 4JDIA 4XHKB 2YM4A 1P4FA 3QHWA 4E5WA 3S1HA 3R00A 1YI4A 4CXAA 3A2CA 4WNPA 2CSNA 3ZRKA 2XNEA 1OKVA 4L68A 3GC9A 1RE8A 5JFWA 4OTPA 5EW9A 1H1PA 3L9NA 2UVXA 4TTHB 3MVJA 4DFYA 2CCHA 4DGNA 2BZJA 3ZM9A 3QFVA 4BTMA 2OFVA 4LV5A 5HNBA 3OEZA 2YA9A 3KK8A 2GNHA 5LMBA 3DBQA 5BVDA 5LCKA 5TOZA 3PUPA 3EJ1A 5D12A 4UX9A 5ETAA 4BCQA 4QTBA 3LFCA 3F3UA 4LOPA 5H8GA 4ZTSA 2GS7A 2O8YA 4JBVA 5HVYA 1PXMA 4TWNA 4LRJA 3KREA 3I7BA 3FY0A 2R7BA 4NYEA 3W0SA 2IN6A 4DA5A 2ITZA 3QALE 3SKCA 5IQGA 2XK9A 4YUQA 1HOWA 3QQFA 4HZRA 1M2QA 3UZTA 4YTCA 1OUYA 2ZV7A 4ZK5A 3GGFA 4BBMA 5AUUA 1PYXA 4TKSA 5I9VA 3DK3A 4NTSA 2Z60A 1XMMA 4EJ7A 5M09A 1R78A 5AR8A 1IAJA 2RFNA 5JH6A 5E9EA 2W9ZB 5A4QA 3S2PA 5EQEA 4O7ZA 4K1BA 5L6OA 4B4LA 3K5VA 3QZIA 3NRMA 3FZPA 1YRPA 3MV5A 1TZDA 5AR5A 1SVGA 2QOIA 3DJ6A 3ZLYA 4Q2AA 2JKKA 3LJ2A 3CR0A 4NFNA 3KQ7A 1XH8A 4LOOA 3ATSA 3MH0A 2P2IA 4KS7A 1WBTA 3AC1A 4AXDA 4OTRA 1P5EA 4YPDA 2XIKA 1OKZA 5DMZA 3I81A 3FZTA 5IUHA 4FZ6A 4DDGA 5M08A 2VTHA 3FPMA 4HVIA 2H8HA 3D5XA 4QNAA 4E7WA 4U7ZA 5M4FA 4EJNA 4QMUA 3ALNA 3Q6UA 5E4HA 2Z2WA 4GV1A 2CKOA 2XS0A 1U4DA 1BYGA 2OW3A 3AD6A 3ZCLA 3DKFA 4BKYA 1J7UA 4JX3A 2XJ2A 2C47A 4J95A 3F69A 3E64A 2IEWA 5D10A 5B7VA 4ERKA 5CAQA 5HVJA 4YSMA 3M1SA 3WYYA 2A1AB 4XJ0A 4JI9A 1UNGA 3H0YA 3TNIA 5CF5A 3MDYA 5JT2A 4BJJB 2CGVA 3AT2A 2BFXA 3MGYA 5CYIA 4B99A 4EH5A 1CM8A 4AQCA 2WB8A 1MRYA 1GZKA 5EM5A 2E9OA 5ITAA 4CZYB 2R0IA 3RINA 4D4RA 3O8TA 5BUIA 2QOHA 3KVWA 1XMLA 4FEXA 4PP9A 4L6QA 4QMXA 3OWKA 2P4IA 4KNBA 5C03A 5JK3A 3GCSA 3NCGA 5BYLA 4FT0A 4AFJA 1IEPA 3EFKA 4QP7A 5I9XA 1UU9A 4XEYA 5C01A 4O7TA 2BTSA 4WG5A 4FNWA 4BCHA 4J98A 3U6JA 3R73A 5FEQA 1YWRA 4U0IA 4G6OA 4Z3VA 1P4OA 2XP2A 3KMWA 1L3RE 2P2HA 3MFUA 3EQGA 3Q4TA 1R0EA 3ZZEA 3QZHA 1ZAOA 1PXPA 4N70A 5A6NA 3BX5A 2XNOA 3LFAA 3OXZA 1UU3A 3DJ5A 5AP3A 1R3CA 1G8KA 4CQGA 3KCFA 4M68A 4Z7HA 3UP2A 4GUBA 4UMQA 5FBOA 5HO6A 3VUTA 3UC3A 3FZRA 3UTOA 4FV7A 2JIVA 4O96A 2HENA 3ZBXA 5AUXA 4NM5A 4FEUA 4MXAA 4FZAB 3QA8A 4DGOA 4Z16A 1OMWA 3FC1X 5J5SA 2AQXA 4ORKA 4CD0A 3UYTA 3ORIA 4I6FA 3IOPA 1LP4A 4DEAA 3HMMA 2ESMA 2FSLX 2G2HA 2V62A 4IB0A 4NKSA 5FRIA 3WE8A 3AD5A 5M4IA 4CFXA 4KIKB 5H3QA 3HYHA 4AZSA 3PFYA 2VWVA 3MBLA 5IA2A 3UOHA 3DZQA 1GJOA 2OXXA 4KA3A 3U55A 4D28A 3KRJA 3NYVA 1ZWSA 4FTCA 4AT5A 1JOWB 3COHA 2QONA 4HW7A 3G90X 1OL2A 5L6WL 1M17A 4DHFA 4IB5A 1Q61A 4GU6A 1MP8A 2GS2A 4BIDA 4BN1A 4IZ7A 4WSYA 2OH4A 4RIXA 3ZRMA 4BRXA 3ORNA 5E1SA 5BYYA 1PW2A 3F7WA 4FODA 5AIKA 4CMTA 3PFQA 3VS7A 5HX8A 4CCUA 3POOA 4R77A 5AIRA 4CEGA 4XV3A 3UIMA 5CQWA 2Y4IB 4MD9E 4HYUA 4BDHA 3VVHA 5DLSA 4TW9A 1LUFA 2C5XA 5D7AA 3W0NA 4CFVA 4C37A 4IADA 3UP7A 3D4QA 4XG9A 3CD8A 3ZO1A 4C02A 3QRKA 4OTIA 3G9NA 4U40A 4XP0A 4FNXA 4H1JA 3P78A 3PE2A 4DFZE 2NPQA 4K0YA 3LZBA 4ID7A 1TQPA 3PVUA 4BC6A 4EQMA 1W2CA 1ZOHA 5JRSA 5IMEA 3PA3A 2CLXA 3R02A 4D0XA 1WVYA 3QX4A 3R1QA 4QO9A 3VC4A 4FKTA 4C35A 3TTJA 4EKLA 4YTIA 2QG7A 3I5NA 3KKVA 5ETIA 5LQFA 2OZAA 2IJMA 2B52A 5DT0A 5DGZA 4KUJA 4BWKA 4ERWA 2GS6A 3BHYA 5CXZA 3AMYA 1FQ1B 1OI9A 3NEWA 4G17A 5E92A 3ML1A 4UMPA 1KOAA 3F2AA 3MYGA 3W10A 4ZZOA 5E91A 3EHAA 5B2MA 5IZFA 5HD7A 1L8TA 5ETFA 2EU9A 3BYVA 1XHAA 4BYIA 3P7CA 2BROA 3OMVA 4LFIA 4FL1A 4BCNA 3GCVA 3I60A 4IANA 2JDOA 3G15A 1OECA 2XK6A 4QQTA 1G8SA 3ZUUA 5L2WA 1YW2A 2NRUA 5AP5A 3QCSA 3DKCA 3S0OA 1H01A 4WNOA 4BDAA 4UWBA 3H30A 4PL4A 2WQMA 4R7BA 3EQIA 2VX3A 3FLSA 4M67A 3R9NA 2BPMA 2UW5A 4YHFA 2CNVA 5J9YA 1RQQA 2YN8A 3MN3A 1ZZ2A 4TYIA 1V1KA 3VQHA 1DI9A 2ETKA 3VAPA 3WIKA 2C30A 4GCJA 4GT3A 3LJ1A 4RSSA 4Y8DA 4AZWA 5IDNA 3F2RA 3D5UA 4LOQA 4YJSA 1PHKA 4DH1A 5L3AA 3TV6A 3Q04A 3TZ9A 3GCQA 4IHPA 3KL8A 2R3HA 1Q3WA 5BYZA 5EOBA 3F5PA 3BI6A 5AP4A 4FV2A 3AQVA 3C7QA 3PJCA 4IZAA 4GG7A 4E4NA 5HIDA 3ZS5A 4NUSA 4RFYA 2Y4PA 4E20A 2XYNA 3DLZA 4F65A 5A46A 4PTEA 4R3CA 5DHJA 2R3LA 3D15A 2OIDA 4QP2A 2R3JA 2F4JA 2ZV8A 5FDXA 4U8ZA 5AP6A 4BCKA 3UDZA 3UZPA 5L8KA 3ANQA 5JFSA 3W0PA 1ZRZA 2VWZA 4E26A 1H27A 4A9YA 3GXLA 4C2WA 5ANGA 3U51A 2HELA 4B9DA 2YISA 3MFTA 4F64A 5BVEA 2BCJA 4IDTA 5TT7A 3G0FA 3ZONA 4IAKA 3LLAA 4L3LA 3BEGA 5TKDA 3ATTA 2H9VA 3KGAA 3QD4A 4FVPA 4Q9SA 3PG3A 5CAOA 4A4XA 3OOGA 4IVAA 5CEIA 3ORZA 2X8DA 4QYGA 4UMTA 2JIIA 4WNMA 5D7VA 2JBOA 2WTJA 3BGPA 5BMMA 3ZSHA 3JYAA 4GL9A 5AJQA 5KUPA 4RZVA 4DGMA 3AMAA 3LCOA 4H3PA 5CEQA 4AS0A 4UZDA 3R1YA 4NEUA 2OI4X 3V8SA 4YJNA 3D2KA 2ITXA 1TQMA 4QPAA 4WUAA 4X6QC 5EYCA 3VQUA 2OSCA 2X7OA 4FKUA 5DNRA 4MXZA 2F49A 3BWJA 1YXVA 3AG9A 3KXGA 1UNHA 4L52A 3DBFA 2X2MA 2VO6A 3TT0A 2ZB0A 1J7LA 3EB0A 4IX5A 1NA7A 4QP3A 2VNYA 3TYKA 4BY9E 4BDCA 4QMNA 4Y73A 4YZ9A 1APME 5E8UA 3VS0A 4RJ4A 5DT4A 4UB7A 3SD0A 4EOQA 4RFMA 4EC9A 4KBKA 2GPHA 2UZDA 3CTJA 4UY9A 4QMOA 2YCQA 3R04A 4AE6A 3HDMA 3TKUA 4G3FA 4ZTRA 3KFAA 4BCJA 4UALA 4JS8A 3RCDA 4AW1A 2YZLA 1F3MC 2XCHA 3MW1A 4HCTA 4O0XA 4ANOA 5LVNA 4IAYA 4FTMA 5JZNA 1IASA 4A9RA 4EL9A 2R3RA 5CX9A 5I3OA 3RK9A 2JKMA 3IDBA 2BDFA 4MQ2A 4AW5A 4O86A 3MY1A 3WF6A 2PWLA 3R7IA 3QWJA 1WBWA 4X2GA 2PVLA 3ORTA 5LVPA 4FSYA 3UQCA 2XIZA 3VJNA 1FOTA 3V6RA 1VJYA 4FT7A 5DI1A 4HNIA 4F9WA 1Y91A 3PSBA 4PMSA 2R3IA 3BU6A 3DKGA 3WF8A 1BL7A 3QTQA 2J7TA 4BTFA 5IUGA 3LIJA 3MB6A 3VN9A 1SMHA 1VLRA 2Y4IC 4CFNA 4F0IA 4I0TA 4O0VA 5AWMA 2XAOA 2W1CA 3PZEA 1Q8TA 2VWYA 3LFSA 4HGSA 2ITVA 4RX8A 2B9FA 1XKKA 3DBDA 2W5BA 2VU3A 2DQ7X 2W7XA 2VTRA 3DB6A 2R3OA 3QKKA 2CLQA 3E7VA 4KIKA 3QRIA 2HZ4A 2VO7A 2XK4A 4RVMA 5DBXA 3W2PA 4EOJA 2OIQA 3NUUA 4X0MA 3VRYA 2R9SA 4FOCA 4AF3A 5J1VA 3QUDA 3G6GA 4ZZNA 4IW0A 2R7IA 2PVKA 2HY0A 4QMSA 5F4NA 4CSVA 2QOKA 3BCEA 2VV9A 3EMGA 2YLFA 4DH3A 4R1VA 3CQEA 3UDSA 2J0LA 3BRBA 2H34A 3SG8A 5DH3A 3SHEA 5C26A 4JNWA 4AXCA 5HU9A 5A4EA 4RZWA 2JLDA 2WU7A 2W1IA 4ASEA 4W4YA 3PRFA 4FRFA 2F7XE 4CYIA 5IQIA 3MIYA 4QMTA 2A2AA 3H9RA 3NSZA 5DIAA 2ZFYA 3KRRA 5IQBA 2WQBA 3E93A 3VBQA 5K5XA 3FSFA 3C4FA 2JKQA 3KF4A 3NW6A 4GK4A 5GJFA 4I41A 4LGDA 2XRWA 4TNDA 4YZDA 5EHOA 4YJRA 2BRMA 3U9NA 3WF9A 4TWOA 2ONLC 5ACKA 2PL0A 2VWXA 3LFEA 2XRUA 4W4VA 5EYDA 3G33A 2Y6MA 2P55A 1B39A 1GZOA 3ORLA 2QOLA 4C4GA 5IQFA 4O4FA 5DT3A 1XH4A 2VZ6A 3LFDA 4H36A 3QKMA 3AT3A 4G3CA 3R8PA 3VF8A 4B6LA 5BVFA 3EZRA 3VONA 4D2RA 1VYZA 3GU8A 4NM7A 5HCXA 4GFGA 2VTAA 3QCQA 4LDTA 2ERKA 1OB3A 4K2RA 3LXPA 2F57A 1RJBA 1XBAA 1ZMVA 2J0KA 4EK6A 3OBJA 4JOAA 1M7QA 2BRBA 4H3QA 3OC1A 2PVHA 1URCA 2IF8A 1U59A 3BEAA 3KC3A 4ANNA 5K4IA 3OTUA 3U4UA 4DBXA 3A7HA 2G15A 3IW6A 4PV0A 4RBLA 3EQDA 4HCUA 4P5QA 4YNOA 4C4EA 3QX2A 2B54A 2VWIA 4BBEA 5J9LA 3G2FA 3BQCA 4LYNA 1FMOE 4KB8A 1WBOA 4Y5HA 3RNIA 3MESA 2Y7JA 3P08A 2WQEA 4W8DA 3BBTB 4FKLA 4YJOA 5C9CA 3LFFA 4QTEA 5LMKA 2GHLA 3LCSA 3PLSA 3V5WA 4LUEA 4Z7GA 2ETRA 2OFUA 2VWWA 5CF6A 3R71A 5IH4A 2OF2A 3MS9A 4IJ9A 1QMZA 3OCSA 5JQ8A 4LV8A 4FKVA 4S34A 5CTPA 4CT1A 3KU2A 4O22A 4QRCA 3PP1A 4WD5A 2HAKA 5CNNA 4IX6A 4KABA 3R8ZA 2X9EA 3TDVA 4LQMA 4D1ZA 3SA0A 4BDEA 4FG7A 4RMZA 4PDOA 3GFWA 4ENXA 4L8MA 2EWAA 1FBNA 2BKKA 5KX8A 5BPYA 4MAOA 4CRSA 4D4YA 3KF7A 4OBPA 3ZDIA 3S3IA 2HZIA 4PX6A 2PU8A 4D2TA 3H3CA 4JBOA 4RA4A 3QTXA 2I0YA 3BBWA 1H26A 4XRLA 1Y8GA 3E8CA 3FI2A 3WIGA 2WTVA 4YTHA 2W4JA 4MD8E 4DBNA 5FTQA 1VYWA 3Q6WA 2JDVA 3TN8A 4C3FA 3GOKA 5CVHA 4FIGA 2NNWB