4XG8A

Crystal structure of an inhibitor-bound syk
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
270
structure length
258
Chain Sequence
DRKLLTLEDKELGSGGTVKKGYYQMVVKTVAVKILDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Crystal structures of spleen tyrosine kinase in complex with novel inhibitors: structural insights for design of anticancer drugs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 80
structure length 258
sequence length 270
chains with identical sequence C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4xg8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4xg8A01
1OECA 1R39A 1WAKA 3VWAA 4R5SA 3TG1A 3OROA 4E4XA 1YOJA 4X2GA 3KEXA 1OM1A 2B9JA 1H1WA 1UU7A 3P08A 3UNJA 4K18A 5JT2A 1OKWA 3LM0A 4O7SA 3AXWA 4UXQA 4DTAA 1UKHA 3EN6A 3P7BA 2PVMA 3ALOA 3FV8A 4M12A 2Y4IC 3D5XA 3MJ1A 3ORMA 3ODZX 5CEKA 4MXZA 4MWHA 4ASDA 4G16A 2R2PA 5FDXA 3CJGA 3ZDIA 3MH1A 3HX4A 1YDTE 5HX8A 4QMQA 3MFRA 5HD7A 3QYWA 2BPMA 3LJ1A 2BCJA 4HGTA 1E1XA 4O0XA 3KU2A 4RLKA 4GK3A 2YHVA 3QX2A 4LI5A 3LFCA 3GC8A 2BALA 1ZAOA 2B0QA 3PJCA 3A62A 4F7JA 4E6CA 4ZTRA 5L2WA 5DNRA 4TYIA 1CKPA 1OIYA 2O2UA 3F5XA 2WTCA 4Q9SA 2OICA 1ZOEA 3IDPA 3IOKA 4U7ZA 5HE0A 4YLLA 3ZYAA 4AXAA 2DS1A 3QQHA 1M17A 5FM2A 3PXZA 3RHKA 4C4IA 5KMJA 4MXOA 1JSVA 2HY0A 3D9VA 2JFLA 2XUUA 4RFZA 4OLIA 5L6WL 4XJ0A 4EH3A 2XJ0A 3NZ0A 2R3RA 3HV4A 5F9EA 5K4IA 2BZKB 5BVWA 5AV4A 3BEAA 3ETAA 5C4LA 5E92A 1MP8A 4DINA 5DRBA 2SRCA 5FTOA 4H1MA 4UMRA 4PL3A 4FTMA 4RIYB 2UZDA 3FMNA 2BHEA 3KY2A 5HIEA 5FWKK 3E8DA 5HOAA 3ORZA 5IA2A 3NRMA 4MWIA 3DOGA 4EOQA 2OU7A 5JRSA 2VRXA 5KKRC 3Q53A 5AUUA 3CC6A 4BDBA 5ANEA 5BYZA 4O0UA 3V5WA 2IVSA 5H8BA 3JVRA 2XA4A 1SZMA 2UW9A 4Z7HA 4EZ7A 4EC9A 5J5SA 2GHLA 2FB8A 4K1BA 4FSWA 5M4CA 2YCSA 3COIA 3DAKA 3MVLA 4MHAA 2QU5A 1UKIA 5CSWA 4EQMA 2QOLA 4IANA 4O7RA 3SGCA 2RG6A 5A4EA 3PY3A 2PZYA 3EQFA 4FIGA 3COHA 4QNYA 3O0GA 4TYHA 4OTPA 3AC1A 3E7OA 5CVFA 3MBLA 4C8BA 3V6SA 2C6TA 4YC3A 4DEHA 3ENHA 3O17A 4FKQA 4BVUA 4MD8E 3WE4A 4BTFA 2R3HA 3N9XA 3MYGA 4M13A 4BCOA 4C36A 3W1FA 2CNUA 3BZ3A 4I5HA 5AM6A 4UWCA 5B2KA 4LMUA 4AN3A 4JG7A 5TF9A 2HXLA 4JXFA 3PP0A 4EEVA 4EH2A 2J0JA 5CF8A 4L01A 3NUNA 4X3FB 1UNHA 3FQSA 5DEYA 4Y95A 4XLVA 1Q5KA 5DRDA 4D4YA 3DPKA 3R1SA 3W55A 3PDTA 4PTCA 5CU4A 2AC3A 4U42A 5ANOA 2BVAA 2CGWA 5TKDA 4ANNA 3ZM9A 2HYYA 2VGOA 4C61A 3P9JA 3C4XA 3VBXA 4AG8A 3BKBA 4GIIA 3D2IA 4XUFA 3TNIA 3U8WA 4F7LA 5CALA 1Q3DA 4U80A 5DT3A 5HNBA 3ZLWA 3AMAA 3C4WA 4YR8A 1CM8A 3A7GA 2EB3A 1UWJA 4EQCA 1Z9XA 4H1JA 4DFLA 5DR2A 5DA3A 4RX5A 5D7AA 4A4OA 1VR2A 3IGOA 3ZSGA 4YHFA 4BKYA 2ITYA 3KGAA 4DFBA 5CEMA 3IW5A 4IJ9A 2VUWA 2XKEA 3FL5A 2YZLA 4MBJA 4EK3A 3RK7A 3PE1A 5L2IA 3SXSA 3CKXA 3ZU7A 3PXKA 3WF6A 4LRMA 3FEGA 5CENA 3FE3A 2B9FA 1ZYCA 2QC6A 4ZP5A 4IM2A 2ZAZA 4OTFA 4CCUA 2UW0A 3O50A 2R3FA 4IB1A 5AWMA 3VBYA 5ETFA 2BAQA 3ORPA 4RIOA 5CT7A 5GIPE 5HESA 1ZY5A 3FMDA 2W1DA 3K3JA 4JDJA 4RIWB 1Q97A 3L9LA 5ITAA 3FZRA 4ZTLA 3EQPA 3QD3A 5ANDA 5M57A 2HZ4A 3W8QA 2XIKA 4HPUE 1V0PA 2BHHA 3L9MA 4M84A 2GSFA 1NVSA 4YZMA 2UW5A 4M7IA 2QOQA 4MBIA 2UZUE 3E87A 2XNEA 2JKOA 4BWKA 2QONA 2UW6A 5EOBA 3UOLA 5CZHA 4UWYA 2W1GA 3BCEA 5A4CA 3NVKI 5DOSA 2JBPA 4WG3A 3SOAA 2YCFA 5AFVA 4RC4A 3Q04A 2YN8A 2UW8A 4TYGA 2VWVA 4NH1A 4KNBA 5ETIA 4N0SA 4EBVA 4I20A 4KIQA 5AV3A 3FZSA 3E8NA 3LCKA 5C27A 5IEYA 4GUBA 3QZIA 5HG5A 3ODYX 4TWOA 3TKUA 4E6AA 3A61A 3PSBA 4J53A 2VTSA 1U5RA 4JVGA 3EN7A 3JYAA 3I79A 5AAEA 3MH3A 4YHTA 5KO1A 3ZEPA 1JNKA 3HP2A 3PJ8A 5L2QA 4R78A 4G3EA 3H9OA 2J4ZA 2ZM4A 4WIHA 4G2FA 2A19B 3LXNA 3ZUVA 3V8WA 3HV6A 3LKMA 2XH5A 5IA1A 4WSQA 1OIRA 4IBMA 4XG2A 4YLJA 1CSNA 2X8IA 3QWJA 4R7HA 3DB6A 4XRLA 5K5NA 4KAOA 5AUWA 2B7AA 2ZV8A 1U4DA 2XKFA 3W32A 5J87A 3CLYA 3Q3BA 3FZPA 3TXOA 3EQRA 2J9MA 2UZWE 4RC3A 2CPKE 5AR2A 5FM3A 3GVUA 4HZRA 4L68A 5HQ0A 4BI2A 4BZNA 4AFEA 4CMUA 1PXJA 2G15A 4L8MA 4Y72A 5KHXA 1JSUA 2LAVA 4RJ5A 5KUPA 3S00A 4GFOA 3I0QA 5CSXA 5FD2A 1Q8WA 2PK9A 4FTUA 5IQCA 5H8GA 4AOJA 5HEZA 4BCPA 5JH6A 2QVSE 4DH1A 3O51A 1PXMA 4UMQA 1JAMA 1HCKA 3OWLA 4YLKA 2C0IA 3C50A 2WTVA 3JPVA 2W5AA 3PY1A 5BVKA 2VWYA 4BN1A 1J1CA 4FC0A 5M4UA 4TT7A 4UZHA 2YISA 1ATPE 4BDIA 3GUBA 4FV1A 4DFXE 2OO8X 2X2LA 4OTHA 3VS5A 3PJ2A 3P5KA 3R1YA 3WZEA 2W1CA 5DH3A 5BYLA 4I41A 2WMSA 4X2JA 5A4QA 2YIXA 4AX8A 4FKIA 4IQ6A 5I0BA 5IPJA 4I93A 4X2NA 3KF4A 1RE8A 3R7IA 2JAMA 4FV9A 3QRJA 4ACMA 5EDRA 5JFVA 4L7FA 2YM4A 1WBPA 4G9RA 4J52A 4KIOA 4F0GA 5C03A 3GCPA 3DLZA 4GUEA 2PVFA 4LG4A 3Q6WA 5LMBA 1XBCA 4HVGA 5CU6A 5AV0A 4DLIA 2WOUA 4FVPA 3ENMA 5DHJA 1H4LA 5CF5A 3WYXA 4Z9LA 2QO2A 3C9WA 3P0MA 4I6BA 3R7YA 2X1NA 4PV0A 4ZMEA 3GOKA 4YO6A 4EL9A 4B8LA 3OCBA 3PVBA 1YXXA 3VBVA 3F88A 4GJ2A 5HNGA 2W1FA 2ZDTA 4BDEA 4XV9A 4E6DA 3F5PA 4FT7A 5J7BA 4XOYA 3DNEA 4ANBA 2VZ6A 3A99A 3EFLA 2QOHA 3CQEA 3ZHPC 1IAHA 3Q2JA 1M7NA 1BX6A 3HV3A 3IO7A 4ZTHA 2RKUA 3V5LA 2XK9A 4D55A 5JQ5A 3PA3A 1REKA 4KIKA 3LVPA 4IAIA 2OXDA 2RFSA 5AV2A 5TOZA 1S9IA 4BBMA 3RCJA 3UO5A 3TZ9A 5JGBA 5CXHA 2BDFA 5GJFA 4KUJA 4DCAA 2J5FA 4YZBA 3IONA 3Q9ZA 5BPYA 2FSLX 3VRYA 1JOWB 4C2VA 2R3OA 1W84A 2DQ7X 3GU7A 2C1AA 4GYIA 4QPMA 4V0GB 2OW3A 1YXSA 4IX3A 4MTAA 4P7EA 4O1PA 3RAHA 3TDWA 2PL0A 4BRXA 4DEBA 3QTUA 2C3JA 2R7BA 3R2BA 2PTKA 4PTEA 4V01A 1TVOA 5E9EA 5ANGA 5CEIA 2YM3A 3ACKA 4DH7A 2PVRA 3O7LB 3NNXA 5BUIA 4GT4A 5HVJA 2UV2A 4J96A 1J7UA 3AT2A 5HLNA 1BI8A 5B0XA 4YSJA 5DI1A 4HNIA 5EQPA 5E8VA 3L8XA 5FDPA 5DT0A 4DFZE 3FHRA 4AGWA 3PVUA 2JC6A 1STCE 3AC8A 4K77A 2GS2A 5AIKA 2QOOA 4M15A 3R9DA 5JGDA 4ACCA 4AW1A 5M55A 1GZNA 3BWJA 4HYSA 4LV8A 2DUVA 2CNVA 4CEGA 3HRBA 2OG8A 1WFCA 2VTNA 3QC4A 4Y73A 4FZFB 3RPVA 3K5VA 3U6IA 3SG8A 4IX4A 4WSYA 4JIKA 3I5ZA 3TT0A 3F2AA 1RDQE 3KXNA 4O0RA 4WRGA 1OITA 5IQGA 2G01A 4M69A 3W10A 4ASXA 4O21A 3GBZA 4FV5A 4GFMA 1Y6AA 4TN6A 2R3MA 3UC3A 2P0CA 2QG7A 4W4YA 4XRJA 4F6WA 4ZAUA 5BVEA 2HIWA 2O8YA 2FGIA 4L3LA 1UA2A 2VNYA 4I5CA 4A7CA 3O96A 4UB7A 1URCA 4E4MA 4J71A 4O2ZA 3EQBA 4WD5A 3QALE 4BGGA 4EOOA 4EONA 3CY3A 3R8UA 2XNPA 5FLFA 2XJ2A 4FT0A 4AZTA 2X7GA 1W98A 3ROCA 2PUPA 3F6XA 3GB2A 3PSDA 2C5YA 3FLYA 3FKLA 3FXWA 4GYGA 5HTIA 4G5PA 4YGAA 5DEWA 3R9NA 1PXKA 4QPAA 4HZSA 4FIEA 3E88A 3HUCA 4BICA 3A2CA 3DQXA 4J7BA 3CD8A 4NFNA 3LLAA 4AA0A 4AU8A 4EORA 3KRXA 1QPDA 2XIYA 5FXSA 3DTWA 5TE0A 3OT3A 3LXKA 4XP3A 4BBEA 3BQRA 4L9IA 4LFIA 5M56A 1ZY4A 2B9HA 2BAKA 5D1JA 4AACA 3EN4A 3NUPA 4FTJA 4U44A 2YIYA 4CCBA 3C13A 5IUGA 4FV2A 2HWPA 4DTBA 5E8SA 3HYHA 4PL5A 4V05A 4BZOA 4BY9E 1FOTA 3CTHA 4G34A 5HNIX 3UPZA 3UZRA 2BRMA 3BIZA 5DR9A 3DXNA 5HTBA 5CSVA 5ETAA 2PY3A 1VYWA 4EOMA 3MGYA 3D5UA 3R30A 5CWZA 4I1ZA 3ZFMA 2WIPA 1PF8A 2PZPA 1BL7A 2F7ZE 5E91A 4ASZA 4BC6A 4E5AX 4PNKA 3D2KA 3U87A 3OXTA 3NUXA 2O3PA 4WG4A 1SM2A 3DCVA 2GNIA 4CMTA 4DFNA 4CKJA 4DCEA 4USEA 1IASA 4HYHA 3R8ZA 2WMBA 4BDKA 4CFUA 4HW7A 3HMNA 2VN9A 5HCXA 4FTLA 4JAIA 3M11A 4OUCA 4EH5A 5CU0A 4ZSGA 2QCSA 4ZXTA 4L46A 3BU5A 2C0TA 1K9AA 2PZ5A 4S2ZA 5A6OA 4BCQA 3LMHA 3KF7A 2GMXA 4KIKB 4W9XA 3EMGA 5H3QA 5E8WA 5IQHA 3DGKA 2YITA 1XR1A 3HECA 4IAZA 1V0BA 4DTKA 4JR3A 4G6NA 4ZJIA 4RSSA 4WHZA 5J79A 4HPTE 3RGFA 2F7XE 3E63A 4IAFA 2VTHA 3ELJA 4KSPA 1GOLA 4AA5A 1CTPE 1ZMWA 3QTZA 3MVMA 4PP9A 4X2FA 4EQUA 3JY0A 1UU8A 3QFVA 3R04A 3GCQA 4ZIMA 2CGXA 3IECA 3AT4A 4I5MA 4PWNA 2B53A 1FQ1B 5TT7A 4O2PA 5T68A 3QTWA 2I6LA 4EUTA 3AC2A 4DEGA 4AGUA 2OH4A 2JFMA 4AFJA 1HOWA 3C5UA 4RJ3A 3ZLXA 2XKCA 4ANMA 2OGVA 4QTAA 2VV9A 3VHKA 2IW8A 5JFXA 2IZTA 3W2PA 1MQBA 3V5QA 3I5NA 5CAOA 3PRFA 4B4LA 5AV1A 4R3PA 2A1AB 2B52A 2J0IA 3BYOA 5L3AA 4OTRA 2UZOA 4DEIA 3PIYA 3LCDA 1P4OA 2FA2A 5JGAA 4AW2A 1Q99A 2E9NA 4WNKA 4WNOA 4U40A 3AD6A 3VULA 4EKLA 2YDJA 1JPAA 3MW1A 4EOSA 3CXWA 3SX9A 5I3RA 4IVBA 3PG1A 2R3PA 2PVNA 3HKOA 2WKMA 4RVTA 2KTYA 2VO0A 4IVCA 4UWBA 5AP2A 3RHXA 2PUNA 1OGUA 2VTMA 3H4JA 3F7ZA 4JJRA 1PMUA 5E7RA 3V8TA 5LQFA 2BKKA 2QOIA 3WIKA 3QUEA 2C5NA 5I9XA 2HXQA 5HICA 2YACA 4GVJA 4EOIA 2HW6A 1BUHA 2OJGA 5LMAA 4BDCA 4PF4A 3NW5A 4XG3A 4JQEA 4IJPA 5EYCA 4RX9A 3ALNA 5CSHA 2PSQA 4N6YA 4O0SA 1J91A 3FZTA 4YJUA 5CTPA 2XRUA 5CSPA 4BYIA 1AQ1A 4FTRA 3T9IA 4RIYA 5B7VA 3QF9A 3LZBA 3LXPA 4Z16A 4A9UA 2YM6A 2CKQA 4F65A 2EU9A 2WTKB 5EQEA 2X8DA 4FR4A 3NCZA 4F9AA 3ZOSA 3KXMA 3Q4ZA 4QP9A 2R3JA 4O1OA 4FIIA 5D9HA 4FTOA 3SD0A 5IKWA 4IC7A 2FO0A 4BDJA 4UN0C 2C6LA 2XCHA 3QTXA 5HIDA 3FI8A 2YWPA 5DYJA 2VTJA 2X2KA 5BYYA 3DU8A 4K9YA 4YZNA 2PULA 3BEGA 3G6GA 4GS6A 4WRSA 4XS2A 4ZSJA 2QR8A 3IW4A 4TZRA 3QXOA 3MIYA 2P2IA 4LOOA 1B38A 4PQNA 5CY3A 3REPA 1NVRA 4L53A 2ACXA 2QOBA 3R01A 4FV3A 3A7IA 4EI4A 1OPJA 3ZS5A 5ICPA 3UO6A 4BI0A 3U6JA 1J3HA 1SVGA 3O7LD 2XIRA 2R3NA 2ZM1A 3R8MA 3PXQA 4X3FA 4YJSA 4D2TA 1R78A 2VTIA 4K0YA 4AW0A 1PXNA 4AAAA 4D4SA 4H39A 1W82A 4RQVA 4A9RA 3R9OA 2IWIA 2UW7A 5CZIA 3SAYA 1XJDA 4MH7A 5CI6A 5EDQA 3D0EA 4ITHA 2Y4PA 2OJFE 3HMMA 3IQ7A 4NKAA 2BZJA 4WUAA 3UPXA 2PYWA 1XBAA 3F3UA 1Q41A 1P4FA 3RZFA 4C57A 3EYHA 3ZBXA 1UU3A 1OVEA 4GIHA 3FY0A 3QZGA 2F49A 3F3WA 4R1YA 5LVPA 2E9UA 4U41A 2CLXA 3RAKA 2BDWA 1WBVA 3H30A 2H96A 3R71A 4QYFA 2HCKA 3F7WA 4I6HA 4UYNA 5HVYA 4ZLOA 4UV0A 1KWPA 1KOAA 2YAAA 5EYMA 5F4NA 4FT3A 4IX5A 3G2FA 4EHEA 4CNHA 4AZFA 4MK0A 4A4LA 3VJOA 5LXMA 1G8AA 4FBXA 2ITPA 3LJ0A 4TWNA 4IB3A 2V62A 5E1SA 2F4JA 4CTBA 4DF3A 3NR9A 5HLPA 4KKGA 2OXYA 2UW4A 4GV1A 4EWQA 4CLJA 4GH2A 4NT4A 4GL9A 3LQ5A 4JNWA 1MUOA 4TYEA 2P33A 5HG8A 4KABA 3VUDA 3ET7A 3U4UA 3ZEWA 2GS6A 4RVMA 1AD5A 2JKKA 2GNFA 4FE2A 4RFMA 4PNIA 1G5SA 2OBJA 4RIWA 3FDNA 2I7QA 2Z7RA 3RJCA 2WU6A 4YBJA 3RCDA 2WPAA 5E8TA 3TKHA 1VYZA 2WO6A 4HJOA 4OTGA 5EOLA 3Q2MA 2IZSA 1DAWA 1OB3A 1P5EA 3QQJA 4AQCA 4OAVB 4QMZA 2F9GA 3OXZA 3QLFA 4FZDB 4B99A 4RLLA 2WNTA 3L9PA 2CMWA 4O7LA 2Y9QA 4O96A 4FKTA 3I7CA 3FXZA 4CVAA 4KBAA 4DH5A 2IN6A 1YHWA 2Z02A 4FZAB 4E4NA 1PYXA 5IQDA 3H3CA 3KB7A 3QAME 3UE4A 3LW0A 3MA6A 5FBOA 3TNQB 4XX9A 2HK5A 4GFGA 4ZS0A 5H9BA 3NNWA 1LR4A 2GNJA 4E4LA 4OBQA 3E5AA 4PUZA 4FGBA 2J5EA 4QYYA 3VN9A 5D41A 2IW6A 4F9CA 4IM0A 4FEUA 4QTEA 2IG7A 5G1XA 3TNHA 1GZKA 1H0VA 2PE1A 1OMWA 1TKIA 4IZ5A 1XO2B 3RZBA 4F64A 5CAQA 4R3RA 3R0TA 5BVFA 3LPBA 2PPQA 3JS2A 5E4HA 4FKJA 4ZTSA 4O91A 4OTDA 2WMVA 4FI1A 3MJ2A 1MRUA 4XYFA 4EC8A 3MY1A 4IVAA 5M53A 5HCZA 3Q96A 4ZOGA 3BYUA 1OKVA 3E62A 2AC5A 3MPMA 2Y6MA 4MXAA 2QO7A 3DK3A 2GPHA 5HLWA 3SA0A 1Q8UA 2YJSA 4YP8A 4PMSA 4DLJA 3LFEA 4I24A 2CLQA 3F3ZA 4GKHA 4FKUA 3QTSA 1OIQA 5EI2A 3D14A 3KRLA 4BCFA 5CEQA 4XG8A 2A4LA 2B9IA 4X21A 3U4WA 4MAOA 4FIFA 4RT7A 4LL0A 3WF5A 3ANQA 4P2KA 4D0XA 3G5DA 2XBJA 2Z7QA 5FP6A 5K3YA 3MWUA 3OMVA 3SDJA 4ZSLA 4GCJA 3QKMA 3VRZA 4XG7A 4GK2A 1RW8A 1ERKA 4BYJA 4C3PA 1PJKA 1Q8TA 3R73A 2WMWA 3W2RA 4E5BA 3UP2A 1NT2A 1OKZA 4U5JA 5CU2A 4C33A 3KK9A 5I9WA 3D5WA 4J98A 4WO5A 3VUKA 1YVJA 2VTLA 3R7VA 1Q62A 5HVKA 4TWCA 3OCTA 2B54A 3F61A 4FT5A 4CYIA 1PKDA 3H10A 4PMMA 2X4FA 2HZNA 1FVRA 4N6ZA 5B2MA 3GCUA 3QQUA 2BRNA 2X39A 3FKNA 4QQTA 3FYJX 3I81A 3V6RA 3IW6A 4DT9A 4CTCA 3CIKA 1ZARA 3FI3A 5IQEA 2YIWA 3W18A 3CKWA 4EK6A 3KULA 3EZRA 4NIFB 3A8WA 3MY5A 3ZXTA 3O8TA 2W96B 4P5ZA 3CQWA 3FMJA 4QMLA 3QA8A 5DN3A 5E8UA 4Y85A 4H3QA 1CKJA 1XQZA 3FLZA 4YC6A 2WIHA 5JZNA 4RG0A 4ZTQA 3BU6A 2Z7LA 4CRSA 3QCXA 3MY0A 4XV1A 3COMA 4K11A 2FSMX 4K33A 3EQDA 3R28A 4I4EA 5AIRA 2J7TA 5HE2A 3W33A 1H08A 4MKCA 3FUPA 1Q8ZA 4DITA 3NNVA 4BCJA 1WBTA 4CYJA 5J9LA 2XNMA 4F0FA 1EH4A 4NTSA 1YDSE 3QHWA 2C6DA 4DG0E 3UQFA 2VTTA 5FEEA 1H1QA 4TL0A 4MX9A 2DWBA 3LIJA 3EB0A 1IG1A 3CY2A 3Q4CA 3NLBA 4TPTA 4C3FA 2VWZA 1JBPE 2UZVA 4MEDA 1H01A 2YJRA 4K6ZA 2BZHB 3C1XA 4NTTA 5KMOA 1HCLA 1UU9A 2W1HA 3WBLA 5JRQA 4XNEA 4O84A 4FOCA 4PL4A 4A06A 4JBPA 3G15A 4C7TA 2XIZA 4EKKA 4IZYA 4JQ7A 2VWIA 5HG9A 1PXIA 2WB8A 4I4FA 3LCOA 2WTDA 4YNOA 3R02A 1S9JA 3MIAA 4FSQA 4FVRA 4HGEA 3GC7A 4BCMA 2REIA 3QC9A 4FNZA 2W4KA 4DN5A 5L2TA 4V0GA 2YAKA 2VO6A 1FBNA 4NM0A 3OFMA 4O0VA 3HRFA 3MPTA 4MD9E 3I6WA 3MA3A 4NUSA 2VX3A 2QO9A 2W0JA 2ZV2A 4IW0A 5FEQA 4EZ5A 5L4QA 2XS0A 2GU8A 3SQQA 1PXLA 1GAGA 4ACGA 4F09A 4EUUA 1YXUA 5AM7A 3RPRA 3FJQE 3IW7A 3QD0A 3SRVB 1XH8A 3PPZA 3QYZA 3LFQA 4CD0A 2WTJA 1R0PA 1Z57A 3EJ1A 4E7WA 4I22A 1SMHA 2WMXA 1GIIA 5CX9A 5IA4A 2OIBA 2A27A 3DBQA 4FNYA 4O0TA 4GJ3A 4TRLA 3FMMA 5J8IA 3FSKA 1ZLTA 3MSSA 3M2WA 5GZAA 3DAJA 3EIDA 4UXLA 3VQHA 1W7HA 3NDMA 5DFPA 1JLUE 4FV7A 5IUIA 4E6QA 4WKQA 3GC0A 5EG3A 5CF4A 1WBWA 2GTNA 2XVDA 5M44A 1JKSA 1H00A 3DKFA 3VUMA 3WILA 3UJGA 2F57A 2VTAA 5ANJA 2RF9A 3WZDA 4I94A 3PYYA 5HBEA 4QMYA 3FC1X 1I44A 4ZZNA 4CG9A 2YA9A 4IXPA 4KINA 2ZMCA 3SV0A 2WD1A 5CYIA 1AGWA 4FNXA 3FI2A 2XK3A 3NIEA 4FEVA 3AC3A 2NNWB 4DGLC 4QT1A 4E93A 4LM5A 3OS3A 3UG2A 3UQGA 1A06A 3U9CA 1YW2A 3QWKA 4I3ZA 1F3MC 4BDFA 2H6DA 2ETKA 5JZJA 2VTPA 5F94A 2OK1A 1ZZLA 3MN3A 2HAKA 1XH5A 4MXYA 5CF6A 2CN5A 3ZLSA 3LM5A 3DY7A 3FLQA 3I60A 2VWBA 4BIDA 3HEGA 4EWHA 2X9EA 5A4LA 2PVJA 5CAPA 3ZSIA 1YOMA 1YOLA 2VGPA 3NAXA 4HCTA 2X6DA 3FAAA 4RJ7A 2ZV7A 4MCVA 5FEDA 5JFSA 4YJNA 3UIXA 3VBQA 2OF4A 1LUFA 4HVDA 3PVWA 5L8JA 3R2YA 3CCNA 3R7OA 5C26A 2VO3A 3TI1A 4ZSAA 3OW4A 4OBOA 4CLIA 4DGMA 1FMOE 4FNWA 4AGCA 4GSBA 5J5TA 3ZZWA 3ORKA 3W2QA 4LGDA 4QMUA 3ZO3A 3TUDA 1G8SA 4Q5HA 3EL8A 1OL6A 4O27B 4QP1A 4RWLA 4YJTA 2XNBA 5K0KA 2QOKA 5HD4A 2C3KA 2NPQA 4JAJA 4X0MA 3KULB 5LWNA 3N4UA 4H3BA 4U0IA 4HCVA 3KXZA 4DGGA 4U43A 3TDVA 3CGOA 2H34A 3POOA 3LFBA 5K0XA 4YO4A 4C4FA 5ANKA 1E1VA 1LPUA 4BGHA 3OBJA 4QTDA 2ZOQA 4QMMA 2ZVAA 5EM8A 1NY3A 1KSWA 4S30A 3JUHA 2YIQA 3KRWA 4FTTA 5D11A 5BNJA 3RKBA 3GU5A 5C8KA 2GDOA 3KCFA 4JBQA 4YNEA 3CSVA 2YDIA 3D94A 3U51A 4JG6A 2FVDA 3P1AA 3PA5A 3OBGA 4FYOA 3S95A 4NL0A 3PXYA 2YLFA 4FKPA 5GHVA 4D28A 4FOBA 2W05A 3ATTA 2YDKA 4IX6A 4E8AA 3VC4A 4WBOA 3B8QA 2JD5A 3A4OX 3FMKA 4JOAA 3DTCA 1YHVA 1SYKA 1YKRA 3MV5A 3UGCA 1K2PA 5HHWA 4RMZA 4BIBA 2OJ9A 5HX6A 5HU3A 4X3FC 4IDVA 3G9LX 5AR5A 1KV2A 3DJ6A 2R3IA 1GNGA 3NUSA 1ZZ2A 2BAJA 1DM2A 5AP5A 2BFYA 3EQGA 2C30A 4U45A 1H24A 1PHKA 4W4XA 3SXRA 3R83A 4CXAA 3QRIA 3UVRA 3FY2A 2HY81 4HYUA 4KKEA 4HVHA 1SVHA 2J6MA 3HP5A 5LVOA 4FK6A 4IVDA 5HGIA 4L00A 3VUGA 4BKZA 4WG5A 2OFUA 4L42A 3ZH8A 4CT1A 5BVDA 3QRUA 2WAJA 1OL1A 4M0YA 4JG8A 3EKNA 2LGCA 5KMNA 1H1RA 1B39A 2NO3A 5LARA 2OIDA 3HMIA 2JIUA 4E73A 3RNIA 4C4JA 3FZOA 2EXEA 2JITA 3QD4A 3ITZA 2A2AA 5DE2A 4D2SA 4R8QA 3D7TA 4ITJA 4F99A 2E9VA 4FZ6A 2QURA 3SW4A 4RFYA 3AQVA 3UP7A 1QPEA 2WEVA 3TJCA 5C8NA 3IS5A 1JVPP 2IZRA 5BMMA 4LRKA 4YZDA 5BQ0A 2ITVA 3ZFYA 2CNQA 5G6VA 4EK5A 4DEEA 3GT8A 1SNXA 5DIAA 3VUHA 2HWOA 2I40A 2VX0A 4PX6A 4FKVA 4A9YA 2I0EA 4HVIA 4FSZA 5BVOA 1OKYA 4IHPA 2P2HA 2HOGA 2Y8OA 3DS6A 4W8DA 3WZKA 4C62A 4EBWA 4Z7GA 2XK8A 1IA9A 1ZOHA 3ZUTA 3KK8A 4BTKA 5J9ZA 1RQQA 3IDCA 1GJOA 3T3UA 2J2IB 4JBOA 4IZAA 5J1VA 3KREA 4QP4A 2QI8A 5EHLA 5ETCA 3WE8A 4AZSA 1H28A 3SW7A 3LE6A 3QCSA 4NSTA 4ZY6A 4XV3A 4UEUA 4IWOA 3RAWA 5I3OA 3D15A 2OWBA 2PHKA 2ITOA 5F95A 3K3IA 4PDSA 4AT5A 1H1SA 4I6QA 3OY1A 1YWNA 2X4ZA 4BDDA 4UMPA 3T9TA 2ETMA 2BRBA 5A9UA 3HA8A 3ZCLA 5TO8A 5J9YA 1ZMVA 3ZRLA 4MQ2A 5C8MA 4Z3VA 3BE9A 1A9UA 3T8OA 4ITIA 2X2MA 3CBLA 1REJA 1IAJA 3I7BA 3G90X 4KRDA 4LMNA 5CQUA 4LL5A 3VS6A 1DAYA 3OOGA 3ZC6A 4CV9A 3EKKA 4Y8DA 4IWPA 4XBRA 2J0KA 5IUHA 3EQCA 5HZNA 2VD5A 2QLUA 3OXIA 4QMTA 3LMGA 5B2LA 4USDA 3BHTA 1PMNA 1KV1A 2CDZA 2EXCX 3KRJA 2ITQA 3ZM4A 1FPUA 3RPSA 3W8LA 3EOCA 4DH3A 1FVVA 3UBDA 1FMKA 2C6IA 2OZAB 4F1OA 4X2KA 3A60A 2VTRA 3NS9A 3PRIA 4EH7A 2UZNA 2WMUA 3KVWA 3TUCA 1J7LA 1DS5A 3CP9A 4O86A 4L67A 5GNKA 5D7VA 3A4PA 5FG8A 2ERKA 3WI6A 3HL7A 3U55A 4QYHA 1GZ8A 3UO4A 3S1HA 3GI3A 4RA5A 4MNEB 3EWHA 4PPBA 3KN6A 4EHVA 4BBFA 2BDJA 5EW8A 4IFCA 1MQ4A 1UNGA 2B55A 5EKOA 3SC1A 2PUIA 4ERKA 4JDHA 5AX3A 4J99A 4O38A 5A4TA 4IIRA 3L8PA 5AX9A 2J0LA 5K9IA 4XP2A 4OT6A 3PLAE 4FTKA 1J1BA 3I6UA 3ORLA 4ACHA 2XYNA 5E8XA 3SXFA 1K3AA 3QQFA 3M1SA 2JDOA 3OC1A 1Q4LA 4GW8A 4XHKB 5AP4A 4AA4A 5L2SA 3AD4A 5CLPA 3TIZA 3MVHA 5I5ZA 4PDOA 3R8LA 2WOTA 1OL2A 3TTIA 4ASEA 4FUYA 3V04A 2C68A 4D5KA 4RIXA 4IC8A 3VF8A 3BWFA 3QU0A 3LFAA 4IDTA 4X3JA 2QHNA 3HLLA 3OOMA 5CT0A 3KMWA 4JX7A 5E90A 2OSCA 4NWMA 5E8ZA 2GNHA 5ACKA 2J90A 2BRGA 2RGPA 3L1SA 4ACDA 4CZTA 1QL6A 4QTBA 4ZMFA 3TNWA 2WMAA 4K8AA 4RWJA 2RFEA 3E3BX 5LJJA 4YPDA 4FV8A 4O22A 5CVHA 4J8NA 3EQIA 3S4QA 2VWUA 1Y57A 3WIGA 1H07A 1OL5A 3BE2A 3LOKA 5D10A 4U8ZA 3NMUF 3OT8A 3FBVA 1O6YA 2OIQA 3ACJA 4KRCA 2R3GA 1PYEA 2HZ0A 2IPXA 4QOXA 4CFWA 4QTCA 5AA9A 5LCJA 2QR7A 4GKIA 4I5PA 5ACBC 2OLCA 4WA9A 1L8TA 3KN5A 3DB8A 4FG8A 4S34A 3VBWA 2WU7A 3D7TB 4XMOA 2RG5A 3GNIB 1GY3A 5LVLA 1UVRA 3LCSA 4BHNA 4ZEGA 4EJ7A 2V0DA 3AMYA 3Q5IA 3QRKA 3VS1A 4BR3A 5DGZA 4IB5A 1NA7A 4QP7A 3BBTB 4RGJA 4RJ4A 4W4VA 4H3PA 1MRVA 2W5HA 4FYNA 1IEPA 3FKOA 3MI9A 4MYGA 2JDRA 2C6OA 3HA6A 3G9NA 1YWVA 1VEBA 3CEKA 4CFVA 3PJ1A 4ALWA 3LHJA 4IE9A 5LVNA 4JX3A 4E1ZA 3CPCA 5T6KA 4QMOA 4JS8A 5IDPA 3P7CA 2NRUA 3II5A 3UZPA 1W83A 5FTQA 4AS0A 2X6EA 4R7IA 5CEPA 3TUBA 4DA5A 4O7ZA 3R9HA 5ANIA 2XP2A 5AA8A 4D9UA 3Q9WA 5JSMA 2BTRA 3O8PA 5GINE 3RVGA 3ZUUA 2HELA 3IDBA 2QOFA 1VZOA 1F0QA 3KMMA 4FIHA 4KBKA 1IR3A 3V01A 3EH9A 3LCTA 4WNPA 1WVWA 4LUDA 3TZMA 2I0VA 3E3PA 3DQWA 5L8KA 2FSOX 2XJ1A 4CFMA 1OBGA 2XYUA 3WZJA 4BB4A 3TNPC 4CKRA 1CDKA 3DNDA 3PTGA 3FMLA 3W2CA 4EHGA 4JDIA 3PWYA 4C4GA 4RX8A 5EFQA 3RM7A 3TKIA 2G2FA 2W17A 4L43A 5BVNA 4FK3A 4L3JA 3PLSA 5AR3A 1UV5A 4JL9A 5FXQA 3VUTA 3WF8A 2XNGA 3QA0A 2PMOX 3VAPA 2WXVA 4Y5QA 5IG1A 3GU4A 4KS7A 3V5JA 4H58A 4BI1A 4BKJA 4IAKA 4FEXA 1CKIA 3IK3A 3QBNA 1JKLA 3GOPA 5BUJA 2PMIA 3QQGA 4QQ5A 5CS6A 5D12A 5T3QA 3PIXA 3OG7A 3RNYA 2UZBA 4G17A 5IH4A 4RC2A 1XHAA 3DXPA 1JWHA 2YLEA 4C4EA 4A07A 1M14A 1TQIA 4B9DA 2R0UA 2PVHA 3E7VA 4HYIA 2JAVA 3TIYA 2WTIA 4BDHA 2C5XA 4IB0A 4FTCA 2VU3A 4NIFA 5IA3A 2PMLX 3P7AA 3DKGA 3I1AA 2X0GA 4FICA 4O6EA 2Z7SA 4ZSEA 4EZ3A 5GIOE 4D1XA 4BCHA 1LEWA 3BHYA 4L7SA 3C51A 3ULZA 3VVHA 5AMNA 2GTMA 4FGRA 2GQRA 4LOPA 4LRJA 4QMWA 2C0OA 2XZSA 1TQPA 2ZB1A 3MDYA 2WGJA 4MNFA 1W0XC 4IEBA 4TKSA 5EW3A 3R7UA 3NGAA 3GEQA 4LGHA 5JEBA 3L8VA 4D0WA 3S0OA 4EOLA 2GHGA 2W06A 5GJDA 3LQ3A 3DZOA 4FV4A 3UTOA 1JKTA 2GNGA 4ONAA 4AP7A 3SG9A 5EI8A 3VW8A 4D4VA 3N4VA 4ANSA 2V55A 5DT4A 3CJFA 1YHSA 4B8MA 4EH6A 3COKA 4QRCA 4FODA 4DH8A 2XKDA 4QO9A 5M07A 3UG1A 2QKRA 1PXPA 4KWPA 1WBNA 5M4IA 4ORKA 4AE9A 2XNOA 2QU6A 3BU3A 3F69A 4U9AA 1YXVA 4RIXB 4Y5HA 4NW5A 4QP8A 2W1ZA 4G31A 2P4IA 3F5UA 4RJ6A 4U79A 4XEYA 5IQIA 5CQWA 3CR0A 3R1QA 3H9RA 2WEIA 3Q9XA 4BCIA 3BGPA 3NYNA 3OF0A 1I09A 3PWDA 2B4SB 2UUEA 3H0YA 4KIPA 2PZRA 4N57A 5L8LA 5EI6A 3FPMA 2VNWA 2CKOA 3K2LA 4JDKA 1E9HA 4YJVA 3TZ7A 1XH9A 2BRHA 4F6UA 4NYEA 3OWPA 3F2RA 2UVZA 4IAYA 2PVYA 4YPSA 4NFMA 3C7QA 5LCKA 2PZIA 4RVLA 1YXTA 3DV3A 4Z55A 4F9WA 1PRYA 2JIIA 3HRCA 4OGRA 4BCKA 2UZTA 4AT4A 3ZSHA 5KMMA 2Y0AA 2GQSA 5GZ8A 4NJDA 2IVUA 2QOCA 1KE6A 3P23A 2Q0NA 4HCUA 5EQYA 4DT8A 5M09A 4EH8A 3DBEA 2O0UA 4HOKA 4XH6A 3NIZA 3SRVA 3G6HA 3OEZA 2V22A 3WOWA 5IDNA 3A8XA 3KQ7A 4AOIA 5K4JA 2CCIA 3CE3A 4P4CA 3DAEA 3PA4A 3JY9A 4AGDA 4TXCA 4BFMA 2W1EA 3MH2A 1PKGA 3F9NA 5FGKA 4GG5A 3P86A 4PRJA 4F1MA 5M08A 4HGSA 4KKHA 5CNNA 3DBFA 4C4HA 4FL2A 3QL8A 4RA4A 4QQJA 4ANQA 2W5BA 5A46A 4PP7A 4JRVA 4RRVA 3RWPA 3TCPA 4DC2A 5JN2A 3AGMA 3GQIA 4KD1A 3VJNA 4YTCA 2FYSA 4D2WA 2DYLA 4C59A 4X6QC 2C5VA 4PDYA 3GFEA 4I0RA 5BUEA 4AN9A 1BI7A 4TW9A 4YBKA 5IQAA 1XWSA 4J1RA 2IVTA 3ULIA 4AN2A 4YZ9A 2BIKB 4PMTA 4XCUA 5AP6A 4M8TA 2R7IA 2J0MB 3HUBA 3KMUA 5EH0A 1H1PA 5M06A 4IADA 1WBOA 4D2RA 2XM8A 5AUYA 2ITUA 2QD9A 2W9ZB 3NSZA 4J97A 2YFXA 4ZLYA 2C3IB 3CQUA 3LAUA 5EYKA 5TR6A 3PPKA 2RIOA 4G3CA 3KFAA 2C6KA 2YCRA 1FGIA 2Y6OA 3DBCA 3DLSA 1U46A 2ZMDA 5FRIA 1CMKE 3OHTA 3QRTA 2KULA 3UZTA 3PXFA 1H0WA 5AR7A 5EYDA 2YM8A 4I0TA 1O6LA 2YM5A 2YM7A 4OTQA 4BIEA 4FEWA 4FG7A 4F70A 4FA2A 4DBXA 2WQNA 3RWQA 3Q60A 4AZEA 3FZ1A 3S2PA 4RZVA 5AP7A 3BBWA 1WCCA 4UMUA 3ROYA 3R8PA 3ORNA 2BKZA 3Q52A 4PDPA 1ZYLA 3GGFA 3I0OA 4RQKA 4XLIA 2FSTX 3UIMA 1LEZA 3UMXA 3O2MA 4BDGA 5IH5A 2R5TA 2ZB0A 4G3FA 3BV2A 4QP6A 5C4KA 4M0ZA 4PPAA 2VO7A 2X7OA 2R3QA 5LMKC 3KCKA 2IJMA 2VTOA 3Q4TA 4RVKA 4GU9A 4QQCA 2XMYA 2VWWA 3BYSA 2ESMA 3NEWA 4BWPA 3PG3A 3VF9A 4ARKA 1R1WA 4YTIA 4NM3A 4U3YA 1Y6BA 3MPAA 4D2PA 1T46A 3NW6A 1YI4A 3U6HA 2WTKC 5EM5A 1V0OA 3BV3A 4APCA 4L52A 3BGQA 5IA5A 3B2TA 4AT3A 4F7SA 2C3LA 3MH0A 4FSUA 4R3CA 3KL8A 3PY0A 5IF1A 3G51A 5M4FA 3NYXA 3KXXA 3U9NA 1ZYDA 4XV2A 5KCVA 4YZCA 2JDTA 1Q3WA 1U5QA 4DGOA 2XM9A 2NP8A 4F0IA 3VS4A 4FTQA 4YSMA 5IMXA 4UMTA 4JT3A 4DFYA 5C1QB 2J51A 2CJMA 3VUIA 5FBNC 3NAYA 3QGYA 4ZZMA 3FMEA 5LVMA 3QLGA 3UODA 3OTVA 2GFSA 3JR1A 3GCSA 2WMTA 5DVRA 4GT5A 5FTGA 2W9FB 2C69A 3ZFXA 2XRWA 2QLQA 3QCYA 1URWA 5KZIA 4ANOA 2R9SA 2ITWA 1NVQA 4R7BA 3FL4A 3QCQA 5HCYA 1OI9A 3POZA 4FX3A 4R5YA 2ETRA 4ZK5A 3PJ3A 3DT1A 4W4WA 5CAVA 2OXXA 3FPQA 5EM7A 4ERWA 2WQBA 4IFGA 4GK4A 4D1SA 4O7NA 3EYGA 3NCGA 3EL7A 2BTSA 4FSYA 3UOJA 4JBVA 2ZJWA 4S31A 4C35A 3H0ZA 1UWHA 2X7FA 2HZIA 3QHRA 2BROA 4P90A 3NVMB 1XH4A 4Q5EA 3G33A 3A7JA 1L3RE 4XP0A 1M7QA 5EW9A 5F20A 3CD3A 5JMSA 3D83A 5DG5A 3SHEA 4KA3A 1NXKA 3R63A 4CSVA 3THBA 3VO3A 4ZLZA 1H25A 4I0SA 4UY9A 3ID6C 2JKQA 2UVYA 3F3VA 3ORIA 2C6MA 4FKSA 4NK9A 4C02A 2W1IA 4NZWB 3EN9A 4K2RA 4D5HA 2B1PA 3F66A 3FLSA 4NM7A 5I9VA 1WVXA 1KE5A 3R22A 4D2VA 3EHAA 3EQHA 4NCTA 2OFVA 4DBNA 3DDQA 4IACA 5IMEA 2WFYA 1OPLA 2ZV9A 4G9CA 4O0YA 5CVGA 3PPJA 4QPSA 3HMPA 5IZFA 3W16A 5BX0A 4JIAA 3R21A 5EKNA 3VW6A 3OCSA 4NU1A 5AUVA 5FXRA 3RP9A 4GRBA 4YJPA 1H8FA 2WHBA 4HVSA 4AZWA 2ITXA 2X81A 3HNGA 2XEYA 3MTFA 4BCGA 3IW8A 3LJ2A 1JSTA 4KBCA 4UX9A 2ONLA 3B2WA 4WNMA 4BWXA 3M42A 3P78A 2CSNA 3F2NA 4FKLA 5IA0A 3KA0A 3K5UA 4N4SA 3PVGA 4PY1A 3LFDA 2C6EA 3QZHA 5HG7A 4AUAA 3V51A 4CKIA 2Y7JA 2QODA 4G6LA 4FSRA 3F3TA 1PMEA 2GNLA 1OBDA 1OPKA 2G9XA 5JQ8A 2ERZE 1WBSA 1ZRZA 4OTIA 4ALVA 4GMYA 1YI3A 4FTNA 4QD6A 4CRLA 2V7OA 3NW7A 4BTJA 3HAVA 4YTFA 1YRPA 4F08A 1YQJA 1XH6A 2BUJA 3UVQA 3AC5A 2O5KA 4TTHB 5JK3A 2BIYA 3WF7A 3BLRA 4U97A 3B8RA 2Z60A 3ZXZA 2OZAA 1Q24A 3TACA 1KE9A 4YC8A 4OT5A 4IWQA 2O64A 5KE0A 3Q32A 4RWKA 4BGQA 3AD5A 3R1NA 2JLDA 3QUPA 2ITTA 5IISA 3BRBA 2YABA 4LGGA 3R6XA 4MNEA 5LOHA 4OBPA 4CGAA 4TYHB 3RINA 2J50A 1T45A 1M52A 1V1KA 4C37A 5HE1A 2CCHA 4QNAA 2UZEA 2ZM3A 4RBLA 5HU9A 3OW3A 3C5IA 3IG7A 4XBUA 5CANA 2WQOA 3FQHA 3OWKA 3GU8A 1LP4A 4A4XA 5HBHA 4ANLA 2G2IA 4GU6A 2W7XA 3ORTA 3UOHA 2H8HA 2Q83A 3PFQA 4ZS4A 3OP5A 2W4OA 1ZXEA 3RAIA 4ZTMA 3C4EA 2R64A 2YEXA 5I9UA 4CMOA 5CAUA 4QMVA 4FG9A 4H05A 3NPCA 1PXOA 4YU2A 1ZOGA 2PUUA 2WMQA 2ZYBA 2GQGA 5C01A 4CV8A 3ZO4A 1H27A 4QMPA 2ZDUA 2JDVA 3LQ8A 3GP0A 4YTHA 3KC3A 4FKGA 4PTGA 1OL7A 3GFWA 4O0WA 4A9SA 4MVFA 4AWIA 4ZZOA 4L44A 3QGWA 4J8MA 4C2WA 4TNDA 2R0IA 4GEOA 3FYKX 3GENA 3DKOA 3DDPA 4II5A 1RJBA 4KSQA 5HORA 1M2RA 2XK4A 1FINA 3U54A 3QXPA 2F2UA 3PE2A 4RPVA 2EWAA 4KS8A 5E1EA 1BYGA 4E5WA 1Y8GA 3OWJA 4S33A 5AADA 5IQFA 4O7VA 3E8CA 1GIHA 2Q0BA 2R3LA 1A48A 1BLXA 2C5OA 2GCDA 4G3DA 3E8EA 4FV0A 3C0IA 3L9NA 5HBJA 5IU2A 5HO8A 1ND4A 2JKMA 1OUYA 5F1ZA 2BZIB 2YERA 4EOPA 3IPHA 4ZJVA 3NX8A 1FGKA 3HMOA 3R7GA 4DGNA 4G5JA 5EM6A 3ZLYA 4Y83A 5L6OA 4MQ1A 3FWQA 2VX1A 3MB6A 4U3ZA 4FKOA 4OTWA 4W8EA 3DK7A 3ZRMA 2JEDA 2QQ7A 3K54A 3RPOA 1Q61A 3D7ZA 1BMKA 4FF8A 3LFNA 3DFCB 3ATSA 3FLWA 4HNFA 4WBBB 4M68A 4I92A 5AEPA 4CT2A 2XIXA 4YHJA 1KE7A 3LXLA 3OUKA 4QMNA 2WQEA 3G0EA 5DMZA 3NYOA 4D58A 2XBAA 3TN8A 1GIJA 4IZ7A 5HO6A 4IH8A 4Q2AA 3RTPA 1P2AA 3FQEA 5I9YA 3HDNA 4IWDA 5KBQA 3N4TA 3NUYA 3C0HA 3EZVA 3R00A 1JKKA 4EYMA 2IO6A 1R0EA 4Y46A 4L6QA 4LOQA 2E2BA 3V3VA 4BF2A 3BHVA 4AZVA 3CPBA 3TL8A 5LMKA 4BTMA 2EB2A 3CTJA 4CQGA 3KXHA 2PE0A 3E64A 3FXXA 3FI4A 4GVAA 4FIJA 4NW6A 4X6RA 4C3RA 3S3IA 3EFWA 4MXXA 2HW7A 4NM5A 4TNBA 1UNLA 4ENXA 2CGUA 3CTQA 3DXQA 3ZTXA 4DEAA 4FL3A 1BKXA 4M66A 1J7IA 3BQCA 4O82A 4DAWA 1WZYA 5KBRA 5A6NA 1KUTA 3LMIA 3DJ7A 4AF3A 1XBBA 4XG6A 4CFFA 3VHEA 3HGKA 3Q9YA 2E9OA 4YJRA 4X7QA 3UNKA 2EXMA 3BHHA 5AP3A 4C34A 2V5QA 5FP5A 1BL6A 4GG7A 3UNZA 4EH4A 1OZ1A 2WELA 2YCQA 1X8BA 5GJGA 4O7WA 4F9YA 3OZ6A 4NJ3A 3ZONA 4NEUA 4FTIA 3WF9A 4W9WA 3OY3A 4V04A 3QKLA 5CNOA 4O83A 3HV7A 4R6VA 1VJYA 2Z8CA 1WVYA 4QP3A 4EK4A 1U59A 1IRKA 3IOPA 4O7TA 4DFUA 2I1MA 1YWRA 2PU8A 4WOVA 3Q4UA 3HV5A 4F1TA 3PP1A 4A9TA 1U54A 5K5XA 5AAGA 4ZY4A 3UMWA 5DR6A 3RALA 4KB8A 3W2SA 1QMZA 4FL1A 4NKSA 5AR8A 3EFJA 2C1BA 4G3GA 5KNJA 3QQKA 5BMSA 3LLTA 3AGLA 4FUXA 4AE6A 2AUHA 3FHIA 4Q9ZA 5H8EA 4S32A 2YZAA 3G0FA 3OD6X 2EUFB 3W2OA 4TY1A 5KHWA 3R8VA 3VS0A 4L3PA 5DBXA 3AG9A 4OR5A 4LQMA 4P5QA 2PVKA 3SLSA 4C58A 5KMLA 3UYSA 3E93A 4AW5A 5HO7A 5DWRA 3DJ5A 5J1WA 2NRYA 1OUKA 3BPRA 5J7HA 2VAGA 3UOKA 4M3QA 3MFTA 3BELA 3OCGA 3TV4A 2C4GA 2RL5A 4YJOA 2OF2A 2YWVA 4H36A 5EDPA 3RM6A 4BDAA 3O71A 4I21A 4CZYB 3UQCA 5IQBA 2RSVA 1Q8YA 1JQHA 2JDSA 3BX5A 3V5PA 2P55A 4F9BA 5CXZA 2X9FA 3GXLA 4MD7E 4JQ8A 2AYPA 1Z5MA 2Y4IB 3ERKA 3QTIA 4QYGA 3SVVA 1SVEA 3P79A 5AAFA 3OEFX 3RK9A 3V5TA 1PMVA 3MFUA 3L8SA 4ZTNA 3RMFA 4ALUA 4F63A 1O6KA 3AC4A 2R4BA 1P14A 5CI7A 4MXCA 3RI1A 3UIBA 2PE2A 3VBTA 4LYNA 4I23A 3DZQA 3PIZA 4CG8A 3HZTA 4BZDA 1KOBA 1ZMUA 1B6CB 4USFA 4FV6A 5LWMA 3VS2A 1G3NA 3BLHA 3KXGA 4EK8A 2F7EE 2ITZA 4EOJA 2FH9A 5HTCA 2CGVA 5CU3A 3A7HA 5I9ZA 2XEZA 3ZBFA 4AOTA 2R3KA 4B0GA 4OAUC 3C4FA 3ZRKA 1IA8A 4CQEA 2OI4X 4FTAA 5AUZA 2QG5A 1R3CA 5A3XA 4TYJA 5HI2A 4C38A 4F4PA 3GC9A 4YURA 4O81A 1NW1A 4R77A 2RFDA 2PWLA 3EFKA 2HENA 5IH6A 3ZC5A 5HIBA 1APME 2BMCA 3QUDA 4EJNA 3ORXA 5A14A 3DFAA 2XCKA 4WT6A 3QZFA 5I4NA 3BGZA 2EVAA 2WTWA 3AMBA 3SKCA 3QD2B 3TM0A 5JFWA 4ENYA 2IZUA 2GS7A 5DPVA 2CHLA 3PXRA 2E9PA 3ZO1A 4HGLA 3VQUA 2OJJA 5KMKA 1F5QA 3CS9A 3OTUA 4MF1A 4APPA 3O8UA 3A7FA 2O65A 3FC2A 4FVQA 1XKKA 4UBAA 3RPYA 4M97A 2C47A 2P3GX 2Z2WA 3TTJA 3OUNB 4FSMA 5KKRB 3IGGA 4M14A 5DLSA 3V8SA 4TWPA 3ZDUA 4DG3E 2PMNX 1KE8A 4EYJA 3FSFA 3QKKA 2OH0E 2GHMA 4UYAA 5AR4A 5CASA 3QX4A 4B7TA 5L6PA 4J95A 4DE4A 4JRNA 1Y91A 2BFXA 3TEIA 4FEQA 5M51A 4UZDA 3E92A 4DG2E 4FMQA 2YIRA 4G6OA 4ZJJA 5IEXA 3RBWA 3MFSA 3ANRA 4RJ8A 3TZ8A 1DI9A 3C4ZA 3DKCA 3T3VA 4FKRA 4IMYA 4IM3A 2XK7A 4FSTA 4BCNA 3UVPA 4F7NA 2IW9A 2V7AA 3LFSA 4QYEA 1ZWSA 3ZO2A 4IAAA 1M2QA 3D5VA 4L45A 3Q6UA 5H2UA 4R1VA 3TV7A 4RZWA 1QCFA 2QKWB 5HKMA 3TV6A 2UVXA 3NYVA 3BI6A 4N70A 2JGZA 4M69B 3AT3A 4QP2A 4PMPA 2WQMA 1W8CA 4CFNA 4GT3A 1ZYJA 2UW3A 3GQLA 4WUNA 1Y8YA 3PSCA 2BILB 4CFXA 4JLCA 3UYTA 1PW2A 3RK5A 3TWJA 4JR7A 4NCTC 5C9CA 4YMJA 5GZ9A 3UIUA 4FKWA 3QTRA 2XB7A 4FZ7A 3BYMA 3GU6A 4PPCA 4G1WA 3TJDA 5CEOA 5AP1A 3P4KA 2OZOA 3PUPA 4XG4A 3HAMA 2W4JA 3NNUA 1H26A 1U54B 2GFCA 1O9UA 1XH7A 5KZ0A 3I4BA 3KRRA 3NUUA 4O7YA 4DYMA 4ZY5A 3VS3A 2X8EA 3SOCA 4DEDA 2CN8A 2G2HA 2ONLC 3MB7A 2QHMA 3VS7A 5KX8A 4E3CA 4B6LA 3KVXA 4FSNA 3C0GA 2XK6A 1MRYA 2XNNA 4YUQA 5J95A 4QMXA 5AP0A 1FVTA 2W99B 3MTLA 2JIVA 4M67A 2VTQA 3MESA 4LUEA 3F82A 5AUXA 4XOZA 1DI8A 2WZJA 3JVSA 3MVJA 3PZEA 4YJQA 3QQLA 4O6LA 4JI9A 4D1ZA 1ZYSA 3BLQA 4U6RA 5A54A 3D4QA 5E8YA 3ZMMA 1GZOA 4E20A 3WYYA 3N51A 4UALA 3BHUA 3CGFA 3FMHA 3DA6A 3VIDA 2ITNA 5HE3A 4XG9A 4QMSA 2PVLA 3IKAA 2FUMA 2WMRA 1QPCA 1SNUA 3LFFA 4MF0A 2I0YA 4RX7A 4D9TA 1OIUA 2JBOA 3OVVA 4CZUA 2A0CX 4FT9A 4LV5A 2UZLA 5FUTA 3WZUA 3C4CA 3PZHA 4E26A 2VWXA 4EOKA 3BYVA 4OW8A 3R7EA 3AOXA 2OKRA 4I6FA 4BL1A 3ZZEA 2IVVA 3HDMA 4ID7A 4EHZA 2XF0A 2OJIA 3UDBA 3JXWA 4MBLA 2QNJA 3FLNC 3NUAA 5KMIA 2G1TA 3VNTA 4RWIA 3GCVA 2CKPA 5EHOA 2I0HA 2RFNA 5EHYA 5IEVA 4C0TA 1QPJA 1M2PA 3KKVA 3DK6A 3UC4A 5FQDC 2BR1A 1YI6A 2H9VA 3Q5ZA 3WARA 3R9RA 5AJQA 5AUTA 5EK7A 1PY5A 1TQMA 2CKEA 4DHFA 3HVCA 3O23A 4EH9A 2F2CB 5JKGA 4BHZA 1YDRE 3DBDA 3NWWA 3H9FA 3F5GA 3MS9A 3QTQA 4U81A 1WMKA 2O63A 4D4RA 3EN5A 4F6SA
chains in the Genus database with same CATH superfamily
1OECA 1R39A 1WAKA 3VWAA 4R5SA 3TG1A 3OROA 4FRFA 1YOJA 4X2GA 4E4XA 3KEXA 1OM1A 2B9JA 1H1WA 1UU7A 3P08A 3UNJA 4K18A 5JT2A 1OKWA 3LM0A 4O7SA 3AXWA 4UXQA 4DTAA 1UKHA 3EN6A 3P7BA 2PVMA 3ALOA 3FV8A 4M12A 2Y4IC 3D5XA 3MJ1A 3ORMA 3ODZX 5CEKA 4MXZA 4MWHA 4ASDA 4G16A 2R2PA 5FDXA 3CJGA 3ZDIA 3MH1A 3HX4A 1YDTE 5HX8A 4QMQA 3MFRA 5HD7A 3QYWA 2BPMA 3LJ1A 2BCJA 4HGTA 1E1XA 4O0XA 3KU2A 4RLKA 4GK3A 2YHVA 3QX2A 4LI5A 3LFCA 3GC8A 2BALA 1ZAOA 2B0QA 3PJCA 3A62A 4F7JA 4E6CA 4ZTRA 5L2WA 5DNRA 4TYIA 1CKPA 1OIYA 2O2UA 3F5XA 2WTCA 4Q9SA 2OICA 1ZOEA 3IDPA 3IOKA 4U7ZA 5HE0A 4YLLA 3ZYAA 4AXAA 2DS1A 3QQHA 1M17A 5FM2A 3PXZA 3RHKA 4C4IA 5KMJA 4MXOA 1JSVA 2HY0A 3D9VA 2JFLA 2XUUA 4RFZA 4OLIA 5L6WL 4XJ0A 4EH3A 2XJ0A 3NZ0A 2R3RA 3HV4A 5F9EA 5K4IA 2BZKB 5BVWA 5AV4A 3BEAA 3ETAA 5C4LA 5E92A 1MP8A 4DINA 5DRBA 2SRCA 5FTOA 4H1MA 4UMRA 4PL3A 4FTMA 4RIYB 2UZDA 3FMNA 2BHEA 3KY2A 5HIEA 5FWKK 3E8DA 5HOAA 3ORZA 5IA2A 3NRMA 4MWIA 3DOGA 4EOQA 2OU7A 5JRSA 2VRXA 5KKRC 3Q53A 5AUUA 3CC6A 4BDBA 5ANEA 5BYZA 4O0UA 3W0QA 3V5WA 2IVSA 5H8BA 3JVRA 2XA4A 1SZMA 2UW9A 4Z7HA 4EZ7A 4EC9A 5J5SA 2GHLA 2FB8A 4K1BA 4FSWA 5M4CA 2YCSA 3COIA 3DAKA 3MVLA 4MHAA 2QU5A 1UKIA 5CSWA 4EQMA 2QOLA 4IANA 4O7RA 3SGCA 2RG6A 5A4EA 3PY3A 2PZYA 3EQFA 4FIGA 3COHA 4QNYA 3O0GA 4TYHA 4OTPA 3AC1A 3E7OA 5CVFA 3MBLA 4C8BA 3V6SA 2C6TA 4YC3A 4DEHA 3ENHA 3O17A 4FKQA 4BVUA 4MD8E 3WE4A 4BTFA 2R3HA 3N9XA 3MYGA 4M13A 4BCOA 4C36A 3W1FA 2CNUA 3BZ3A 2XARA 4I5HA 5AM6A 4UWCA 5B2KA 4LMUA 4AN3A 4JG7A 5TF9A 2HXLA 4JXFA 3PP0A 4EEVA 4EH2A 2J0JA 5CF8A 4L01A 3NUNA 3O5AA 4X3FB 1UNHA 3FQSA 5DEYA 4Y95A 4XLVA 1Q5KA 5DRDA 4D4YA 3DPKA 3R1SA 3W55A 3PDTA 4PTCA 5CU4A 2AC3A 4U42A 5ANOA 2BVAA 2CGWA 5TKDA 4ANNA 3ZM9A 2HYYA 2VGOA 4C61A 3P9JA 3C4XA 3VBXA 4AG8A 3BKBA 4GIIA 3D2IA 4XUFA 3TNIA 3U8WA 4F7LA 5CALA 1Q3DA 4U80A 5DT3A 5HNBA 3ZLWA 3AMAA 3C4WA 4YR8A 1CM8A 3A7GA 2EB3A 1UWJA 4EQCA 1Z9XA 4H1JA 4DFLA 5DR2A 5DA3A 4RX5A 5D7AA 4A4OA 1VR2A 3IGOA 3ZSGA 4YHFA 4BKYA 2ITYA 3KGAA 4DFBA 5CEMA 3IW5A 4IJ9A 2VUWA 2XKEA 3FL5A 2YZLA 4MBJA 4EK3A 3RK7A 3PE1A 5L2IA 3SXSA 3CKXA 3ZU7A 3PXKA 3WF6A 4LRMA 3FEGA 5CENA 3FE3A 2B9FA 1ZYCA 2QC6A 4ZP5A 4IM2A 2ZAZA 4OTFA 4CCUA 2UW0A 3O50A 2R3FA 4IB1A 5AWMA 3VBYA 5ETFA 2BAQA 3ORPA 4RIOA 5CT7A 5GIPE 5HESA 1ZY5A 3FMDA 2W1DA 3K3JA 4JDJA 4RIWB 1Q97A 3L9LA 5ITAA 3FZRA 4ZTLA 3EQPA 3QD3A 5ANDA 5M57A 2HZ4A 3W8QA 2XIKA 4HPUE 1V0PA 2BHHA 3L9MA 4M84A 2GSFA 2IF8A 1NVSA 4YZMA 2UW5A 4M7IA 2QOQA 4MBIA 2UZUE 3E87A 2XNEA 2JKOA 4BWKA 2QONA 2UW6A 5EOBA 3UOLA 5CZHA 4UWYA 2W1GA 3BCEA 5A4CA 3NVKI 5DOSA 2JBPA 4WG3A 3SOAA 2YCFA 5AFVA 4RC4A 3Q04A 2YN8A 2UW8A 4TYGA 2VWVA 4NH1A 4KNBA 5ETIA 4N0SA 4EBVA 4I20A 4KIQA 5AV3A 3FZSA 3E8NA 3LCKA 5C27A 5IEYA 4GUBA 3QZIA 5HG5A 3ODYX 4TWOA 3TKUA 4E6AA 3A61A 3PSBA 4J53A 2VTSA 1U5RA 4JVGA 3EN7A 3JYAA 3I79A 5AAEA 3MH3A 4YHTA 5KO1A 3ZEPA 1JNKA 3HP2A 3PJ8A 5L2QA 4R78A 4G3EA 3H9OA 2J4ZA 2ZM4A 4WIHA 4G2FA 2A19B 3LXNA 3ZUVA 3V8WA 3HV6A 3LKMA 2XH5A 5IA1A 4WSQA 1OIRA 4IBMA 4XG2A 4YLJA 1CSNA 2X8IA 3QWJA 4R7HA 3DB6A 4XRLA 5K5NA 4KAOA 5AUWA 2B7AA 2ZV8A 1U4DA 2XKFA 3W32A 5J87A 3CLYA 3Q3BA 3FZPA 3TXOA 3EQRA 1W2DA 2J9MA 2UZWE 4RC3A 2CPKE 5AR2A 5FM3A 3GVUA 4HZRA 4L68A 5HQ0A 4BI2A 4BZNA 4AFEA 4CMUA 1PXJA 2G15A 4L8MA 4Y72A 5KHXA 1JSUA 2LAVA 4RJ5A 5KUPA 3S00A 4GFOA 3I0QA 5CSXA 5FD2A 1Q8WA 2PK9A 4FTUA 5IQCA 5H8GA 4AOJA 5HEZA 4BCPA 5JH6A 2QVSE 4DH1A 3O51A 1PXMA 4UMQA 1JAMA 1HCKA 3OWLA 4YLKA 2C0IA 3C50A 2WTVA 3JPVA 2W5AA 3PY1A 5BVKA 2VWYA 4BN1A 1J1CA 4FC0A 5M4UA 4TT7A 4UZHA 2YISA 1ATPE 4BDIA 3GUBA 4FV1A 4DFXE 2OO8X 2X2LA 4OTHA 3VS5A 3PJ2A 3P5KA 3R1YA 3WZEA 2W1CA 5DH3A 5BYLA 4I41A 2WMSA 4X2JA 5A4QA 2YIXA 4AX8A 4FKIA 4IQ6A 5I0BA 5IPJA 4I93A 4X2NA 3KF4A 1RE8A 3R7IA 2JAMA 4FV9A 3QRJA 4ACMA 5EDRA 5JFVA 4L7FA 2YM4A 1WBPA 4G9RA 4J52A 4KIOA 4F0GA 5C03A 3GCPA 3DLZA 4GUEA 2PVFA 4LG4A 3Q6WA 5LMBA 1XBCA 4HVGA 5CU6A 5AV0A 4DLIA 2WOUA 4FVPA 3ENMA 5DHJA 1H4LA 5CF5A 3WYXA 4Z9LA 2QO2A 3C9WA 3P0MA 4I6BA 3R7YA 2X1NA 4PV0A 4ZMEA 3GOKA 4YO6A 4EL9A 4B8LA 3OCBA 3PVBA 1YXXA 3VBVA 3F88A 4GJ2A 5HNGA 2W1FA 2ZDTA 4BDEA 4XV9A 4E6DA 3F5PA 4FT7A 5J7BA 1XMMA 4XOYA 3DNEA 4ANBA 2VZ6A 3A99A 3EFLA 2QOHA 3CQEA 3ZHPC 1IAHA 3Q2JA 1M7NA 1BX6A 3HV3A 3IO7A 4ZTHA 2RKUA 3V5LA 2XK9A 4D55A 5JQ5A 3PA3A 1REKA 4DHIB 4KIKA 3LVPA 4IAIA 2OXDA 2RFSA 5AV2A 5TOZA 1S9IA 4BBMA 3RCJA 3UO5A 3TZ9A 5JGBA 5CXHA 2BDFA 5GJFA 4KUJA 4DCAA 2J5FA 4YZBA 3IONA 3Q9ZA 5BPYA 2FSLX 3VRYA 1JOWB 4C2VA 1W2FA 2R3OA 1W84A 2DQ7X 3GU7A 2C1AA 4GYIA 4QPMA 4V0GB 2OW3A 1YXSA 4IX3A 4MTAA 4P7EA 4O1PA 3RAHA 3TDWA 2PL0A 4BRXA 4DEBA 3QTUA 2C3JA 2R7BA 3R2BA 2PTKA 4PTEA 4V01A 1TVOA 5E9EA 5ANGA 5CEIA 2YM3A 3ACKA 4DH7A 3VONA 2PVRA 3O7LB 3NNXA 5BUIA 4GT4A 5HVJA 2UV2A 4J96A 1J7UA 3AT2A 5HLNA 1BI8A 5B0XA 4YSJA 5DI1A 4HNIA 5EQPA 3PUFC 5E8VA 3L8XA 5FDPA 5DT0A 4DFZE 3FHRA 4AGWA 3PVUA 2JC6A 1STCE 3AC8A 4K77A 2GS2A 5AIKA 2QOOA 4M15A 3R9DA 5JGDA 4ACCA 4AW1A 5M55A 1GZNA 3BWJA 4HYSA 4LV8A 2DUVA 2CNVA 4CEGA 3HRBA 2OG8A 1WFCA 2VTNA 3QC4A 4Y73A 4FZFB 3RPVA 3K5VA 3U6IA 3SG8A 4IX4A 4WSYA 4JIKA 3I5ZA 3TT0A 3F2AA 1RDQE 3KXNA 4O0RA 4WRGA 1OITA 5IQGA 2G01A 4M69A 3W10A 4ASXA 4O21A 3GBZA 4FV5A 4GFMA 1Y6AA 4TN6A 2R3MA 3UC3A 2P0CA 2QG7A 4W4YA 4XRJA 4F6WA 3AKKA 4ZAUA 5BVEA 2HIWA 2O8YA 2FGIA 4L3LA 4AXFA 1UA2A 2VNYA 4I5CA 4A7CA 3O96A 4UB7A 1URCA 4E4MA 4J71A 4O2ZA 3EQBA 4WD5A 3QALE 4BGGA 4EOOA 4EONA 3CY3A 1OGYA 3R8UA 2XNPA 5FLFA 2XJ2A 4FT0A 4AZTA 1TFFA 2X7GA 1W98A 3ROCA 2PUPA 3F6XA 3GB2A 3PSDA 2C5YA 3FLYA 3FKLA 3FXWA 4GYGA 5HTIA 4G5PA 4YGAA 5DEWA 3R9NA 1PXKA 4QPAA 4HZSA 4FIEA 3E88A 3HUCA 4BICA 3A2CA 3DQXA 4J7BA 3CD8A 4NFNA 3LLAA 4AA0A 4AU8A 4EORA 3KRXA 1QPDA 2XIYA 5FXSA 3DTWA 5TE0A 3OT3A 3LXKA 4XP3A 4BBEA 3BQRA 4L9IA 4LFIA 5M56A 1ZY4A 2B9HA 2BAKA 5D1JA 4AACA 3EN4A 3NUPA 4FTJA 4U44A 2YIYA 4O4DA 3C13A 4CCBA 4FV2A 2HWPA 5IUGA 4DTBA 5E8SA 3HYHA 4PL5A 4V05A 4BZOA 3W0MA 4BY9E 1FOTA 3CTHA 4G34A 5HNIX 3UPZA 2IEWA 2BRMA 3UZRA 3BIZA 5DR9A 3DXNA 5HTBA 5CSVA 5ETAA 2PY3A 1VYWA 4EOMA 3MGYA 3D5UA 3R30A 5CWZA 2XAMA 4AAYA 4I1ZA 3ZFMA 2WIPA 1PF8A 2PZPA 1BL7A 2F7ZE 5E91A 4ASZA 4BC6A 4E5AX 4PNKA 3D2KA 3U87A 3OXTA 3NUXA 2O3PA 4WG4A 1SM2A 3DCVA 2GNIA 4CMTA 4DFNA 4CKJA 4DCEA 4USEA 1IASA 4HYHA 3R8ZA 2WMBA 4BDKA 4CFUA 3UDTA 4HW7A 3HMNA 2VN9A 5HCXA 4FTLA 4JAIA 3M11A 4OUCA 4EH5A 5CU0A 4ZSGA 2QCSA 4ZXTA 4L46A 3BU5A 2C0TA 1K9AA 2PZ5A 4S2ZA 5A6OA 4BCQA 3LMHA 3KF7A 2GMXA 4KIKB 4W9XA 3EMGA 5H3QA 5E8WA 4DHJA 5IQHA 4DDGA 3DGKA 2YITA 1XR1A 3HECA 4IAZA 1V0BA 4DTKA 4JR3A 3W0OA 4G6NA 4ZJIA 4RSSA 4WHZA 5J79A 4HPTE 3RGFA 2F7XE 3E63A 4IAFA 2VTHA 4F78A 3ELJA 4KSPA 1GOLA 4AA5A 1CTPE 1ZMWA 3QTZA 3MVMA 4O4CA 4PP9A 4X2FA 3JY0A 1UU8A 3QFVA 3R04A 3GCQA 4ZIMA 2CGXA 3IECA 3AT4A 4I5MA 4PWNA 2B53A 1FQ1B 5TT7A 4O2PA 5T68A 3QTWA 2I6LA 4EUTA 3AC2A 4DEGA 4AGUA 2OH4A 2JFMA 4AFJA 1HOWA 3C5UA 4RJ3A 3ZLXA 3ML1A 2XKCA 4ANMA 2OGVA 4QTAA 2VV9A 3VHKA 2IW8A 5JFXA 2IZTA 3W2PA 1MQBA 3V5QA 3I5NA 5CAOA 3PRFA 4B4LA 5AV1A 4R3PA 2A1AB 2B52A 2J0IA 3BYOA 5L3AA 4OTRA 2UZOA 4DEIA 3PIYA 3LCDA 1P4OA 2FA2A 5JGAA 4AW2A 1Q99A 2E9NA 4WNKA 4WNOA 4U40A 3AD6A 3VULA 4EKLA 2YDJA 1JPAA 3MW1A 4EOSA 3CXWA 3SX9A 5I3RA 4IVBA 3PG1A 2R3PA 4MUQA 2PVNA 3HKOA 2WKMA 4RVTA 2KTYA 2VO0A 4IVCA 4UWBA 5AP2A 3RHXA 2PUNA 1OGUA 2VTMA 3H4JA 3F7ZA 4JJRA 1PMUA 5E7RA 3V8TA 5LQFA 2BKKA 2QOIA 3WIKA 3QUEA 2C5NA 5I9XA 2HXQA 5HICA 2YACA 4GVJA 4EOIA 2HW6A 1BUHA 2OJGA 5LMAA 4BDCA 4PF4A 3NW5A 4XG3A 4JQEA 4IJPA 5EYCA 4RX9A 3UDSA 3ALNA 5CSHA 2PSQA 4N6YA 4O0SA 1J91A 3FZTA 4YJUA 5CTPA 2XRUA 5CSPA 4BYIA 1AQ1A 4FTRA 3T9IA 4RIYA 5B7VA 3QF9A 3LZBA 3LXPA 4Z16A 2X0OA 4A9UA 2YM6A 2CKQA 4F65A 2EU9A 2WTKB 5EQEA 2X8DA 4FR4A 3NCZA 4F9AA 3ZOSA 3KXMA 3Q4ZA 3AKLA 4QP9A 2R3JA 4O1OA 4FIIA 5D9HA 4FTOA 3SD0A 5IKWA 4IC7A 2FO0A 4BDJA 4UN0C 2C6LA 2XCHA 3QTXA 5HIDA 3FI8A 2YWPA 5DYJA 2VTJA 2X2KA 5BYYA 3DU8A 4K9YA 4YZNA 2PULA 3BEGA 3G6GA 4GS6A 4WRSA 4XS2A 4ZSJA 2QR8A 3IW4A 4TZRA 3QXOA 3MIYA 2P2IA 4LOOA 1B38A 4PQNA 5CY3A 3REPA 1NVRA 4L53A 2ACXA 2QOBA 3R01A 4FV3A 3A7IA 4EI4A 1OPJA 3ZS5A 5ICPA 3UO6A 4BI0A 3U6JA 1J3HA 1SVGA 3O7LD 2XIRA 2R3NA 2ZM1A 3R8MA 3PXQA 4X3FA 4YJSA 4D2TA 1R78A 2VTIA 4K0YA 4AW0A 1PXNA 4AAAA 4D4SA 4H39A 1W82A 4RQVA 4A9RA 3R9OA 2IWIA 2UW7A 5CZIA 3SAYA 1XJDA 4MH7A 5CI6A 5EDQA 3D0EA 4ITHA 2Y4PA 2OJFE 3HMMA 3IQ7A 4NKAA 2BZJA 4WUAA 3UPXA 2PYWA 1XBAA 3F3UA 1Q41A 1P4FA 3RZFA 4C57A 3EYHA 3ZBXA 1UU3A 1OVEA 4GIHA 3FY0A 3QZGA 2F49A 3F3WA 4R1YA 5LVPA 2E9UA 4U41A 2CLXA 3RAKA 2BDWA 1WBVA 3H30A 2H96A 3R71A 4QYFA 2HCKA 3F7WA 4I6HA 4UYNA 5HVYA 4ZLOA 4UV0A 1KWPA 1KOAA 2YAAA 5EYMA 5F4NA 4FT3A 4IX5A 3G2FA 4EHEA 3BL7A 4CNHA 4AZFA 4MK0A 4A4LA 3VJOA 5LXMA 1G8AA 4FBXA 2ITPA 3LJ0A 4TWNA 4IB3A 2V62A 5E1SA 2F4JA 4CTBA 3NFFB 4DF3A 3NR9A 5HLPA 4KKGA 2OXYA 4QDEA 2UW4A 4GV1A 4EWQA 4CLJA 1XMLA 4GH2A 4NT4A 4AQKA 4GL9A 3LQ5A 4JNWA 1MUOA 4TYEA 2P33A 5HG8A 4KABA 3VUDA 3ET7A 3U4UA 3ZEWA 2GS6A 4RVMA 1AD5A 2JKKA 2GNFA 4FE2A 4RFMA 4PNIA 1G5SA 2OBJA 4RIWA 3FDNA 2I7QA 2Z7RA 3RJCA 2WU6A 4YBJA 3RCDA 2WPAA 5E8TA 3TKHA 1VYZA 2WO6A 4HJOA 4OTGA 5EOLA 3Q2MA 2IZSA 1DAWA 1OB3A 1P5EA 3QQJA 4AQCA 4OAVB 4QMZA 2F9GA 3OXZA 3QLFA 4FZDB 4B99A 4RLLA 2WNTA 3L9PA 2CMWA 4O7LA 2Y9QA 4O96A 4FKTA 3I7CA 3FXZA 4CVAA 4KBAA 4DH5A 2IN6A 1YHWA 2Z02A 4FZAB 4E4NA 1PYXA 5IQDA 3H3CA 3KB7A 3QAME 3UE4A 3LW0A 3MA6A 5FBOA 3TNQB 4XX9A 2HK5A 4GFGA 4ZS0A 5H9BA 3NNWA 1LR4A 2GNJA 4E4LA 4OBQA 3E5AA 4PUZA 4FGBA 2J5EA 4QYYA 3VN9A 5D41A 2IW6A 4F9CA 4IM0A 4FEUA 4QTEA 2IG7A 5G1XA 3TNHA 1GZKA 1H0VA 2PE1A 1OMWA 1TKIA 4IZ5A 1XO2B 3RZBA 4F64A 5CAQA 4R3RA 3R0TA 5BVFA 3LPBA 2PPQA 3JS2A 5E4HA 4FKJA 4ZTSA 4O91A 4OTDA 2WMVA 4FI1A 3MJ2A 1MRUA 4XYFA 4EC8A 3MY1A 4IVAA 5M53A 5HCZA 3Q96A 4ZOGA 3BYUA 1OKVA 3E62A 2AC5A 3MPMA 2Y6MA 4MXAA 2QO7A 3DK3A 2GPHA 5HLWA 3SA0A 1Q8UA 2YJSA 4YP8A 4DDIA 4PMSA 4DLJA 3LFEA 4I24A 2CLQA 3F3ZA 4GKHA 4FKUA 3TYKA 3QTSA 1OIQA 5EI2A 3D14A 3KRLA 4BCFA 5CEQA 4XG8A 2A4LA 2B9IA 4X21A 3U4WA 4MAOA 4FIFA 4RT7A 4LL0A 3WF5A 3ANQA 4P2KA 4D0XA 3PFYA 3G5DA 2XBJA 2Z7QA 5FP6A 5K3YA 3MWUA 3OMVA 3SDJA 4EQUA 4ZSLA 4GCJA 3QKMA 3VRZA 4XG7A 4GK2A 1RW8A 1ERKA 4BYJA 4C3PA 1PJKA 1Q8TA 3R73A 2WMWA 3W2RA 4E5BA 3UP2A 1NT2A 1OKZA 4U5JA 5CU2A 4C33A 3KK9A 5I9WA 3D5WA 4J98A 4WO5A 3VUKA 1YVJA 2VTLA 3R7VA 1Q62A 5HVKA 4TWCA 3OCTA 2B54A 3F61A 4FT5A 4CYIA 1PKDA 3H10A 4PMMA 2X4FA 3P5JC 2HZNA 1FVRA 4N6ZA 5B2MA 3GCUA 3QQUA 2BRNA 2X39A 3FKNA 4QQTA 3FYJX 3I81A 3V6RA 3IW6A 4DT9A 4CTCA 3CIKA 1ZARA 3FI3A 5IQEA 2YIWA 3W18A 3CKWA 4EK6A 3KULA 3EZRA 4NIFB 3A8WA 3MY5A 3ZXTA 3O8TA 2W96B 4P5ZA 3CQWA 3FMJA 4QMLA 3QA8A 5DN3A 5E8UA 4Y85A 4H3QA 1CKJA 1XQZA 3FLZA 4YC6A 2WIHA 5JZNA 4RG0A 4ZTQA 3BU6A 2Z7LA 4CRSA 3QCXA 3MY0A 4XV1A 3COMA 4K11A 2FSMX 4K33A 3EQDA 3R28A 4I4EA 5AIRA 2J7TA 5HE2A 3W33A 1H08A 4MKCA 3FUPA 1Q8ZA 4DITA 3NNVA 4BCJA 1WBTA 4CYJA 5J9LA 2XNMA 4F0FA 1EH4A 4NTSA 1YDSE 3QHWA 2C6DA 4DG0E 3UQFA 2VTTA 5FEEA 1H1QA 4TL0A 4MX9A 2DWBA 3LIJA 3EB0A 1IG1A 3CY2A 3Q4CA 3NLBA 4TPTA 4C3FA 2VWZA 1JBPE 2UZVA 4MEDA 1H01A 2YJRA 4K6ZA 2BZHB 3C1XA 4NTTA 5KMOA 1HCLA 1UU9A 2W1HA 3WBLA 5JRQA 4XNEA 4O84A 4FOCA 4PL4A 4A06A 4JBPA 3G15A 4C7TA 2XIZA 4EKKA 4IZYA 4JQ7A 2VWIA 5HG9A 1PXIA 2WB8A 4I4FA 3LCOA 2WTDA 4YNOA 3R02A 1S9JA 3MIAA 4FSQA 4FVRA 4HGEA 3GC7A 4BCMA 2REIA 3QC9A 4FNZA 2W4KA 4DN5A 5L2TA 2AEGA 4V0GA 2YAKA 2VO6A 1FBNA 4NM0A 3OFMA 4O0VA 3HRFA 3MPTA 4MD9E 3I6WA 3MA3A 4NUSA 2VX3A 2QO9A 2W0JA 2ZV2A 4IW0A 5FEQA 4EZ5A 5L4QA 2XS0A 2GU8A 3SQQA 1PXLA 1GAGA 4ACGA 4F09A 4EUUA 1YXUA 5AM7A 3RPRA 3FJQE 3IW7A 3QD0A 3SRVB 1XH8A 3PPZA 3QYZA 3LFQA 4CD0A 2WTJA 1R0PA 1Z57A 3EJ1A 2X0QA 4E7WA 2ZFYA 4AXCA 4I22A 1SMHA 2WMXA 1GIIA 5CX9A 5IA4A 2OIBA 2A27A 3DBQA 4FNYA 4O0TA 4GJ3A 4TRLA 3FMMA 5J8IA 3FSKA 1ZLTA 3MSSA 3M2WA 5GZAA 3DAJA 3EIDA 4UXLA 3VQHA 1W7HA 3NDMA 5DFPA 1JLUE 4FV7A 5IUIA 4E6QA 4WKQA 3GC0A 5EG3A 5CF4A 1WBWA 2GTNA 2XVDA 5M44A 1JKSA 2NYAA 1H00A 3DKFA 3VUMA 3WILA 3UJGA 2F57A 2VTAA 5ANJA 2RF9A 3WZDA 4I94A 3PYYA 5HBEA 4QMYA 3FC1X 1I44A 2AQXA 4ZZNA 4BJJA 4CG9A 2YA9A 4IXPA 4KINA 2ZMCA 3SV0A 2WD1A 5CYIA 1AGWA 4FNXA 3FI2A 2XK3A 3NIEA 4FEVA 3AC3A 2NNWB 4DGLC 4QT1A 4E93A 4LM5A 3OS3A 3UG2A 3UQGA 1A06A 3U9CA 1YW2A 3QWKA 4I3ZA 1F3MC 4BDFA 2H6DA 2ETKA 5JZJA 2VTPA 5F94A 2OK1A 4O4BB 1ZZLA 3MN3A 2HAKA 1XH5A 4MXYA 5CF6A 2CN5A 3ZLSA 3LM5A 3DY7A 3FLQA 3I60A 2VWBA 4BIDA 3HEGA 4EWHA 2X9EA 5A4LA 2PVJA 5CAPA 3ZSIA 1YOMA 1YOLA 2VGPA 3NAXA 4HCTA 2X6DA 3FAAA 4RJ7A 2ZV7A 4MCVA 5FEDA 5JFSA 4YJNA 3UIXA 3VBQA 2OF4A 1LUFA 4HVDA 3PVWA 5L8JA 3R2YA 3CCNA 3R7OA 5C26A 2VO3A 3TI1A 4ZSAA 3OW4A 4OBOA 4CLIA 4DGMA 1FMOE 4FNWA 4AGCA 4GSBA 5J5TA 3ZZWA 3ORKA 3W2QA 4LGDA 4QMUA 3ZO3A 3TUDA 1G8SA 4Q5HA 3EL8A 1OL6A 4O27B 4QP1A 4RWLA 4YJTA 2XNBA 5K0KA 2QOKA 5HD4A 2C3KA 2NPQA 4JAJA 4X0MA 3KULB 5LWNA 3N4UA 4H3BA 4U0IA 4HCVA 3KXZA 4DGGA 4U43A 3TDVA 3CGOA 2H34A 3POOA 3LFBA 5K0XA 4YO4A 4C4FA 5ANKA 1E1VA 1LPUA 4BGHA 3OBJA 4QTDA 2ZOQA 4QMMA 2ZVAA 5EM8A 1NY3A 1KSWA 4S30A 3JUHA 2YIQA 3KRWA 4FTTA 5D11A 5BNJA 1TZDA 3RKBA 3GU5A 5C8KA 2GDOA 3KCFA 4JBQA 4YNEA 3CSVA 2YDIA 3D94A 3U51A 4JG6A 2FVDA 3P1AA 3PA5A 3OBGA 4FYOA 3S95A 4NL0A 3PXYA 2YLFA 4FKPA 5GHVA 4D28A 4FOBA 2W05A 3ATTA 2YDKA 4IX6A 4E8AA 3VC4A 4WBOA 3B8QA 2JD5A 3A4OX 3FMKA 4JOAA 3DTCA 1YHVA 1SYKA 1YKRA 3MV5A 3UGCA 4I6LA 5BV3A 1K2PA 5HHWA 4RMZA 4BIBA 2OJ9A 5HX6A 5HU3A 4X3FC 4IDVA 3G9LX 5AR5A 1KV2A 3DJ6A 1ST0A 2R3IA 1GNGA 3NUSA 1ZZ2A 2BAJA 1DM2A 5AP5A 2BFYA 3EQGA 2C30A 4U45A 1H24A 1PHKA 4W4XA 3SXRA 3R83A 4CXAA 3QRIA 3UVRA 3FY2A 2HY81 4HYUA 4KKEA 4HVHA 1SVHA 2J6MA 3HP5A 5LVOA 4FK6A 4IVDA 5HGIA 4L00A 3VUGA 4BKZA 4WG5A 2OFUA 4L42A 3ZH8A 4CT1A 5BVDA 3QRUA 2WAJA 1OL1A 4M0YA 4JG8A 3EKNA 2LGCA 5KMNA 1H1RA 1B39A 2NO3A 5LARA 2OIDA 3HMIA 2JIUA 4E73A 3RNIA 4C4JA 3FZOA 2EXEA 2JITA 3QD4A 3ITZA 2A2AA 5DE2A 4D2SA 4R8QA 3D7TA 4ITJA 4F99A 2E9VA 4FZ6A 2QURA 3SW4A 4RFYA 3AQVA 3UP7A 1QPEA 2WEVA 3TJCA 5C8NA 3IS5A