4I0TA

Crystal structure of spleen tyrosine kinase complexed with 2-(5,6,7,8-tetrahydro-imidazo[1,5-a]pyridin-1-yl)-5h-pyrrolo[2,3-b]pyrazine-7-carboxylic acid tert-butylamide
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
277
structure length
266
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase SYK
publication title Pyrrolopyrazines as selective spleen tyrosine kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 266
sequence length 277
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4i0tA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4i0tA01
4UZDA 3SHEA 4ZMFA 4D0WA 4E4XA 4L53A 3TG1A 4V0GB 4B0GA 1ZYJA 4OTQA 2YN8A 3R7GA 2V22A 2IVUA 3H4JA 1H00A 2VNYA 5C9CA 2ZYBA 5EQYA 4AX8A 1YXUA 2Z7RA 3IPHA 3MH1A 2WMAA 4FIHA 5IQBA 4PV0A 4TYHA 5L8LA 4ITJA 5EOBA 1XJDA 3IW7A 3R7VA 3KRXA 1IG1A 5L8KA 4K2RA 2BZIB 3OWPA 5ITAA 3FMKA 4GS6A 3PVGA 3DAJA 5GJFA 3R1NA 3V8TA 4AP7A 4FIIA 1QPJA 2X8DA 4JDIA 4UWBA 5FD2A 4GW8A 4ZLOA 3LOKA 5I5ZA 4W8DA 2WXVA 3Q9YA 3P1AA 4EYMA 3LHJA 2XIXA 3D7TB 3QUDA 4XV2A 3PA4A 4R5YA 1F5QA 3FL5A 3ITZA 2B55A 4WHZA 4L67A 3KXZA 2UZDA 5CYIA 4CSVA 5L6WL 4MXZA 3TKHA 3W18A 4NM0A 5CU0A 2YCFA 3ZZEA 1FINA 5JH6A 4AA4A 3KRLA 4JG8A 4O38A 3R9HA 4GIIA 3PJ8A 3RAHA 3ETAA 3DA6A 2YISA 2BIKB 3PIXA 3COMA 4OTRA 4W9WA 2NP8A 4KRDA 4YJSA 5DLSA 5B2KA 5DWRA 4ZZNA 1R0PA 1Y8YA 3ULIA 4PMMA 4M0YA 1YHVA 1APME 2Z8CA 2EXCX 1YXVA 3EQGA 4BTJA 4JVGA 1BKXA 5IQCA 1R78A 4O7RA 1ZZLA 4OUCA 1FGKA 5CU4A 5GHVA 5A4EA 3ZXZA 4MTAA 3O23A 4QMWA 4F4PA 5IMXA 5LVMA 3C0HA 4PTCA 5L6OA 4WRGA 3KU2A 3NW5A 3GB2A 3F82A 2XNOA 5CALA 2JDOA 4C4GA 3TZ8A 2RFSA 2VGOA 4MF0A 4G3DA 4BZNA 4I6HA 2ETMA 4AFEA 2J6MA 3NAXA 4H36A 2OXYA 3TACA 3GQLA 4C4HA 1JSVA 4ID7A 1S9IA 1ZY4A 3GU4A 2CKOA 3RINA 5EK7A 5D9HA 4NKAA 2QR8A 1JSTA 3MY0A 4B7TA 1HCLA 3BCEA 5E8UA 4BBEA 2I6LA 4AGUA 3TN8A 4IAYA 3U6IA 4I94A 3ZM9A 4R7HA 2CGUA 2X6EA 4D4SA 2JDRA 2NPQA 2XYUA 3G90X 3KF4A 3LVPA 2YDJA 2PK9A 3ZDUA 4CT1A 5DYJA 2WMQA 2OFVA 1YKRA 3EN9A 4I0RA 1YW2A 3R7IA 5HE3A 3TL8A 2C6EA 5JZNA 1E1VA 5D12A 5FDPA 2GDOA 1JWHA 3UPXA 3E64A 4APPA 3HAMA 1WBTA 2HY81 4EQUA 5A46A 3V5PA 3QL8A 4GH2A 3R8PA 5LCJA 2CNVA 2QURA 4AAAA 1H25A 3OCSA 3CKXA 3K5UA 4FKLA 4F6UA 4Q2AA 3HV4A 3W1FA 3DKOA 1CKIA 4QQJA 5IQEA 3SGCA 2QHMA 3DS6A 4OTIA 4WG5A 2WEVA 4JBPA 3GNIB 2EXMA 3QQHA 1GZOA 3QD2B 5EDQA 3MA3A 5JKGA 4O7WA 3FE3A 4GV1A 3LCDA 4U6RA 4Y73A 4YGAA 4O7ZA 3NYVA 3UO4A 3OG7A 1FOTA 2VTHA 3OEFX 4BCMA 4HVSA 2CNUA 2GFSA 2W5AA 3FV8A 4LMUA 4BWPA 3ORNA 2IVSA 2EUFB 2WKMA 2X2KA 3F9NA 4FV5A 4B6LA 4EZ5A 2BTSA 3MIAA 3R8MA 3VW8A 4CZUA 1PKDA 1X8BA 3NUAA 2BPMA 1YI3A 1ZYLA 5IH4A 3DNDA 3LXNA 4IE9A 1Q8YA 4TWCA 4AS0A 1M7QA 2JC6A 1W8CA 3WIGA 4RIXA 4A9TA 3PXZA 1OVEA 4C8BA 2JEDA 5K4JA 1ZMWA 4YJRA 2IZUA 3ZC5A 2PULA 2VX1A 2V62A 2GFCA 3NCGA 4PMTA 5KHWA 3JVSA 1KE9A 4FV6A 1PXOA 4CCUA 5E92A 5LXMA 3EKNA 4UV0A 5HHWA 4A4OA 3VBXA 5A4CA 3FQEA 2IW9A 3NNVA 1U54B 3LXLA 3QUEA 5EW9A 3RK9A 4P5QA 3FHRA 3ZTXA 4ACHA 4FMQA 4GCJA 3SD0A 2PWLA 5BYZA 4U7ZA 4MNEA 4J52A 1Y57A 3PUPA 2CCHA 3Q60A 4ZSJA 2FSTX 5H3QA 2UZWE 3MTFA 4FVRA 3UVPA 1I09A 4JI9A 4FOCA 4ZOGA 3VWAA 1PY5A 3NNXA 3WZJA 3D2IA 1H24A 3HDNA 4E5WA 4C4IA 2IZSA 2X39A 3EN5A 3H3CA 3UNZA 2WQBA 3TDWA 2HCKA 3W2RA 3BU6A 4DCEA 3DXPA 4FIEA 1A48A 3N4VA 3GU5A 4MD7E 3WYXA 4BRXA 3LM0A 4YMJA 2X9FA 4C58A 4BWXA 3HUCA 4N6ZA 3VQUA 3LFDA 3MBLA 4HYSA 5M4FA 3QAME 3U4UA 2PUPA 1AGWA 4FSMA 4Z7GA 3CP9A 3CPCA 1J1CA 4IDTA 3BHHA 5HX6A 4QMLA 2W05A 2JGZA 1VYWA 2XVDA 5KBQA 2FUMA 2HZ4A 3VS0A 4GYIA 5ETAA 4BFMA 3OUKA 5BVOA 1WMKA 2JITA 3EQPA 4O96A 4QYEA 2PZIA 2OJJA 2V7AA 4CFNA 4S32A 3HZTA 3V5JA 4HVGA 3QUPA 5BMSA 2QU5A 4FEUA 5CEPA 1QPCA 4J96A 1CDKA 2XK7A 2GCDA 3OT8A 3QCYA 5E90A 4PRJA 2IW8A 1FMOE 2OF2A 2XNPA 3FI2A 3R63A 3ZHPC 3PY1A 4FTRA 4EC9A 5FXRA 4DA5A 1ZMVA 1WBSA 4FR4A 5FRIA 4J8MA 3FUPA 4TKSA 4PPAA 5E8VA 5HBEA 4MXCA 3E8DA 3QD0A 2XNNA 2GNFA 2WNTA 3TUDA 2VTAA 3QRKA 4ZSAA 5AUZA 2JDVA 2Y4IC 3NGAA 3S95A 3TNIA 1GAGA 3P7BA 4YZCA 2C6IA 3NCZA 1JOWB 5AUUA 4IB3A 2Z02A 4K0YA 1SYKA 2GHMA 4RFZA 5DRBA 4O84A 2F2CB 3ANRA 5BQ0A 1BLXA 4I24A 3DB6A 5CF4A 3C4EA 5CWZA 1ZLTA 4DEDA 4FNXA 2QODA 5B2MA 2HK5A 5CF5A 2BIYA 5A4QA 3UMWA 1KWPA 3I6UA 5HI2A 3LMGA 5AX3A 1YI4A 5L3AA 4EK3A 2YM7A 3MVJA 4GU9A 4ACDA 4YJOA 5KZ0A 3EFKA 1UU8A 3MB6A 1Z9XA 2YITA 1VR2A 1P14A 2CDZA 3V5QA 1ZOEA 3FZPA 2O3PA 3G5DA 4MWHA 2QHNA 4NIFA 4OR5A 4WO5A 4A4XA 4KWPA 2WU6A 3CE3A 3U9CA 4DFBA 1W83A 2RSVA 3F3TA 5JGBA 3W2QA 1HCKA 4KBCA 3FKLA 4ZZMA 3TI1A 2FSLX 2YERA 5B7VA 2UW5A 2JDTA 3LFCA 4L3LA 5CSPA 3BELA 5LVPA 3FYKX 4RLKA 3GCSA 3BHTA 3PPJA 2YCSA 4O1PA 1OPJA 4EH2A 2PVRA 4OTGA 3IW5A 4RWJA 3PXYA 2QD9A 5F4NA 2YHVA 3H0YA 4RC3A 5J7HA 4J95A 4M8TA 3VULA 4IQ6A 3R73A 2PUUA 2RGPA 3C4WA 3GU7A 3D2KA 3C1XA 3MDYA 4FBXA 4WD5A 5DRDA 5AV0A 3DZQA 3R9OA 4E7WA 2RIOA 3MH2A 4XHKB 3O0GA 5HNGA 4A9SA 3TV4A 3R28A 4NJ3A 4AF3A 2OJ9A 3Q32A 4ERWA 4YBKA 1H08A 4PL5A 5CNOA 3WE4A 4FKSA 4IVAA 2FGIA 4F64A 4RVLA 3PXQA 3LJ2A 4YJQA 3KRRA 3UQFA 1MRVA 1FQ1B 4AT5A 4BBMA 2WMWA 5KMOA 4Y85A 2OLCA 4QD6A 5CEIA 4DH7A 1ZOHA 4HW7A 4AZWA 2X8IA 4AUAA 5LWMA 3KY2A 1R39A 2QOOA 1H8FA 3FYJX 4J7BA 2CGXA 1R3CA 3E7OA 2VZ6A 2GNIA 4ZS4A 2Z7QA 3E8NA 5HD7A 1SNUA 3FZOA 3R1SA 5C03A 4EH7A 3JPVA 1B6CB 2HZNA 4E6QA 5DGZA 4EK5A 3DU8A 2UW0A 3DLZA 1XBBA 1NVRA 2B9IA 4BCFA 4RFMA 4EOPA 4H3PA 2X8EA 3Q96A 4IM0A 4PTGA 4S34A 3UTOA 4E6AA 1PYXA 2X1NA 3ENHA 3R71A 3ZRKA 4JQ8A 1QPEA 4PP7A 4H05A 2C6LA 4QYFA 3CKWA 1OL6A 4TTHB 4MH7A 1GZKA 4DLIA 4EHEA 4BTFA 5HORA 4DN5A 3AMYA 3FLYA 3UG2A 4DG2E 3EJ1A 3LQ5A 2C5XA 3AC4A 2R3KA 4D58A 4QTBA 5HX8A 1H07A 2VO6A 3EN7A 3DFAA 2WB8A 3BYUA 2OF4A 3CJFA 4LOPA 1B38A 1STCE 3FAAA 4I92A 1DM2A 2F57A 4IXPA 2ITUA 1XH5A 2ZV9A 4YTCA 4FKQA 4CFXA 2IW6A 3O2MA 3LZBA 4CD0A 1J91A 3R8UA 3R22A 3VO3A 4U3ZA 4I20A 4OW8A 2VO3A 4IAAA 4TWOA 4TNDA 5HVKA 5LMBA 2ERKA 3MFTA 3E88A 4DLJA 2ONLC 3DOGA 5ANDA 3RKBA 5IZFA 4FL1A 5J8IA 1CSNA 4BKJA 4R3RA 1UWJA 3FY0A 4JL9A 4BZDA 3WYYA 4TRLA 2VD5A 2UW9A 3TUCA 3ODZX 3BI6A 4GU6A 4D1SA 1H1SA 2J5EA 4F0FA 2VTQA 2PZPA 1WBVA 4N0SA 4J8NA 3C9WA 4QMOA 5CSXA 4F9CA 5IEVA 1PXIA 4XNEA 4EK8A 1Q8TA 1V0PA 1R0EA 1FVRA 1OL1A 2W0JA 3CCNA 3GC0A 3O8PA 4Y95A 5AUVA 5HKMA 5DMZA 2OH0E 3DFCB 1LEZA 5AR3A 3GC7A 3FJQE 3DBQA 3ACJA 5A6NA 4UMRA 4O6EA 3QQJA 1TQMA 4XUFA 3I5NA 3R8ZA 1UVRA 1Q8ZA 5AP7A 4BIDA 3PRFA 5J9ZA 2P55A 5JGDA 2XM9A 2C3LA 1CM8A 4HNFA 2B0QA 3AD6A 3VIDA 4GJ3A 2GQGA 4KBAA 3NWWA 4MXXA 4CCBA 4XCUA 5CSVA 3Q2JA 5LJJA 4IVDA 4ANSA 5DVRA 3C5UA 3IG7A 4DFZE 4Z55A 3UYSA 1KSWA 4KS8A 5KKRB 4GSBA 2RF9A 3II5A 5HO6A 3HMPA 3RPYA 2UW4A 3TT0A 4D4YA 4EK6A 5J7BA 2YM5A 2ACXA 2ZV7A 4H58A 4L01A 2UUEA 3U6JA 3F69A 2RL5A 5IDNA 5I3OA 4MBLA 4U43A 4CLIA 3HMNA 1U59A 5K9IA 2GPHA 4JOAA 1ZWSA 4LQMA 2ZV2A 2B52A 2EWAA 4F7NA 5FLFA 3OCGA 4EOSA 4BCIA 2R2PA 4TN6A 5HZNA 5FEEA 2CCIA 4XBRA 4QPMA 5T68A 3PXFA 4PDPA 4XRJA 2VTJA 4AG8A 3VRZA 3BRBA 4YLJA 5TO8A 3NYXA 3OP5A 5EM8A 5H8EA 3RALA 5AUTA 3NUSA 3D5WA 2PZYA 2QVSE 3TTJA 4R7IA 2CGVA 3SW4A 4AW1A 4AU8A 2YM6A 3UGCA 4QP9A 1P5EA 2BZKB 2G01A 3U51A 3MPTA 3V51A 4F6SA 5IU2A 4O7SA 3RAWA 3ZLWA 1OL7A 4DEAA 4KKEA 5AR2A 5ANIA 3QC9A 2QOKA 2IO6A 5HG7A 4GIHA 3OBJA 2OWBA 3P4KA 5T3QA 4BI0A 5BX0A 4K33A 2PYWA 4UWCA 2C5VA 1ZARA 5KO1A 3QZGA 3TNQB 2JIVA 4FTNA 1O9UA 2UZVA 5HQ0A 4R1YA 4G6NA 4IX3A 3C0GA 1PMEA 4F6WA 2I0VA 3GCVA 5C8NA 3LLAA 4BC6A 2HIWA 4IZ5A 3IDBA 2XIKA 4RX9A 2AC3A 2QOBA 2VO0A 3WF6A 5CQWA 5DBXA 4OLIA 2BAJA 3P9JA 4BDAA 2C6TA 3UMXA 3CBLA 5AR4A 3ZO3A 3TEIA 4K77A 4YC3A 2BHHA 2OO8X 3KCFA 2ZM3A 3MY1A 4PDOA 1XQZA 4M84A 4DCAA 2XBJA 3I1AA 2BZJA 3CXWA 5M57A 4ASZA 4BDEA 4PL4A 3RZFA 3VHKA 2R4BA 3PLAE 3GT8A 1J7LA 2X9EA 2A0CX 5AV2A 1WVWA 3DLSA 4RIWB 1A9UA 5IQDA 4UXQA 1UKHA 3GBZA 4LV5A 4EKKA 4EQMA 2ITYA 3TNPC 1ATPE 3LE6A 4R3CA 3EQDA 3KK9A 4L68A 3T9TA 2XP2A 3BE9A 4WIHA 1NVSA 5GJGA 3VHEA 2PVNA 4JIKA 2ESMA 3VUMA 4E26A 1TQIA 3T3UA 5GNKA 3BWFA 4C36A 4GVAA 3KXNA 4FZFB 3UZPA 4F99A 4DEBA 4O21A 2R3LA 5HCYA 3RMFA 5KMIA 5FGKA 4RZWA 3KXXA 3QKKA 4BCKA 4BTKA 2PUIA 2W7XA 2ETRA 4DH1A 4AZTA 3CJGA 4L52A 3HMOA 2A27A 4ZTRA 4MVFA 4BCNA 3RHKA 4DH5A 1WBWA 1BI8A 4IMYA 4EH5A 4FVQA 5EYDA 2WQNA 3QD4A 4F7SA 2P0CA 5BYYA 3ELJA 4DINA 3G33A 4YPDA 3QKMA 4NJDA 2XNBA 4M3QA 5CU2A 3ZZWA 4PNKA 4AN9A 3LFFA 3IW6A 2HWPA 3VBYA 2VWZA 3TV7A 1Q99A 2XEZA 3Q4ZA 1XR1A 4O0YA 3ROCA 2OICA 3TKUA 3ZC6A 4BCJA 5KMMA 4KKHA 5L2SA 1OKYA 2W96B 2VTPA 3HEGA 5HD4A 1CKJA 4FNYA 2QG5A 2BCJA 4E5AX 1U4DA 5GIPE 3OXTA 1BI7A 1MQBA 5JEBA 4FTQA 4BL1A 3UZRA 1WCCA 4FTUA 4JJRA 4TYHB 5HU3A 5KUPA 2ERZE 5F9EA 3KA0A 4FKTA 3HRCA 2V5QA 3BEGA 3FSFA 5L4QA 2X2LA 3F2RA 3TIYA 2X81A 4YZBA 3LLTA 4EOQA 4CFVA 2WTWA 5CSWA 4I6BA 2FVDA 3UIMA 5CI7A 4GRBA 3RWQA 5AEPA 3BGQA 4GEOA 2OJIA 3FLQA 4LG4A 2GHLA 3D94A 3K5VA 4ZY5A 3TDVA 2UW7A 5K5XA 5HO7A 3PZEA 1T46A 2W1EA 1Q62A 4DE4A 3AC1A 5J87A 3CGFA 4MD9E 4BGGA 4ZSEA 4DT8A 2ITWA 4XG3A 1GNGA 5K0XA 4DFXE 5F1ZA 3M11A 4I21A 1OM1A 2QONA 4BBFA 4C37A 5JQ5A 3HYHA 3VAPA 3W10A 3MFUA 3FMEA 3JXWA 4M14A 5BUJA 3UYTA 3GFWA 5M07A 2WMBA 4FTMA 4I6QA 3P5KA 1WFCA 4A06A 3DKCA 4PP9A 3U4WA 3HV5A 5CAOA 4U3YA 1GIIA 5CEQA 3NSZA 3G0EA 4MWIA 4G34A 4FG7A 4HZRA 4IZ7A 1XH6A 4PL3A 5ETCA 3TZ7A 4UMPA 1DI9A 3D15A 4K8AA 4LM5A 2GHGA 5IDPA 2YWPA 3CTHA 3A62A 3R6XA 4CQEA 4BGQA 4OTPA 5JQ8A 2Y4PA 3UG1A 3PE2A 1H1WA 5M56A 5CU6A 5LMKC 4O83A 4DH3A 3GEQA 4LGHA 3MFSA 4AOTA 4AE9A 1TQPA 4WKQA 2BHEA 2C6DA 5EYCA 3UBDA 4RSSA 3OW3A 1M2PA 4G17A 2XB7A 1ZRZA 4ZTHA 1OB3A 3FEGA 4IW0A 2VTRA 1XBCA 3DTWA 3QRJA 2QC6A 4FV4A 2H6DA 4FV7A 4K18A 4QTDA 2ZDTA 5M44A 4DF3A 3FXZA 3PTGA 2WTJA 3OOMA 4FUYA 3ZBXA 2W4JA 4G5PA 3EQRA 2OU7A 2Y6OA 5AX9A 2I1MA 2RFDA 4F9AA 4QPAA 3F3VA 4BDKA 2OZOA 2WELA 3HL7A 5AP1A 3PZHA 1LR4A 5EDPA 3TZMA 4CYIA 4D5KA 4A07A 2I7QA 3NMUF 4D0XA 2R7BA 2Q0NA 4AGDA 4OAUC 3RI1A 2OIQA 1H28A 5G1XA 3ZONA 3PJ1A 2UZUE 2G1TA 4TWPA 3WF7A 5GINE 1VJYA 1KOAA 4JDKA 5M53A 4DT9A 2X6DA 4N6YA 4UX9A 4FEWA 1MP8A 1WZYA 4XLIA 5M51A 2NRUA 3R0TA 1Q97A 3VVHA 1ZYCA 4PY1A 5TF9A 4F9WA 4MYGA 4EJ7A 4WRSA 3BLHA 4IADA 4I23A 1CKPA 4IANA 3ERKA 4PNIA 3EKKA 4AGCA 3TV6A 1PXMA 1GIJA 1S9JA 2IZTA 2WMVA 4FZDB 3V8SA 3EFWA 2V7OA 2VWYA 2PUNA 4ASEA 4RQKA 2OIDA 2OJFE 4ANLA 5T6KA 2ZV8A 3RPVA 1OGUA 4QYYA 5J9LA 4D4VA 1M52A 2AYPA 4FV8A 5DG5A 4C57A 3UVQA 4RJ8A 4DFYA 3G9LX 5AFVA 3DBDA 4QYHA 4B4LA 2VWIA 4F9YA 1ZAOA 4O0VA 3OT3A 3ZUVA 3MI9A 2GSFA 3ZUTA 5AUXA 5JFWA 4C3RA 4YJUA 2HAKA 1FVVA 4FG9A 3BYOA 4FL2A 4WUNA 1YHSA 4TYEA 4FTKA 4BDIA 1XH8A 2E9OA 2RFEA 3KMMA 3KMUA 4QMTA 5AP2A 4FK6A 5ANOA 1GY3A 4FT3A 3BLQA 4AW0A 3GI3A 5K0KA 5JFXA 5DR6A 4BKZA 3ZS5A 1Q5KA 2ITNA 4EWQA 5HTBA 1OZ1A 2WAJA 3PSDA 4NZWB 4RIXB 5CVGA 4ANBA 3ATSA 2UZEA 3VUTA 2BDFA 3AC5A 3KULA 4PPCA 1E9HA 2BALA 2BTRA 4S2ZA 4XJ0A 2R3FA 3NS9A 4O81A 2ZM4A 5KE0A 2P33A 3ZCLA 5HBJA 4U41A 3TWJA 1PMUA 4FSZA 5IQFA 4Y46A 4CRSA 5E8TA 5G6VA 2JLDA 4LUEA 4PX6A 3CD3A 2E9UA 5DHJA 1KE6A 3LPBA 5FWKK 3SLSA 2WMXA 4MNEB 5HESA 5CAPA 2R5TA 1JSUA 3DAEA 3POOA 3OZ6A 2X4ZA 4U9AA 1UNGA 5IH6A 1W0XC 3MWUA 3D14A 1M14A 3ET7A 3KGAA 3SOCA 3SG9A 3OTVA 4GFGA 4TPTA 4CKIA 2VUWA 4DGGA 4FNZA 2B1PA 4Z16A 2IN6A 2F2UA 3MY5A 4FI1A 3QHRA 4QRCA 3U54A 3LAUA 2YM8A 4AACA 3HMMA 4M69A 3R00A 4I41A 1WVYA 3BE2A 3K3IA 2AC5A 4G3EA 5AV4A 1OL2A 4RA4A 1DI8A 3KVWA 3RPOA 2UZTA 3SV0A 3E8EA 4HPTE 3OF0A 4M15A 5JSMA 5AP4A 4CFFA 2WTKC 4RX5A 4QMYA 4NW6A 1OIUA 4FV3A 3KCKA 3QLFA 3EIDA 2XIRA 2VTLA 3CPBA 4W8EA 5HIBA 3UE4A 5AMNA 4FK3A 3CC6A 2W06A 5H9BA 4QQCA 3GOKA 3RCJA 2I0HA 3CQEA 2OFUA 4WG3A 4U5JA 2VTMA 4W4VA 5CZHA 5EHYA 4A4LA 3O71A 5E7RA 3VBWA 3FLZA 4GT5A 4XYFA 5AR5A 2PE1A 3AD4A 4G1WA 4NFNA 3QTRA 3HA6A 4FKJA 5AP0A 3RTPA 3VUDA 4TL0A 5AR7A 3FZRA 3S3IA 1SM2A 4IHPA 4F09A 3BIZA 4QPSA 4ZK5A 5M55A 3KRJA 4EZ7A 5HIEA 2J90A 5ACKA 4FV2A 4D2SA 4LOQA 3OXZA 4TY1A 4BF2A 1WAKA 4X3FC 2UVYA 3FPMA 4EHGA 4DG3E 3IDPA 3GP0A 3W2SA 5HE0A 3ZFMA 4GFMA 3RAIA 1LEWA 4C62A 2CLQA 3QRIA 3DV3A 3NNUA 1W7HA 5BUIA 4CG8A 1PJKA 3NUNA 4L9IA 3ORKA 4FT0A 4I3ZA 4I5MA 2BFYA 4FTAA 3MA6A 4AGWA 4AOIA 5KMLA 2BROA 4LRKA 5CEMA 2FA2A 1JLUE 3GU8A 4FKIA 4ZSLA 3ZXTA 4ZIMA 2ITQA 2YEXA 2UW8A 4B99A 4EWHA 2EB3A 3SXFA 4QMPA 5FEDA 1PW2A 2PZRA 2YCQA 4GK2A 2PE0A 1ZZ2A 4NIFB 2A2AA 2OZAA 5CF8A 3GU6A 4KKGA 4RRVA 2OW3A 4RJ5A 2X7FA 3SW7A 4L46A 3ZO1A 4JG6A 3NLBA 3BV2A 4IB0A 2VX0A 5LVLA 5GIOE 3DK3A 3O17A 2YCRA 1CMKE 5I9WA 2C4GA 3OCTA 4P7EA 4Y83A 1H4LA 4YC6A 4W9XA 4FYNA 3A8XA 4PDSA 3QYZA 4O2PA 4AA0A 3CSVA 2B54A 3MGYA 3PP0A 1KE7A 5CTPA 3VF9A 4BN1A 4FSUA 2BZHB 4YUQA 3N4UA 2J51A 4QP3A 3B2WA 3DBEA 1ND4A 3WF5A 5E8ZA 3R8VA 3MTLA 4CRLA 1YOMA 3IECA 3QKLA 1NA7A 2PHKA 3F5UA 4RX8A 2R0UA 5B0XA 4EONA 4XG4A 3R2BA 4OBQA 1YI6A 2PVYA 2XA4A 5IA1A 4HGLA 1G3NA 4ENXA 5K3YA 4JBVA 3DZOA 3O7LD 2F7EE 3HNGA 4U8ZA 3OWLA 4MHAA 1UV5A 1YVJA 1OUYA 2QOFA 3ZH8A 4F1MA 1LUFA 2RFNA 2F4JA 1Y91A 1YWRA 2HOGA 3C4CA 3PSCA 1YXXA 4RC4A 4DITA 3FC2A 3PPZA 1M2QA 3Q6WA 1J3HA 4J71A 3NPCA 1RW8A 4JX3A 4JQEA 1M2RA 3FC1X 5EM6A 2OH4A 5FBOA 5AA9A 3O7LB 4CYJA 4YR8A 5DN3A 2ZMDA 4F0IA 5LWNA 3R8LA 3QC4A 2E9VA 4V05A 1K2PA 3P7CA 4O2ZA 2PVHA 3KXMA 2F7XE 2W1GA 2XMYA 2OGVA 3H0ZA 4LL0A 3BGZA 4DYMA 4KD1A 4EEVA 4OT6A 1PMVA 3LXPA 4RWLA 2GS7A 4DG0E 4EQCA 2W99B 2XZSA 2UZOA 3QQGA 1PYEA 3ZEWA 3QGWA 4A9RA 4EH6A 3ORIA 5AM7A 3DKGA 4C2VA 2B9HA 5M4IA 4I4FA 3WE8A 2CKQA 2J0JA 1JKSA 3VBTA 1SVHA 4EH4A 5A4TA 4J99A 4QMUA 3QXPA 4M67A 2BAQA 3HLLA 4B8MA 4F08A 3H9OA 3GFEA 3F66A 3PJ3A 1VEBA 5BVWA 4KAOA 3VUHA 1ERKA 2YM3A 4BDJA 3A7JA 3V5LA 1IEPA 4ARKA 1GJOA 4NYEA 3M2WA 4FT5A 4DC2A 1M17A 4E73A 5EOLA 4FSRA 4GUBA 3EFJA 1IAHA 4FNWA 4P4CA 3JR1A 2RG5A 2GQSA 3E63A 4ZSGA 2QOIA 4D1XA 2C5YA 1J7UA 2VAGA 5C4KA 2XEYA 3OS3A 3B2TA 3RK5A 4YO6A 3TIZA 2C1AA 5IG1A 4PTEA 1U54A 2QO9A 4RPVA 2P2HA 2R3GA 3SRVA 4APCA 2J9MA 3PE1A 5EM7A 3ZU7A 1IASA 4KABA 5FP6A 3LFQA 4BVUA 4LOOA 4UYAA 3IK3A 3U8WA 3EN6A 3FXWA 4EHZA 4C4EA 2W9ZB 5CAQA 2O64A 4DGMA 3F2AA 1ZOGA 4GK4A 4XG8A 5HBHA 5DOSA 2YIXA 3EL7A 3UNJA 2HENA 5E8XA 4USFA 2ONLA 3SXSA 2BRHA 4ZAUA 4LYNA 4FTLA 4C4JA 3L8XA 4NK9A 1PF8A 2UZBA 4O0RA 3COIA 3ZFXA 4KB8A 2QR7A 5A3XA 4R1VA 2LGCA 4NTSA 4DTKA 3HV6A 3D5UA 3RP9A 3TTIA 3DDQA 1NXKA 3Q2MA 4FV9A 3A4OX 2QLQA 3EB0A 3L8VA 3Q4TA 3QGYA 5HGIA 3REPA 3VNTA 4HGTA 5HNIX 1GZ8A 3ZBFA 5LQFA 2WMTA 2CKEA 4X6QC 5E8SA 2CSNA 2EB2A 4K1BA 5IA2A 2Z2WA 4CKRA 1JPAA 2QOHA 3O50A 3W55A 2O63A 3P08A 4IWDA 4ZP5A 1ZY5A 3NRMA 1WBNA 4O91A 4XV3A 4ZY6A 3RCDA 3A7HA 3FI8A 3V8WA 3JY0A 3OD6X 3AMAA 1PKGA 4HYUA 4FKUA 3QX2A 3AGLA 4GKHA 5J9YA 4YZNA 2C3JA 4JQ7A 4ZTQA 5HU9A 3FLSA 3RGFA 2ZMCA 3PLSA 3IO7A 5EHLA 2ETKA 1E1XA 3ZFYA 4HNIA 4BDBA 4JAJA 4F70A 3PJ2A 3LFSA 4H3QA 4FKGA 1REJA 2O8YA 1MRYA 2C68A 4E5BA 3A99A 1XH7A 4KIKA 3BHUA 4E1ZA 4BI1A 2R3MA 4F1OA 4IJ9A 5E4HA 4BR3A 3L9NA 4QP6A 4BDFA 3LIJA 4U80A 3W2OA 4I5HA 4G9CA 4CZTA 4D1ZA 2KULA 4NSTA 5ICPA 3KQ7A 3QRUA 4FGBA 5KCVA 3ORTA 4O1OA 3ALOA 4XP0A 1IAJA 4QP8A 2YM4A 3GC9A 3PG3A 5I9VA 3RBWA 1FGIA 3MVMA 4L45A 3V04A 4AZFA 2VV9A 3E87A 3UC3A 3A7IA 3LFAA 5EKOA 2CN5A 3VC4A 3UIXA 3WZUA 5CEOA 2PU8A 5BYLA 4ZLYA 3ORZA 3TJCA 4P5ZA 3O8TA 5HE1A 3QQLA 3P7AA 4F65A 4X0MA 3PXRA 5J95A 4KIOA 5HG9A 4Z3VA 3PDTA 5ANKA 2F9GA 2UZLA 3VS4A 5CVFA 3GCPA 5A6OA 4JDHA 3QZFA 3W8LA 4C61A 4WNOA 2XK8A 4EUTA 3DK7A 2XKCA 3KFAA 2ZM1A 1BL7A 4MBIA 3E3BX 4QTEA 4JNWA 3R7EA 3AXWA 2R3PA 4RMZA 5IUGA 4MQ1A 3MH3A 4D2PA 2XNEA 3BBWA 1FVTA 2VTIA 3G51A 3L8PA 4O0SA 3DB8A 1REKA 3ORLA 4GVJA 4ANQA 5BPYA 3G6GA 3RK7A 1K3AA 4J1RA 4G3GA 5GJDA 3BYSA 1VZOA 3WBLA 5CI6A 4XG7A 1BX6A 2WZJA 3MIYA 2BILB 3UP2A 5HG8A 3LMHA 3AMBA 5JN2A 1SVEA 3CY3A 4YP8A 5FM3A 3QD3A 4RT7A 3PWYA 4U79A 2OKRA 3QX4A 1OL5A 2XK6A 2UW6A 3LJ0A 2YIWA 5AP5A 4A7CA 5ANEA 3QQUA 5IA5A 4OGRA 4IVBA 4TT7A 5FM2A 3ALNA 5EHOA 2FH9A 4C0TA 3MSSA 3SXRA 1P4FA 4BCGA 4NU1A 2Q83A 4N57A 4GMYA 5L8JA 2YDKA 4Z9LA 5AV3A 4CV9A 5TE0A 3GUBA 3EQHA 3RAKA 4RFYA 1XHAA 3EQBA 4ZEGA 4O86A 1B39A 5ETIA 2JKQA 2PVFA 2R3QA 3LCOA 2C5NA 4QTCA 1YXSA 4U44A 3HX4A 3S2PA 3R30A 4FZ7A 4IBMA 3TUBA 2I0EA 3LJ1A 3OEZA 2W1IA 4DGLC 5CX9A 3H10A 4C3FA 4LGGA 4X3JA 2P4IA 3QA0A 3U9NA 4F7JA 4CZYB 3NVMB 3FZ1A 4AE6A 5CS6A 3PVUA 2J5FA 4RVKA 4RJ3A 1L8TA 3AG9A 4QMXA 2CN8A 1YOLA 4KSQA 1DS5A 4JLCA 1YWVA 2R3NA 3F5PA 3SX9A 2Y0AA 4I4EA 2J0MB 4P90A 3UPZA 4KRCA 5DI1A 5AV1A 4RBLA 1PRYA 5AIKA 3DTCA 3ZLXA 4N4SA 3S4QA 3U87A 4ERKA 4XP2A 2REIA 1UWHA 3BQCA 4AA5A 4JDJA 5L2TA 2DQ7X 2Z7SA 3PIZA 5H2UA 3HV3A 3EFLA 1YRPA 2CPKE 4YJTA 4B9DA 3CTQA 4IVCA 4USEA 5DE2A 4AW2A 4UMTA 2XCHA 5CF6A 2WHBA 2V0DA 3ORMA 4EKLA 4A9YA 3UVRA 3QQKA 3CLYA 5M08A 2XJ0A 2W1FA 5ANGA 3I0OA 4FSQA 4L3JA 4JBOA 4R5SA 3AGMA 4UEUA 4UN0C 5IF1A 5CAUA 2P3GX 3C0IA 3PA3A 4D2TA 3MB7A 3MVHA 2W1HA 5CU3A 1BYGA 3VS1A 5E9EA 4IZYA 2BKZA 3MFRA 4TZRA 4C3PA 3P23A 4ZJVA 3DT1A 3T8OA 3POZA 1IA9A 3HAVA 4U40A 5DH3A 4CGAA 2WOTA 3HA8A 1UU9A 2PMLX 2GS6A 1JQHA 3BYVA 4AN3A 4BDHA 4FICA 3TXOA 4I0TA 5HNBA 4EJNA 4WG4A 4XBUA 4ALUA 2WD1A 1A06A 5HLNA 3C4ZA 4XV1A 1Q24A 1HOWA 2XK3A 4FTOA 4V01A 3AC3A 1MRUA 4R3PA 4RVTA 2CKPA 3QTIA 5AIRA 4JAIA 5M06A 4TYIA 1OKVA 4JG7A 3SAYA 5AAGA 3F88A 5LOHA 2W1ZA 5D7VA 4I22A 2CNQA 3KREA 3SC1A 2UVXA 2VTOA 2BAKA 2PZ5A 3FLWA 4FTJA 5FDXA 3QTQA 4FVPA 4ASDA 4FTCA 2HZ0A 4ANOA 1NW1A 2E2BA 2DUVA 4MCVA 3VQHA 4ZZOA 4HGEA 2ZAZA 1DAWA 4IFCA 2DS1A 3G9NA 4FTIA 4ONAA 1Q3WA 3FSKA 2BRBA 2GNGA 1MQ4A 4NUSA 3I6WA 4XS2A 3G2FA 5LVOA 2YDIA 2GTMA 4U81A 1OPLA 2FYSA 5HTCA 4PMSA 5LMKA 4EK4A 2BMCA 3K3JA 4R77A 1OIQA 3HVCA 3WZKA 4DHFA 5AP6A 1OITA 3K54A 3NVKI 3IKAA 4QO9A 2J2IB 4KUJA 4X2KA 3NNWA 4FKRA 4ALVA 3O8UA 4GKIA 3R7OA 2B9FA 4HPUE 3R83A 3QCXA 2E9PA 2X4FA 2YZLA 5HIDA 3C4XA 3EQCA 5CENA 4EZ3A 1LPUA 3S1HA 4XH6A 2YIYA 4JT3A 4U45A 1Q3DA 4M66A 2XCKA 3OOGA 3ZRLA 3NW6A 3SKCA 4WNPA 3Q52A 4JR7A 3Q4UA 1I44A 5DEWA 2HY0A 1FMKA 3K2LA 3KKVA 5FTOA 1GOLA 4GJ2A 1OMWA 4O0TA 1YHWA 3C51A 5I0BA 3ODYX 4AWIA 5IEYA 5K5NA 1U5RA 4FEXA 2AUHA 2P2IA 3F2NA 5H8BA 4I1ZA 3P78A 3D5VA 3MV5A 4FKVA 4XLVA 4YHFA 2OSCA 2WOUA 1FPUA 3DJ7A 3E5AA 3P0MA 3UQCA 2J4ZA 4NT4A 3NEWA 1EH4A 3MJ1A 4IWPA 2WTKB 3Q5IA 2ITVA 5HE2A 1H0VA 4YO4A 1JKTA 3FQHA 4QNYA 2J50A 4EOMA 4YU2A 4DGNA 5HLWA 2ITTA 2ZDUA 5EM5A 5J5TA 3VUIA 4CV8A 5KHXA 2C3KA 4YZ9A 3KN6A 3KRWA 4FA2A 4O22A 3MESA 4IH8A 5M4CA 5J79A 2XYNA 3D7ZA 2X0GA 5D10A 4FT9A 3AD5A 3I7CA 3VS7A 3EQFA 2GNLA 4WSYA 2BFXA 4YPSA 1Y6AA 3LFBA 3PPKA 4IZAA 4QQ5A 3HV7A 2GTNA 3EQIA 3NZ0A 1AQ1A 4UYNA 4KBKA 4ZLZA 2OXDA 4FGRA 4QMVA 4EH3A 3FKNA 5TR6A 4YBJA 5HG5A 4FOBA 4YSJA 4GUEA 4TNBA 3FMHA 4BB4A 3VF8A 2UVZA 3QZIA 3EYHA 2IPXA 3EOCA 4E93A 5IA3A 3RPSA 4WOVA 3PJCA 4I5PA 4FTTA 4R8QA 5ANJA 3PVWA 4NL0A 3QCQA 4RIOA 1KE5A 2R0IA 2FSOX 4QMMA 3G15A 3IGOA 4FX3A 5F95A 3IGGA 5EI8A 4IWOA 3I5ZA 5DA3A 2PL0A 3E8CA 5A4LA 4QMSA 4MXOA 3NAYA 4MQ2A 3FKOA 1Q8WA 4IAZA 4KSPA 4RLLA 2Y6MA 5EW8A 3KF7A 4M7IA 4M69B 2F7ZE 4GT4A 3BBTB 3BWJA 3DNEA 2JFMA 3IS5A 4J97A 2J0KA 3B8QA 5EKNA 3QALE 3PP1A 4CFUA 4HVIA 3GVUA 4RIYA 3VJNA 1Q61A 4JX7A 2WTVA 1SNXA 1QMZA 4PMPA 4ANMA 4QMQA 4FG8A 4S33A 4GYGA 3R9DA 4XMOA 3EZVA 4DEIA 2QOLA 1RE8A 4K11A 4DBNA 2YABA 5LARA 4R7BA 5EYKA 3IONA 5E1EA 2XS0A 2QU6A 4NM3A 4UMQA 4O0XA 4OBPA 5IH5A 2XH5A 2PSQA 1K9AA 4E3CA 5M4UA 3AQVA 3OW4A 1PXLA 5EQPA 3FMMA 2QOCA 4Q5HA 5J1WA 4YJPA 1OIYA 1P2AA 4CXAA 2SRCA 3WOWA 4FSYA 4X6RA 2C6OA 2YAAA 3FMDA 3UIUA 5FUTA 3FMJA 3Q4CA 2X7GA 4V04A 4X2GA 2G2IA 2XIZA 3FHIA 3UNKA 1VYZA 3BZ3A 4JRNA 2PVJA 5A9UA 5DNRA 4NFMA 4FF8A 4QOXA 4X7QA 3AT3A 4TYJA 4PQNA 2G15A 3C13A 2Y8OA 4ORKA 4HYIA 4JIAA 4R6VA 4NEUA 3EMGA 2PMIA 1ZYSA 4L00A 4FV1A 3F5XA 4IJPA 4L3PA 4RVMA 5FXQA 4YTIA 3RVGA 4CNHA 3DXQA 3ANQA 4DBXA 4NM7A 4X3FA 5DIAA 3VS2A 4O7NA 3H9RA 3W8QA 4IX5A 2Y4IB 2EXEA 1ZMUA 3V5TA 5AWMA 2GQRA 3OC1A 2ITXA 5I9XA 4YTFA 2IWIA 3BX5A 2UZNA 4W4YA 4EHVA 3WF8A 2OZAB 3H30A 1ZYDA 2YAKA 4UB7A 3FQSA 3DQWA 2RG6A 2IVTA 1H1PA 3Q9WA 3CEKA 3LCKA 4Z7HA 4FEVA 1H26A 2C0TA 3ZOSA 4DAWA 4KA3A 4LL5A 1KUTA 3ID6C 3ULZA 2W9FB 3EN4A 3I60A 3RPRA 3JUHA 1R1WA 3UP7A 4ZY4A 1Z57A 2VWWA 2VWBA 4RZVA 3PVBA 4C33A 4G6OA 3GGFA 3QQFA 4FUXA 5AA8A 4HYHA 2ZJWA 4IB1A 2HXQA 3CQUA 1W82A 4V0GA 2NNWB 3W33A 5FTGA 4AZVA 4D9UA 4LRJA 4EBWA 3WI6A 3E7VA 3GXLA 1O6YA 4G2FA 2BR1A 4BYJA 4EI4A 4CTBA 4BDGA 3EZRA 4ITIA 4A9UA 2PVLA 5JFSA 1OI9A 5FEQA 4ZTSA 3F3UA 4E20A 5GZ8A 3Q53A 3PYYA 4MAOA 4DEHA 3UOLA 5D7AA 5AJQA 5KZIA 5BNJA 3C7QA 3VUGA 2NRYA 2JDSA 3FL4A 4IAKA 4L6QA 5KMKA 1V0BA 4BICA 5EW3A 4IM3A 4K6ZA 4F1TA 3UIBA 4XG2A 5TKDA 3RM6A 4N70A 1URWA 4YC8A 4C35A 4EOOA 1OECA 4UALA 3NIEA 2OJGA 3JVRA 4NKSA 4QT1A 3T3VA 3V6RA 3RNIA 1WVXA 3D7TA 5CT7A 3FWQA 5I9ZA 2XJ2A 2BUJA 3COKA 4GFOA 2OI4X 3IW8A 4MD8E 3UOHA 5IA0A 2BVAA 2ITPA 2BRMA 3A61A 3R7UA 1J7IA 2VRXA 3R9RA 3IOPA 2PMNX 4WBBB 3QYWA 2WU7A 4YHTA 2WMSA 1JAMA 2HW6A 3CGOA 3PXKA 3DBFA 4ZJJA 1DAYA 4EOIA 5IMEA 2WTCA 4BWKA 2XM8A 4AZSA 4X2FA 4QMNA 3LKMA 5FG8A 4O7LA 2JKKA 2XK9A 4ITHA 3OY1A 4YLLA 4AQCA 4WNMA 4XEYA 3UC4A 4UZHA 2JAVA 2W1DA 4CMOA 3TNWA 2Y7JA 4IEBA 3ZYAA 4YSMA 5JFVA 4O27B 5IPJA 1WBOA 4FSTA 4CFMA 4CVAA 4RJ6A 4MXYA 1NY3A 3KXHA 4IB5A 3CTJA 2J0IA 4OTWA 2V55A 3LQ3A 2WMRA 4HCUA 2HXLA 2WO6A 3GQIA 3TM0A 4OTHA 4FV0A 4MKCA 4BZOA 2R9SA 3FI3A 5D41A 2JKOA 4ZJIA 1JVPP 5DT4A 3VW6A 1Z5MA 3SRVB 3NX8A 4NH1A 3A60A 5KMJA 2WTDA 3DAKA 4CT2A 4YNEA 1V0OA 2R3RA 1XH4A 2XKEA 3A7FA 4YTHA 1OKWA 5LMAA 3QRTA 3ZSHA 5K4IA 3FZTA 4AOJA 2WIHA 5CEKA 3Q9ZA 3SDJA 3FPQA 3AT2A 1M7NA 5F94A 3LM5A 3RHXA 4QP4A 5HLPA 4B8LA 2JFLA 3ZMMA 1YXTA 4H1JA 1OBGA 2QKRA 3R1YA 1V1KA 5BMMA 2GMXA 4YURA 3SVVA 4WNKA 4O7VA 1SMHA 1TVOA 4ALWA 4PUZA 5LCKA 4XP3A 3I81A 4M12A 3C50A 5IKWA 2IVVA 3FZSA 3BU5A 2W5BA 4E8AA 3L1SA 4L8MA 4YLKA 3TCPA 1BUHA 2R3JA 3ZDIA 4BHNA 2XIYA 1UKIA 1BL6A 4XV9A 3THBA 2J0LA 2PVKA 3F7ZA 4HJOA 4W4WA 4DH8A 4WA9A 1G5SA 1FBNA 3SG8A 4EYJA 5EI6A 4D5HA 4FKOA 3L9LA 4JRVA 4FC0A 3V01A 3UZTA 2BDWA 1UU7A 4I6FA 3PY0A 4G31A 3QWJA 4W4XA 2HW7A 5CLPA 2BDJA 3DJ5A 2F49A 2YFXA 2JBPA 2OG8A 2PE2A 5L2IA 2JBOA 2PVMA 2IJMA 2O2UA 4KIKB 4MX9A 1Q8UA 4O7YA 5IQHA 1KV2A 1PXNA 4EORA 1H0WA 4RJ7A 3KB7A 3D4QA 2I40A 3D5XA 3HRBA 3M42A 4FODA 3BQRA 4KIPA 4RC2A 5AM6A 1RQQA 3DCVA 5CXZA 2BRGA 5KNJA 3GC8A 3QWKA 4JXFA 2YIRA 4M0ZA 4RWIA 3AC2A 3ZEPA 2C5OA 5EYMA 4BDDA 3ZM4A 5FQDC 4OTDA 3G0FA 4UBAA 4AW5A 4RGJA 2UV2A 4BI2A 1YDSE 4BKYA 2Y9QA 3G6HA 4UY9A 4F7LA 1O6LA 4E6CA 2ZVAA 2WQOA 3AC8A 5IA4A 4WBOA 1XWSA 3M1SA 5CY3A 3HDMA 2W17A 2HYYA 4EC8A 4FKWA 3V6SA 2KTYA 3QBNA 3W16A 4FYOA 4CEGA 2VWXA 5DT3A 4KS7A 5AADA 4HOKA 5CT0A 2CHLA 3BKBA 2W4OA 3P79A 3NR9A 4CMUA 1OKZA 2VTTA 3DK6A 3LCTA 3ATTA 5AUWA 3A7GA 5EQEA 5BVKA 2CJMA 4GL9A 3W2PA 5JK3A 4RQVA 2HELA 3ZRMA 1QPDA 4FIGA 4CG9A 4FT7A 1BMKA 2XBAA 3OVVA 4MK0A 2GNHA 3VRYA 4IWQA 3QLGA 5C26A 1JNKA 3DJ6A 5L6PA 3LFEA 3O51A 4NM5A 1JKLA 1PMNA 2XNGA 4ZXTA 5HOAA 4E4LA 3WF9A 3H9FA 5HTIA 2C6KA 3NUXA 4BCHA 2YJSA 3EL8A 1URCA 1IA8A 1LP4A 5AP3A 3E3PA 4BCOA 4F9BA 1OIRA 2C69A 4EUUA 1YDTE 3JYAA 4BCPA 4CMTA 4XOYA 1W98A 3NW7A 4L7SA 3V3VA 1YWNA 3F61A 4DEGA 4IX4A 2IZRA 3ACKA 3TKIA 2C0IA 1QL6A 4FEQA 1RJBA 3NUUA 3IQ7A 4WUAA 5BVEA 4O6LA 4LGDA 5C01A 3OUNB 4S31A 4ZMEA 3BLRA 4MF1A 3R9NA 5BVFA 2H8HA 3V5WA 3OWJA 4IACA 4L43A 4YZDA 2CLXA 2ITZA 4DEEA 5I3RA 5J1VA 3R7YA 2VTNA 4IIRA 4PWNA 5DFPA 3PWDA 2JIUA 2GS2A 3QTSA 4XG6A 4X21A 2PTKA 4YNOA 3GCUA 2DWBA 2CMWA 4ANNA 4L7FA 4QMZA 4AT3A 5C27A 2C47A 4G16A 2C3IB 3I79A 3CY2A 4LV8A 3OWKA 4Q5EA 5TOZA 3IOKA 2A1AB 3ENMA 2VWVA 5H8GA 3HP2A 3AOXA 3I4BA 4GT3A 4H3BA 4AFJA 4BIEA 3RJCA 2CGWA 5EFQA 5AUYA 3SOAA 2WIPA 2XF0A 2Z7LA 4RWKA 3MW1A 2NO3A 4M97A 3LW0A 3ZSGA 2WTIA 5CASA 1PXJA 4AT4A 5DR2A 3DXNA 3NUPA 5HCZA 5E8YA 3D0EA 2C1BA 3KXGA 3MS9A 3Q6UA 1Y6BA 3KMWA 3ZSIA 5TT7A 3PA5A 4KIQA 3R02A 4E4MA 5EH0A 3QZHA 2VWUA 2WQEA 2YZAA 4C34A 1G8SA 4IDVA 2WGJA 5DT0A 2WMUA 4Y5QA 1NVQA 1H01A 1IR3A 4QP1A 3VUKA 4CKJA 4O0WA 3ZLSA 3CR0A 2VO7A 3D83A 5HICA 3ROYA 3QHWA 3FI4A 4WT6A 2YLEA 2Q0BA 2H34A 4ACCA 4D4RA 3HECA 4G3FA 3PIYA 2ZB0A 4HCTA 4RG0A 5F20A 4TYGA 3EH9A 3RM7A 5AAEA 1SVGA 4QP7A 4GG7A 4C2WA 4QQTA 2A4LA 5CZIA 4D28A 3WARA 4FIFA 2FO0A 3E92A 2C0OA 3EYGA 3PY3A 3Q3BA 3VBQA 3OXIA 4FZAB 4R78A 4G6LA 3E62A 3KEXA 3R01A 4U97A 2H9VA 2VU3A 2QNJA 3DKFA 3QTZA 4Y5HA 5CVHA 3WILA 4D2WA 5GZAA 4FSNA 4DGOA 1QCFA 5ACBC 3HRFA 4IFGA 3AT4A 3FLNC 1W84A 2JKMA 3DBCA 1Y8GA 2R7IA 4UWYA 4FIJA 3O96A 2IG7A 3GENA 2I0YA 5M09A 3UO5A 1F3MC 2XKFA 3BHYA 2VTSA 4NTTA 4C4FA 5E8WA 4UXLA 5IISA 3R2YA 3ZLYA 5C1QB 5BUEA 3Q9XA 3HUBA 3LMIA 5A54A 3FBVA 1NT2A 4ZTMA 4F0GA 2PMOX 1UA2A 1XKKA 3HGKA 4FZ6A 4H1MA 1PXPA 4J53A 3KK8A 1XO2B 4D2VA 4LFIA 3GOPA 3R1QA 4BYIA 4KINA 4E6DA 3KC3A 1T45A 5IQAA 2B53A 5GZ9A 5HVJA 2OXXA 2J7TA 1H27A 3FXXA 2ITOA 3KL8A 3ORPA 3Q5ZA 2VN9A 4QTAA 4ZTNA 4CFWA 3VS5A 2UW3A 5D11A 3Q04A 4PPBA 5AAFA 3OY3A 4LRMA 4IAIA 3ZUUA 4IM2A 5E91A 4I0SA 4ENYA 4G5JA 3F7WA 4DTBA 5C4LA 2EVAA 3IW4A 1P4OA 2XRWA 3DPKA 3UDBA 2WQMA 5AR8A 2EU9A 4OAVB 3LQ8A 4XRLA 3KVXA 2JD5A 2YJRA 4IX6A 2HWOA 2B4SB 3MJ2A 1U46A 4HGSA 4DFLA 3A4PA 3OFMA 3NIZA 4L42A 5A14A 3S00A 5CSHA 1KV1A 5CXHA 3HMIA 1G8AA 4TW9A 4DTAA 5E1SA 4Q9SA 1J1BA 3TJDA 3C4FA 4C7TA 2QI8A 5J5SA 2R3IA 4HCVA 5EI2A 1JBPE 3VN9A 3U55A 2QO7A 4O0UA 1OBDA 2C30A 3IDCA 4EH9A 4QNAA 1Q4LA 5HCXA 4AN2A 3SQQA 2RKUA 4CTCA 5BVDA 2QKWB 3FY2A 2ZOQA 3F3WA 3KN5A 4MBJA 3OHTA 3F6XA 5IUIA 5HEZA 2C6MA 5L2QA 4O7TA 4GK3A 4PDYA 4FL3A 2QQ7A 2X7OA 4MNFA 4HZSA 4HVHA 4QP2A 4RJ4A 3FDNA 4ASXA 1JKKA 3FMLA 2G2HA 3QTUA 2R3OA 1ZXEA 2R3HA 4NCTA 5EG3A 1UNLA 3L9PA 3N51A 4J98A 5CAVA 1L3RE 1F0QA 5DPVA 3ZO4A 3SA0A 2JAMA 2FB8A 4I5CA 3B8RA 4LI5A 3OCBA 5CQUA 3CD8A 2OIBA 4L44A 4TXCA 2W4KA 3A8WA 1KE8A 3NYOA 3UQGA 2XRUA 3QU0A 4XX9A 2YLFA 3MVLA 3ORXA 3I0QA 4IC8A 3VJOA 4P2KA 4U0IA 4X2NA 4BIBA 4YJNA 4PF4A 3MH0A 4MXAA 3DDPA 2VX3A 3BHVA 5I4NA 4BTMA 3UOKA 4EOJA 3N4TA 5DEYA 2YA9A 1AD5A 4NW5A 2O65A 4S30A 3F5GA 5JMSA 4DFUA 2X2MA 3PRIA 5IUHA 3PSBA 4G9RA 1OPKA 4EL9A 3TZ9A 5B2LA 5D1JA 2W5HA 3S0OA 3NUYA 4AZEA 3D9VA 1WBPA 2O5KA 2G2FA 4YJVA 5I9YA 5L2WA 2PPQA 2W1CA 4X2JA 5C8KA 4MEDA 2QG7A 3NYNA 2B9JA 3HP5A 3UO6A 4K9YA 4E4NA 2LAVA 2PY3A 3N9XA 1XBAA 4XG9A 3W32A 1UU3A 2FSMX 1IRKA 2O0UA 2QO2A 1KOBA 2H96A 3C5IA 3T9IA 3QTXA 5JZJA 4D55A 4JBQA 2HZIA 3R21A 4OT5A 3WZDA 4EOKA 3L8SA 2XKDA 3FMNA 3OBGA 5ETFA 3RZBA 1PXKA 5I9UA 2VNWA 4NCTC 3LCSA 4ZS0A 4RIYB 2BKKA 4IC7A 1YOJA 2XK4A 4Y72A 3BEAA 4EBVA 4UMUA 4D2RA 5EDRA 4M68A 4QYGA 3VS6A 1MUOA 2G9XA 3U6HA 4O82A 4FSWA 4D9TA 4BDCA 1GIHA 3UJGA 2GU8A 2QOQA 3DQXA 1OUKA 4CQGA 5JRQA 4YHJA 5IQIA 2A19B 4FKPA 4Y8DA 3CQWA 3W2CA 2YACA 4OTFA 1O6KA 5HO8A 5KKRC 4DFNA 2E9NA 5FTQA 3RWPA 1PHKA 2XUUA 3A2CA 2WPAA 3BPRA 3P86A 4LUDA 2Z60A 2YIQA 5CNNA 4HVDA 3QXOA 1TKIA 2B7AA 5DR9A 3CS9A 2QLUA 3DY7A 3E93A 3OTUA 4BHZA 2XNMA 3QFVA 4KNBA 5IEXA 1YQJA 4RA5A 4AXAA 4FE2A 3WIKA 4C02A 2OBJA 3QCSA 5C8MA 3MPMA 1UNHA 5FXSA 3JS2A 3LFNA 4JS8A 4ZTLA 1XH9A 2WEIA 3QA8A 4C38A 2BRNA 3BU3A 5KMNA 4I93A 3JY9A 4U42A 5BVNA 3UOJA 4ACMA 3I7BA 4GG5A 3GCQA 3KULB 3RNYA 3PFQA 3ZO2A 5JGAA 4RIWA 2JIIA 5JT2A 2VGPA 3QF9A 5FP5A 2QCSA 3HKOA 5IQGA 3EHAA 3OMVA 1YDRE 3PG1A 4LMNA 1CTPE 4H39A 4X3FB 3UODA 4EOLA 2YWVA 3MN3A 4G3CA 3CIKA 3MYGA 3TNHA 4CLJA 5JRSA 3LXKA 2OK1A 4II5A 4M13A 4RX7A 2XJ1A 4YZMA 4BY9E 3NDMA 3WZEA 1RDQE 3MPAA 4C59A 4WSQA 4XOZA 4Q9ZA 1H1QA 3QTWA 3R04A 3OROA 4BCQA 3VBVA 5KBRA 4USDA 2R64A 1SZMA 3L9MA 3BYMA 5LVNA 4TWNA 5HVYA 5KX8A 2ZB1A 4F63A 5CANA 1U5QA 3EWHA 3VS3A 1GZNA 4NWMA 2WFYA 3BV3A 1Q41A 2DYLA 4OBOA 5FBNC 4EH8A 3F3ZA 3COHA 3DGKA 2GNJA 4JR3A 4BGHA 4ACGA 4IAFA 3BGPA 1H1RA
chains in the Genus database with same CATH superfamily
4UZDA 3SHEA 4ZMFA 4D0WA 4E4XA 4L53A 3TG1A 4V0GB 4B0GA 1ZYJA 4OTQA 2YN8A 3R7GA 2V22A 2IVUA 3H4JA 1H00A 2VNYA 5C9CA 2ZYBA 5EQYA 4AX8A 1YXUA 2Z7RA 3IPHA 3MH1A 2WMAA 4FIHA 5IQBA 4PV0A 4TYHA 5L8LA 4ITJA 5EOBA 1XJDA 3IW7A 3R7VA 3KRXA 1IG1A 5L8KA 4K2RA 2BZIB 3OWPA 5ITAA 3FMKA 4GS6A 3PVGA 3DAJA 5GJFA 3R1NA 3V8TA 4AP7A 4FIIA 1QPJA 2X8DA 4JDIA 4UWBA 5FD2A 4GW8A 4ZLOA 3LOKA 5I5ZA 4W8DA 2WXVA 3Q9YA 3P1AA 4EYMA 3LHJA 2XIXA 3D7TB 3QUDA 4XV2A 3PA4A 4R5YA 1F5QA 3FL5A 3ITZA 2B55A 4WHZA 4L67A 3KXZA 2UZDA 5CYIA 4CSVA 5L6WL 4MXZA 3TKHA 3W18A 4NM0A 5CU0A 2YCFA 3ZZEA 1FINA 5JH6A 4AA4A 3KRLA 4JG8A 4O38A 3R9HA 4GIIA 3PJ8A 3RAHA 3W0NA 3ETAA 3DA6A 2YISA 2BIKB 3PIXA 3COMA 4OTRA 4W9WA 2NP8A 4KRDA 4YJSA 5DLSA 5B2KA 5DWRA 4ZZNA 1R0PA 1Y8YA 3ULIA 4PMMA 4M0YA 1YHVA 1APME 2Z8CA 2EXCX 1YXVA 3EQGA 4FRFA 4BTJA 4JVGA 1BKXA 5IQCA 1R78A 4O7RA 1ZZLA 4OUCA 1FGKA 5CU4A 5GHVA 5A4EA 3ZXZA 4MTAA 3O23A 4QMWA 4F4PA 5IMXA 5LVMA 3C0HA 4PTCA 5L6OA 4WRGA 3KU2A 3NW5A 3GB2A 3F82A 2XNOA 5CALA 2JDOA 4C4GA 3TZ8A 2RFSA 2VGOA 4MF0A 4G3DA 4BZNA 4I6HA 2ETMA 4AFEA 2J6MA 3NAXA 4H36A 2OXYA 3TACA 3GQLA 4C4HA 1JSVA 4ID7A 1S9IA 1ZY4A 3GU4A 2CKOA 3RINA 5EK7A 5D9HA 4NKAA 2QR8A 1JSTA 3MY0A 4B7TA 1HCLA 3BCEA 5E8UA 4BBEA 2I6LA 4AGUA 3TN8A 4IAYA 3U6IA 4I94A 3ZM9A 4R7HA 2CGUA 2X6EA 4D4SA 2JDRA 2NPQA 2XYUA 3G90X 3KF4A 3LVPA 2YDJA 2PK9A 3ZDUA 4CT1A 5DYJA 2WMQA 2OFVA 1YKRA 3EN9A 4I0RA 1YW2A 3R7IA 5HE3A 3TL8A 2C6EA 5JZNA 1E1VA 5D12A 5FDPA 2GDOA 1JWHA 3UPXA 3E64A 4APPA 3HAMA 1WBTA 2HY81 4EQUA 5A46A 3V5PA 3QL8A 4GH2A 3R8PA 5LCJA 2CNVA 2QURA 4AAAA 1H25A 3OCSA 3CKXA 3K5UA 4FKLA 4F6UA 4Q2AA 3HV4A 3W1FA 3DKOA 3W0PA 1CKIA 4QQJA 5IQEA 3SGCA 2QHMA 3DS6A 4OTIA 4WG5A 2WEVA 4JBPA 3GNIB 2EXMA 3QQHA 1GZOA 3QD2B 5EDQA 3MA3A 2NYAA 5JKGA 4O7WA 3FE3A 4GV1A 3LCDA 4U6RA 4Y73A 4YGAA 4DHIB 4O7ZA 3NYVA 3UO4A 3OG7A 1FOTA 2VTHA 3OEFX 4BCMA 4HVSA 2CNUA 2GFSA 2W5AA 3FV8A 4LMUA 4BWPA 3ORNA 2IVSA 2EUFB 2WKMA 2X2KA 3F9NA 4FV5A 4B6LA 4EZ5A 2BTSA 3MIAA 3R8MA 3VW8A 4CZUA 1PKDA 1X8BA 3NUAA 2BPMA 1YI3A 1ZYLA 5IH4A 3DNDA 3LXNA 4IE9A 1Q8YA 4TWCA 4AS0A 1M7QA 2JC6A 1W8CA 3WIGA 4RIXA 4A9TA 3PXZA 1OVEA 4C8BA 2JEDA 5K4JA 1ZMWA 4YJRA 1TZDA 2IZUA 3ZC5A 2PULA 2VX1A 2V62A 2GFCA 3NCGA 4PMTA 5KHWA 4DDIA 3JVSA 1KE9A 4FV6A 1PXOA 4CCUA 5E92A 5LXMA 3EKNA 4UV0A 5HHWA 4A4OA 3VBXA 5A4CA 3FQEA 2IW9A 3NNVA 1U54B 3LXLA 3QUEA 5EW9A 3RK9A 4P5QA 3FHRA 3ZTXA 4ACHA 4FMQA 4GCJA 3SD0A 2PWLA 5BYZA 4U7ZA 4MNEA 4J52A 1Y57A 3PUPA 2CCHA 3Q60A 4ZSJA 2FSTX 5H3QA 2UZWE 3MTFA 4FVRA 3UVPA 1I09A 4JI9A 4FOCA 4ZOGA 3VWAA 1PY5A 3NNXA 3WZJA 3D2IA 1H24A 3HDNA 4E5WA 3O5AA 4C4IA 2IZSA 2X39A 3EN5A 3H3CA 3UNZA 2WQBA 3TDWA 2HCKA 3W2RA 3BU6A 4DCEA 3DXPA 4FIEA 1A48A 3N4VA 3GU5A 4MD7E 3WYXA 4BRXA 3LM0A 4YMJA 2X9FA 4C58A 4BWXA 3HUCA 4N6ZA 3VQUA 3LFDA 3MBLA 4HYSA 5M4FA 3QAME 3U4UA 2PUPA 1AGWA 4FSMA 4Z7GA 3CP9A 3CPCA 1J1CA 4IDTA 3BHHA 4O4CA 5HX6A 4QMLA 2W05A 2JGZA 1VYWA 2XVDA 5KBQA 2FUMA 2HZ4A 3VS0A 4GYIA 5ETAA 4BFMA 3OUKA 5BVOA 1WMKA 2JITA 3EQPA 4O96A 4QYEA 2PZIA 2OJJA 2V7AA 4CFNA 4S32A 3HZTA 3V5JA 4HVGA 3QUPA 5BMSA 2QU5A 4FEUA 5CEPA 1QPCA 4J96A 1CDKA 2XK7A 2GCDA 3OT8A 3QCYA 5E90A 4PRJA 2IW8A 1FMOE 2OF2A 2XNPA 3FI2A 3R63A 3ZHPC 3PY1A 4FTRA 4EC9A 5FXRA 4DA5A 1ZMVA 1WBSA 2IF8A 4FR4A 5FRIA 4J8MA 3FUPA 4TKSA 4PPAA 5E8VA 5HBEA 4MXCA 3E8DA 3QD0A 2XNNA 2GNFA 2WNTA 3TUDA 2VTAA 3QRKA 4ZSAA 5AUZA 2JDVA 2Y4IC 3NGAA 3S95A 3TNIA 1GAGA 3P7BA 4YZCA 2C6IA 3NCZA 1JOWB 5AUUA 4IB3A 2Z02A 4K0YA 1SYKA 2GHMA 4RFZA 5DRBA 4O84A 2F2CB 3ANRA 5BQ0A 1BLXA 4I24A 3DB6A 5CF4A 3C4EA 5CWZA 1ZLTA 4DEDA 4FNXA 2QODA 5B2MA 2HK5A 5CF5A 2BIYA 5A4QA 3UMWA 1KWPA 3I6UA 5HI2A 3LMGA 5AX3A 1YI4A 5L3AA 4EK3A 2YM7A 3MVJA 4GU9A 4ACDA 4YJOA 4DDGA 5KZ0A 3EFKA 1UU8A 3MB6A 1Z9XA 2YITA 1VR2A 1P14A 2CDZA 3V5QA 1ZOEA 3FZPA 2O3PA 3G5DA 4MWHA 2QHNA 4NIFA 4OR5A 4WO5A 4A4XA 4KWPA 2WU6A 3CE3A 3U9CA 4DFBA 1W83A 2RSVA 3F3TA 5JGBA 3W2QA 1HCKA 4KBCA 3FKLA 4ZZMA 3TI1A 2FSLX 2YERA 5B7VA 2UW5A 2JDTA 3LFCA 4L3LA 5CSPA 3BELA 5LVPA 3FYKX 3PFYA 4RLKA 3GCSA 3BHTA 3PPJA 2YCSA 4O1PA 1OPJA 4EH2A 2PVRA 4OTGA 3IW5A 4RWJA 3ML1A 3PXYA 2QD9A 5F4NA 2XARA 2YHVA 3H0YA 4RC3A 5J7HA 4J95A 4M8TA 3VULA 4IQ6A 3R73A 2PUUA 2RGPA 3C4WA 3GU7A 3D2KA 3C1XA 3MDYA 4FBXA 4WD5A 5DRDA 5AV0A 3DZQA 3R9OA 4E7WA 2RIOA 3W0QA 3MH2A 4XHKB 3O0GA 5HNGA 4A9SA 3TV4A 3R28A 4NJ3A 4AF3A 2OJ9A 3Q32A 4ERWA 4YBKA 1H08A 4PL5A 5CNOA 3WE4A 4FKSA 4IVAA 2FGIA 4F64A 4RVLA 3PXQA 3LJ2A 4YJQA 3KRRA 3UQFA 1MRVA 1FQ1B 4AT5A 4BBMA 2WMWA 5KMOA 4Y85A 2OLCA 4QD6A 5CEIA 4DH7A 1ZOHA 4HW7A 4AZWA 2X8IA 4AUAA 5LWMA 3KY2A 1R39A 2QOOA 1H8FA 3FYJX 4J7BA 2CGXA 1R3CA 3E7OA 2VZ6A 2GNIA 4ZS4A 2Z7QA 3E8NA 5HD7A 1SNUA 3FZOA 3R1SA 5C03A 4EH7A 3JPVA 1B6CB 2HZNA 4E6QA 5DGZA 4EK5A 3DU8A 2UW0A 3DLZA 1XBBA 1NVRA 2B9IA 4BCFA 4RFMA 4EOPA 4H3PA 2X8EA 3Q96A 4IM0A 4PTGA 4S34A 3UTOA 4E6AA 1PYXA 2X1NA 3ENHA 3R71A 3ZRKA 4JQ8A 1QPEA 4PP7A 4H05A 2C6LA 4QYFA 3CKWA 1OL6A 4TTHB 4MH7A 1GZKA 4DLIA 4EHEA 4BTFA 5HORA 4DN5A 3AMYA 3FLYA 3UG2A 4DG2E 3EJ1A 3LQ5A 2C5XA 3AC4A 2R3KA 4D58A 4QTBA 5HX8A 1H07A 2VO6A 3EN7A 3DFAA 2WB8A 3BYUA 2OF4A 3CJFA 4LOPA 1B38A 1STCE 3FAAA 4I92A 1DM2A 2F57A 4IXPA 2ITUA 1XH5A 2ZV9A 4YTCA 4FKQA 4CFXA 2IW6A 3O2MA 3LZBA 4CD0A 1J91A 3R8UA 3R22A 3VO3A 4U3ZA 4I20A 4OW8A 2VO3A 4IAAA 4TWOA 4TNDA 5HVKA 5LMBA 2ERKA 3MFTA 3E88A 4DLJA 2ONLC 3DOGA 5ANDA 3RKBA 5IZFA 4FL1A 5J8IA 1CSNA 4BKJA 4R3RA 1UWJA 3FY0A 4JL9A 4BZDA 3WYYA 4TRLA 2VD5A 2UW9A 3TUCA 3ODZX 3BI6A 4GU6A 4D1SA 1H1SA 2J5EA 4F0FA 2VTQA 2PZPA 1WBVA 4N0SA 4J8NA 3C9WA 4QMOA 5CSXA 4F9CA 5IEVA 1PXIA 4XNEA 4EK8A 1Q8TA 1V0PA 1R0EA 1FVRA 1OL1A 2W0JA 3CCNA 3GC0A 3O8PA 4Y95A 5AUVA 5HKMA 5DMZA 2OH0E 3DFCB 1LEZA 3KIOC 5AR3A 1ST0A 3GC7A 3FJQE 3DBQA 3ACJA 5A6NA 4UMRA 4O6EA 3QQJA 1TQMA 4XUFA 3I5NA 3R8ZA 1UVRA 1Q8ZA 5AP7A 4BIDA 3PRFA 5J9ZA 2P55A 5JGDA 2XM9A 2C3LA 1CM8A 4HNFA 2B0QA 3AD6A 3VIDA 4GJ3A 2GQGA 4KBAA 3NWWA 4MXXA 4CCBA 4XCUA 5CSVA 3Q2JA 5LJJA 4IVDA 4ANSA 4I6LA 5DVRA 3C5UA 3IG7A 4DFZE 4Z55A 3UYSA 1KSWA 4KS8A 5KKRB 4GSBA 2RF9A 3II5A 5HO6A 3HMPA 3RPYA 2UW4A 3TT0A 4D4YA 4EK6A 5J7BA 2YM5A 2ACXA 2ZV7A 4H58A 4L01A 2UUEA 3U6JA 3F69A 2RL5A 5IDNA 5I3OA 4MBLA 4U43A 4CLIA 3HMNA 1U59A 5K9IA 2GPHA 4JOAA 1ZWSA 4LQMA 2ZV2A 2B52A 2EWAA 4F7NA 5FLFA 3OCGA 4EOSA 4BCIA 2R2PA 4TN6A 5HZNA 5FEEA 2CCIA 4XBRA 4QPMA 5T68A 3PXFA 4PDPA 4XRJA 2VTJA 4AG8A 3VRZA 3BRBA 4YLJA 5TO8A 3NYXA 3OP5A 5EM8A 5H8EA 3RALA 5AUTA 3NUSA 3D5WA 2PZYA 2QVSE 3TTJA 4R7IA 2CGVA 3SW4A 4AW1A 4AU8A 2YM6A 3UGCA 4QP9A 1P5EA 2BZKB 2G01A 3U51A 3MPTA 3V51A 4F6SA 5IU2A 4O7SA 3RAWA 3ZLWA 1OL7A 4DEAA 4KKEA 5AR2A 3W0MA 5ANIA 3QC9A 2QOKA 2IO6A 5HG7A 4GIHA 3OBJA 2OWBA 3P4KA 5T3QA 4BI0A 5BX0A 4K33A 2PYWA 4UWCA 2C5VA 1ZARA 5KO1A 3QZGA 3TNQB 2JIVA 4FTNA 1O9UA 4AXFA 2UZVA 5HQ0A 4R1YA 4G6NA 4IX3A 3UDTA 3C0GA 1PMEA 4F6WA 2I0VA 3GCVA 5C8NA 3LLAA 4BC6A 2HIWA 4IZ5A 3IDBA 2XIKA 4RX9A 2AC3A 2QOBA 2VO0A 3WF6A 5CQWA 5DBXA 4OLIA 2BAJA 3P9JA 4BDAA 2C6TA 3UMXA 3CBLA 5AR4A 3ZO3A 3TEIA 4K77A 4YC3A 2BHHA 2OO8X 3KCFA 2ZM3A 3MY1A 4PDOA 1XQZA 4M84A 4DCAA 2XBJA 3I1AA 2BZJA 3CXWA 5M57A 4ASZA 4BDEA 4PL4A 3RZFA 3VHKA 2R4BA 3PLAE 3GT8A 1J7LA 2X9EA 2A0CX 5AV2A 1WVWA 3DLSA 4RIWB 1A9UA 5IQDA 4UXQA 1UKHA 3GBZA 4LV5A 4EKKA 4EQMA 2ITYA 3TNPC 1ATPE 3LE6A 4R3CA 3EQDA 3KK9A 4L68A 3T9TA 2XP2A 3BE9A 4WIHA 1NVSA 5GJGA 3VHEA 2PVNA 4JIKA 2ESMA 3VUMA 4E26A 1TQIA 3T3UA 5GNKA 3BWFA 4AXCA 4C36A 4GVAA 3KXNA 4FZFB 3UZPA 4F99A 4DEBA 4O21A 2R3LA 5HCYA 3RMFA 5KMIA 5FGKA 4RZWA 3KXXA 3QKKA 4BCKA 4BTKA 2PUIA 2W7XA 2ETRA 4DH1A 4AZTA 3CJGA 4L52A 3HMOA 2A27A 4ZTRA 4MVFA 4BCNA 3RHKA 4DH5A 1WBWA 1BI8A 4IMYA 4EH5A 4FVQA 5EYDA 2WQNA 3QD4A 4F7SA 3BL9A 2P0CA 5BYYA 3ELJA 4DINA 3G33A 4YPDA 3QKMA 4NJDA 2XNBA 4M3QA 5CU2A 3ZZWA 4PNKA 4AN9A 3LFFA 3IW6A 2HWPA 3VBYA 2VWZA 3TV7A 1Q99A 2XEZA 3Q4ZA 1XR1A 4O0YA 3ROCA 2OICA 3TKUA 3ZC6A 4BCJA 5KMMA 4KKHA 5L2SA 1OKYA 2W96B 2VTPA 3HEGA 5HD4A 1CKJA 4FNYA 2QG5A 2BCJA 4E5AX 1U4DA 5GIPE 3OXTA 1BI7A 1MQBA 5JEBA 4FTQA 4BL1A 3UZRA 1WCCA 4FTUA 4JJRA 4TYHB 5HU3A 5KUPA 2ERZE 5F9EA 3KA0A 4FKTA 3HRCA 2V5QA 3BEGA 3FSFA 5L4QA 2X2LA 3F2RA 3TIYA 2X81A 4YZBA 3LLTA 4EOQA 4CFVA 2WTWA 5CSWA 4I6BA 2FVDA 3UIMA 5CI7A 4GRBA 3RWQA 5AEPA 3BGQA 4GEOA 4LDTA 1W2DA 2OJIA 3FLQA 4LG4A 2GHLA 3D94A 3K5VA 4ZY5A 3TDVA 2UW7A 5K5XA 5HO7A 3PZEA 1T46A 2W1EA 1Q62A 4DE4A 3AC1A 2X0OA 3CGFA 5J87A 4MD9E 4BGGA 4ZSEA 4DT8A 2ITWA 4XG3A 1GNGA 5K0XA 4DFXE 5F1ZA 3M11A 4I21A 1OM1A 2QONA 4BBFA 4C37A 5JQ5A 3HYHA 3VAPA 3W10A 3MFUA 3FMEA 3JXWA 4M14A 5BUJA 3UYTA 3GFWA 5M07A 2WMBA 4FTMA 4I6QA 3P5KA 1WFCA 4A06A 3BLAA 3DKCA 4PP9A 3U4WA 3HV5A 5CAOA 4U3YA 1GIIA 5CEQA 3NSZA 3G0EA 4MWIA 4G34A 4FG7A 4HZRA 4IZ7A 1XH6A 4PL3A 5ETCA 3TZ7A 4UMPA 1DI9A 3D15A 4K8AA 4LM5A 2GHGA 5IDPA 2YWPA 3CTHA 3A62A 3R6XA 4CQEA 4BGQA 4OTPA 5JQ8A 2Y4PA 3UG1A 3PE2A 1H1WA 5M56A 5CU6A 5LMKC 4O83A 4DH3A 3GEQA 4LGHA 3MFSA 4AOTA 4AE9A 1TQPA 4WKQA 2BHEA 2C6DA 5EYCA 3UBDA 4RSSA 3OW3A 1M2PA 4G17A 2XB7A 1ZRZA 4ZTHA 1OB3A 3FEGA 4IW0A 2VTRA 1XBCA 3DTWA 3QRJA 2QC6A 4FV4A 2H6DA 4FV7A 4K18A 4QTDA 2ZDTA 5M44A 4DF3A 3FXZA 3PTGA 2WTJA 3OOMA 4FUYA 3ZBXA 2W4JA 4G5PA 3EQRA 2OU7A 2Y6OA 5AX9A 2I1MA 2RFDA 4F9AA 4QPAA 3F3VA 4BDKA 2OZOA 2WELA 3HL7A 5AP1A 3PZHA 1LR4A 5EDPA 3TZMA 4CYIA 4D5KA 4A07A 2I7QA 3NMUF 4D0XA 2R7BA 2Q0NA 4AGDA 4OAUC 3RI1A 2OIQA 1H28A 5G1XA 3ZONA 3PJ1A 2UZUE 2G1TA 4TWPA 3WF7A 5GINE 1VJYA 1KOAA 4JDKA 5M53A 4DT9A 2X6DA 4N6YA 4UX9A 4FEWA 1MP8A 1WZYA 4XLIA 5M51A 2NRUA 3R0TA 1Q97A 3VVHA 1ZYCA 4PY1A 5TF9A 4F9WA 4MYGA 4EJ7A 4WRSA 3W0OA 3BLHA 4IADA 4I23A 1CKPA 4IANA 3ERKA 4PNIA 3EKKA 4AGCA 3TV6A 1PXMA 1GIJA 1S9JA 2IZTA 2WMVA 4FZDB 3V8SA 3EFWA 2V7OA 2VWYA 2PUNA 4ASEA 4RQKA 2OIDA 2OJFE 4ANLA 5T6KA 2ZV8A 4O4FA 3RPVA 1OGUA 4QYYA 5J9LA 4D4VA 1M52A 2AYPA 4FV8A 5DG5A 4C57A 3UVQA 4RJ8A 4DFYA 3G9LX 5AFVA 3DBDA 4QYHA 4B4LA 2VWIA 4F9YA 1ZAOA 4O0VA 3OT3A 3ZUVA 3MI9A 2GSFA 3ZUTA 5AUXA 5JFWA 4C3RA 4YJUA 2HAKA 1FVVA 4FG9A 3BYOA 4FL2A 4WUNA 1YHSA 4TYEA 4FTKA 4BDIA 1XH8A 2E9OA 2RFEA 3KMMA 3KMUA 4QMTA 5AP2A 4FK6A 5ANOA 1GY3A 4FT3A 3BLQA 4AW0A 3GI3A 5K0KA 5JFXA 5DR6A 4BKZA 3ZS5A 1Q5KA 2ITNA 4EWQA 5HTBA 1OZ1A 2WAJA 3PSDA 4NZWB 4RIXB 5CVGA 4ANBA 3ATSA 2UZEA 3VUTA 2BDFA 3AC5A 3KULA 4PPCA 1E9HA 2BALA 2BTRA 4S2ZA 4XJ0A 2R3FA 3NS9A 4O81A 2ZM4A 5KE0A 2P33A 3ZCLA 5HBJA 4U41A 3TWJA 1PMUA 2AEGA 4FSZA 5IQFA 4Y46A 4CRSA 5E8TA 5G6VA 2JLDA 4LUEA 4PX6A 3CD3A 2E9UA 5DHJA 1KE6A 3LPBA 5FWKK 3SLSA 2WMXA 4MNEB 5HESA 5CAPA 2R5TA 1JSUA 3DAEA 3POOA 3OZ6A 2X4ZA 4U9AA 1UNGA 5IH6A 1W0XC 3MWUA 2X0QA 3D14A 1M14A 3ET7A 3KGAA 3SOCA 3SG9A 3OTVA 4GFGA 4TPTA 4CKIA 2VUWA 4DGGA 4FNZA 2B1PA 4Z16A 2IN6A 2F2UA 3MY5A 4FI1A 3QHRA 4QRCA 3U54A 3LAUA 2YM8A 4AACA 3HMMA 4M69A 3R00A 4I41A 1WVYA 3BE2A 3K3IA 2AC5A 4G3EA 5AV4A 1OL2A 4RA4A 1DI8A 3KVWA 3RPOA 2UZTA 3SV0A 3E8EA 4HPTE 3OF0A 4M15A 5JSMA 5AP4A 4CFFA 2WTKC 4RX5A 4QMYA 4NW6A 1OIUA 4FV3A 3KCKA 3QLFA 3EIDA 2XIRA 2VTLA 3CPBA 4W8EA 5HIBA 3UE4A 5AMNA 4FK3A 3CC6A 2W06A 5H9BA 4QQCA 3GOKA 3RCJA 2I0HA 3CQEA 2OFUA 4WG3A 4U5JA 2VTMA 4W4VA 5CZHA 5EHYA 4A4LA 3O71A 5E7RA 3VBWA 3FLZA 4GT5A 4XYFA 5AR5A 2PE1A 3AD4A 4G1WA 4NFNA 3QTRA 3HA6A 4FKJA 5AP0A 3RTPA 3VUDA 4TL0A 5AR7A 3FZRA 3S3IA 1SM2A 4IHPA 4F09A 3BIZA 4QPSA 4ZK5A 5M55A 3KRJA 4EZ7A 5HIEA 2J90A 5ACKA 4FV2A 4D2SA 4LOQA 3OXZA 4TY1A 4BF2A 1WAKA 4X3FC 2UVYA 3FPMA 4EHGA 4DG3E 3IDPA 3GP0A 3W2SA 5HE0A 3ZFMA 4GFMA 3RAIA 1LEWA 4C62A 2CLQA 3QRIA 3DV3A 3NNUA 1W7HA 5BUIA 4CG8A 1PJKA 3NUNA 4L9IA 3ORKA 4FT0A 4I3ZA 4I5MA 2BFYA 4FTAA 3MA6A 4AGWA 4AOIA 5KMLA 2BROA 4LRKA 5CEMA 2FA2A 1JLUE 3GU8A 4FKIA 4ZSLA 3ZXTA 4ZIMA 2ITQA 2YEXA 2UW8A 4B99A 4EWHA 2EB3A 3SXFA 4QMPA 5FEDA 1PW2A 2PZRA 2YCQA 4GK2A 2PE0A 1ZZ2A 4NIFB 2A2AA 2OZAA 5CF8A 3GU6A 4KKGA 4RRVA 2OW3A 4RJ5A 2X7FA 3SW7A 2XAMA 4L46A 3ZO1A 4JG6A 3NLBA 3BV2A 4IB0A 2VX0A 5LVLA 5GIOE 3DK3A 3O17A 2YCRA 1CMKE 5I9WA 2C4GA 3OCTA 4P7EA 4Y83A 1H4LA 4YC6A 4W9XA 4FYNA 3A8XA 4PDSA 3QYZA 4O2PA 4AA0A 3CSVA 2B54A 3MGYA 3PP0A 1KE7A 5CTPA 3VF9A 4BN1A 4FSUA 2BZHB 4YUQA 3N4UA 2J51A 2X0PA 4QP3A 3B2WA 3DBEA 1ND4A 3WF5A 5E8ZA 3R8VA 3MTLA 4CRLA 1YOMA 3IECA 3QKLA 1NA7A 2PHKA 3F5UA 4RX8A 2R0UA 5B0XA 4EONA 4XG4A 3R2BA 4OBQA 1YI6A 2PVYA 2XA4A 5IA1A 4HGLA 1G3NA 4ENXA 5K3YA 4JBVA 3DZOA 3O7LD 4DHZA 2F7EE 3HNGA 4U8ZA 3OWLA 4MHAA 1UV5A 1YVJA 1G8KA 1OUYA 2QOFA 3ZH8A 4F1MA 1LUFA 2RFNA 2F4JA 1Y91A 1YWRA 2HOGA 3C4CA 3PSCA 1YXXA 4RC4A 4DITA 3FC2A 3PPZA 1M2QA 3Q6WA 1J3HA 4J71A 3NPCA 1RW8A 4JX3A 4JQEA 1M2RA 3FC1X 5EM6A 2OH4A 5FBOA 5AA9A 3O7LB 4CYJA 4YR8A 5DN3A 2ZMDA 4F0IA 5LWNA 3R8LA 3QC4A 4MUQA 2E9VA 4V05A 1K2PA 3P7CA 4O2ZA 2PVHA 3KXMA 2F7XE 2W1GA 2XMYA 2OGVA 3H0ZA 4LL0A 3BGZA 4DYMA 4KD1A 4EEVA 4OT6A 1PMVA 1W2FA 3LXPA 4RWLA 2GS7A 4DG0E 4EQCA 2W99B 2XZSA 2UZOA 3QQGA 1PYEA 3ZEWA 3QGWA 4A9RA 3W0RA 4EH6A 3ORIA 5AM7A 3DKGA 4C2VA 2B9HA 5M4IA 4I4FA 3WE8A 2CKQA 2J0JA 1JKSA 3VBTA 1SVHA 4EH4A 5A4TA 4J99A 4QMUA 3QXPA 4M67A 2BAQA 3HLLA 4B8MA 4F08A 3H9OA 3GFEA 3F66A 3PJ3A 1VEBA 5BVWA 4KAOA 3VUHA 1ERKA 2YM3A 4BDJA 3A7JA 3V5LA 1IEPA 4ARKA 1GJOA 4NYEA 3M2WA 4FT5A 4DC2A 1M17A 4E73A 5EOLA 4FSRA 4GUBA 3EFJA 1IAHA 2ZFYA 1TFFA 4FNWA 4P4CA 3JR1A 2RG5A 2GQSA 3E63A 4ZSGA 2QOIA 4D1XA 2C5YA 1J7UA 2VAGA 5C4KA 2XEYA 3OS3A 3B2TA 3RK5A 4YO6A 3TIZA 2C1AA 5IG1A 4PTEA 1U54A 2QO9A 4RPVA 2P2HA 2R3GA 3SRVA 4APCA 2J9MA 3PE1A 5EM7A 3ZU7A 1IASA 4KABA 5FP6A 3LFQA 4BVUA 4LOOA 4UYAA 3IK3A 3U8WA 3EN6A 3FXWA 4EHZA 4C4EA 2W9ZB 5CAQA 2O64A 4DGMA 3F2AA 1ZOGA 4GK4A 4XG8A 5HBHA 5DOSA 2YIXA 3EL7A 3UNJA 2HENA 5E8XA 4USFA 2ONLA 3SXSA 2BRHA 4ZAUA 4LYNA 4FTLA 4C4JA 3L8XA 4NK9A 1PF8A 2UZBA 4O0RA 3COIA 3ZFXA 4KB8A 2QR7A 5A3XA 4R1VA 2LGCA 4NTSA 4DTKA 3HV6A 3D5UA 3RP9A 3TTIA 3DDQA 1NXKA 3Q2MA 4FV9A 3A4OX 2QLQA 3EB0A 3L8VA 3Q4TA 3QGYA 5HGIA 3REPA 3VNTA 4HGTA 5HNIX 1GZ8A 3ZBFA 5LQFA 2WMTA 2CKEA 4X6QC 5E8SA 2CSNA 2EB2A 4K1BA 5IA2A 2Z2WA 4CKRA 1JPAA 2QOHA 3O50A 3W55A 2O63A 3P08A 4IWDA