4I0TA

Crystal structure of spleen tyrosine kinase complexed with 2-(5,6,7,8-tetrahydro-imidazo[1,5-a]pyridin-1-yl)-5h-pyrrolo[2,3-b]pyrazine-7-carboxylic acid tert-butylamide
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
277
structure length
266
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Pyrrolopyrazines as selective spleen tyrosine kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 89
structure length 266
sequence length 277
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4i0tA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4i0tA01
3UP7A 3RHXA 5HG8A 3VO3A 1OPKA 5H8GA 3SW4A 3H10A 1ZARA 3CKWA 2J9MA 3UIMA 4HCUA 1Q8WA 3KMWA 1ZLTA 4Z7GA 1M7NA 4WUNA 5CTPA 4EL9A 3NNUA 4O0YA 4RX7A 1V0OA 3QTRA 4FUYA 1PXLA 2HIWA 1OKWA 3DTCA 5K0XA 3EWHA 5HE0A 5IA0A 1KOBA 3SQQA 2CHLA 3F82A 4AGDA 4QYFA 4BBFA 3F3WA 2O64A 4NFMA 2QVSE 4HCTA 3VBQA 2ZB0A 3KCKA 3QKLA 2ZYBA 5JEBA 5CVGA 4DINA 2CCHA 2OKRA 4O6LA 5JZNA 2JLDA 4YGAA 1AGWA 2NRYA 1Q24A 3HMIA 2EVAA 2V62A 3CBLA 3P9JA 1JSTA 3FLWA 3GBZA 3Q4TA 4Q5EA 4RQVA 2HZNA 2ETRA 4D4RA 2Y8OA 2IZUA 3V3VA 2AUHA 3R04A 2BUJA 3SHEA 5IQFA 4CTBA 5EW9A 2PMIA 3QRJA 4BR3A 1CTPE 4O2ZA 5EYMA 1H1PA 2R3KA 3I4BA 4XJ0A 4U0IA 3LHJA 3QA8A 3UOHA 2HYYA 3A2CA 4WNKA 5DH3A 2GHGA 5KNJA 1CMKE 3SG9A 3RKBA 4RFZA 5ETAA 4WD5A 5GZAA 3DNEA 4USEA 4JX3A 5DHJA 3RMFA 1PYEA 1O6KA 3KKVA 3I7BA 3A7FA 5J7BA 3KY2A 4L7SA 3PJ1A 1DI8A 1ZOEA 4LI5A 4ZAUA 1J7UA 5E90A 2C6MA 3KF4A 4RPVA 1PY5A 1PYXA 2OZOA 3V6SA 4ACHA 3JVSA 4D9UA 2W4JA 2P4IA 2W1DA 3DKFA 4HYHA 4RZWA 3P08A 4LOQA 2UW4A 1VR2A 4IJPA 4EHZA 1EH4A 4F7LA 4O91A 5AX3A 2CGUA 4X3FA 4PDOA 5AUZA 1KE5A 3ORPA 4HVHA 3D4QA 5I0BA 4OTDA 3C4CA 3DJ5A 2X2KA 2XUUA 1ZYJA 1V0BA 3CJFA 4DGNA 2A0CX 2VTRA 5L3AA 2J0JA 4CYIA 2VX1A 4EUUA 4EH2A 5BUEA 4WSQA 4IWOA 3VJNA 4YC3A 2I0YA 2IG7A 5CVFA 5AV0A 3MPMA 4D58A 2HAKA 2ONLC 4FIGA 5I9UA 4ZSLA 3BHHA 1OIRA 1ATPE 2R4BA 3BBTB 2J5EA 3FYJX 4A9YA 5IH4A 1IA9A 3ORKA 4O86A 3W10A 3A8XA 5I3OA 2VX0A 5F1ZA 2WTJA 2CN5A 2Z60A 4MQ1A 3UDBA 2C1BA 2I1MA 2PVMA 2YIRA 2E9PA 2W5HA 4KA3A 1CKPA 2XK4A 5BMSA 4BDIA 3UZRA 4ACCA 1H4LA 2VTSA 4G3FA 3EQGA 3R7GA 4FUXA 2Q0NA 4LV8A 4FSRA 1KE6A 2SRCA 3OCSA 3UP2A 3HKOA 3V01A 3EQRA 5IEYA 5CF5A 3OCTA 3EFLA 2PHKA 2UZVA 4KWPA 2ERZE 4WG5A 3LJ0A 4EWQA 4G31A 4YJSA 3CY3A 3R2BA 3Q5IA 2JKQA 1DS5A 4S32A 2RG6A 3LQ5A 4NU1A 1ZOHA 3QQGA 4R3RA 4YJVA 4NT4A 3FDNA 5EQYA 2XM8A 5EQPA 1T46A 3IONA 4E1ZA 1P5EA 4K2RA 4QTAA 4EWHA 3R1NA 3ZTXA 5A9UA 4RJ4A 4RVTA 4E3CA 4AOJA 5H8BA 1UU9A 2GHMA 5K4IA 3SGCA 3CR0A 3QC9A 3AXWA 4K0YA 4RIXA 4GFOA 4XP3A 1ZZ2A 2CJMA 5CALA 4I0RA 2BAKA 4S31A 3AT4A 2C0IA 3BPRA 3F7WA 1Y8GA 5C8NA 3JS2A 2GSFA 3DT1A 3KRWA 4FODA 5D7VA 3VUDA 4DEEA 3U55A 2X6DA 3ITZA 4OR5A 4AE6A 4BCGA 3BLRA 4UALA 3ZFMA 2ITXA 1OL5A 4IX4A 1ZYSA 3IW5A 3FXZA 4FF8A 4F63A 4H36A 2J2IB 2BTSA 3HMNA 4OTPA 3T3VA 3FI8A 3KGAA 2R3RA 1E1VA 3QQUA 2XK7A 3FLQA 4MNEB 2RGPA 4QMOA 3I0OA 1OUYA 3O8TA 1OBDA 4I4EA 4ZP5A 5JFSA 2WTDA 2UW3A 2UVZA 4BDBA 2H8HA 5BUIA 3HDNA 5FTQA 4OAUC 3LFDA 2YCQA 5CI7A 4AN3A 4I5HA 1UWHA 3WYXA 2R3MA 1H0WA 3BHYA 4ZJVA 3UOKA 3MTLA 4H1MA 1CKJA 4GU9A 4C38A 2HW7A 3MH3A 4QMNA 3LCTA 3MA3A 3HV5A 1JKLA 3CY2A 3WI6A 4A9TA 4BWXA 5HE1A 4QYHA 2P33A 4L00A 5FEDA 1G8AA 2ZV7A 3LFSA 1J1CA 2XBJA 3VBYA 4H3BA 4GRBA 4AFEA 4QTDA 1GZKA 2R64A 3D7TB 4CQGA 4BWPA 3F61A 5J5TA 4FEQA 3K54A 5LARA 3C4EA 5I9VA 2XM9A 4W8EA 5AAGA 2I6LA 4P5QA 2IW6A 4ASXA 4I22A 3VBVA 5AV1A 4IB5A 1LR4A 2W4OA 2CSNA 2XKEA 4O22A 5ANEA 2QOCA 4FZFB 3UNKA 2F4JA 1H0VA 2JITA 3POZA 3R71A 3BQRA 4M14A 3NNVA 3W2OA 2DUVA 4FK3A 3KXHA 2YIQA 4YTIA 4O83A 5M09A 1FVRA 3DCVA 4GG7A 2OZAA 2EXMA 5D1JA 4FKOA 4L68A 4X2NA 4DH8A 4M97A 3ORXA 2IVVA 5JT2A 2VWVA 3RK5A 1KOAA 1NXKA 3QHWA 5DGZA 4V04A 4ZJJA 4R7HA 3AMBA 4DG3E 2V0DA 2KTYA 2ERKA 4JQ8A 2YWPA 2B7AA 4EC9A 5IU2A 5IUGA 3OD6X 1UVRA 3THBA 2OW3A 2YABA 2WZJA 2EWAA 1FGKA 2QOOA 2H9VA 4U8ZA 2OGVA 4IB1A 4OTIA 3ANRA 2F7XE 3HA8A 4LUDA 4MD9E 4AA4A 3RGFA 3BQCA 3VAPA 3CGOA 3ZO2A 2BROA 2GQSA 1XO2B 5IQCA 4CKJA 4C34A 3BLHA 3NAYA 4FI1A 4H1JA 4K33A 3PVBA 3RPRA 5BVDA 3Q04A 2XJ1A 2BAQA 1XR1A 4AA0A 3AQVA 4DG2E 1L8TA 3WF9A 1REJA 2J0IA 3E87A 3TNIA 3HECA 2C0TA 2VWUA 4LGGA 4M7IA 2HELA 5FBNC 1OKYA 3MVLA 4JBPA 4TYIA 4BGQA 5TO8A 2OH0E 4ID7A 2XK3A 4QP3A 4GH2A 2VNYA 5C26A 4FNXA 3R21A 3RBWA 4BRXA 5AIRA 3ZSIA 3PVWA 4MQ2A 4GYIA 1OITA 2VWYA 3WOWA 2PUUA 2PVFA 3AMAA 1R0EA 1J1BA 3COMA 4J7BA 1OBGA 4KIPA 4RC2A 1RE8A 3WZKA 2OF4A 3HYHA 2EU9A 4R7IA 4FICA 3RALA 4L43A 4WA9A 3ROCA 4BF2A 3MY0A 4EK5A 1J7IA 3OBGA 5CU3A 4P90A 4QRCA 5M4FA 2JC6A 1H1SA 5C01A 5C8KA 2AC5A 4J95A 2JBOA 2QKRA 4NM5A 5ANDA 3RTPA 4DH7A 2W1ZA 4G2FA 5CF6A 4F1TA 1WBPA 1V0PA 3Q53A 3KXZA 5AR2A 5IQGA 2GS6A 4BDCA 4CZYB 3Q3BA 2YIYA 4UWBA 2ONLA 4V0GA 4ZEGA 3WE4A 1GIHA 3H0ZA 3R63A 4PTEA 4RQKA 4JT3A 3MS9A 3B8QA 2OK1A 4L3LA 2WEIA 5CYIA 4XG2A 4AP7A 4CFVA 5IDPA 3TDWA 4Q9SA 2WB8A 4LL5A 4CYJA 3DBDA 3QKMA 4YPDA 1FOTA 5IA2A 4AU8A 3C9WA 5HTBA 1XH9A 5HVJA 5HCZA 2YLFA 2REIA 3E8NA 1XKKA 3NNXA 3NYVA 4GK2A 4AW2A 1GJOA 3ZEPA 4USFA 4RX5A 3PJCA 4HPUE 5KMMA 2OLCA 4FEWA 3GB2A 4RWKA 4KIQA 4OBOA 1YWRA 4UMPA 1BL7A 5I4NA 1ZXEA 4TNBA 4FKRA 2ZMDA 3CGFA 1VYZA 5DR6A 5EOLA 1SVEA 4CLJA 4RA5A 4PX6A 5EG3A 2CLXA 4PTCA 4CCBA 1LEZA 4DEIA 2YCRA 5AV3A 5HE3A 2X1NA 3W32A 5D41A 3QWKA 3QL8A 2Y6OA 5J87A 5LWNA 3E7VA 3FHIA 4O7ZA 3EB0A 2E9NA 5C27A 2C69A 4D1SA 2GDOA 3QU0A 2CDZA 2HXLA 5E91A 3BYSA 3P7CA 2W05A 4QMXA 4U45A 2OJ9A 4UWYA 4ENYA 4YUQA 1U46A 4G5JA 5EW3A 3BGZA 4A9UA 4LYNA 1OL1A 4G16A 1G8SA 2XH5A 1LEWA 4U3ZA 3BCEA 4Y95A 3BEGA 3LM0A 2FYSA 3FMMA 3G0EA 5HKMA 3G9LX 4GIIA 4I5MA 1Y8YA 4G6OA 4GL9A 4F99A 4G5PA 4AE9A 4C57A 2BCJA 1NW1A 1U59A 2E2BA 4EQMA 1F3MC 4LOOA 3RAIA 5JKGA 1Y91A 2BDFA 3GC9A 2VUWA 3I0QA 3OUKA 4YZBA 2J51A 4E7WA 1PMNA 1WAKA 3F9NA 4LV5A 4BDHA 4IFGA 4L01A 4DGOA 4IWQA 4TRLA 3LLAA 3OWPA 4QD6A 2B9FA 3BIZA 3E62A 4RC3A 4I5CA 4GK4A 4BDAA 2VTJA 3IPHA 4FT0A 1WMKA 3TACA 1TQIA 5BUJA 1JVPP 4FGRA 4FV7A 1PXNA 2CGWA 3QBNA 4B9DA 3LQ3A 4BZDA 4CD0A 2PZRA 3SDJA 3MN3A 5M4CA 3CLYA 3WF7A 2PVKA 4Y85A 1H27A 4H3PA 4D4SA 3BLQA 5J9YA 2WO6A 2XP2A 4I21A 3E7OA 5EW8A 2QO7A 1XH4A 4EJNA 1OECA 2QO2A 3PXFA 3K3IA 4N57A 4ASZA 5TR6A 1PKDA 4AFJA 4KSQA 4ZSAA 2J0LA 2BHHA 1GZOA 3UZTA 4CLIA 1XWSA 3OXIA 5IDNA 3VS4A 3QRTA 4EOLA 2ACXA 4YLKA 1J7LA 3HL7A 3GFWA 5FD2A 3DFAA 3EN4A 1PW2A 4MKCA 4S2ZA 5C03A 3KK8A 2FSLX 4KB8A 3SOAA 3NNWA 5M08A 3C13A 4NTTA 4TYHA 4JBOA 4QMWA 5L8JA 3QZGA 4ERKA 3R1SA 2ZB1A 3OBJA 2PMLX 4M3QA 4MWHA 5JRSA 3F3ZA 3L8PA 3CTQA 4IXPA 4W8DA 1NVRA 3KRXA 3O2MA 4APPA 2PU8A 2JDTA 3JUHA 3K5VA 3E8EA 2CLQA 3PIZA 5EDQA 2R7BA 4C62A 3AOXA 2Q83A 5GIOE 2EUFB 5IG1A 4NUSA 1F5QA 2BHEA 4YC8A 4AT3A 1SZMA 4B4LA 2G01A 2PUIA 4QPAA 4BDDA 3QCQA 4JDJA 5C8MA 4D2TA 2VWWA 5AIKA 1QMZA 1W8CA 3V8SA 3CQWA 2YJRA 2QKWB 1G3NA 4IH8A 3EZVA 5KE0A 4ZTMA 3G15A 4MF1A 4YJOA 3RCJA 3ZLXA 3PG3A 3DZQA 2C6DA 5FBOA 3NYNA 1PXKA 4ZXTA 3RAKA 3A8WA 2J0KA 3AT3A 3SLSA 5HTCA 2UV2A 3NUUA 3RWQA 2JFMA 5E7RA 1FPUA 4XG9A 3ZYAA 4XRLA 3TL8A 2QR8A 4IWDA 3ROYA 5JGDA 4NM0A 3GU4A 1QPDA 4I24A 3NS9A 3DXNA 4E5AX 4GS6A 3FJQE 1VJYA 1YDTE 4ACDA 5A46A 4E4LA 4M66A 4D0XA 4BCKA 4LUEA 4ALWA 1OUKA 2C3LA 4JAIA 5E9EA 4EKKA 5LMKA 1SM2A 1RDQE 3DB6A 3OTVA 2CKOA 1U54A 4C36A 1P4OA 5IQEA 3E3PA 2GTNA 4BTMA 3MW1A 4OAVB 4A4XA 5IMXA 1FBNA 4MF0A 3HVCA 3S4QA 2C6TA 4YHTA 1L3RE 1XH5A 3R0TA 5CSVA 4HVIA 2AYPA 4FA2A 2BDJA 2WU6A 4GJ2A 1XHAA 4J8MA 4C4GA 2XA4A 4ZOGA 4D1XA 4O7NA 1BUHA 4DEGA 3OWJA 1B6CB 4FNZA 5IEXA 3HUBA 3M2WA 3R00A 4PL4A 5DWRA 4PDYA 4IM0A 3NUSA 1HCKA 4JLCA 5CS6A 4AGUA 1M2RA 5K3YA 3W8QA 2ZM1A 2X7GA 3CP9A 4WNOA 4FV4A 2XNBA 3EN9A 4J71A 5IEVA 5J79A 3KL8A 4GSBA 3SRVA 4X3FC 1URCA 4UV0A 3R02A 4DT9A 2OSCA 3U9NA 4E8AA 4FEUA 2OH4A 4QMPA 3OHTA 4OT5A 5JK3A 2W99B 4NYEA 3R30A 4YTHA 4O82A 3TUBA 2QLUA 5F4NA 4BIEA 1MUOA 3MJ2A 4H3QA 3ID6C 4IZ5A 3AC5A 3HNGA 3N4TA 5LXMA 4LL0A 3DZOA 1IEPA 5KMOA 2QOBA 3PP0A 2C5XA 3UMWA 5E8WA 1Y57A 3VUGA 5FEEA 4GVAA 4RIWA 3W33A 3MSSA 3UTOA 1SYKA 4FTUA 4MCVA 4EK4A 2GCDA 3PLSA 4N0SA 2ZV2A 4WBBB 5AUWA 2IW8A 4WKQA 3RZFA 4IZ7A 1BYGA 4OTRA 4BIDA 4FTMA 3SOCA 1JNKA 4CNHA 5BYYA 3OOGA 3IOPA 5KX8A 1JPAA 3GNIB 5KHXA 3CEKA 3R01A 4LM5A 3Q52A 4RBLA 4HZRA 2WAJA 1KE8A 5I5ZA 4JDKA 3OVVA 5L2WA 5LMBA 4I1ZA 1HCLA 2R5TA 4G1WA 2Z7RA 5AUTA 5ITAA 3HEGA 2HWOA 1W98A 4NWMA 3CIKA 3BE2A 3PTGA 5BMMA 2BRHA 3SKCA 4ACGA 4CCUA 2WQMA 2I0HA 3IW4A 3DJ6A 2YIWA 3PA3A 2FSOX 4IJ9A 3ZLSA 3H30A 4BHNA 2WIHA 1WZYA 4CT1A 2RFNA 3FLZA 1R1WA 5FEQA 4J1RA 1OGUA 5FXSA 4WRGA 5CEIA 5EDPA 4E6CA 2VZ6A 4EEVA 1CM8A 2JIVA 3UIXA 1PKGA 4YBKA 5LWMA 5CU4A 4DEBA 2OFUA 4EI4A 4ITIA 2OJJA 1QPCA 3ODYX 3DK3A 1WBWA 4Q2AA 5FTOA 2BZHB 3L9LA 2W1IA 4UEUA 4YNOA 5M53A 3GI3A 1YXTA 3CD8A 3MY5A 4AA5A 3WIGA 4PMSA 3R9OA 5HZNA 2XJ0A 1H00A 3QD0A 3QUEA 3TIZA 3BX5A 3TWJA 5KMJA 2GNFA 2CNVA 5FLFA 4AQCA 4K8AA 2X9EA 4DE4A 2HZ0A 4GK3A 4KAOA 1IAHA 2WNTA 4Z16A 4CFWA 2CCIA 4K77A 4XOZA 5JRQA 5BQ0A 4FKIA 3FY2A 4IVDA 1RW8A 2PE0A 2YM7A 2LGCA 4K1BA 4O7WA 3FZOA 3DK6A 4RC4A 4RJ7A 4G9CA 4LGHA 1RQQA 4I0TA 3DXPA 4BKZA 4XV9A 4BCQA 4X7QA 4DAWA 1ZOGA 2BRBA 5B2LA 4CFMA 2FA2A 5K5NA 4BDJA 1GOLA 4EYMA 3RCDA 2JGZA 5M55A 3ORZA 2J5FA 2PVNA 4E6AA 4TKSA 1NVQA 1XBBA 2OXYA 3LCKA 4YO4A 2XMYA 1YWVA 2BZKB 2VX3A 4FKSA 3C5UA 2X8IA 2B53A 3KXMA 5AV2A 1WVYA 1YKRA 3PG1A 2W1GA 3QYZA 1H1WA 4FKPA 5GNKA 1OIUA 3OMVA 3MJ1A 4RX9A 2W7XA 3Q96A 2H34A 3DBQA 4ZMEA 5G1XA 5GZ8A 4O21A 3S2PA 5HORA 4IDVA 3WILA 4ERWA 1APME 4HCVA 3ZC6A 4J8NA 1Z9XA 1ZYLA 3A62A 4GT5A 4O0WA 3ZRLA 1V1KA 4GKHA 3VUKA 1BI7A 2QONA 4FMQA 3F5XA 3V51A 3CS9A 3R8LA 3W2SA 4FVPA 3KA0A 4BCMA 4FKQA 3GC7A 4JDHA 4O38A 5AP7A 4MXXA 3UPXA 3NYOA 5AR5A 4DFNA 3RINA 2P2HA 4CMUA 2QOHA 5L4QA 3TKHA 5BNJA 3A7HA 3C4ZA 2X39A 4RT7A 4AOIA 4CZUA 5KZIA 1JQHA 2YM4A 4RZVA 4C7TA 1YXSA 3Q9ZA 2W1EA 3N9XA 4MNFA 2R3QA 2W9FB 3ZO3A 4O7LA 4GVJA 3PFQA 4DTAA 2VTPA 4OGRA 4R8QA 4GCJA 3A61A 2LAVA 5CNOA 4K18A 4ZLOA 4BB4A 2RF9A 5KUPA 3KULA 4YBJA 1FVTA 3PY3A 3ZUUA 2C5VA 5HI2A 3SXFA 2J4ZA 1MRUA 4NFNA 5IA1A 3P86A 1W7HA 2DWBA 3ALOA 3MIAA 2YDIA 3PSDA 4XX9A 3W2QA 5HG9A 3VS6A 5F94A 2PY3A 5A4QA 1YDSE 5EM7A 5E92A 5GIPE 3B8RA 5IISA 1SNUA 4DITA 5GZ9A 1YHSA 4U80A 3V8TA 3GFEA 1DAWA 5AX9A 1YQJA 2B54A 4MXZA 2A2AA 4L3JA 1YI6A 4P7EA 1CDKA 3OZ6A 5FDXA 1A9UA 5L6WL 3ZO1A 5HTIA 3P23A 5FWKK 4TYEA 2WU7A 3VF9A 5JH6A 3R83A 2PE1A 4WHZA 4C3RA 3ORLA 1FQ1B 1UNHA 3PA4A 5EI6A 4QMVA 2X4FA 4DH5A 2W1HA 3MBLA 3WYYA 3TTIA 2CNQA 2VV9A 3MFRA 3D5XA 2JAMA 4BKJA 4FL1A 3Q2MA 4F9YA 2XNGA 4KNBA 3HV4A 4G9RA 2I7QA 2AC3A 4FTCA 5BVKA 4FZAB 4LGDA 3Q60A 4FOCA 4JRVA 1GNGA 5LVOA 3SG8A 3MFUA 3JY9A 3I1AA 3BBWA 3DOGA 3OOMA 2P55A 4IW0A 2C4GA 3GVUA 4RSSA 5ANGA 1A48A 2Q0BA 3VS2A 4G3GA 3SXRA 5H8EA 2ZM3A 2FSTX 2UW7A 2VO6A 4GV1A 4FC0A 3MWUA 3ZFXA 2OI4X 2QQ7A 3V5JA 4DYMA 1R3CA 3ET7A 4L42A 2BFXA 3QCXA 2X0GA 3NUYA 2IVSA 1JWHA 4GG5A 1MQ4A 3DU8A 2R3OA 5M4UA 4RVMA 4QP7A 4V01A 4C58A 4Y5QA 2QC6A 5HLNA 4TWOA 4UN0C 2EXCX 2YZAA 3DBFA 3WF6A 2C3IB 4O27B 1YXXA 3POOA 1H1RA 4NSTA 4XHKB 4AGWA 3NW7A 3SAYA 4YLJA 3KREA 4HGLA 4LRMA 5CAQA 2YLEA 3EMGA 3LQ8A 2WMRA 2XCHA 3DBEA 2ZDUA 4QNAA 4FZ6A 1PJKA 1SMHA 4ZSEA 4PQNA 3VUMA 4RGJA 2JFLA 2WFYA 4RFMA 2J7TA 4YJNA 3QA0A 4Z9LA 4F7NA 5L8LA 3UNZA 1H24A 5HO8A 3UOJA 3G6GA 2NPQA 3I79A 3IGOA 4TTHB 2R3PA 5KBQA 1Y6AA 3DV3A 2G15A 4QNYA 4QQ5A 4ZJIA 3UO5A 3R73A 5HEZA 1OVEA 5ANIA 3QTIA 1H08A 2XF0A 5TF9A 3BYVA 3OEFX 3QAME 4OBQA 3VS0A 3FI4A 1PF8A 2BVAA 4EBVA 5HQ0A 4HVGA 3DQWA 4LOPA 4RIYB 1VYWA 2PPQA 1YHVA 5GINE 3MTFA 4PDPA 4WOVA 4F70A 5AP2A 2WTWA 5AV4A 4U7ZA 5HNGA 4JQEA 5JQ5A 2UZOA 2CNUA 3M1SA 3MIYA 5AP3A 5TOZA 5HVKA 5FDPA 3F7ZA 4YNEA 4FTNA 1OPLA 2JAVA 3LM5A 5BPYA 1RJBA 3LJ2A 5AMNA 1DI9A 1OPJA 3R7UA 3LAUA 4GW8A 3D94A 4FZ7A 4YP8A 5CI6A 5HLPA 4C61A 4EORA 4YU2A 3FWQA 3R6XA 4FV1A 5DVRA 3TDVA 3EKKA 3KVXA 3NLBA 3FKNA 2ITPA 1NT2A 4QMMA 2UUEA 3AC3A 4O1OA 2PVLA 3Q6UA 3HZTA 3PA5A 1W83A 2HWPA 2W0JA 4QMSA 3O8PA 4I4FA 3ZBFA 2YM6A 4FKVA 4FSNA 5LQFA 5IQDA 3FI2A 3ZEWA 4FV8A 2OF2A 4DFZE 5EM8A 2VTHA 2OJIA 5HCXA 5IUIA 5CX9A 4WRSA 3GGFA 4Y73A 2VTIA 4L9IA 4RIXB 4WIHA 3NIEA 4Y83A 5JZJA 4MBJA 4GFGA 4CGAA 2VWIA 4F6UA 2R0IA 3DLSA 3REPA 3DA6A 3FKOA 3GCSA 5ANOA 5DR9A 3ZBXA 5TE0A 3D7TA 4EH3A 2RKUA 3ZM9A 1E9HA 2R3HA 1Q8TA 5A6OA 3G90X 4FIHA 3F69A 3S0OA 3NRMA 4OTQA 3WBLA 3C51A 4O1PA 2A4LA 3FV8A 1QCFA 5A3XA 2PUPA 1R39A 3PXKA 4YR8A 4I6QA 5HIDA 3JYAA 3Q9XA 2B55A 4IX3A 1ZMWA 3LPBA 4JL9A 2F57A 2GMXA 4RJ5A 5AP5A 5DRBA 5CVHA 4XLIA 3UO4A 5L2TA 5DYJA 4QP6A 3L1SA 4X2GA 5EI8A 5CT0A 4C4IA 1JAMA 4AN9A 2F49A 2WOTA 4QP2A 4CZTA 3RK7A 4O0VA 4ZK5A 4U40A 3ZLWA 4QMQA 2VN9A 4W4YA 3IW7A 2BIYA 3BGQA 3DS6A 3RVGA 4OTHA 4PUZA 2PUNA 4FEXA 1LUFA 1OKZA 1FMKA 3U4WA 5AAFA 4A9SA 4Q5HA 5CEMA 2Y4IC 4IM3A 4EC8A 3ZC5A 3U54A 4R3CA 4AXAA 1YI3A 2ITWA 4KINA 2XNEA 4MYGA 4FSUA 3DFCB 3TNHA 4EHGA 3VWAA 4BDGA 4NJDA 3LZBA 4EJ7A 3FAAA 5FP6A 4C4HA 2CKPA 2WMUA 5KZ0A 1DAYA 1GIIA 2JDVA 3W18A 5AUYA 1IRKA 2H6DA 2A19B 4O2PA 3RP9A 3MV5A 4A9RA 5IA4A 4O81A 4XV3A 4CT2A 2QU6A 1YOJA 4NKAA 4PTGA 4W4WA 4FT9A 2VWZA 2WMBA 4YJRA 5DOSA 2I40A 2O2UA 1PXIA 2W06A 3EQIA 4UXLA 4ALUA 4EH6A 3C0IA 1S9IA 1XJDA 4F09A 5KMIA 2YWVA 4YMJA 4IACA 5BVNA 3TCPA 4YURA 4X2FA 1JKTA 4UZHA 3W16A 2PWLA 4BCPA 2Z02A 1BMKA 3O17A 2VTOA 3WZUA 5IQHA 4ANMA 2VTLA 4U97A 1R0PA 2QNJA 2ITTA 3DNDA 3F5UA 4L7FA 3ZOSA 4EQUA 5DBXA 3BI6A 3R1YA 4YZMA 3QQKA 5GJFA 5HOAA 3UGCA 2GNJA 4KKEA 4PMMA 5DPVA 4C3FA 2X2MA 3PPKA 4MTAA 4JDIA 4ZTQA 5LMKC 1QL6A 1ZMUA 2B1PA 2EXEA 3IOKA 3H0YA 5L2SA 4K11A 4AZVA 3P4KA 2BPMA 3KFAA 5DI1A 5E8VA 5FGKA 3LCSA 4E5BA 3LFQA 3VN9A 1WBNA 1ZAOA 3ERKA 5IF1A 4I3ZA 2UW5A 4D2PA 5CAVA 4DCAA 4O96A 4XEYA 4A06A 3DAEA 3MPAA 2NO3A 1ZY5A 1ZWSA 2E9VA 5J1VA 1XH7A 2W5AA 3JVRA 4FK6A 5CXHA 4KIKA 4M84A 3PSCA 2IO6A 5DE2A 1WVWA 2YAKA 1MP8A 4PY1A 3TXOA 3NDMA 2XCKA 4XV1A 5H9BA 4B6LA 4FG9A 5IA5A 2NRUA 3NVKI 2BRGA 3EQDA 4BN1A 4RFYA 5E4HA 4NTSA 3VW6A 2XZSA 3CSVA 4YHJA 1B38A 4V05A 3I6UA 3SD0A 2C1AA 3EFWA 1Q61A 2C6IA 2UZEA 3QZFA 5HBJA 4I23A 1Y6BA 3E93A 3O50A 4ZTNA 4ZY4A 3LKMA 2WQEA 4XBUA 4U5JA 5K0KA 2G9XA 3PPJA 4UB7A 4FE2A 4MHAA 3F88A 4NZWB 2WTIA 4QTCA 2XIKA 2XEYA 4FBXA 1JKKA 2ZVAA 5I9XA 3FQHA 2WMXA 2PZPA 5J1WA 4ZLYA 1UNGA 2WTVA 3O96A 3V5QA 3QYWA 4M12A 5JGBA 1REKA 4HNIA 4IZYA 2WTKC 4MD8E 1OL7A 3R9RA 3PWDA 4TWNA 4BCFA 2QR7A 1ND4A 3PDTA 2FH9A 4ACMA 4EH5A 4DCEA 3W55A 4TNDA 2JKOA 3HAMA 4O7RA 3D14A 4BBMA 3R9DA 2E9OA 3TG1A 2FO0A 4PF4A 3PSBA 5DEWA 4W4VA 3VS1A 4F1MA 4I41A 5JGAA 4BCIA 1PMUA 3FPQA 5AUUA 4EBWA 4XV2A 2QLQA 3ZRKA 3A7IA 4IB0A 5HU9A 5A4CA 3PXZA 4OTFA 2ZM4A 4BI2A 3TUCA 2VD5A 3OTUA 4Z55A 5A14A 3FZTA 3R7IA 3QD3A 4EOKA 2HENA 4AG8A 2ZV9A 5ETFA 1JBPE 3G6HA 4U9AA 3R7OA 4F7JA 3ORIA 3OY1A 4HGEA 2QODA 3FSKA 3E64A 4FR4A 2O0UA 1W84A 5ACKA 4MBLA 3G9NA 3COHA 4W4XA 3OUNB 3QTXA 3MESA 3TV7A 3AD6A 4QMUA 4S33A 4U44A 5C1QB 4BVUA 2JD5A 3RK9A 5AWMA 3I5ZA 3GCVA 5LVLA 5M07A 3R8ZA 4U43A 4FYOA 5J9LA 4BCNA 2R7IA 4BICA 5E1EA 2C5NA 4QQCA 3PJ2A 3V5WA 4CMTA 3D15A 4PPAA 2O8YA 4R1YA 1XH8A 2GU8A 3LXLA 3UQGA 3P79A 4RJ6A 4FKUA 3PRIA 5E8YA 3DBCA 5EI2A 4M13A 4BI0A 3MH1A 4ZIMA 4DHFA 4MX9A 1YRPA 4GT3A 5CASA 3TI1A 4IFCA 5CF8A 3FUPA 2ZMCA 4TT7A 4IAYA 3LXKA 3OC1A 3QKKA 4O0SA 4BYJA 1VEBA 3ZCLA 2Z2WA 4M69A 4XYFA 2QHNA 4FT7A 5CNNA 5CQUA 4HZSA 5CANA 1U5RA 4B0GA 2IW9A 3SVVA 3GCPA 3WF5A 4E4NA 3PUPA 4JR3A 4OTWA 4IX6A 4BFMA 3HAVA 1JSVA 4IB3A 4YLLA 4HJOA 2F7EE 3F6XA 2YN8A 4QYEA 1KV2A 2Z7QA 4HW7A 2YEXA 3ELJA 4FSMA 4M68A 5JMSA 4LFIA 1Q5KA 3V8WA 5KKRB 3ODZX 5A6NA 3GU6A 3KK9A 1BKXA 4FV3A 4Y46A 5FRIA 4N4SA 1Z5MA 3ZZEA 5GJDA 1U4DA 4BY9E 3QUDA 3JPVA 3OW3A 4JG6A 1DM2A 3MI9A 3UNJA 2GNLA 1JKSA 3K2LA 1WFCA 5CEOA 4H39A 3ORMA 4LRJA 4DFXE 2W4KA 4IWPA 3KQ7A 5HBEA 4ZTRA 3PP1A 4G6NA 3A99A 1BI8A 3UYSA 4PPCA 3SW7A 4D5KA 2UW8A 3NMUF 3E8DA 2OICA 4FOBA 4F7SA 3ZLYA 3WZDA 3O71A 5GHVA 4RRVA 4PRJA 4X2KA 5FXQA 4AWIA 4QTEA 3OEZA 1I44A 3UVRA 3NYXA 5B2MA 4WNMA 3QD4A 5DIAA 1ZYDA 2XBAA 3PVUA 3BU6A 3NCGA 3ZUVA 4RVLA 2UW6A 2XKDA 4YSMA 1WCCA 5T68A 4YJTA 4BBEA 4E5WA 3GP0A 5HU3A 4N70A 3FEGA 3PZEA 3UG2A 4IAFA 4F1OA 3ZM4A 4AOTA 4KRDA 3E63A 3ALNA 3ATTA 3CCNA 2VAGA 5E8ZA 3C0GA 4DN5A 2GQGA 3BU5A 2B4SB 4S34A 2XEZA 5ETIA 3LFCA 3CQEA 2NP8A 2XIZA 3NR9A 4FKWA 4KS7A 2JKMA 3RZBA 5AEPA 4O0RA 2O5KA 4R7BA 3ACKA 2KULA 2X8DA 4ANQA 4I92A 4QO9A 3QTQA 3TNQB 2HCKA 5AUXA 2PL0A 2G1TA 3HV3A 4IZAA 3OW4A 1Q8ZA 3GOPA 4WT6A 1SNXA 4HGTA 5D10A 5EDRA 3RNYA 1M2QA 4AF3A 3COKA 2C0OA 4R1VA 2WD1A 3TZ8A 1H01A 3ZONA 1IAJA 3M11A 3VRYA 3BYUA 3M42A 2VO3A 1LP4A 5T6KA 3FZRA 4KRCA 3RPYA 3UOLA 3DKCA 4AZWA 2GPHA 4YJPA 3UIUA 5ACBC 3JY0A 3KN6A 2R0UA 2P3GX 3EQHA 3PJ3A 4G3EA 1IG1A 2GHLA 3LMIA 4C2WA 3HDMA 4TZRA 2B9HA 3ZFYA 2ETKA 5B0XA 2YA9A 1P2AA 3FMNA 2UZBA 3O23A 4HVSA 5LCJA 4FKGA 2PE2A 4KKHA 4CMOA 3UC4A 5L8KA 2RL5A 3VS7A 3PIXA 3FQSA 4ALVA 1IR3A 3ZXTA 1FVVA 3OXZA 4JQ7A 3SA0A 2ITZA 3WF8A 3OG7A 3U9CA 4D5HA 2WMSA 3EKNA 3KU2A 2CGVA 3D5WA 3MVHA 4L6QA 4GIHA 1BL6A 4IHPA 2V55A 4FTJA 4QP8A 1H25A 1O6YA 2GNGA 3CPBA 3K3JA 4FV2A 4FEVA 3UG1A 1NA7A 4XBRA 2UZWE 3ETAA 5JN2A 4GEOA 4CRSA 3HV6A 5BYZA 4AZFA 3DK7A 3SRVB 5AA9A 5M51A 4IC7A 2HOGA 3FLSA 4IAIA 3RHKA 3IK3A 2VNWA 2CKQA 5EOBA 1I09A 2XK9A 3D7ZA 2F2CB 3W2PA 2XVDA 2WTCA 3S95A 4L67A 3C0HA 3FLYA 3KRJA 4QMZA 4ASEA 3PJ8A 3P7BA 4FKTA 3VW8A 1NVSA 2I0EA 3GEQA 5CAOA 5C4KA 4FV5A 1Q8UA 1UA2A 4N6YA 3LXPA 3IW8A 1GZNA 3CC6A 3DGKA 4CFNA 4KUJA 2R3FA 2WQOA 2X6EA 3RPSA 4F4PA 3COIA 3U6IA 4JIKA 2XKFA 3QCYA 4YTFA 4Z7HA 5L6OA 5FQDC 2GFSA 3U4UA 4NIFA 3NUNA 3HA6A 3HP2A 4RIWB 1TKIA 2R3JA 3TJCA 2C5YA 3P7AA 4WG4A 4E20A 3MH0A 3IO7A 3N4VA 1ERKA 2B9IA 4L3PA 4UXQA 4BGGA 4R6VA 3VIDA 2Y9QA 4A4OA 1YW2A 2GS7A 4NK9A 4WUAA 2HY81 1B39A 2YJSA 4XG3A 1OIYA 3CKXA 4FTKA 3VRZA 4EOPA 3DAKA 5HO7A 1W82A 4YZDA 2QO9A 3GC0A 3LFEA 3T8OA 2RIOA 3U87A 1KE9A 4DEAA 4FNWA 5CT7A 2R3NA 4RJ3A 3R7EA 5HD4A 4H05A 1YDRE 3QLFA 4O7YA 4DT8A 1OI9A 1ZYCA 3IDBA 3BHVA 4YC6A 4C3PA 3AC8A 4FSQA 4XMOA 4EH9A 2FGIA 3ORTA 5LVMA 1PHKA 3E5AA 4DBXA 2C3JA 5AP6A 2RFEA 3F3TA 4IAAA 5EHYA 3UQCA 4O0XA 4A07A 5K4JA 4UX9A 4EYJA 4DEDA 3VJOA 4WO5A 2OXXA 3RPOA 3VS3A 4AN2A 2BZJA 2UVYA 3R2YA 4X6RA 5M4IA 3EL7A 1WBOA 4FIEA 5DNRA 5CU2A 4IVBA 5AM6A 2WMQA 3VVHA 2XNOA 5AP0A 2OXDA 4BL1A 4F9AA 3MPTA 3MB7A 3PLAE 1E1XA 2DS1A 3F66A 3HP5A 4M8TA 5CENA 2BALA 4EONA 4C02A 4EOIA 1UKIA 4DTBA 4IC8A 4A7CA 2VO0A 5I3RA 3FKLA 3ZH8A 4B8MA 3QXOA 2WEVA 2R3GA 1YI4A 3EH9A 2O65A 4GYGA 3FYKX 3D83A 3QQFA 2Y6MA 3F3UA 3WIKA 1OKVA 1WBVA 3KXNA 1Q41A 1QPEA 5J8IA 3ENMA 2YDKA 2JBPA 3BELA 3GXLA 1M7QA 4KBCA 3HMMA 3UC3A 4F0GA 2A1AB 1U5QA 3KRLA 4O84A 4PDSA 4XG8A 5CSXA 4KBAA 2G2IA 4FTIA 4JOAA 4MK0A 5IMEA 2C47A 2YM5A 4QYYA 2J0MB 4D9TA 2YAAA 4ASDA 1M2PA 5AM7A 3FC1X 4EOQA 2WQBA 3O7LD 3UZPA 2Z8CA 2UZUE 2XIXA 3LCDA 5AR7A 4ANSA 1PRYA 5BVWA 2GNHA 5D11A 1ZMVA 3VF8A 5A4LA 2YDJA 3E88A 2F9GA 4NKSA 2IZRA 4WSYA 4DBNA 4K6ZA 4TPTA 1OM1A 3MFTA 4MWIA 1GIJA 5CZIA 3DJ7A 4F08A 3WE8A 3LCOA 4JBQA 3PZHA 1ZY4A 4O0TA 2OIBA 4OUCA 4M15A 4YJQA 2UVXA 5GJGA 5HG7A 4X0MA 3UVQA 1T45A 4D2WA 2YCFA 2ZDTA 1KV1A 3GENA 3NCZA 4D1ZA 3EJ1A 3IGGA 4FT5A 3FBVA 4U6RA 1F0QA 4EK3A 3R1QA 2F2UA 3V5LA 4FSYA 3FMHA 2UW0A 2BFYA 3BYOA 4FL2A 3QUPA 4X21A 4F9CA 4FG8A 4UMRA 5CY3A 1KSWA 3G33A 4LMNA 1PMVA 5J9ZA 1TVOA 1WVXA 4FVQA 2GFCA 2Y4PA 3ZHPC 2QOQA 2GQRA 1XQZA 4CRLA 4DTKA 4LMUA 4ZS0A 2W1FA 4FSZA 4EK6A 3DDQA 5DT0A 4RLKA 3TV6A 3C5IA 4HPTE 4CV9A 1P4FA 2W17A 3RM7A 3GQLA 3QTUA 2C6LA 1YWNA 2VTTA 4KKGA 4RIOA 3WZEA 4CXAA 4XLVA 1CKIA 5EHLA 2GNIA 2IVTA 4B99A 3VC4A 1GY3A 3TT0A 3KXXA 2WMWA 4ZY5A 4OW8A 1OZ1A 2ITQA 3OWKA 4M0YA 4HVDA 2XNMA 3FPMA 4KIOA 1URWA 4TL0A 2YM8A 3KULB 2C3KA 4WBOA 4DLIA 3I7CA 5B2KA 5BX0A 5IH6A 4BC6A 4H58A 2OJFE 2PZ5A 4IIRA 4P2KA 5CF4A 3A7JA 3EQCA 2OIQA 4C35A 3L9MA 2QHMA 5FG8A 3A60A 3O51A 3VQUA 2C6OA 1YVJA 4C4JA 5KMLA 2X9FA 4FIIA 5EFQA 3ZDIA 3B2TA 1SVGA 2QG5A 2X81A 3LFBA 2XRWA 2IVUA 5IA3A 4W9XA 3R8MA 4QOXA 1Q99A 3TIYA 3CPCA 2R3IA 4K9YA 2QOKA 4EOOA 2ITOA 4G6LA 3Q9YA 2RSVA 3S00A 3IW6A 5D12A 2XK8A 5FM2A 5HG5A 3V6RA 1JLUE 4QYGA 3VBTA 3PWYA 2R9SA 3ZMMA 3QRIA 3C4WA 3DXQA 3Q4UA 5A4EA 4RJ8A 4RG0A 5HE2A 3KEXA 5ANKA 4AUAA 3GCQA 1CSNA 4AW1A 3ENHA 3D2KA 3HRCA 2B0QA 4GKIA 4L46A 2WELA 1YXVA 3R22A 3TN8A 3O8UA 4ZSGA 4ZTHA 4PMPA 4X3FB 4Y72A 3QALE 3BRBA 1H26A 2IN6A 2WKMA 3ANQA 3IECA 5LOHA 1H1QA 5B7VA 1OIQA 3KF7A 4E6DA 3R8VA 3FE3A 3PXQA 4IBMA 2UZTA 4AZEA 4F6WA 2PULA 2QCSA 2CKEA 4G3CA 2G2HA 2PTKA 4RIYA 1PXJA 5CWZA 3OWLA 4JIAA 4XP0A 5F95A 4HOKA 3V5PA 4MXOA 3R9NA 5L6PA 3O0GA 4XP2A 4D0WA 4YZ9A 2C6KA 5KCVA 4ZS4A 4FSWA 5CXZA 3ATSA 3IKAA 4L8MA 4BTFA 4YTCA 5M57A 3SXSA 5TKDA 2UW9A 2WIPA 3DY7A 4ZZOA 4FKLA 4NL0A 5E1SA 5LJJA 4FTTA 3Q5ZA 4L44A 2E9UA 5E8UA 2B52A 3FZ1A 3G5DA 5F9EA 5K9IA 3QC4A 1MQBA 5DN3A 5I9WA 2OIDA 4CG8A 4NM7A 4Q9ZA 2YFXA 4D2VA 5KMKA 4YJUA 4JNWA 5AP1A 2Z7LA 4OLIA 3EIDA 2ZAZA 3L8SA 4FNYA 4ENXA 4MNEA 3PE1A 4BDEA 3AC2A 3NEWA 3R7YA 3O7LB 4ARKA 4DG0E 5HCYA 3W1FA 3H4JA 4DC2A 3UPZA 3PXYA 3OP5A 2FVDA 3TEIA 3OCBA 4BCOA 2PVYA 1OL2A 5AR3A 3OT3A 1H28A 3D2IA 4XCUA 2YCSA 3Q9WA 3I6WA 5LVPA 1GZ8A 4MXYA 5F20A 4BDKA 5CSHA 3C4FA 5FUTA 2PZIA 3VS5A 5J95A 5DT3A 3D5UA 3NZ0A 3ULZA 1PMEA 4MVFA 4G34A 4R5YA 3VUTA 4BGHA 4F9BA 4D2SA 4R3PA 3LE6A 5EM6A 5DMZA 4KS8A 3H9FA 4TYJA 4B7TA 3OS3A 5KBRA 2BIKB 2X7FA 2XJ2A 3UBDA 3D5VA 4M67A 3T9IA 4BHZA 4C8BA 3AT2A 3BEAA 3II5A 3QFVA 2V22A 5EYCA 4ANNA 3A4OX 2PMOX 3HRFA 4C33A 5I9YA 5KKRC 3R28A 2VGOA 4BYIA 2Y7JA 3AGMA 3NIZA 3F5GA 1O6LA 4RLLA 3E92A 4FSTA 3ZDUA 5C9CA 3RNIA 2YM3A 4C0TA 4CQEA 2ZOQA 1R78A 3FL4A 1M17A 4FKJA 5IH5A 4GMYA 2UZDA 3HLLA 3QLGA 5LMAA 4EOJA 3BZ3A 3CD3A 4IVAA 3PPZA 3NPCA 3WARA 4O0UA 3AC4A 3DDPA 3LVPA 2BTRA 2YIXA 3EQPA 1A06A 2BZIB 4DGGA 2OJGA 5DFPA 4U41A 4PV0A 2XIRA 4QT1A 3A7GA 2VWBA 3P5KA 4XG4A 3N51A 2PK9A 4JBVA 4QQTA 4OTGA 4LQMA 1MRVA 4CFFA 5IQAA 3KCFA 4QPSA 2A27A 3HMOA 3BE9A 4MAOA 3FZPA 2BRNA 3MH2A 2JDSA 5C4LA 4MXAA 4YHFA 4XRJA 4JS8A 4TWPA 4AS0A 4APCA 4MEDA 4II5A 1JSUA 2PZYA 2GS2A 2P0CA 3NWWA 3LOKA 3PRFA 5AJQA 4E73A 1K2PA 4C2VA 5G6VA 4CVAA 2BRMA 3VNTA 3QXPA 2JKKA 1Q8YA 2OZAB 3S1HA 3C1XA 3VBXA 3UQFA 4FIFA 3C4XA 4BIBA 5CAUA 4X3JA 3ZU7A 3RWPA 4RA4A 2BKZA 3NUXA 2BILB 4BZOA 4EZ5A 4YPSA 3G2FA 4D55A 2XNPA 3DQXA 1NY3A 4XS2A 3U8WA 4LG4A 3QCSA 2OFVA 4X6QC 1YOLA 3LMHA 4PNIA 1J3HA 2PVRA 3QX2A 3TKUA 4AAAA 2VRXA 5M44A 4XNEA 4F0IA 2PYWA 4IM2A 3QQJA 4G17A 4JI9A 3R8UA 4QP9A 4CSVA 3UIBA 5CEPA 3GQIA 3OCGA 4U3YA 1FGIA 4PL3A 5IQBA 3EFKA 5E8TA 3LW0A 2V7AA 2BMCA 4NW6A 4EZ7A 1XBCA 1TQPA 3L8VA 3T9TA 3CXWA 2YHVA 1O9UA 4D4VA 3I5NA 3PY0A 2W96B 4GJ3A 3DKGA 4WG3A 3NGAA 3ZXZA 1VZOA 4JX7A 4EOMA 5HLWA 3NUAA 2C68A 3FMDA 5EHOA 3HUCA 4J53A 5AR4A 4EK8A 1M52A 2XNNA 3EZRA 3EQBA 3FMLA 3ZRMA 4L53A 5HVYA 3ZS5A 4PWNA 4AACA 3OT8A 4UBAA 2QOLA 4UY9A 5EK7A 2YERA 1UU3A 3QTZA 4PL5A 3VULA 3JR1A 4EKLA 2WGJA 2CPKE 4F65A 1WBTA 4GUEA 4Z3VA 2XYNA 4F6SA 3TZ7A 3EYGA 3NAXA 3FLNC 4IAKA 2X4ZA 3E8CA 3QRUA 4AX8A 5L2QA 5ICPA 5AR8A 4RVKA 5M06A 2O3PA 3PYYA 5FM3A 4TN6A 1FINA 4DFLA 4QTBA 2WHBA 4DLJA 1Q3DA 4KIKB 4QPMA 5IQIA 1UU7A 3GU8A 3IG7A 5CU0A 3TM0A 1BX6A 4PMTA 3FI3A 3PE2A 3NW5A 2RFDA 4YZCA 5CQWA 1G5SA 4XG7A 1KE7A 5KO1A 3NVMB 3GU5A 4V0GB 4AT5A 2XRUA 3T3UA 3TJDA 4BWKA 5JFWA 2EB3A 3Q4CA 3BV2A 3EN7A 4BKYA 4TW9A 4ZZNA 2PVHA 2YACA 4DFYA 1J91A 2IJMA 4I6HA 2C30A 3VQHA 2ITYA 3UO6A 5IZFA 4CEGA 4ITHA 1UV5A 3F3VA 3TKIA 4DEHA 2PSQA 2ITUA 4FT3A 5HO6A 5HX6A 5HICA 2H96A 2XYUA 5HD7A 4C37A 1OMWA 4ZSJA 3AD5A 3W8LA 1GAGA 3IDCA 5JFXA 5ETCA 5EM5A 3MFSA 4JVGA 1ZZLA 2VTQA 3EL8A 3MVMA 4HGSA 1H07A 2XB7A 4U42A 4BCHA 5T3QA 2UZLA 2IPXA 4J52A 3R8PA 4EQCA 5AAEA 2QU5A 2DYLA 5HIBA 4U79A 4ZLZA 3FC2A 4I5PA 4F64A 3KC3A 3FQEA 4NCTC 4PPBA 1SVHA 3QZHA 5D7AA 2V7OA 3P0MA 4HYUA 2W5BA 3TZ9A 4CKIA 3ZUTA 3FMKA 4QP1A 5DRDA 4NM3A 4I6FA 4C4FA 2J6MA 2QOFA 3TV4A 2IZSA 5DLSA 4I0SA 4KD1A 2B9JA 3BU3A 2XS0A 2ITNA 1IA8A 4CG9A 4C4EA 4J96A 3KRRA 3MVJA 3QGWA 3OY3A 3EN5A 4E6QA 1M14A 4CTCA 4BCJA 4R5SA 2NNWB 3ZSGA 3FMJA 3TTJA 3F2AA 3KXGA 4IAZA 4IDTA 5LCKA 3VUHA 4I94A 4KBKA 3FZSA 4S30A 3L9PA 5AP4A 3W2RA 4GU6A 3U6JA 1Z57A 1Q97A 4D2RA 4JRNA 3ACJA 5A4TA 5CSPA 4HNFA 4L45A 2JDRA 5IPJA 4ZY6A 4ZMFA 3DB8A 4D4YA 5CEKA 3F2RA 4MXCA 4DF3A 2OU7A 5BYLA 4IEBA 2RFSA 5EH0A 5KMNA 3I60A 1AD5A 4BDFA 4IANA 2WMTA 3P1AA 1XH6A 2QD9A 5H2UA 5FXRA 2PVJA 4XG6A 4W9WA 1OL6A 4FZDB 4QMYA 4NJ3A 4FV0A 2QI8A 2R3LA 2BKKA 4LRKA 1PXMA 3JXWA 4HYIA 4BTJA 4ANOA 3LLTA 4U81A 1X8BA 3IDPA 3FY0A 4AGCA 2J50A 4DH1A 4M69B 3C7QA 4KABA 4IQ6A 2CGXA 4FTLA 4J98A 3HX4A 5DT4A 2HZIA 5J5SA 4FYNA 4XOYA 4EHVA 2W1CA 4FL3A 4IVCA 3F2NA 2EB2A 3H3CA 3RI1A 4YSJA 4Y5HA 2I0VA 4OBPA 5CLPA 2J90A 3SV0A 1BLXA 1KUTA 1QPJA 3KB7A 2FSMX 3RAHA 4TYHB 2WMVA 3UJGA 4E93A 3D0EA 1UNLA 4DGMA 2CMWA 4UZDA 3DKOA 3MDYA 3U51A 5EKNA 2ITVA 4DFUA 1MRYA 3R9HA 5CSWA 2VU3A 5EQEA 4R78A 2O63A 1Q4LA 4IMYA 1UKHA 3NSZA 4CV8A 1K3AA 2Y4IB 3FXXA 3EOCA 5L2IA 2F7ZE 4FTOA 2QURA 3LFNA 2VTAA 4FV9A 3GUBA 5HNBA 4O7VA 5D9HA 3QX4A 4AW0A 5IKWA 3V04A 2VO7A 3PY1A 2PMNX 4JR7A 3Q4ZA 3ORNA 4I6BA 4AZSA 3AMYA 4F0FA 5JQ8A 3U6HA 2X8EA 2RG5A 3FHRA 3AG9A 4NH1A 4CFUA 4O6EA 3KMUA 3QQHA 4EUTA 2JEDA 4EHEA 3QTSA 5J7HA 3FMEA 2HZ4A 3QHRA 3W2CA 3CE3A 4RWJA 2GTMA 1YHWA 4M0ZA 5HHWA 4FGBA 5AUVA 1S9JA 3A4PA 4QMLA 3H9RA 4B8LA 4J97A 3UYTA 5E8XA 5BVFA 3OXTA 4F9WA 4L52A 3UVPA 3VHKA 2V5QA 3AGLA 4EH8A 4AW5A 2VTMA 5EYKA 4MD7E 3HGKA 4EH7A 4ONAA 4FX3A 2BAJA 2HXQA 2X2LA 3KMMA 5TT7A 3TNWA 4BI1A 3N4UA 3OF0A 4O7TA 3V5TA 4IX5A 3EN6A 4DH3A 2FUMA 4I20A 2W9ZB 5JSMA 2YZLA 4EOSA 4EH4A 2ZJWA 1U54B 1Q3WA 4UMQA 4G3DA 2VTNA 4A4LA 3RAWA 4FV6A 2X7OA 3IS5A 2WQNA 1PXOA 3QF9A 2VGPA 3OROA 4JXFA 4E4XA 4TXCA 4XH6A 3L8XA 1AQ1A 2OO8X 4UYAA 1KWPA 4DFBA 3RPVA 4JAJA 4UWCA 5KHWA 1STCE 2IZTA 3NW6A 4TWCA 3HV7A 2JIUA 3EQFA 4IADA 3CJGA 2P2IA 4ANBA 1P14A 3IQ7A 5AADA 3UMXA 4DA5A 1OB3A 1JOWB 3BKBA 4RMZA 4ZZMA 3LMGA 5HESA 3H9OA 3FSFA 2HW6A 1XBAA 3BWJA 3GCUA 3TUDA 3L9NA 4GUBA 4FTQA 3BGPA 2WMAA 3MY1A 3VBWA 4NEUA 2ZV8A 2IWIA 4RWIA 5CU6A 4ZTSA 3Q6WA 4RWLA 4JG7A 5M56A 4EZ3A 3ZZWA 2UZNA 1UU8A 3FL5A 5EKOA 3LXNA 3PIYA 5JFVA 5CAPA 2BDWA 2R2PA 5CZHA 3QZIA 2XKCA 4GT4A 3VUIA 4PP7A 3AD4A 1YOMA 2XK6A 4JG8A 3TZMA 3UODA 5I9ZA 3GC8A 5AA8A 5K5XA 2QOIA 3LFFA 2JDOA 5DEYA 3SC1A 2WTKB 3BYMA 3UE4A 3DPKA 2WPAA 2OWBA 3PXRA 4DGLC 4P5ZA 3ULIA 3QWJA 4C59A 4FTRA 4ZTLA 3BHTA 5A54A 3QQLA 2YITA 3KVWA 4UYNA 3MGYA 4YO6A 1K9AA 2C5OA 4NCTA 3EHAA 3Q2JA 1UWJA 3MYGA 5HGIA 4X2JA 2ETMA 1FMOE 1W0XC 2HK5A 4FG7A 4MH7A 4N6ZA 5DA3A 5EYDA 3KN5A 3SX9A 5E8SA 4TY1A 4CKRA 2QG7A 3LFAA 4E26A 4ORKA 3DAJA 3E3BX 3C50A 1H8FA 3PVGA 3WZJA 5LVNA 5BVOA 2Y0AA 2BR1A 2DQ7X 3VHEA 4R77A 5FTGA 3EFJA 4FTAA 3R7VA 4PNKA 4AZTA 3MB6A 2CN8A 5HBHA 1ZRZA 4NIFB 4BTKA 5HIEA 3G0FA 3QRKA 4UMTA 3LJ1A 4QMTA 1WBSA 3P78A 4Y8DA 2C6EA 4QQJA 5CEQA 5DG5A 3ZSHA 3NUPA 3K5UA 2OG8A 2Z7SA 4NW5A 3D9VA 2JIIA 2YISA 3CTJA 3QGYA 4QP4A 3CQUA 3EYHA 2FB8A 4FVRA 1IASA 4I93A 4GFMA 5BVEA 3QTWA 2G2FA 3GU7A 3MA6A 4ANLA 5IUHA 4J99A 1Q62A 4WNPA 3ZO4A 3AC1A 4MBIA 4XUFA 5ANJA 4E4MA 5HNIX 3Q32A 4KSPA 1LPUA 3B2WA 3DTWA 4USDA 2WOUA 3DLZA 3I81A 5DR2A 3TNPC 3S3IA 3BHUA 4IE9A 3GT8A 3BWFA 3LIJA 1HOWA 2XIYA 3RM6A 1YXUA 5HX8A 3GOKA 3HMPA 4FIJA 2ESMA 4O7SA 2OBJA 5FP5A 3FXWA 4BZNA 4JJRA 3G51A 3F5PA 3BV3A 5H3QA 4P4CA 4UMUA 2WXVA 4CFXA 4OT6A 4TYGA 4HYSA 3NX8A 3HRBA 4YZNA 1TQMA 3OFMA 4RX8A 3QD2B 1PXPA 2VWXA 4ITJA 5AFVA 4D28A 2HY0A 3CTHA 3RJCA 4AT4A 4PP9A
chains in the Genus database with same CATH superfamily
3UP7A 3RHXA 5HG8A 3VO3A 1OPKA 5H8GA 3SW4A 3H10A 1ZARA 3CKWA 2J9MA 3UIMA 4HCUA 1Q8WA 3KMWA 1ZLTA 4Z7GA 1M7NA 4WUNA 5CTPA 4EL9A 3NNUA 4O0YA 4RX7A 1V0OA 3QTRA 4FUYA 1PXLA 2HIWA 1OKWA 3DTCA 5K0XA 3EWHA 5HE0A 5IA0A 1KOBA 3SQQA 2CHLA 3F82A 4AGDA 4QYFA 4BBFA 3F3WA 2O64A 4NFMA 2QVSE 4HCTA 3VBQA 2ZB0A 3KCKA 3QKLA 2ZYBA 5JEBA 5CVGA 4DINA 2CCHA 2OKRA 4O6LA 5JZNA 2JLDA 4YGAA 1AGWA 2NRYA 1Q24A 3HMIA 2EVAA 2V62A 4BJJB 3CBLA 3P9JA 1JSTA 3FLWA 3GBZA 3Q4TA 4Q5EA 4RQVA 2HZNA 2ETRA 4D4RA 2Y8OA 2IZUA 3V3VA 2AUHA 3R04A 2BUJA 3SHEA 5IQFA 4CTBA 5EW9A 2PMIA 3QRJA 4BR3A 1CTPE 4O2ZA 5EYMA 1H1PA 2R3KA 3I4BA 4XJ0A 4U0IA 3LHJA 3QA8A 3UOHA 2HYYA 3A2CA 4WNKA 5DH3A 2GHGA 5KNJA 1CMKE 3SG9A 3RKBA 4RFZA 5ETAA 4WD5A 5GZAA 3DNEA 4USEA 4JX3A 5DHJA 3RMFA 1PYEA 1O6KA 3KKVA 3I7BA 3A7FA 5J7BA 3KY2A 4L7SA 3PJ1A 3W0OA 1DI8A 1ZOEA 4LI5A 4ZAUA 1J7UA 5E90A 2C6MA 3KF4A 4RPVA 1PY5A 1PYXA 2OZOA 3V6SA 4ACHA 3JVSA 4D9UA 2W4JA 2P4IA 2W1DA 3DKFA 4HYHA 4RZWA 3P08A 4LOQA 2UW4A 1VR2A 4IJPA 4EHZA 1EH4A 4F7LA 4O91A 5AX3A 2CGUA 4X3FA 4PDOA 5AUZA 1KE5A 3ORPA 4HVHA 3D4QA 5I0BA 4OTDA 3C4CA 3DJ5A 2X2KA 2XUUA 1ZYJA 1V0BA 3CJFA 4DGNA 2A0CX 2VTRA 5L3AA 2J0JA 4CYIA 2VX1A 4EUUA 4EH2A 5BUEA 4WSQA 4IWOA 3VJNA 4YC3A 2I0YA 2IG7A 5CVFA 5AV0A 3MPMA 4D58A 2HAKA 2ONLC 4FIGA 5I9UA 4ZSLA 3BHHA 1OIRA 1ATPE 2R4BA 3BBTB 2J5EA 1OGYA 3FYJX 4A9YA 5IH4A 1IA9A 3ORKA 4O86A 3W10A 3A8XA 5I3OA 2VX0A 5F1ZA 2WTJA 2CN5A 2Z60A 4MQ1A 3UDBA 2C1BA 2I1MA 2PVMA 2YIRA 2E9PA 2W5HA 4KA3A 1CKPA 2XK4A 5BMSA 2ZFYA 4BDIA 3UZRA 3W0MA 4ACCA 1H4LA 2VTSA 4G3FA 3EQGA 3R7GA 4FUXA 2Q0NA 4LV8A 4FSRA 1KE6A 2SRCA 3OCSA 3UP2A 3HKOA 3V01A 3EQRA 5IEYA 5CF5A 3OCTA 3UDSA 3EFLA 2PHKA 2UZVA 4KWPA 2ERZE 4WG5A 3LJ0A 4EWQA 4G31A 4YJSA 3CY3A 3R2BA 3Q5IA 2JKQA 1DS5A 4S32A 2RG6A 3LQ5A 4NU1A 1ZOHA 3QQGA 4R3RA 4YJVA 4NT4A 3FDNA 5EQYA 2XM8A 5EQPA 1T46A 3IONA 4E1ZA 1P5EA 4K2RA 4QTAA 4EWHA 3R1NA 3ZTXA 5A9UA 4RJ4A 4RVTA 4E3CA 4AOJA 5H8BA 1UU9A 2GHMA 5K4IA 3SGCA 3CR0A 3QC9A 3AXWA 1G8KA 4K0YA 4RIXA 4GFOA 4XP3A 1ZZ2A 2CJMA 5CALA 4I0RA 2BAKA 4S31A 3AT4A 2C0IA 3BPRA 3F7WA 1Y8GA 5C8NA 3JS2A 2GSFA 3DT1A 3KRWA 4FODA 5D7VA 3VUDA 4DEEA 4JMQA 3W0QA 3U55A 2X6DA 3ITZA 4OR5A 4AE6A 4BCGA 3BLRA 4UALA 3ZFMA 2ITXA 1OL5A 4IX4A 1ZYSA 3IW5A 3FXZA 4FF8A 4F63A 4H36A 2J2IB 2BTSA 3HMNA 4OTPA 3T3VA 3FI8A 3KGAA 2R3RA 1E1VA 3QQUA 2XK7A 3FLQA 4MNEB 2RGPA 4QMOA 3I0OA 1OUYA 3O8TA 1OBDA 4I4EA 4ZP5A 5JFSA 2WTDA 2UW3A 2UVZA 4BDBA 2H8HA 5BUIA 3HDNA 5FTQA 4OAUC 3LFDA 2YCQA 5CI7A 4AN3A 4I5HA 1UWHA 3WYXA 2R3MA 1H0WA 3BHYA 4ZJVA 3UOKA 3MTLA 4H1MA 1CKJA 4GU9A 4C38A 2HW7A 3MH3A 4QMNA 3LCTA 3MA3A 3HV5A 1JKLA 3CY2A 3WI6A 4A9TA 4BWXA 5HE1A 4QYHA 2P33A 4L00A 5FEDA 1G8AA 2ZV7A 3LFSA 1J1CA 2XBJA 3VBYA 4H3BA 4GRBA 1W2FA 4AFEA 4QTDA 1GZKA 2NYAA 2R64A 3D7TB 4CQGA 4BWPA 3F61A 5J5TA 4FEQA 3K54A 5LARA 3C4EA 5I9VA 2XM9A 4W8EA 5AAGA 2I6LA 4P5QA 2IW6A 4ASXA 4I22A 3VBVA 5AV1A 4IB5A 1LR4A 2W4OA 2CSNA 2XKEA 4O22A 5ANEA 2QOCA 2XAMA 4FZFB 3UNKA 2F4JA 1H0VA 2JITA 3POZA 3R71A 3BQRA 4M14A 3NNVA 3W2OA 2DUVA 4FK3A 3KXHA 2YIQA 4YTIA 4O83A 5M09A 1FVRA 3DCVA 4GG7A 3W0NA 2OZAA 2EXMA 5D1JA 4FKOA 4L68A 4X2NA 4DH8A 4M97A 3ORXA 2IVVA 5JT2A 2VWVA 3RK5A 1KOAA 1NXKA 3QHWA 5DGZA 4V04A 4ZJJA 4R7HA 3AMBA 4DG3E 2V0DA 2KTYA 2ERKA 4JQ8A 4QDVA 2YWPA 2B7AA 4EC9A 5IU2A 5IUGA 3OD6X 1UVRA 3THBA 2OW3A 2YABA 2WZJA 4MUQA 2EWAA 1FGKA 2QOOA 2H9VA 4U8ZA 2OGVA 4IB1A 4OTIA 3ANRA 2F7XE 3HA8A 4LUDA 4MD9E 4AA4A 3RGFA 3BQCA 3VAPA 3CGOA 3ZO2A 2BROA 2GQSA 1XO2B 5IQCA 4CKJA 4C34A 3BLHA 3NAYA 4FI1A 4H1JA 4K33A 3PVBA 3RPRA 5BVDA 3Q04A 2XJ1A 2BAQA 1XR1A 4AA0A 4AXDA 3AQVA 4DG2E 1L8TA 3WF9A 1REJA 2J0IA 3E87A 3TNIA 3HECA 2C0TA 2VWUA 4LGGA 4M7IA 2HELA 5FBNC 1OKYA 3MVLA 4JBPA 4TYIA 4BGQA 5TO8A 2OH0E 4ID7A 2XK3A 4QP3A 4GH2A 2VNYA 5C26A 4FNXA 3R21A 3RBWA 4BRXA 5AIRA 3ZSIA 3PVWA 4MQ2A 4GYIA 1OITA 2VWYA 3WOWA 3AMAA 2PUUA 2PVFA 1R0EA 1J1BA 3COMA 4J7BA 1OBGA 4KIPA 4O4CA 4RC2A 1RE8A 3WZKA 2OF4A 3HYHA 2EU9A 4R7IA 4FICA 3RALA 4L43A 4WA9A 3ROCA 4BF2A 3MY0A 4EK5A 1J7IA 3OBGA 5CU3A 4P90A 4QRCA 5M4FA 2JC6A 1H1SA 5C01A 5C8KA 2AC5A 4J95A 2JBOA 2QKRA 4NM5A 5ANDA 3RTPA 4DH7A 2W1ZA 4G2FA 5CF6A 4F1TA 1WBPA 1V0PA 3Q53A 3KXZA 5AR2A 5IQGA 2GS6A 4BDCA 4CZYB 3Q3BA 2YIYA 4UWBA 2ONLA 4V0GA 4ZEGA 3WE4A 1GIHA 3H0ZA 3R63A 4PTEA 4RQKA 4JT3A 3MS9A 3B8QA 2OK1A 4L3LA 2WEIA 5CYIA 4XG2A 4AP7A 4CFVA 5IDPA 3TDWA 4Q9SA 2WB8A 4LL5A 4CYJA 3DBDA 3QKMA 4YPDA 1FOTA 5IA2A 4AU8A 3C9WA 5HTBA 1XH9A 5HVJA 5HCZA 2YLFA 2REIA 3E8NA 1XKKA 3NNXA 3NYVA 4GK2A 4AW2A 1GJOA 3ZEPA 4USFA 4RX5A 3PJCA 4HPUE 5KMMA 2OLCA 4FEWA 3GB2A 4RWKA 4KIQA 4OBOA 1YWRA 4UMPA 1BL7A 5I4NA 1ZXEA 4TNBA 4FKRA 2ZMDA 3CGFA 1VYZA 5DR6A 5EOLA 1SVEA 4CLJA 4RA5A 4PX6A 5EG3A 2CLXA 4PTCA 4CCBA 1LEZA 4DEIA 2YCRA 5AV3A 5HE3A 2X1NA 3W32A 5D41A 3QWKA 3QL8A 2Y6OA 5J87A 5LWNA 3E7VA 3FHIA 4O7ZA 3EB0A 2E9NA 5C27A 2C69A 4D1SA 2GDOA 3QU0A 2CDZA 2HXLA 5E91A 3BYSA 3P7CA 2W05A 4QMXA 4U45A 2OJ9A 4UWYA 4ENYA 4YUQA 1U46A 4G5JA 5EW3A 3BGZA 4A9UA 4LYNA 4AXEA 1OL1A 4G16A 1G8SA 2XH5A 1LEWA 4U3ZA 3BCEA 4Y95A 3BEGA 3LM0A 2FYSA 3FMMA 3G0EA 5HKMA 3G9LX 4GIIA 4I5MA 1Y8YA 4G6OA 4GL9A 4F99A 4G5PA 4AE9A 4C57A 2BCJA 1NW1A 1U59A 2E2BA 4EQMA 1F3MC 4LOOA 3RAIA 5JKGA 1Y91A 2BDFA 3GC9A 2VUWA 3I0QA 3OUKA 4YZBA 2J51A 4E7WA 1PMNA 1WAKA 3F9NA 4LV5A 4O4FA 4BDHA 4IFGA 4L01A 4DGOA 4IWQA 4TRLA 3LLAA 3OWPA 4QD6A 2B9FA 3BIZA 3E62A 4RC3A 4I5CA 4GK4A 4BDAA 2VTJA 3IPHA 4FT0A 1WMKA 3TACA 1TQIA 5BUJA 1JVPP 4FGRA 4FV7A 1PXNA 2CGWA 3QBNA 4B9DA 3LQ3A 4BZDA 4CD0A 2PZRA 3SDJA 3MN3A 5M4CA 3CLYA 3WF7A 2PVKA 4Y85A 1H27A 4H3PA 4D4SA 3BLQA 5J9YA 2WO6A 2XP2A 4I21A 3E7OA 5EW8A 1TZDA 1XH4A 2QO7A 4EJNA 1OECA 2QO2A 3PXFA 3K3IA 4N57A 4ASZA 5TR6A 1PKDA 4AFJA 4KSQA 4ZSAA 2J0LA 2BHHA 1GZOA 3UZTA 4CLIA 1XWSA 3OXIA 5IDNA 3VS4A 3QRTA 4EOLA 2ACXA 4YLKA 1J7LA 3HL7A 3GFWA 5FD2A 3DFAA 3EN4A 1PW2A 4MKCA 4S2ZA 5C03A 3KK8A 2FSLX 4KB8A 3SOAA 3NNWA 5M08A 3C13A 4NTTA 4TYHA 4JBOA 4QMWA 5L8JA 3QZGA 4ERKA 3R1SA 2ZB1A 3OBJA 2PMLX 4M3QA 4MWHA 2AQXA 5JRSA 3F3ZA 3L8PA 3CTQA 4IXPA 4W8DA 1NVRA 3KRXA 3O2MA 4APPA 2PU8A 2JDTA 3JUHA 3K5VA 3E8EA 2CLQA 3PIZA 5EDQA 2R7BA 4C62A 3AOXA 2Q83A 5GIOE 2EUFB 5IG1A 4NUSA 1F5QA 2BHEA 4YC8A 4AT3A 1SZMA 4B4LA 2G01A 2PUIA 4QPAA 4BDDA 3QCQA 4JDJA 5C8MA 4D2TA 4QDEA 2VWWA 5AIKA 1QMZA 1W8CA 3V8SA 3CQWA 2YJRA 2QKWB 1G3NA 4IH8A 3EZVA 5KE0A 4ZTMA 3G15A 4MF1A 4YJOA 3RCJA 3ZLXA 3PG3A 3DZQA 2C6DA 5FBOA 3NYNA 1PXKA 4ZXTA 3RAKA 3A8WA 2J0KA 3AT3A 3SLSA 5HTCA 2UV2A 3NUUA 3RWQA 2JFMA 5E7RA 1FPUA 4XG9A 3ZYAA 4XRLA 3TL8A 2QR8A 4IWDA 3ROYA 5JGDA 4NM0A 3GU4A 1QPDA 4I24A 3NS9A 3DXNA 4E5AX 4GS6A 3FJQE 1VJYA 1YDTE 4ACDA 5A46A 4E4LA 4M66A 4D0XA 4BCKA 4LUEA 4ALWA 1OUKA 2C3LA 4JAIA 5E9EA 4EKKA 5LMKA 1SM2A 1RDQE 3DB6A 3OTVA 2CKOA 1U54A 4C36A 1P4OA 5IQEA 3E3PA 2GTNA 4BTMA 3MW1A 4OAVB 4A4XA 5IMXA 1FBNA 4MF0A 3HVCA 3S4QA 4I6LA 2C6TA 4YHTA 1L3RE 1XH5A 3R0TA 5CSVA 4HVIA 2AYPA 4FA2A 2BDJA 2WU6A 4GJ2A 1XHAA 4J8MA 4C4GA 2XA4A 4ZOGA 4D1XA 4O7NA 1BUHA 4DEGA 3OWJA 1B6CB 4FNZA 5IEXA 3HUBA 3M2WA 3R00A 4PL4A 5DWRA 4PDYA 4IM0A 3NUSA 1HCKA 4JLCA 5CS6A 4AGUA 1M2RA 5K3YA 3W8QA 2ZM1A 2X7GA 3CP9A 4WNOA 4FV4A 2XNBA 3EN9A 4J71A 5IEVA 5J79A 3KL8A 4GSBA 3SRVA 4X3FC 1URCA 4UV0A 3R02A 4DT9A 2OSCA 3U9NA 4E8AA 4FEUA 2OH4A 4QMPA 3OHTA 4OT5A 5JK3A 2W99B 4NYEA 3R30A 4YTHA 4O82A 3TUBA 2QLUA 5F4NA 4BIEA 1MUOA 3MJ2A 4H3QA 3ID6C 4IZ5A 3AC5A 3HNGA 3N4TA 5LXMA 4LL0A 3DZOA 1IEPA 5KMOA 2QOBA 3PP0A 2C5XA 3UMWA 5E8WA 1Y57A 3VUGA 5FEEA 4GVAA 4RIWA 3W33A 3MSSA 3UTOA 1SYKA 4FTUA 4MCVA 4EK4A 2GCDA 1TFFA 3PLSA 4N0SA 2ZV2A 4WBBB 5AUWA 2IW8A 4WKQA 3RZFA 4IZ7A 1BYGA 4OTRA 4BIDA 4FTMA 3SOCA 1JNKA 4CNHA 5BYYA 3OOGA 3IOPA 5KX8A 1JPAA 3GNIB 5KHXA 3CEKA 3R01A 4LM5A 3Q52A 4RBLA 4HZRA 2WAJA 1KE8A 5I5ZA 4JDKA 3OVVA 5L2WA 5LMBA 4I1ZA 1HCLA 2R5TA 4G1WA 2Z7RA 5AUTA 5ITAA 3HEGA 2HWOA 1W98A 1W2DA 3CIKA 4NWMA 3BE2A 3PTGA 5BMMA 2BRHA 3SKCA 4ACGA 4CCUA 2WQMA 2I0HA 3IW4A 2IEWA 3DJ6A 2YIWA 3PA3A 2FSOX 4IJ9A 3ZLSA 3H30A 4BHNA 3AKLA 2WIHA 1WZYA 4CT1A 2RFNA 3FLZA 1R1WA 5FEQA 4J1RA 1OGUA 5FXSA 4WRGA 5CEIA 5EDPA 4E6CA 2VZ6A 4EEVA 1CM8A 2JIVA 3UIXA 1PKGA 4YBKA 5LWMA 5CU4A 4DEBA 2OFUA 4EI4A 4ITIA 2OJJA 1QPCA 3ODYX 3DK3A 1WBWA 4Q2AA 5FTOA 2BZHB 3L9LA 2W1IA 4UEUA 4YNOA 5M53A 3GI3A 1YXTA 3CD8A 3MY5A 4AA5A 3WIGA 4PMSA 3R9OA 5HZNA 2XJ0A 1H00A 3QD0A 3QUEA 3TIZA 3BX5A 3TWJA 5KMJA 2GNFA 2CNVA 5FLFA 4AQCA 4K8AA 2X9EA 4DE4A 2HZ0A 4GK3A 4KAOA 1IAHA 2WNTA 4Z16A 4CFWA 2CCIA 4K77A 4XOZA 5JRQA 5BQ0A 4FKIA 3FY2A 4IVDA 1RW8A 2PE0A 2YM7A 2LGCA 4K1BA 4O7WA 3FZOA 3DK6A 4RC4A 4RJ7A 4G9CA 4LGHA 1RQQA 4I0TA 3DXPA 4BKZA 4AAYA 4XV9A 4BCQA 4X7QA 4DAWA 1ZOGA 2BRBA 5B2LA 4CFMA 2FA2A 5K5NA 4BDJA 1GOLA 4EYMA 3RCDA 2JGZA 5M55A 3ORZA 2J5FA 2PVNA 4E6AA 4TKSA 2AEGA 1NVQA 1XBBA 2OXYA 3LCKA 4YO4A 2XMYA 1YWVA 2BZKB 2VX3A 4FKSA 3C5UA 2X8IA 2B53A 3KXMA 5AV2A 1WVYA 1YKRA 3PG1A 2W1GA 3QYZA 1H1WA 4FKPA 5GNKA 1OIUA 3OMVA 3MJ1A 4RX9A 2W7XA 3Q96A 2H34A 3DBQA 4ZMEA 5G1XA 5GZ8A 4O21A 3S2PA 5HORA 4IDVA 3WILA 4ERWA 1APME 4HCVA 3ZC6A 4J8NA 1Z9XA 1ZYLA 3A62A 4GT5A 4O0WA 3ZRLA 1V1KA 4GKHA 3VUKA 1BI7A 2QONA 4FMQA 3F5XA 3V51A 3CS9A 3VONA 3R8LA 3W2SA 4FVPA 3KA0A 4BCMA 4FKQA 3GC7A 4JDHA 4O38A 5AP7A 4MXXA 3UPXA 3NYOA 5AR5A 4DFNA 3RINA 2P2HA 4CMUA 2QOHA 5L4QA 3TKHA 5BNJA 3A7HA 3C4ZA 2X39A 4RT7A 4AOIA 4CZUA 5KZIA 1JQHA 2YM4A 4RZVA 4C7TA 1YXSA 3Q9ZA 2W1EA 3N9XA 4MNFA 2R3QA 2W9FB 3ZO3A 4O7LA 4GVJA 3PFQA 4DTAA 2VTPA 4OGRA 4R8QA 4GCJA 3A61A 2LAVA 5CNOA 4K18A 4ZLOA 4BB4A 2RF9A 5KUPA 3KULA 4YBJA 1FVTA 3PY3A 3ZUUA 2C5VA 5HI2A 3SXFA 2J4ZA 1MRUA 4NFNA 5IA1A 3P86A 1W7HA 2DWBA 3ALOA 3MIAA 2YDIA 3PSDA 4XX9A 3W2QA 5HG9A 3VS6A 5F94A 2PY3A 5A4QA 1YDSE 5EM7A 5E92A 5GIPE 3B8RA 5IISA 1SNUA 4DITA 5GZ9A 1YHSA 4U80A 3V8TA 3GFEA 1DAWA 5AX9A 1YQJA 2B54A 4MXZA 2A2AA 4L3JA 1YI6A 4P7EA 1CDKA 3OZ6A 5FDXA 1A9UA 5L6WL 3ZO1A 5HTIA 3P23A 5FWKK 4AXCA 4TYEA 2WU7A 3VF9A 5JH6A 3R83A 2PE1A 4WHZA 4C3RA 3ORLA 1FQ1B 1UNHA 3PA4A 5EI6A 4QMVA 2X4FA 4DH5A 2W1HA 3MBLA 3WYYA 3TTIA 2CNQA 2VV9A 3MFRA 3D5XA 2JAMA 4BKJA 4FL1A 3Q2MA 4F9YA 2XNGA 4KNBA 3HV4A 4G9RA 2I7QA 2AC3A 4FTCA 5BVKA 4FZAB 4LGDA 3Q60A 4FOCA 4JRVA 1GNGA 5LVOA 3SG8A 3MFUA 3JY9A 3I1AA 3BBWA 3DOGA 3OOMA 2P55A 4IW0A 2C4GA 3GVUA 4RSSA 5ANGA 1A48A 2Q0BA 3VS2A 4G3GA 3SXRA 5H8EA 2ZM3A 2FSTX 2UW7A 2VO6A 4GV1A 4FC0A 3MWUA 3ZFXA 2OI4X 2QQ7A 3V5JA 4DYMA 1R3CA 3ET7A 4L42A 2BFXA 3QCXA 2X0GA 3NUYA 2IVSA 1JWHA 4GG5A 1MQ4A 3DU8A 2R3OA 5M4UA 4RVMA 4QP7A 4V01A 4C58A 4Y5QA 2QC6A 5HLNA 4TWOA 4UN0C 2EXCX 2YZAA 3DBFA 3WF6A 2C3IB 4O27B 1YXXA 3POOA 1H1RA 4NSTA 4XHKB 4AGWA 3NW7A 3SAYA 4YLJA 3KREA 4HGLA 4LRMA 5CAQA 2YLEA 3EMGA 3LQ8A 2WMRA 2XCHA 3DBEA 2ZDUA 4QNAA 4FZ6A 1PJKA 1SMHA 4ZSEA 4PQNA 3VUMA 4RGJA 2JFLA 2WFYA 4RFMA 2J7TA 4YJNA 3QA0A 4Z9LA 4F7NA 5L8LA 3UNZA 1H24A 5HO8A 3UOJA 2A98A 3G6GA 2NPQA 3I79A 3IGOA 4TTHB 3KIOC 2R3PA 5KBQA 1Y6AA 3DV3A 2G15A 4QNYA 4QQ5A 4ZJIA 3UO5A 3R73A 5HEZA 1OVEA 5ANIA 3QTIA 1H08A 2XF0A 5TF9A 3BYVA 3OEFX 3QAME 4OBQA 3VS0A 3FI4A 1PF8A 2BVAA 4EBVA 5HQ0A 4HVGA 3DQWA 4LOPA 4RIYB 1VYWA 2PPQA 1YHVA 5GINE 3MTFA 4PDPA 4WOVA 4F70A 2XALA 5AP2A 2WTWA 5AV4A 4U7ZA 5HNGA 4JQEA 5JQ5A 2UZOA 2CNUA 3M1SA 3MIYA 5AP3A 5TOZA 5HVKA 5FDPA 3F7ZA 4YNEA 4FTNA 1OPLA 2JAVA 3LM5A 5BPYA 1RJBA 3LJ2A 5AMNA 1DI9A 1OPJA 3R7UA 3LAUA 4GW8A 3D94A 4FZ7A 4YP8A 5CI6A 5HLPA 4C61A 4EORA 4YU2A 3FWQA 3R6XA 4FV1A 5DVRA 3AKKA 3TDVA 3EKKA 3KVXA 3NLBA 3FKNA 2ITPA 1NT2A 4QMMA 2UUEA 3AC3A 4O1OA 2PVLA 3Q6UA 3HZTA 3PA5A 1W83A 2HWPA 2W0JA 4QMSA 3O8PA 4I4FA 3ZBFA 2YM6A 4FKVA 4FSNA 5LQFA 5IQDA 3FI2A 3ZEWA 4FV8A 2OF2A 4DFZE 5EM8A 2VTHA 2OJIA 5HCXA 5IUIA 5CX9A 4WRSA 3GGFA 4Y73A 2VTIA 4L9IA 4RIXB 4WIHA 3NIEA 4Y83A 5JZJA 4MBJA 4GFGA 4CGAA 2VWIA 4F6UA 2R0IA 3DLSA 3REPA 3DA6A 3FKOA 3GCSA 5ANOA 5DR9A 3ZBXA 5TE0A 3D7TA 4EH3A 2RKUA 3ZM9A 1E9HA 2R3HA 1Q8TA 5A6OA 1W2CA 3G90X 3F69A 4FIHA 3S0OA 3NRMA 4OTQA 3WBLA 3C51A 4O1PA 2A4LA 3FV8A 1QCFA 5A3XA 2PUPA 1R39A 3PXKA 4YR8A 4I6QA 5HIDA 3JYAA 3Q9XA 2B55A 4IX3A 4O4DA 1ZMWA 3LPBA 4JL9A 2F57A 2GMXA 4RJ5A 5AP5A 5DRBA 5CVHA 4XLIA 3UO4A 5L2TA 5DYJA 4DHIB 4QP6A 3L1SA 4X2GA 5EI8A 5CT0A 4C4IA 1JAMA 4AN9A 2F49A 2WOTA 4QP2A 4CZTA 3RK7A 4O0VA 4ZK5A 4U40A 3ZLWA 4QMQA 2VN9A 4W4YA 3IW7A 2BIYA 3BGQA 3DS6A 3RVGA 4OTHA 4PUZA 2PUNA 4FEXA 1LUFA 1OKZA 1FMKA 3U4WA 5AAFA 4A9SA 4Q5HA 5CEMA 2Y4IC 4IM3A 4EC8A 3ZC5A 3U54A 4R3CA 4AXAA 1YI3A 2ITWA 4KINA 2XNEA 4MYGA 4FSUA 3DFCB 3TNHA 4EHGA 3VWAA 4BDGA 4NJDA 3LZBA 4EJ7A 3FAAA 5FP6A 4C4HA 2CKPA 2WMUA 5KZ0A 1DAYA 1GIIA 2JDVA 3W18A 5AUYA 1IRKA 2H6DA 2A19B 4O2PA 3RP9A 3MV5A 4A9RA 5IA4A 4O81A 4XV3A 4CT2A 2QU6A 1YOJA 4NKAA 4PTGA 4W4WA 4FT9A 2VWZA 2WMBA 4YJRA 5DOSA 2I40A 2O2UA 1PXIA 2W06A 3EQIA 4UXLA 4ALUA 4EH6A 3C0IA 1S9IA 1XJDA 4F09A 5KMIA 2YWVA 4YMJA 4IACA 5BVNA 3TCPA 4YURA 4X2FA 1JKTA 4UZHA 3W16A 2PWLA 4BCPA 2Z02A 1BMKA 3O17A 2VTOA 3WZUA 5IQHA 4ANMA 2VTLA 4U97A 1R0PA 2QNJA 2ITTA 3DNDA 3F5UA 4L7FA 3ZOSA 4EQUA 5DBXA 3BI6A 3R1YA 4YZMA 3QQKA 5GJFA 5HOAA 3UGCA 2GNJA 4KKEA 4PMMA 5DPVA 4C3FA 3PUFC 2X2MA 3PPKA 4MTAA 4JDIA 4ZTQA 5LMKC 1QL6A 1ZMUA 2B1PA 2EXEA 3IOKA 3H0YA 3BL9A 5L2SA 4K11A 4AZVA 3P4KA 2BPMA 3KFAA 5DI1A 5E8VA 5FGKA 3LCSA 4E5BA 3LFQA 3VN9A 1WBNA 1ZAOA 3ERKA 5IF1A 4I3ZA 2UW5A 4D2PA 5CAVA 4DCAA 4O96A 4XEYA 4A06A 3DAEA 3MPAA 2NO3A 1ZY5A 1ZWSA 2E9VA 5J1VA 1XH7A 2W5AA 3JVRA 4FK6A 5CXHA 4KIKA 4M84A 3PSCA 2IO6A 5DE2A 1WVWA 2YAKA 1MP8A 4PY1A 3TXOA 3NDMA 2XCKA 4XV1A 5H9BA 4B6LA 4FG9A 5IA5A 3W0SA 2NRUA 3NVKI 2BRGA 3EQDA 4BN1A 4RFYA 5E4HA 4NTSA 3VW6A 2XZSA 3CSVA 4YHJA 1B38A 3ML1A 4V05A 3I6UA 3SD0A 1ST0A 2C1AA 3EFWA 1Q61A 2C6IA 2UZEA 3QZFA 5HBJA 4I23A 1Y6BA 3E93A 3O50A 4ZTNA 4ZY4A 3LKMA 2WQEA 4XBUA 4U5JA 5K0KA 2G9XA 3PPJA 4UB7A 4FE2A 4MHAA 3F88A 4NZWB 2WTIA 4QTCA 2XIKA 2XEYA 4FBXA 1JKKA 2ZVAA 5I9XA 3FQHA 2WMXA 2PZPA 5J1WA 4ZLYA 1UNGA 2WTVA 3O96A 3V5QA 3QYWA 4M12A 5JGBA 1REKA 4HNIA 4IZYA 2WTKC 4MD8E 1OL7A 3R9RA 3PWDA 4TWNA <