3DU8A

Crystal structure of gsk-3 beta in complex with nms-869553a
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
348
structure length
336
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogen synthase kinase-3 beta
publication title First Cdc7 kinase inhibitors: pyrrolopyridinones as potent and orally active antitumor agents. 2. Lead discovery.
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 336
sequence length 348
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3du8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3du8A01
5B2LA 3HX4A 4YZDA 5AV0A 1DS5A 2WMWA 4P90A 4D4VA 3QLFA 2EVAA 4WSYA 4AUAA 5L2IA 1Q8UA 4GSBA 2RKUA 2W1DA 5IMXA 3MA6A 2PZIA 5ANGA 3ZM4A 5J9YA 4J96A 4CD0A 4CKRA 4GK3A 2X1NA 3PVWA 2ZYBA 4O7VA 4I94A 3KXNA 3DS6A 4TYIA 2X2KA 2ESMA 2UV2A 4BDEA 4BCPA 1V0PA 3DKFA 3ALNA 4CV8A 2VZ6A 3R6XA 2HZ4A 2HZIA 4E5WA 1GIJA 4F9AA 4EHGA 5EKNA 1OL7A 1XBBA 4W8DA 4E6CA 3G33A 4O0SA 4C3RA 4Z16A 5J5TA 2WQOA 1WCCA 4WNMA 2QHNA 4GT4A 5LVLA 1M7QA 1JLUE 3KGAA 4JIKA 3OVVA 3TL8A 3QHWA 2WEVA 4YZCA 3BRBA 4DG0E 4GT5A 1JKSA 5K5NA 3KVWA 1ZLTA 4QTDA 4FKRA 3ACJA 3ZRMA 4I21A 4WO5A 3UO6A 3OFMA 3VHEA 3DQWA 1RW8A 5IH6A 3L8VA 4WNOA 3O71A 3W1FA 1YOLA 4E4MA 4BIEA 2ETRA 2R3QA 2UW7A 3NVKI 2UW4A 3AT3A 3FZ1A 4Y83A 2XK6A 2FVDA 2YCRA 2QI8A 3V6RA 2JFLA 3PPKA 3D7TA 2QNJA 1SVHA 1ZARA 4LM5A 4DFNA 5FG8A 4CVAA 5E8UA 4D2WA 4BGHA 4XV2A 4HZSA 5HIDA 4F7NA 5BUEA 5TKDA 2WTCA 5IA1A 5CVHA 3GU8A 2CDZA 4JX7A 4X0MA 1J7UA 3E92A 5GNKA 4I20A 4MQ2A 5IH4A 5CZHA 3HDMA 4EH6A 4RIXA 3JVSA 3CS9A 3PTGA 3SW4A 5AAEA 3PWDA 4KINA 4D58A 5JQ8A 3KKVA 4UALA 5K0KA 3Q9WA 5DYJA 3MH1A 3OT3A 2GTMA 4GFMA 2W1GA 3BELA 4FE2A 3O7LB 1OPJA 3QKMA 5EM6A 1PXLA 3PPJA 4FIGA 4JNWA 3RK9A 4EC8A 2E9PA 5AV2A 4OW8A 3VQHA 3ZDIA 4CQGA 4DTKA 2XBJA 3CJGA 1W0XC 4FSYA 2QD9A 3MN3A 3MY0A 1H1QA 5F94A 3LZBA 3FE3A 4MNFA 4Y5HA 4J71A 3B8QA 4FNZA 4QYHA 3P86A 5AUVA 2YIRA 3BEAA 3NIEA 1UKHA 1V0BA 4FIFA 4S32A 1PF8A 3PSCA 4KBAA 2VNYA 4FZ6A 5BVFA 5I5ZA 4CYIA 1P14A 4EONA 5BMSA 2G9XA 3R2YA 5AP5A 2VNWA 4M15A 4RGJA 3ZFMA 2W1CA 3MBLA 2GNLA 5FQDC 3S95A 1APME 2WMAA 5LCJA 4E5BA 4GG5A 4WG3A 4ZY4A 3AGLA 3NW7A 5I4NA 4XCUA 4C61A 3KFAA 5HD7A 4E4LA 3LLAA 5BYYA 3DT1A 3K54A 4EOJA 3COHA 4MWHA 3RNIA 4IDTA 5GHVA 4O7TA 2F7ZE 2QOOA 3DAKA 4EK4A 1H07A 4UYNA 1H1RA 2XK8A 5M4UA 3ORXA 1V0OA 3NLBA 4IJPA 4TXCA 1RE8A 4L52A 4TYGA 3AT4A 3MH3A 4BRXA 3QZIA 3NR9A 5FDXA 5A46A 5CU4A 4I23A 4DBXA 2BMCA 2FB8A 3C4XA 3FSFA 3WZEA 4FEVA 4FV3A 4KSPA 5TT7A 2EXEA 4DH1A 1DAWA 4CRLA 4ACHA 3ORPA 3PSBA 5KMMA 4ZSEA 4AW1A 3MY1A 2G1TA 2PVJA 3OXTA 5HHWA 4FSWA 4FTJA 3R7OA 4NW6A 3W2PA 3C4WA 5TOZA 5KNJA 4O7WA 3PZEA 1H4LA 4E5AX 2BHEA 2OFUA 3OTUA 4YJOA 1JSTA 2FO0A 1B6CB 1WZYA 3QUPA 2ETMA 1YOMA 4FEUA 4ITIA 4I3ZA 5HD4A 3JR1A 2WQMA 4AZTA 2Y7JA 4D1XA 2BDWA 4IQ6A 3QRIA 4O0XA 4AA4A 2P2IA 4EHVA 4J53A 5TE0A 1PMNA 3WBLA 4E3CA 3CIKA 1KOBA 4OTWA 3WF5A 4FA2A 4F1TA 4ORKA 3NZ0A 4YTCA 3D5WA 5DWRA 3GU6A 4N70A 5CU6A 1B38A 3FY0A 2C1AA 4AS0A 2BFYA 4PF4A 3I79A 3NUNA 3PRIA 4E26A 2WFYA 4YJNA 3DJ7A 3PJ3A 5F1ZA 2G01A 3BV3A 3ALOA 5EHLA 1PYEA 3Q9ZA 3R73A 3VC4A 2XK3A 3DQXA 2ZJWA 3OMVA 3PPZA 5CTPA 3BWFA 1YKRA 4E7WA 3FUPA 2JFMA 2QU6A 3I6WA 3Q4CA 4GJ3A 3KXZA 4MXXA 1P4OA 3EQRA 4NU1A 3T3VA 3BGPA 3K3JA 5G1XA 3NYOA 3ZONA 4W8EA 4YGAA 3R7UA 4BI2A 3WOWA 2BDFA 5AV1A 5EOBA 4FVRA 1WVYA 2QOKA 2P4IA 1WMKA 2IZUA 1GNGA 2QOBA 1Y57A 4O2PA 1ZYDA 5HORA 2YLFA 3G5DA 3PVBA 4R8QA 2J0IA 5HNGA 3RCJA 3OBJA 5J9LA 3NUAA 4TPTA 1R3CA 3UOKA 1QMZA 3OWKA 5FTOA 4MHAA 1A48A 4DGMA 3MPTA 3UVRA 1NXKA 3A2CA 4QP7A 3ZM9A 3IKAA 4OTHA 2J2IB 2J0JA 2O2UA 2IW8A 4XRLA 3U87A 3PDTA 2OKRA 3FV8A 4GIIA 4BI1A 4UMUA 4DBNA 3TJCA 3EN4A 4E6DA 4QYFA 1W84A 2OF2A 4RWLA 3HMPA 3LJ0A 4R5SA 4Q9SA 2YM5A 4BCNA 3G51A 5L6WL 3TN8A 5EYDA 5FRIA 1H27A 4AX8A 2QU5A 5AP0A 3ORKA 4OTFA 3JY9A 4IVAA 1ZMWA 2J50A 4CCBA 3G0EA 4P5ZA 4EH7A 4C2WA 5HBJA 4FKQA 1H08A 3LFBA 1YI4A 3MIYA 3DK7A 3UP2A 2E9OA 3DFCB 1CKPA 3GFWA 3R0TA 3E88A 3RPVA 2BZHB 1MUOA 1QPJA 2EWAA 3ORIA 2WMXA 2JBPA 4X21A 3MB6A 2GFCA 4UZHA 5HBEA 2X8DA 4KIKB 5E8VA 4A06A 4J95A 5IMEA 3EKNA 5KX8A 1FVVA 1H1WA 4YC8A 3KULB 4FNYA 3LMIA 3MWUA 4U40A 4X3FC 2X9FA 4F64A 3QALE 3RP9A 1ZZ2A 2Y4IC 5JRSA 3R9RA 4FV0A 5J1VA 2VTAA 4KA3A 5GIOE 2GCDA 4BTFA 1Y8YA 5IQBA 5HKMA 1IAHA 5HIEA 4QMSA 4AQCA 2PY3A 4D0XA 5IZFA 5JFVA 4L53A 3OF0A 4P4CA 3FQHA 4MEDA 3O50A 1YDRE 5IUIA 4GV1A 4IE9A 4MXYA 5KUPA 2O64A 5GZ8A 4O96A 3VBVA 4GIHA 4EK8A 4BVUA 3JUHA 2G2IA 2JKKA 4RX7A 2YABA 4FMQA 4AFEA 3NCZA 4EOQA 5H8BA 4QMWA 4Y72A 5HVJA 1W7HA 2XM8A 3VS0A 3R1SA 5J79A 1E1VA 4Q9ZA 3BHVA 3MJ2A 4IHPA 4ITHA 4QP4A 3HEGA 4HCVA 5AR5A 3TV4A 4AWIA 5AUTA 4KRDA 3VBQA 1BL7A 4QTBA 2PVNA 3SD0A 2VWVA 4A07A 3RVGA 3UODA 4DFBA 3CP9A 2VWIA 3F82A 4YZMA 4FIEA 3G90X 4IFGA 2GNIA 4EQCA 4QMMA 4CFVA 2CKOA 3DXQA 3ULZA 4G17A 4XV9A 3E8DA 4NTSA 3OTVA 1OB3A 2HK5A 1ZOHA 4DGLC 3BBWA 5EHYA 5BVEA 3ZH8A 4KKGA 4OAUC 2EXMA 1E1XA 2H96A 2UW5A 3P7CA 4B6LA 3HA8A 5DR6A 4G16A 2Z02A 4C38A 4XG2A 2WQBA 4I6BA 3HGKA 5EI2A 3PP1A 4V01A 4BBFA 3MESA 3C5UA 3DCVA 3GC0A 4RG0A 2OJ9A 4EC9A 3SAYA 2YHVA 1U5QA 4RT7A 4FOBA 3RI1A 1ZOGA 3QRJA 2BAQA 3O2MA 3FEGA 2E9NA 2W17A 5CSVA 5A4QA 2PUIA 4IVBA 4O7YA 4FR4A 2ERKA 4DH7A 3BU6A 2QG5A 3LFFA 5KKRB 2IG7A 4EZ7A 3QZFA 4Z7GA 3ZXZA 4YJTA 4F7JA 3NUPA 3O51A 3CCNA 2EB3A 1SVEA 3P0MA 4D9UA 5AP1A 4QPMA 3UQCA 3CQEA 1BMKA 2UW6A 3O8UA 4D5KA 5L3AA 4QP2A 4EEVA 4J97A 2BRGA 4IX6A 4PV0A 5LMAA 2ZVAA 3FLNC 4DCAA 2EUFB 2BZKB 3PA5A 2ZV2A 1AD5A 1MRYA 2CPKE 2QHMA 4IB3A 5LMKA 2A4LA 1R0PA 2IW6A 1FINA 2J0KA 3QGWA 2XIZA 3C7QA 3DK6A 4QQTA 2YM4A 4X2FA 4BC6A 4C4HA 5K4IA 3Q04A 3EZVA 5C8MA 3V04A 4C7TA 1M52A 4A9RA 3RM7A 2ERZE 2JDOA 4I5HA 4QTCA 1IEPA 3TZ8A 3EQHA 3UMWA 4BCMA 3WE8A 4ZSAA 4BYIA 5L6OA 3RCDA 5E8ZA 4FEQA 4ZY5A 5DLSA 3CEKA 5H8EA 4EQUA 3ACKA 4H39A 4F1MA 5AV4A 2QOLA 2JKQA 4C4FA 3LJ1A 2XEZA 4WSQA 3H10A 4MYGA 3SDJA 1NT2A 2XKCA 4PNIA 1JQHA 3MVLA 5DBXA 2IWIA 4D28A 2VWXA 2WMVA 1GZKA 1HCKA 4HVGA 1J7IA 5E1SA 3OEFX 3LXKA 3CQWA 4JT3A 4L44A 4BDJA 1ZYSA 3BCEA 5DNRA 5ETIA 3UZPA 4O0UA 4X2GA 4FTTA 3PIYA 5BQ0A 2PUPA 3ZCLA 2CCHA 3EB0A 3ZSHA 3IDCA 4FZAB 3B2WA 2PE2A 4YJQA 4J99A 5TR6A 3TZ9A 3I4BA 4IX4A 3ZBXA 2QR8A 3JY0A 3MI9A 3WZKA 2X6DA 4MF1A 2XP2A 2PZ5A 5F4NA 4AZWA 2BR1A 2ITXA 3O7LD 4R5YA 4AF3A 2IZRA 4U79A 5D11A 2XK4A 1YRPA 2OICA 4JVGA 4YJSA 3D5XA 3U9CA 4C02A 4E6QA 2XS0A 5G6VA 3W2OA 4ZZNA 3F88A 1ZAOA 4J7BA 5CU2A 3BHUA 4Q2AA 1PMVA 4EH5A 4R77A 2W0JA 1L3RE 3F6XA 3KREA 1XR1A 3WYYA 4EBWA 2XKEA 5M4FA 5DEWA 2VTRA 5AUUA 4RA4A 5JFSA 3PZHA 2UW3A 2FYSA 1F5QA 3OOGA 2W06A 2W1FA 4D1ZA 4DTBA 4GJ2A 3HMMA 4KABA 3E8NA 5M08A 2PULA 4LUDA 3VS6A 2CGUA 3COKA 3MY5A 4JRNA 4ZTLA 5BVWA 3BV2A 3QCQA 5AJQA 2BALA 5E1EA 4W4YA 5J95A 2CHLA 4HVSA 2WIPA 4FGRA 3OHTA 4MBJA 4DCEA 4YU2A 2CGXA 3AC2A 1FOTA 3OCBA 3MW1A 4TRLA 5CNNA 4BDHA 4L3PA 4QMTA 3ZO2A 1YDTE 3A4PA 5I9WA 2YZAA 3AMAA 5K5XA 5DPVA 2JLDA 2HOGA 3UOHA 5DEYA 3QQHA 3LFDA 4FEXA 5M57A 1CTPE 1U54A 3EN5A 3PXKA 1H0VA 4FSQA 4QNYA 4B99A 4CTBA 3LXPA 2OH4A 3MV5A 2Z7RA 3PLAE 4RBLA 3W18A 4JG6A 3DKGA 4MD8E 4NM7A 4MXOA 3E3BX 4MXCA 3FYKX 3HZTA 3VJOA 1PY5A 4KIKA 2XF0A 4RC4A 1R78A 2Z7SA 1NW1A 2XM9A 3V5TA 2OU7A 3KULA 4JJRA 4C37A 1KE9A 2ZB0A 3D0EA 2NO3A 2ACXA 3C1XA 4QYGA 5D7AA 4FKOA 4WD5A 2J5EA 4NKSA 5AIKA 4CT2A 2C1BA 3DU8A 4DEGA 3R8LA 2C68A 4NJDA 3BYVA 3F3ZA 4LI5A 3PWYA 2KTYA 4CZUA 3MPAA 4E93A 1YI6A 3A99A 1BI7A 4B4LA 3A60A 4GK2A 3NSZA 3R02A 3ZEWA 4MAOA 1H1SA 1LEWA 3VIDA 5M06A 2BVAA 4EUTA 4FODA 1QPEA 2BRHA 4LQMA 3ZEPA 2NNWB 5AWMA 3OWLA 5AIRA 3BIZA 4GRBA 5HNIX 4FKLA 3CKWA 4GU6A 2HY0A 4G3FA 5FXSA 3RAHA 5IEVA 2OIDA 1XBAA 4XLVA 2I0HA 4YPSA 3G6GA 5HE1A 3HVCA 4L68A 1OUKA 2F49A 3QTSA 2ONLA 3MTLA 4RVLA 1ZOEA 3QRKA 1Q97A 3FAAA 3A61A 4OTPA 3DZOA 3T3UA 2WQEA 5L2QA 3EQCA 4EOLA 4TWPA 5B0XA 5T3QA 2YZLA 3GC9A 3UZRA 4IWQA 2O3PA 5D1JA 4HYHA 3HV3A 3C13A 1MRUA 3FMDA 3KC3A 3V6SA 2R5TA 3BE9A 3QXOA 3R28A 3UG2A 4D1SA 3ODZX 3WARA 4JOAA 3NX8A 2R0IA 4ANBA 4FZFB 3GUBA 3IW5A 3R7YA 4FUXA 1ERKA 4USDA 4XP2A 4M0YA 5L6PA 4TT7A 1U59A 2JAMA 4GYGA 4IM3A 4FT7A 5EYKA 4A7CA 3LMGA 1H28A 3EQGA 4S33A 4ZEGA 4IZ5A 3UIBA 3ZS5A 4IAKA 4DYMA 5IH5A 4RQVA 5TF9A 1P2AA 4RC2A 3LKMA 2ZM4A 5IEYA 4U6RA 4XUFA 1LP4A 1M2QA 3COIA 5K3YA 3ZRLA 2IO6A 4ENYA 3G6HA 4UMRA 3FMNA 4CSVA 4H1MA 4UZDA 3WF9A 4I6QA 5A6NA 5ANEA 1U4DA 3I5NA 4A4LA 2XNGA 3F61A 2GU8A 3R71A 3NNVA 4FZ7A 4LL0A 2OBJA 2QOHA 4U45A 3ZO3A 3C5IA 1H25A 3WIGA 4NTTA 4WKQA 3UYTA 2C0OA 3RPRA 3ZUUA 5HO7A 2C6MA 3EL7A 4QYYA 3H3CA 4FGBA 4YO4A 1J3HA 3F69A 3OC1A 3VN9A 4RIYB 2XZSA 2O63A 4X2NA 4EJNA 4KIPA 2CJMA 2E9VA 4ENXA 3R21A 4M8TA 4F9CA 4DT9A 4JDHA 4ASEA 1UV5A 1DI9A 2WTJA 4IZAA 5TO8A 4PPCA 3R1YA 3FQSA 1FMKA 4O7SA 5B2MA 3W2RA 4KAOA 4DH3A 3ID6C 4Y46A 4PNKA 3E8CA 3NUUA 4FIHA 4X3JA 4EZ5A 4TNBA 4X3FB 2C6IA 4RJ5A 3AGMA 4BTJA 2Y4IB 4RX9A 5LMBA 1OZ1A 4IXPA 3RHKA 4ZZOA 3KMMA 4N57A 3TXOA 4YTFA 5HNBA 2YDJA 4B8MA 5J7HA 2UW0A 3K5VA 4Y5QA 4C57A 4EKKA 4UMPA 4JBVA 2PUUA 4R6VA 4AE9A 4G3DA 4DN5A 1WBNA 5C4KA 3P23A 3PLSA 2ZV9A 4B7TA 1PXPA 3R1QA 3EYHA 4WUAA 5HLPA 1QPDA 3Q2JA 4PMTA 3AC5A 4WT6A 1REKA 4FNWA 5A4TA 4LV5A 2X7GA 2E9UA 4U8ZA 5LXMA 3CPCA 1GZ8A 1UVRA 5CNOA 3DFAA 3NNUA 4USFA 4YTIA 3JXWA 4NIFB 3NW6A 5IUHA 4FV8A 4L8MA 5CSXA 4MVFA 3TZMA 3NAXA 1MQBA 5IUGA 4RC3A 1G8SA 2PVKA 4ANQA 2XEYA 4PL5A 4BWXA 3BYUA 3VWAA 2HENA 3IDPA 3O8TA 5L2WA 3R8PA 1DI8A 4E73A 3GNIB 1G8AA 4ZXTA 2DYLA 3FC1X 4UEUA 4TYHB 3B8RA 4E20A 2PMOX 4EYJA 2J4ZA 3IW4A 4YSMA 4BKYA 4I22A 5CALA 2LGCA 2Y9QA 2YAKA 5E8SA 5HO8A 3EQBA 2CN8A 3FWQA 4J52A 5C8NA 2UW8A 2UVXA 3EQDA 4HYIA 4ZS4A 3S00A 3NYXA 3PVUA 3TCPA 1AQ1A 3NVMB 5C27A 1M17A 4BKJA 4K6ZA 3E7VA 4FL1A 3FLWA 2VO6A 3SX9A 1F0QA 4IZ7A 4CG9A 4AT3A 4CTCA 5CXHA 3MFTA 4C3PA 5M56A 3L9MA 4BF2A 4FT5A 3AOXA 4GUEA 3GVUA 5A3XA 1W98A 4DHFA 3KK8A 4GMYA 4AW2A 3AMBA 3NYNA 5H9BA 1BL6A 4CG8A 3RJCA 4IC8A 3ANRA 3Q9XA 3U4WA 5FEQA 1G3NA 4AOJA 3F2NA 1OL1A 3HECA 3F3UA 4KKHA 2YN8A 2I7QA 3PY1A 5JMSA 3GP0A 4WG4A 4C35A 4OT6A 4EH2A 4PP7A 3UNKA 3ATSA 4BGQA 4WUNA 1SNUA 3DBQA 3LLTA 4UXQA 4E1ZA 5LARA 4MTAA 2JEDA 1PKGA 3WZUA 2PMNX 4YSJA 3PG1A 3GQLA 4ZAUA 5HOAA 5HZNA 2PTKA 3BLHA 3LCDA 2UVYA 5DI1A 3R7VA 4O0RA 3U9NA 2ETKA 3VBWA 5CENA 2B9IA 5IQDA 1XH5A 4A4OA 4NCTC 4FVQA 3SG9A 2R4BA 3R04A 4EORA 5A14A 2XNPA 3ULIA 4QO9A 4ZSGA 2I6LA 3FHRA 3ORLA 1JKTA 4JR3A 4GKIA 1SM2A 1CKJA 1OIQA 4JAIA 2OW3A 3RAIA 3LOKA 4KIQA 3FKOA 1NVSA 4H3BA 2RFSA 2YFXA 4IB0A 2OH0E 5GJDA 5H8GA 2B9HA 2BIKB 3IK3A 3VBXA 5AR4A 5KBRA 2WB8A 4RZVA 2YISA 4HVDA 3Q5IA 4ZTHA 5JGBA 4B8LA 5IQHA 2QR7A 3FSKA 3CE3A 1UWHA 3PYYA 4PMMA 4TWOA 5ANDA 5LOHA 4ZTQA 2BRMA 1YXUA 4BIDA 4PP9A 4M84A 5DG5A 3Q96A 3WIKA 3SW7A 3LCTA 4FT3A 4X6QC 5IEXA 4GW8A 2PZYA 4IB1A 3W16A 1O6YA 4E4XA 2IN6A 4L7FA 1H00A 1OKYA 3NUXA 4HJOA 3RWPA 4FBXA 4DA5A 2C69A 3ZC5A 2O0UA 4MNEB 3DBCA 4OT5A 3QAME 4JXFA 4LOQA 5AR3A 3NPCA 2WXVA 3RPSA 3VUMA 1IAJA 1IR3A 1A9UA 4G5PA 3THBA 2BDJA 2AUHA 3ZMMA 4M14A 4FG7A 3ZZEA 5CT0A 2QLUA 5FWKK 4DC2A 4Y8DA 4F9YA 4BHNA 4CLJA 4D5HA 4FL2A 5I9XA 3TTJA 4MWIA 1Y8GA 4YR8A 1UU3A 3QQUA 3ZYAA 3WYXA 3PE1A 4F0IA 4F09A 4FT9A 3QQGA 4FV9A 2VN9A 4AT4A 5LJJA 3AQVA 4MD7E 4WNKA 2VTOA 2WTIA 4KSQA 3HLLA 3VUTA 2BZJA 3MDYA 3WZJA 1BX6A 1NA7A 1Q41A 2B53A 3EHAA 4PPAA 3AC4A 3QC9A 2C6DA 2BZIB 4YLJA 3DTCA 5CU3A 4WG5A 2P33A 4FYNA 1XQZA 4BICA 3BHTA 5E92A 4BI0A 5K4JA 4DFUA 3FLYA 3BYMA 3H4JA 4FSRA 5CF6A 4YMJA 4EHEA 4XV3A 5FTGA 4O22A 4PRJA 5IQGA 3UIMA 4ACGA 3BEGA 3C0HA 3MTFA 2VTTA 3Q52A 3QTUA 1UNHA 4O27B 2IVVA 5M44A 5AADA 3N51A 4ID7A 2JIUA 4M7IA 3OUNB 3PG3A 3SOCA 1XH9A 4TTHB 2W05A 2BRBA 4X7QA 2R7BA 4UMQA 5ETFA 3TNWA 2CLQA 1M2RA 1IRKA 2VTLA 4G6NA 4G9RA 4TW9A 4AOIA 3FZTA 5CAQA 3GBZA 4KIOA 5IQEA 4NUSA 4O2ZA 4O6EA 3HAVA 4YNEA 3N4VA 5KMNA 3ZU7A 3SGCA 3F3VA 3MJ1A 2YJSA 4IMYA 4OTIA 4FOCA 2R0UA 2PHKA 3RPOA 2W99B 3R01A 4MK0A 3GGFA 5HESA 4D2TA 3PJCA 2VO3A 4R7IA 5HE3A 3V5LA 1TVOA 3OZ6A 4BYJA 2C5NA 3HP5A 3QA0A 3IW7A 3UBDA 2ZMDA 3W8LA 2PVHA 1UNGA 3NEWA 3T8OA 1YI3A 5EHOA 4RJ6A 4EK6A 5IQFA 2DQ7X 3IOKA 4JG8A 1PXKA 4X3FA 3U51A 3R83A 4KRCA 4O7LA 5F20A 4ALWA 5C4LA 3DKOA 1X8BA 2VWWA 2R3JA 1K9AA 1YXTA 1JVPP 4IM2A 4DGNA 1DM2A 4J8MA 5EW9A 3CTJA 4ANSA 5A6OA 2OIBA 4W9WA 3SXFA 4FNXA 2HY81 2YCFA 4QRCA 4AU8A 4CNHA 4FKIA 5AM6A 5JN2A 3DK3A 3DLSA 5FP6A 3R8ZA 5CF4A 4O82A 1ZMVA 1Q8WA 2VWYA 1OKWA 2QOCA 2XMYA 1Q62A 1M14A 1ZRZA 3HRBA 2QLQA 3KMWA 1UU8A 4AGDA 5JZJA 3TUDA 5L2TA 4CMOA 4O7NA 5M53A 3ZHPC 4JIAA 3PIXA 3CC6A 3F66A 5HO6A 1PXIA 4XG6A 3ZTXA 5EM8A 5I9UA 2V22A 3UO4A 5GIPE 4ITJA 2CKPA 4IVCA 3TV6A 3BE2A 4HPUE 2CGWA 4TKSA 4FKWA 3BLQA 1TQIA 2QO9A 3VS5A 1QL6A 2WHBA 5BX0A 4IW0A 2XJ1A 4AE6A 3C4ZA 1WBTA 1ND4A 5AMNA 3OWPA 3F5GA 5I3RA 4HPTE 3RZFA 1KE7A 3UOJA 3W55A 3UIUA 4H36A 5AAGA 1XH6A 5C03A 4BDDA 2F9GA 3LJ2A 2UZLA 3PSDA 3HMOA 4PDSA 4TYHA 3MA3A 3MH0A 3ANQA 3HP2A 2XCKA 2GS6A 3VUGA 4ERKA 5IPJA 4FT0A 4NM3A 4CYJA 3BKBA 4DFXE 3BQRA 2RFDA 5HCYA 5DGZA 4CEGA 4L3LA 1OL6A 4GL9A 2CN5A 3CY3A 5FEDA 3KF7A 4QT1A 3UVPA 3UDBA 4NJ3A 2CKEA 5DT3A 1AGWA 4BHZA 3R8VA 4N6YA 2GDOA 4GUBA 1GY3A 3FZRA 5C8KA 1YDSE 3S4QA 5CZIA 3TKHA 3RAKA 4L45A 4CZYB 2NRYA 3WILA 2XIXA 4L01A 3A62A 1OVEA 4FICA 4GEOA 2ITYA 4PQNA 2W5BA 1YWNA 2YWVA 2WU7A 1RQQA 3ODYX 1P4FA 3O17A 4NK9A 5J7BA 2OXYA 4ANMA 3KRXA 2X81A 3SG8A 3K5UA 4A9SA 5KO1A 3VW8A 1OIYA 3BU3A 2R3HA 3C9WA 4KNBA 4MKCA 3KQ7A 1Q8YA 3REPA 1M2PA 3AT2A 4QMOA 3P7BA 3R1NA 4IAIA 4OTGA 3CD8A 1OECA 4AACA 4LOPA 4WOVA 2GHMA 5LVNA 2HAKA 4FK6A 4G34A 3K3IA 4AFJA 2Q83A 2X8EA 2ZMCA 1WBOA 5AUWA 4DITA 5A4EA 3EKKA 4B9DA 4YURA 4O1OA 4UWCA 2R2PA 4R1VA 4CMUA 2UW9A 5L8KA 2Z8CA 3V5PA 1YXVA 2V5QA 4FTOA 4IX5A 3E93A 2F2CB 3NW5A 5CU0A 5FBNC 5LWMA 5EK7A 1K3AA 1P5EA 5J8IA 1QPCA 1SVGA 3UG1A 4UBAA 5DMZA 3OG7A 1STCE 2O5KA 3BGQA 3D5UA 5JQ5A 2J0MB 4APPA 5JT2A 4YTHA 4IEBA 3DJ6A 3HA6A 5EQPA 4AG8A 1GAGA 1JNKA 1ATPE 3OY1A 3RK7A 3BYSA 4A9TA 3KCKA 1Q99A 4UYAA 3VUKA 3PXRA 4ZTNA 3II5A 2ZAZA 3W2SA 5AP4A 4F99A 3BX5A 2CLXA 4HGTA 2BUJA 2QOIA 3CXWA 4ZLOA 2VV9A 4I93A 1XJDA 3FHIA 2HWOA 5AM7A 4WBBB 1KWPA 5JFWA 2WEIA 3QC4A 4J8NA 4O0YA 4D4YA 2IVTA 1WFCA 2YACA 4AN2A 3ZRKA 2OO8X 2AC5A 3HRCA 2JKMA 3OY3A 4IAFA 4HYSA 3FL4A 3M11A 5K0XA 3W10A 4RLKA 1KOAA 3E5AA 1MRVA 2X4ZA 4S31A 2IVSA 3HV4A 4O81A 4AN9A 4GS6A 5CSWA 4AZVA 4F9WA 4G3CA 5DT0A 5C1QB 3HV7A 2G2FA 4O21A 4PTGA 1I09A 2ZOQA 2H8HA 3HNGA 5CVFA 5FLFA 2EU9A 4MCVA 1GZNA 2FGIA 2WQNA 3BGZA 3BHYA 4EOPA 3FDNA 1E9HA 4QQ5A 2ZM1A 3F3WA 3LFCA 4C62A 2VTNA 3POOA 3QKKA 3R22A 4EZ3A 3U6JA 4B0GA 5IF1A 5HICA 4F6SA 5GZAA 1PYXA 3A7HA 4CZTA 3IPHA 3QU0A 2XK9A 4KS8A 5ANJA 4QPSA 2B7AA 2V55A 4BZOA 4O86A 3TM0A 5E4HA 2X4FA 2HXQA 3HKOA 3RPYA 2XNBA 3G9NA 2ITUA 4BCHA 3M2WA 5JKGA 3OW4A 4LUEA 4JS8A 4PTCA 5D10A 2C6EA 3NS9A 4LL5A 2WTDA 3D14A 4UY9A 4XG4A 5A4LA 2VTPA 5DOSA 4EOOA 3PY0A 5HVYA 3UC3A 4MXZA 4DGGA 3WE4A 5J5SA 1GOLA 4I24A 2OG8A 4AT5A 5FUTA 4QTEA 4RA5A 4KUJA 2X7FA 1OL2A 4ZP5A 1H1PA 2P2HA 1UA2A 3VULA 3LCSA 5IISA 3CJFA 2GFSA 2BCJA 3COMA 3CD3A 5A9UA 2ITZA 3ZBFA 1CDKA 4L3JA 2CNVA 2C0TA 4O7ZA 4AZEA 5BMMA 4OTQA 3OOMA 1O6LA 3Q32A 4ZSJA 4C33A 3KCFA 3KRWA 4JDJA 2GQRA 5HTBA 4XOYA 4IDVA 1ZY5A 4P5QA 2Z7QA 5D41A 3I81A 2YCQA 4EK3A 2FH9A 1BI8A 5LVPA 3KMUA 3R2BA 5J1WA 1KE6A 4KB8A 3D15A 3O8PA 4ASZA 4DEBA 4M97A 4CT1A 5BVDA 3ETAA 3MYGA 3BI6A 2J0LA 3FL5A 3FXWA 4YBJA 4WRSA 3FZPA 3KY2A 4GK4A 3V8SA 3FYJX 4HW7A 3DXPA 1MQ4A 3HL7A 3E87A 4XG8A 5CS6A 5H2UA 2VO7A 3DV3A 4BDBA 4F65A 1FBNA 1OITA 3IGGA 4M69B 4GKHA 4LOOA 4XX9A 4KS7A 4QQCA 3R9DA 2XVDA 3D7ZA 3QTQA 4RX8A 3EL8A 2UZUE 3AC1A 5LCKA 3A8XA 3WF7A 1URCA 1FGIA 3LAUA 3LFSA 5M4IA 5JRQA 3V01A 4IACA 5B7VA 5HTIA 1PMEA 1XWSA 2OWBA 3TT0A 4AW5A 4X2KA 4BIBA 5CAVA 3EMGA 3NNXA 5CEIA 2VTIA 4PL3A 5K9IA 1J7LA 2VU3A 4U81A 3NNWA 4FTMA 4BB4A 2I1MA 2XNMA 3AXWA 4IAZA 4EQMA 4YP8A 3KRRA 4EJ7A 3FY2A 2XIYA 3FLQA 4NSTA 3DBDA 5AX3A 4BDGA 3SVVA 1IA9A 4DEHA 1PXJA 4RQKA 3G15A 2P0CA 4FG8A 2UZWE 4XS2A 3QBNA 4IWDA 4MD9E 1NVRA 2W4JA 2OGVA 2XRWA 4PDPA 1JOWB 3GT8A 4RFZA 4I5CA 1PRYA 2QO7A 2WZJA 3DDQA 5FXQA 2XIRA 4K18A 4ZLYA 5H3QA 4A4XA 1FGKA 5M09A 3TDVA 4N6ZA 3KN6A 1OI9A 5HI2A 5ANIA 1UKIA 3H9OA 1Q8TA 3OT8A 5CQUA 2BRNA 5HG7A 3D2KA 5M55A 3QCSA 4EOMA 4DAWA 4QMXA 1CKIA 2C5YA 3BQCA 4QNAA 3GQIA 4NL0A 4XG9A 4GG7A 4YHJA 3PP0A 1TQMA 1FMOE 3FXXA 4ARKA 2VWZA 4BN1A 4FV1A 4O91A 4L43A 2WMBA 4YJPA 4S2ZA 4RJ8A 1OBGA 1REJA 4D2RA 4R3PA 4OLIA 4H1JA 3C51A 2IPXA 3PUPA 4IFCA 3Q4ZA 2QVSE 3IG7A 3MGYA 2DWBA 2VX1A 3P9JA 4P2KA 1FVTA 4BL1A 3Q6WA 3GCQA 4JRVA 4AW0A 4ZOGA 1S9IA 4YC3A 1YQJA 3RMFA 4EH4A 5M51A 1ZMUA 3OCGA 5ACKA 4DH5A 4H3QA 4EOKA 5E7RA 2ITOA 4Q5EA 3RBWA 1LUFA 3L8PA 3R63A 2WMQA 3W8QA 4F08A 5HQ0A 4IAAA 4LYNA 4YNOA 1W82A 1ZYJA 3LCKA 4XMOA 2PU8A 2CNUA 4EBVA 2H6DA 2R3MA 3P5KA 2YERA 1ZYCA 2WTKC 3F5PA 1VEBA 4K0YA 5EYMA 4C36A 5M4CA 3I6UA 3KXMA 4BBEA 3A4OX 4NWMA 1Y6BA 4HGEA 4FIIA 5DVRA 1UNLA 5EDPA 4ZTRA 4RWKA 4K77A 3W2QA 3EQFA 2VTSA 5L2SA 3DTWA 4YO6A 2X8IA 3LE6A 3OROA 4L9IA 2BKKA 1R0EA 1ZXEA 4IZYA 1V1KA 2WO6A 5C26A 4EWQA 3EZRA 5IDPA 1YVJA 2C5OA 1K2PA 2R3GA 2WD1A 5AR8A 3ROCA 3KVXA 4BCIA 3U6IA 2DUVA 3U54A 1KV1A 4DT8A 3ZLYA 3BBTB 4K9YA 4FTRA 1I44A 1JBPE 3TG1A 2VGOA 4OBOA 4AA5A 4BKZA 3NMUF 1Z9XA 3UNZA 3IW6A 2RFNA 4TWNA 2R9SA 3GC7A 2YAAA 4XEYA 5AFVA 1OPKA 1YHWA 5IG1A 3VS3A 4DLIA 4DF3A 4FTIA 3R7GA 5HIBA 4AN3A 2YM6A 4AP7A 4ONAA 4Q5HA 4FTCA 4YUQA 4NZWB 1JKLA 1YW2A 2EXCX 4I41A 4TY1A 5CEPA 4O1PA 4G1WA 3Q6UA 3D5VA 2PZRA 5HG8A 1VJYA 3O96A 3ET7A 4ANOA 5CAUA 5IU2A 4O0TA 3R9OA 3MVJA 1ZWSA 3OWJA 3T9IA 4RJ4A 2W5HA 5I9YA 3SV0A 3FJQE 2J7TA 4LG4A 4F9BA 3L8SA 4OTDA 4QP6A 4HVHA 4HOKA 2JGZA 2WKMA 2P55A 2I0EA 3FLZA 3LVPA 4AXAA 4G2FA 4FTUA 3SLSA 1JPAA 3VQUA 4ACCA 2ITTA 2ONLC 2YJRA 4C3FA 3C4EA 4TL0A 3HYHA 3ZZWA 3FI2A 3ZFXA 3HMIA 3JPVA 4D2PA 1PJKA 4II5A 2IJMA 2GPHA 4XG7A 5FBOA 2ZM3A 1PXNA 3NYVA 2KULA 4ACMA 5CEKA 5KMLA 2OXDA 5AUXA 2WMTA 2QOQA 4FV2A 5EOLA 1OL5A 1HCLA 3BU5A 4ZTMA 4MBIA 4FSMA 5F95A 5HLWA 4OAVB 2XB7A 3ENHA 4GH2A 2PPQA 3CR0A 3PE2A 4QQJA 3QD4A 3RK5A 2QG7A 1BYGA 3CTHA 1H24A 4IC7A 4GT3A 3VUHA 5AUYA 1R39A 3QQFA 3V8WA 3T9TA 5IA3A 1ZYLA 3VUDA 4G3EA 4RWJA 2UUEA 3ZSIA 5CASA 1OKZA 3IGOA 5CT7A 5ETCA 3U4UA 2B9FA 3PXZA 4FV4A 2PK9A 4XLIA 5DR2A 4OUCA 5EG3A 3PJ2A 3FXZA 3RTPA 4EOIA 4O84A 4NKAA 3EOCA 4RVTA 4YZBA 5AA9A 2PE0A 3PXQA 4W4VA 2GNHA 4FF8A 5DH3A 3QUDA 1Z57A 4FKPA 4GU9A 2I40A 4IB5A 1Q4LA 4QMZA 2W5AA 4GVAA 4IADA 2JD5A 1DAYA 3Q4TA 4QOXA 3F5UA 2RG6A 3FQEA 5CX9A 4L42A 4FK3A 5GJGA 2YM7A 5GINE 2HELA 3ORTA 5CY3A 3RINA 4DEIA 2OJIA 2B4SB 3DBEA 3CY2A 1WVWA 3GOKA 2PUNA 3QX4A 5AP7A 4CLIA 4RFYA 5FTQA 2GS7A 4NCTA 3E8EA 3ZUTA 3M1SA 3ORNA 3VNTA 4M69A 3ZO1A 4QMUA 3IDBA 2V7OA 3EQPA 4BDAA 2GHLA 1OM1A 4YLKA 3UPXA 2QKRA 2JAVA 4G31A 3GCSA 4A9YA 3HAMA 3UTOA 4BZNA 4Z3VA 4O0WA 3GU4A 4W4XA 3G0FA 3VRZA 1NVQA 3G2FA 2OSCA 5I9VA 5JK3A 2YDIA 3TEIA 4XH6A 4C0TA 2I0VA 3F5XA 4U41A 2ITWA 4DH8A 2W9FB 3DY7A 5M07A 4M3QA 1GJOA 4IIRA 5CSPA 3Q4UA 2RGPA 3D83A 1PW2A 3RAWA 3EFKA 1H01A 1Z5MA 3P1AA 4UN0C 4QMPA 4FEWA 4KD1A 3BWJA 4I6FA 4I0TA 4JBPA 4WA9A 4ZLZA 3ZLXA 3QD3A 3QWKA 4R3RA 5HU3A 2JC6A 4UWYA 3CGOA 4D55A 2O8YA 3QGYA 1SMHA 3E64A 4FG9A 2YLEA 3QZHA 4F1OA 3VW6A 5EW8A 4H58A 2Y4PA 3GC8A 4XYFA 4E8AA 2B52A 4TWCA 1Q3WA 5E8WA 4ZZMA 5E8TA 3SKCA 1LR4A 3I5ZA 3NIZA 4IVDA 2SRCA 4U3YA 4EK5A 4HNIA 5D12A 3QLGA 3TUCA 3DZQA 4F63A 1URWA 4FTLA 3VF9A 4R78A 3DKCA 3AD4A 4ALVA 2BROA 2YWPA 3DBFA 2WIHA 2X2MA 2PVFA 3H30A 3W33A 5IDNA 2ITNA 3QQKA 2ITVA 4GFGA 4RSSA 2HWPA 2C4GA 4APCA 4FVPA 3V5QA 3QRTA 3TTIA 4NM5A 4IAYA 4CV9A 2AYPA 3N4UA 5CEOA 3KB7A 4JDKA 3RKBA 2HW6A 2WGJA 3Q9YA 4FKTA 4PX6A 5JH6A 2WTWA 2UZEA 4I0SA 2R3NA 2XKDA 4RWIA 4JDIA 2BFXA 2NP8A 4F6WA 4Z7HA 4K8AA 5LVOA 2C3JA 4QD6A 3VRYA 4RIWB 5KZIA 2YDKA 4DLJA 4JL9A 1KSWA 1Q3DA 1YHVA 2QO2A 3KN5A 3OD6X 3Q2MA 4Z55A 2HIWA 4RVKA 5I3OA 3H9RA 3NWWA 2YIYA 4FTQA 3SHEA 4QP8A 3LIJA 3NGAA 2XUUA 5GZ9A 3F2RA 1J1BA 3AG9A 4W9XA 2A0CX 5AEPA 4FSTA 5KZ0A 3AD5A 3S2PA 4C4JA 1JWHA 2IZSA 5FM2A 3C0IA 5IA5A 1O9UA 3DAEA 4EUUA 1YWRA 5E9EA 3TDWA 3MH2A 5CSHA 3KRJA 1XKKA 5BYLA 3KXGA 2QONA 4TYJA 5KHXA 3EJ1A 4M68A 4FKUA 2PVLA 2VTQA 5FD2A 2R3FA 3VF8A 2R64A 4BDKA 5IQCA 3MVHA 4NEUA 2UZOA 4UX9A 2GNGA 4R3CA 1B39A 2CKQA 3IQ7A 4BCKA 5E8YA 3TWJA 2C0IA 1Y91A 4O0VA 1JSVA 4UMTA 5HGIA 1PHKA 3PY3A 3AC8A 4RZWA 3TIZA 2C3IB 2GQSA 3HV6A 3D4QA 4AZFA 5CANA 4AA0A 4KBKA 4QP1A 4WHZA 5FP5A 4PUZA 5HE0A 4OTRA 3AMYA 3CKXA 3C0GA 3TNPC 1YXSA 2PVMA 2UZBA 3DDPA 3E3PA 3M42A 2GMXA 2X0GA 2P3GX 2XNNA 4O6LA 4D4SA 4BTKA 2PWLA 2VGPA 4JR7A 2JITA 4M67A 3F7ZA 4LRKA 1H26A 2W4KA 1IA8A 5EI8A 3QZGA 2W9ZB 4OBPA 3RHXA 3OCSA 2FA2A 4I0RA 3ZLWA 5CVGA 2UZNA 4I5MA 1PXOA 3F3TA 1JAMA 2C6OA 5ETAA 3W2CA 4RIYA 2Z2WA 4PMSA 4D9TA 4PPBA 3IECA 4YHFA 4XHKB 3DXNA 2W4OA 4FX3A 4U97A 3CTQA 2OXXA 4X2JA 3GU5A 2IVUA 5EW3A 4ANNA 4ZJVA 2Y6MA 5BVKA 2OLCA 1UU7A 4I1ZA 5IQIA 3GCVA 2XNOA 4AZSA 4M66A 2PVRA 3KXHA 3MFRA 2V0DA 4G6OA 3DPKA 2CSNA 4R7BA 2VO0A 4TNDA 2OFVA 3PVGA 3PA3A 4MXAA 1OIRA 3OCTA 4QP3A 3R9NA 1O6KA 3F2AA 4YC6A 1IG1A 5BYZA 3R00A 5EFQA 3RGFA 4EHZA 4XBRA 3VS4A 4BCOA 3AC3A 2YIQA 4EH3A 5DRBA 3MVMA 3O23A 3ROYA 5KBQA 2YIXA 4FV6A 2PMIA 3QTWA 4DINA 4JG7A 3HUCA 2QODA 3UJGA 3QUEA 3RALA 2XH5A 3TV7A 4S30A 3ORZA 5BUJA 1CM8A 4DFLA 1VYWA 3QWJA 2X7OA 1BUHA 3C4CA 3CGFA 3FPMA 4F0GA 2Y6OA 5AUZA 2YIWA 4U42A 2FSTX 4DTAA 2XYNA 3SA0A 2B1PA 3MSSA 2W7XA 1VZOA 3A7FA 3DA6A 2HZNA 5KHWA 4DFZE 4YZNA 3R8UA 2GQGA 2ZB1A 2XYUA 3O0GA 3FMHA 2WTKB 4NIFA 2JDVA 3E62A 3I0OA 3P08A 4RRVA 1OIUA 3UOLA 2VAGA 5HX6A 3QTXA 4U0IA 4EOSA 2C30A 2XNEA 3I1AA 3IO7A 5FEEA 4JAJA 4BZDA 4NH1A 5CI7A 3D9VA 2F4JA 4K1BA 4DEDA 5A4CA 4U3ZA 3CQUA 1ZY4A 4D0WA 2X2LA 2QQ7A 2BAJA 4L7SA 5L8LA 2F2UA 1EH4A 1U46A 1W8CA 2XBAA 4JQEA 5ACBC 5CAOA 3FZOA 4IWPA 4XP3A 3QA8A 4OGRA 1PXMA 4M13A 2GTNA 1U54B 4RJ7A 4QMQA 5ITAA 4LV8A 5FDPA 1YXXA 3OXZA 3UIXA 3DB8A 2CGVA 1TKIA 2JIIA 3AD6A 2W96B 3R7EA 3V5JA 2PMLX 2VTJA 3GOPA 3WZDA 4LRJA 3VO3A 2JDRA 2UVZA 3EN9A 4XBUA 5KE0A 1J91A 3MS9A 3ZDUA 3UVQA 3VS1A 4GVJA 4MF0A 4L00A 5AR2A 5L8JA 3W32A 3QXPA 1UWJA 3GB2A 3ZFYA 1XHAA 4LRMA 3QD2B 5ANKA 3FI4A 2F7XE 2X9EA 3PA4A 4M12A 5IA2A 1CSNA 2QKWB 2VX0A 2OF4A 3QQJA 3GCUA 3LXLA 3OXIA 5CQWA 4M0ZA 1Q8ZA 3QKLA 4CGAA 3VHKA 3FLSA 4IH8A 4FTNA 2VUWA 5C01A 5AA8A 3MFUA 3LXNA 2WTVA 3C4FA 4ALUA 2YM3A 1WBPA 2IZTA 3OS3A 4S34A 4JQ7A 3FI3A 3LW0A 4CFWA 2R3RA 4FTAA 5ANOA 2WOTA 3ZOSA 4ACDA 4JLCA 5CEMA 4ZMEA 2JKOA 2OIQA 2R3LA 3TJDA 2NRUA 3UMXA 3CSVA 5IQAA 2YITA 2HXLA 3FKNA 5E91A 4DEAA 2WU6A 1XO2B 1T45A 2OI4X 4XOZA 1S9JA 5CF5A 1SNXA 3A8WA 5EM7A 2ITPA 3BLRA 2H9VA 3LCOA 2VWBA 3TNQB 3R9HA 2UZDA 4HYUA 3QYWA 3ERKA 5DA3A 2IW9A 3V5WA 4I5PA 4HZRA 2GNJA 3LFQA 3DNEA 2C5XA 2XJ0A 4HGLA 4IANA 5AX9A 3HRFA 1WBSA 4ASXA 3VBTA 2RL5A 1WVXA 4PWNA 4IM0A 1OUYA 2OJFE 4YBKA 1MP8A 2RFEA 3HDNA 5EDQA 4CMTA 2BIYA 2RSVA 5JGAA 3ZUVA 4KWPA 1GIIA 4U44A 3UZTA 2HW7A 2ZDUA 2DS1A 3GENA 3KF4A 4RVMA 3RNYA 3ZLSA 5HX8A 2F7EE 3BHHA 5E90A 5KMOA 3VUIA 2QCSA 3KEXA 2XK7A 2XRUA 5T6KA 4JI9A 3RZBA 3EFJA 4MQ1A 2HCKA 4XG3A 2VD5A 2GHGA 3QF9A 4RIWA 1Q5KA 3U6HA 1R1WA 4G6LA 3SRVB 3OBGA 4V04A 4BWKA 3UO5A 4PY1A 4TYEA 4NM0A 2AC3A 4C34A 2PZPA 4BFMA 4MNEA 3LM0A 3QTRA 3EYGA 1PMUA 3FKLA 4KBCA 4LGDA 5CWZA 2OZAB 2VWUA 4FSUA 2C6KA 2O65A 4CFXA 4IJ9A 3DJ5A 4BR3A 5DN3A 1WBVA 4Y73A 3EWHA 4FKJA 3OW3A 4FTKA 4TN6A 4RX5A 4QPAA 3UYSA 3E63A 3VAPA 4O7RA 2XJ2A 3Q53A 3D94A 2B54A 1LPUA 3H0YA 4FV7A 4PDYA 3P78A 3QFVA 2PL0A 4N0SA 3KA0A 3EN6A 4LGHA 4LMUA 4JX3A 3VS7A 4ZJJA 5ICPA 4GCJA 3IS5A 2PE1A 2C3LA 2R3KA 2A1AB 3ELJA 4C4IA 1T46A 2A19B 4BDIA 4HCTA 4PMPA 5IA4A 4FSZA 3FMLA 4IWOA 4W4WA 4XNEA 3PXFA 5C9CA 5DIAA 3EFWA 3KRLA 2YA9A 3NCGA 5CI6A 2A27A 2C47A 2FSOX 4C4EA 4CFMA 4YJVA 3TIYA 3QX2A 4H3PA 4FKVA 3TI1A 3OP5A 3UQGA 5CLPA 3P7AA 4C59A 3KXXA 4F0FA 4FSNA 3SXSA 3DOGA 1M7NA 4QP9A 4MH7A 3WI6A 5IA0A 4FC0A 3EQIA 3L9PA 4LGGA 5DT4A 5HBHA 3UGCA 4GYIA 3TZ7A 4BCJA 3GU7A 4V0GB 4CFFA 4HNFA 4U9AA 2B0QA 2YCSA 3QRUA 1XH7A 3QL8A 4QTAA 4XP0A 5AR7A 2A2AA 2H34A 3ZC6A 5KCVA 3EH9A 2X39A 2J51A 2LAVA 5EQYA 2JDSA 2OZOA 2R7IA 3CPBA 3PJ1A 4FKSA 4L6QA 3GI3A 5JGDA 3S0OA 4ERWA 4YPDA 1RDQE 3PRFA 5E8XA 4EL9A 3L8XA 5JEBA 5GJFA 4AOTA 4NYEA 1OPLA 4XV1A 3SQQA 3POZA 4IX3A 4YJRA 3KU2A 4AGCA 3PIZA 2RF9A 4HGSA 2R3OA 5HCZA 3TNHA 3SOAA 2HYYA 3RWQA 3I0QA 4NW5A 1OBDA 1A06A 1OGUA 2QOFA 3A7IA 3MB7A 2V62A 5LMKC 2B9JA 2W1IA 4I4FA 3U8WA 3I7BA 5EH0A 4PTEA 4I4EA 4ZK5A 4C2VA 5FXRA 4UV0A 3Q60A 4USEA 3UP7A 3U55A 4ZIMA 3CLYA 3QCXA 4BWPA 5BPYA 3BZ3A 3G9LX 3LQ5A 2W1ZA 3ZXTA 3FMMA 2BKZA 4CKIA 4E4NA 1U5RA 2BTSA 4D2VA 4RPVA 4Y95A 4F6UA 1OMWA 4Z9LA 4LMNA 3V51A 4C4GA 5I0BA 4R7HA 4ASDA 3MFSA 3UNJA 3MIAA 3KL8A 4J98A 5KMJA 5HG5A 5HEZA 1W83A 3C50A 3D2IA 3GFEA 5CEQA 5I9ZA 3NUYA 4GFOA 5JFXA 3GXLA 4KKEA 2CMWA 4ZSLA 4HCUA 2WPAA 4JBQA 5BVOA 2G15A 3VBYA 3GCPA 4ZTSA 1L8TA 4BBMA 1YHSA 3IOPA 4FL3A 4NFNA 4TZRA 5A54A 1QCFA 4AGWA 3QCYA 4EH8A 4BY9E 2BAKA 3S3IA 3P4KA 4QYEA 3K2LA 1YWVA 5LWNA 3HV5A 3A7JA 3VJNA 2Y8OA 3ATTA 5AP2A 5EM5A 1UU9A 5L4QA 2E2BA 4O83A 1WAKA 2F57A 3BYOA 4YJUA 2C3KA 4EI4A 5J9ZA 3N4TA 3IW8A 1HOWA 2WMSA 3D7TB 3LFNA 1J1CA 3DGKA 4DEEA 5HVKA 5D9HA 4DFYA 3TNIA 3ORMA 3I60A 2GSFA 3JVRA 4N4SA 3FC2A 1XH8A 3V8TA 4DG3E 4AGUA 3FMEA 1ZZLA 3TKIA 1SZMA 4EH9A 5DHJA 2JDTA 4G9CA 2Q0BA 3VS2A 2JBOA 3LHJA 5HG9A 3DLZA 5DR9A 4RIXB 4QMNA 3NRMA 3BPRA 5F9EA 3R8MA 2CNQA 4RIOA 2B55A 2W1EA 1FPUA 3WF6A 5KMKA 4U5JA 5EKOA 4R1YA 5BUIA 3FMJA 3UE4A 1PKDA 2REIA 4UB7A 2NPQA 3R7IA 2C6TA 4JBOA 3QTZA 1BLXA 1GZOA 1OKVA 5HTCA 4ZY6A 4CRSA 5LQFA 2WMRA 3LQ3A 1VR2A 2PSQA 2VRXA 4K33A 3PXYA 5BNJA 4WIHA 4E6AA 5HE2A 4LFIA 2RIOA 2WOUA 5HCXA 4ZS0A 1Y6AA 4G3GA 5EDRA 3ZSGA 4CXAA 3GEQA 3TUBA 1KV2A 4FIJA 5CYIA 3RM6A 4CFUA 4F7SA 3OUKA 3TACA 2J6MA 4C58A 5CXZA 4BCFA 3NUSA 2ZV7A 3TKUA 3R30A 4AAAA 4F4PA 4F70A 4J1RA 1VYZA 2R3PA 4YHTA 3KK9A 5DFPA 1F3MC 2JIVA 4FUYA 4Y85A 3UPZA 5DE2A 3QTIA 3HUBA 4DG2E 2PVYA 1JKKA 1WBWA 5AP3A 3V3VA 4XRJA 4NT4A 4U7ZA 1TQPA 5FGKA 4K2RA 4JQ8A 5FM3A 3I7CA 5IKWA 2Z7LA 2WNTA 4U80A 5EYCA 5HLNA 2XA4A 1SYKA 4RJ3A 5J87A 1H8FA 3H9FA 3LPBA 4BDCA 1LEZA 4RLLA 3EN7A 1G5SA 4P7EA 2OJGA 4PL4A 3FMKA 2FSMX 4FI1A 4HVIA 1Q61A 2Y0AA 2VTMA 1KE8A 1H0WA 3UQFA 2R3IA 1KE5A 3CBLA 4WNPA 5CF8A 3F9NA 3E7OA 3IONA 4K11A 2I0YA 3ITZA 4UXLA 5D7VA 4CCUA 4F7LA 1FQ1B 4CKJA 3B2TA 4DE4A 3H0ZA 3PFQA 5JSMA 2G2HA 2BPMA 2W1HA 1XBCA 3L9NA 4BCQA 4FZDB 1KUTA 4XJ0A 2UZTA 3S1HA 4L67A 4YLLA 2X6EA 2XKFA 3SC1A 4EWHA 4UWBA 2FUMA 3MPMA 2Z60A 3F7WA 3QD0A 2PYWA 4QMVA 2XCHA 5HU9A 3LM5A 5JZNA 3WF8A 2CCIA 4PDOA 1GIHA 3P79A 4FV5A 3A7GA 2YEXA 2OK1A 3SRVA 1BKXA 4H05A 2BHHA 2BILB 2QC6A 3DNDA 4EYMA 3QHRA 1Q24A 3QYZA 4RFMA 4U43A 2UZVA 2FSLX 2J9MA 2OZAA 3HMNA 4WBOA 3SXRA 5T68A 3ZO4A 4C8BA 4RMZA 2EB2A 4ZJIA 2GS2A 3QQLA 3N9XA 4QMLA 1CMKE 1YOJA 4FYOA 1NY3A 3LQ8A 4MBLA 4BGGA 3JYAA 1RJBA 2WAJA 4FKGA 2ZDTA 4G5JA 5DRDA 1IASA 5AAFA 4BTMA 3L9LA 4I6HA 4CFNA 3OEZA 2C6LA 3L1SA 5LVMA 4YZ9A 3FZSA 2ZV8A 4D2SA 3LFEA 2YM8A 2XIKA 3LFAA 2J5FA 2WMUA 3EFLA 3NAYA 2QURA 3ENMA 5EI6A 5EQEA 2HZ0A 2VTHA 3PJ8A 4ANLA 4MX9A 4IBMA 4CQEA 5BVNA 5KMIA 4OR5A 2VX3A 4WRGA 3FPQA 5CAPA 4OBQA 4NFMA 4BCGA 1JSUA 3JS2A 2Q0NA 2V7AA 3FBVA 4I92A 5AP6A 3EIDA 2ITQA 2OJJA 4V0GA 3VVHA 2J90A 2GNFA 5KKRC 4O38A 4D4RA 4EKLA 5AV3A 3UC4A 3Q5ZA 3DAJA 3LMHA 3FI8A 1FVRA 5B2KA 2WELA 4QMYA 4L46A 4X6RA 4A9UA 2BTRA 2C5VA 3NDMA 3Q3BA 4V05A 1XH4A 4ZMFA 4BDFA 4DGOA 2RG5A 3DB6A
chains in the Genus database with same CATH superfamily
5B2LA 3HX4A 4YZDA 5AV0A 1DS5A 2WMWA 4P90A 4O4FA 4D4VA 3QLFA 2EVAA 4WSYA 4AUAA 5L2IA 1Q8UA 4GSBA 2RKUA 2W1DA 5IMXA 3MA6A 2PZIA 5ANGA 3ZM4A 5J9YA 4J96A 4CD0A 4QDVA 4CKRA 4GK3A 2X1NA 3PVWA 2ZYBA 4O7VA 4I94A 3KXNA 3DS6A 4TYIA 2X2KA 2ESMA 2UV2A 4BDEA 4BCPA 1V0PA 3DKFA 3ALNA 4CV8A 2VZ6A 3R6XA 3BL9A 2HZ4A 2HZIA 4E5WA 1GIJA 4F9AA 4EHGA 5EKNA 1OL7A 1XBBA 4W8DA 4E6CA 3G33A 4O0SA 4C3RA 4Z16A 5J5TA 2WQOA 1WCCA 4WNMA 2QHNA 4GT4A 5LVLA 1M7QA 1JLUE 3KGAA 4JIKA 3OVVA 3TL8A 3QHWA 2WEVA 4YZCA 3BRBA 4DG0E 4GT5A 1JKSA 5K5NA 3KVWA 1ZLTA 4QTDA 4FKRA 3ACJA 3ZRMA 4I21A 4WO5A 3UO6A 3OFMA 3VHEA 3DQWA 1RW8A 5IH6A 3ML1A 3L8VA 4WNOA 3O71A 3W1FA 1YOLA 4E4MA 4BIEA 2ETRA 2R3QA 4DHZA 2UW7A 3NVKI 2UW4A 3AT3A 3FZ1A 4Y83A 2XK6A 2FVDA 2YCRA 2QI8A 3V6RA 2JFLA 3PPKA 3D7TA 2QNJA 1SVHA 1ZARA 4LM5A 4DFNA 5FG8A 4CVAA 5E8UA 4D2WA 4BGHA 4XV2A 4HZSA 5HIDA 4F7NA 5BUEA 5TKDA 2WTCA 5IA1A 5CVHA 3GU8A 2CDZA 4JX7A 4X0MA 1J7UA 3E92A 5GNKA 4I20A 4MQ2A 5IH4A 5CZHA 3HDMA 4EH6A 4RIXA 3JVSA 3CS9A 3PTGA 3SW4A 5AAEA 3PWDA 4KINA 4D58A 5JQ8A 3KKVA 4UALA 5K0KA 3Q9WA 5DYJA 3MH1A 3OT3A 2GTMA 4GFMA 2W1GA 3BELA 4FE2A 3O7LB 1OPJA 3QKMA 5EM6A 1PXLA 3PPJA 4FIGA 4JNWA 3RK9A 4EC8A 2E9PA 5AV2A 4OW8A 3VQHA 3ZDIA 4CQGA 4DTKA 2XBJA 3CJGA 1W0XC 4FSYA 2QD9A 3MN3A 3MY0A 1H1QA 5F94A 3LZBA 3FE3A 4MNFA 4Y5HA 4J71A 3B8QA 4FNZA 4QYHA 3P86A 5AUVA 2YIRA 3BEAA 3NIEA 1UKHA 1V0BA 4FIFA 4S32A 1PF8A 3PSCA 4KBAA 2VNYA 4FZ6A 5BVFA 5I5ZA 4CYIA 1P14A 4EONA 5BMSA 2G9XA 3R2YA 5AP5A 2VNWA 4M15A 4RGJA 3ZFMA 2W1CA 3MBLA 2GNLA 5FQDC 3S95A 1APME 2WMAA 5LCJA 4E5BA 4GG5A 4WG3A 4ZY4A 3AGLA 3NW7A 5I4NA 4XCUA 4C61A 3KFAA 5HD7A 4E4LA 3LLAA 5BYYA 3DT1A 3K54A 4EOJA 3COHA 4MWHA 3RNIA 4IDTA 5GHVA 4O7TA 2F7ZE 2QOOA 1W2DA 3DAKA 4EK4A 1H07A 4UYNA 1H1RA 2XK8A 5M4UA 3ORXA 1V0OA 3NLBA 4IJPA 4TXCA 1RE8A 4L52A 4TYGA 3AT4A 3MH3A 4BRXA 3QZIA 3NR9A 5FDXA 5A46A 5CU4A 4I23A 4DBXA 2BMCA 2FB8A 3C4XA 3FSFA 3WZEA 4FEVA 4FV3A 4KSPA 5TT7A 2EXEA 4DH1A 1DAWA 4CRLA 4ACHA 3ORPA 3PSBA 5KMMA 4ZSEA 4AW1A 3MY1A 2G1TA 2PVJA 3OXTA 5HHWA 4FSWA 4FTJA 3R7OA 4NW6A 3W2PA 3C4WA 5TOZA 5KNJA 4O7WA 3PZEA 1H4LA 4E5AX 2BHEA 2OFUA 3OTUA 4YJOA 1JSTA 2FO0A 1B6CB 1WZYA 3QUPA 2ETMA 1YOMA 4FEUA 4ITIA 4I3ZA 5HD4A 3JR1A 2WQMA 4AZTA 2Y7JA 4D1XA 2BDWA 4IQ6A 3QRIA 4O0XA 4AA4A 2IEWA 2P2IA 4J53A 5TE0A 4EHVA 1PMNA 3WBLA 4E3CA 3CIKA 1KOBA 4OTWA 3WF5A 4FA2A 4F1TA 4ORKA 3NZ0A 4YTCA 3D5WA 5DWRA 3GU6A 4N70A 5CU6A 1B38A 3FY0A 2C1AA 4AS0A 2BFYA 4PF4A 3I79A 3NUNA 3PRIA 4E26A 2WFYA 4YJNA 3DJ7A 3PJ3A 5F1ZA 2G01A 3BV3A 3ALOA 5EHLA 1PYEA 3Q9ZA 3R73A 3VC4A 2XK3A 3DQXA 2ZJWA 3OMVA 3PPZA 5CTPA 3BWFA 1YKRA 4E7WA 3FUPA 2JFMA 2QU6A 3I6WA 3Q4CA 4GJ3A 3KXZA 4MXXA 1P4OA 3EQRA 4NU1A 3T3VA 3BGPA 3K3JA 5G1XA 3NYOA 3ZONA 4W8EA 4YGAA 3R7UA 4BI2A 3WOWA 2BDFA 5AV1A 5EOBA 4FVRA 1WVYA 2QOKA 2P4IA 1WMKA 2IZUA 1GNGA 2QOBA 1Y57A 4O2PA 1ZYDA 5HORA 2YLFA 3G5DA 3PVBA 4R8QA 2J0IA 5HNGA 3RCJA 3OBJA 5J9LA 3NUAA 3W0OA 4TPTA 1R3CA 3UOKA 1QMZA 3OWKA 5FTOA 4MHAA 1A48A 4DGMA 3MPTA 3UVRA 1NXKA 3A2CA 4QP7A 3ZM9A 3IKAA 4OTHA 2J2IB 2J0JA 2O2UA 2IW8A 4XRLA 3U87A 3PDTA 2OKRA 3FV8A 4GIIA 4BI1A 4UMUA 4DBNA 3TJCA 3EN4A 4E6DA 4QYFA 1W84A 2OF2A 4RWLA 3HMPA 3LJ0A 4R5SA 4Q9SA 2YM5A 4BCNA 3G51A 5L6WL 3TN8A 5EYDA 5FRIA 1H27A 4AX8A 2QU5A 5AP0A 3ORKA 4OTFA 3JY9A 4IVAA 1ZMWA 2J50A 4CCBA 3G0EA 4P5ZA 4EH7A 4C2WA 5HBJA 4FKQA 1H08A 3LFBA 1YI4A 3MIYA 3DK7A 3UP2A 2E9OA 3DFCB 1CKPA 3GFWA 3R0TA 3E88A 3RPVA 2BZHB 1MUOA 1QPJA 2EWAA 2X0OA 3ORIA 2WMXA 2JBPA 4X21A 3MB6A 2GFCA 4UZHA 5HBEA 2X8DA 4KIKB 5E8VA 4A06A 4J95A 5IMEA 3EKNA 5KX8A 1FVVA 1H1WA 4YC8A 3KULB 4FNYA 3LMIA 3MWUA 4U40A 4X3FC 2X9FA 4F64A 3QALE 3RP9A 1ZZ2A 2Y4IC 5JRSA 3R9RA 4FV0A 5J1VA 2VTAA 4KA3A 5GIOE 2GCDA 1ST0A 4BTFA 1Y8YA 5IQBA 5HKMA 1IAHA 5HIEA 4QMSA 4AQCA 2PY3A 4D0XA 5IZFA 5JFVA 4L53A 3OF0A 4P4CA 3FQHA 4MEDA 3O50A 1YDRE 5IUIA 4GV1A 4IE9A 4MXYA 5KUPA 2O64A 5GZ8A 4O96A 3VBVA 4GIHA 4EK8A 4BVUA 3JUHA 2G2IA 2JKKA 4RX7A 2YABA 4FMQA 4AFEA 3NCZA 4EOQA 5H8BA 4QMWA 4Y72A 5HVJA 1W7HA 2XM8A 3VS0A 3R1SA 5J79A 1E1VA 4Q9ZA 3BHVA 3MJ2A 4IHPA 4ITHA 4QP4A 3HEGA 4HCVA 5AR5A 3TV4A 4AWIA 5AUTA 4KRDA 3VBQA 1BL7A 4QTBA 2PVNA 3SD0A 2VWVA 4A07A 3RVGA 3UODA 4DFBA 3CP9A 2VWIA 3F82A 4YZMA 4FIEA 3G90X 4IFGA 2GNIA 4EQCA 4QMMA 4CFVA 2CKOA 3DXQA 3ULZA 4G17A 4XV9A 3E8DA 4NTSA 3OTVA 1OB3A 2HK5A 1ZOHA 4DGLC 3BBWA 5EHYA 5BVEA 3ZH8A 4KKGA 4OAUC 2ZFYA 2EXMA 1E1XA 2H96A 2UW5A 3P7CA 4B6LA 3HA8A 5DR6A 4G16A 2Z02A 4C38A 4XG2A 2WQBA 4I6BA 3HGKA 5EI2A 3PP1A 4V01A 4BBFA 3MESA 3C5UA 3DCVA 3GC0A 4RG0A 2OJ9A 4EC9A 3SAYA 1W2FA 1U5QA 2YHVA 4FOBA 4RT7A 1ZOGA 3QRJA 3RI1A 2BAQA 3O2MA 3FEGA 2E9NA 2W17A 5CSVA 5A4QA 2PUIA 4IVBA 4O7YA 4FR4A 2ERKA 4DH7A 3BU6A 2QG5A 3LFFA 5KKRB 2IG7A 4EZ7A 3QZFA 4Z7GA 3ZXZA 4YJTA 4F7JA 3NUPA 3O51A 3CCNA 2EB3A 1SVEA 3P0MA 4D9UA 5AP1A 4QPMA 3UQCA 3CQEA 1BMKA 2UW6A 3O8UA 4D5KA 5L3AA 4QP2A 4EEVA 4J97A 1XMMA 2BRGA 4IX6A 4PV0A 5LMAA 2ZVAA 3FLNC 4DCAA 2EUFB 2BZKB 3PA5A 2ZV2A 1AD5A 1MRYA 2CPKE 2QHMA 4IB3A 5LMKA 2A4LA 1R0PA 2IW6A 1FINA 2J0KA 3QGWA 2XIZA 3C7QA 3DK6A 4QQTA 2YM4A 4X2FA 4BC6A 4C4HA 5K4IA 3Q04A 3KIOC 3EZVA 5C8MA 3V04A 4C7TA 1M52A 4A9RA 3RM7A 2XALA 2ERZE 2JDOA 4I5HA 4QTCA 1IEPA 3TZ8A 3EQHA 3UMWA 4BCMA 3WE8A 4ZSAA 4BYIA 5L6OA 3RCDA 5E8ZA 4FEQA 4ZY5A 5DLSA 3CEKA 5H8EA 4EQUA 3ACKA 4H39A 4F1MA 5AV4A 2QOLA 2JKQA 4C4FA 3LJ1A 2XEZA 4WSQA 3AKLA 3H10A 2AQXA 4MYGA 3SDJA 1NT2A 1OGYA 3P5JC 2XKCA 4PNIA 1JQHA 3MVLA 5DBXA 2IWIA 4D28A 1ST4A 2VWXA 2WMVA 1GZKA 1HCKA 4HVGA 1J7IA 5E1SA 3OEFX 3LXKA 3CQWA 4JT3A 4L44A 4BDJA 1ZYSA 3BCEA 5DNRA 5ETIA 3UZPA 4O0UA 4X2GA 4FTTA 3PIYA 5BQ0A 2PUPA 3ZCLA 2CCHA 3EB0A 3ZSHA 3IDCA 4FZAB 3B2WA 2PE2A 4YJQA 4J99A 5TR6A 3TZ9A 3I4BA 4IX4A 3ZBXA 2QR8A 3JY0A 3MI9A 3WZKA 2X6DA 4MF1A 2XP2A 2PZ5A 5F4NA 4AZWA 2BR1A 2ITXA 3O7LD 4R5YA 4AF3A 2IZRA 4U79A 5D11A 2XK4A 1YRPA 2OICA 4JVGA 4YJSA 3D5XA 3U9CA 4C02A 4E6QA 2XS0A 5G6VA 3W2OA 4ZZNA 3F88A 1ZAOA 4J7BA 5CU2A 3BHUA 4Q2AA 1PMVA 4EH5A 4R77A 2W0JA 1L3RE 3F6XA 3KREA 1XR1A 3WYYA 4EBWA 2XKEA 5M4FA 5DEWA 2VTRA 5AUUA 4RA4A 5JFSA 3PZHA 2UW3A 2FYSA 1F5QA 3OOGA 2W06A 2W1FA 4D1ZA 4DTBA 4GJ2A 3HMMA 4KABA 3E8NA 4FJVA 5M08A 2PULA 4LUDA 3VS6A 2CGUA 3COKA 3MY5A 4JRNA 4ZTLA 4LDTA 5BVWA 3BV2A 3QCQA 5AJQA 2BALA 5E1EA 4W4YA 5J95A 2CHLA 4HVSA 2WIPA 4FGRA 3OHTA 4MBJA 4DCEA 4YU2A 2CGXA 3AC2A 1FOTA 3OCBA 3MW1A 4TRLA 5CNNA 4BDHA 4L3PA 4QMTA 3ZO2A 1YDTE 3A4PA 5I9WA 2YZAA 3AMAA 5K5XA 5DPVA 2JLDA 2HOGA 3UOHA 5DEYA 3QQHA 3LFDA 4FEXA 5M57A 1CTPE 1U54A 3EN5A 3PXKA 1H0VA 4FSQA 4QNYA 4B99A 4CTBA 3LXPA 2OH4A 3MV5A 2Z7RA 3PLAE 4RBLA 3W18A 4JG6A 3DKGA 4MD8E 4NM7A 4MXOA 3E3BX 4MXCA 3FYKX 3HZTA 3VJOA 1PY5A 4KIKA 2XF0A 4RC4A 1R78A 2Z7SA 1NW1A 2XM9A 3V5TA 2OU7A 3KULA 4JJRA 4C37A 1KE9A 2ZB0A 3D0EA 2NO3A 2ACXA 3C1XA 4QYGA 5D7AA 4FKOA 4WD5A 2J5EA 4NKSA 5AIKA 3UDTA 4CT2A 2C1BA 3DU8A 4DEGA 3R8LA 2C68A 4NJDA 3BYVA 3F3ZA 4LI5A 3PWYA 2KTYA 4CZUA 3MPAA 4E93A 1YI6A 3A99A 1BI7A 4B4LA 3A60A 4GK2A 3NSZA 3R02A 3ZEWA 4QDEA 4MAOA 1H1SA 1LEWA 3VIDA 5M06A 2BVAA 4EUTA 4FODA 1QPEA 2BRHA 4LQMA 3ZEPA 2NNWB 5AWMA 3OWLA 5AIRA 3BIZA 4GRBA 5HNIX 4FKLA 3CKWA 4GU6A 2AEGA 2HY0A 4G3FA 5FXSA 3RAHA 5IEVA 2OIDA 1XBAA 4XLVA 2I0HA 4YPSA 3G6GA 5HE1A 3HVCA 4L68A 1OUKA 2F49A 3QTSA 2ONLA 3MTLA 4RVLA 1ZOEA 3QRKA 1Q97A 3FAAA 3A61A 4OTPA 3DZOA 3T3UA 4DHJA 2WQEA 5L2QA 3EQCA 4EOLA 4TWPA 5B0XA 5T3QA 2YZLA 3GC9A 3UZRA 4IWQA 2O3PA 5D1JA 4HYHA 3HV3A 3C13A 1MRUA 3FMDA 3KC3A 3V6SA 2R5TA 3BE9A 3QXOA 3R28A 3UG2A 4D1SA 3ODZX 3WARA 4JOAA 3NX8A 2R0IA 4ANBA 4FZFB 3GUBA 3IW5A 3R7YA 4FUXA 1ERKA 4USDA 4XP2A 4M0YA 5L6PA 4TT7A 1U59A 2JAMA 4GYGA 4IM3A 4FT7A 5EYKA 4A7CA 3LMGA 1H28A 3EQGA 4S33A 4ZEGA 4IZ5A 3UIBA 3ZS5A 4IAKA 4DYMA 5IH5A 1G8KA 4O4BB 4RQVA 5TF9A 1P2AA 4RC2A 3LKMA 2ZM4A 5IEYA 4U6RA 4XUFA 1LP4A 1M2QA 3COIA 5K3YA 3ZRLA 3AKKA 2IO6A 4ENYA 3G6HA 4UMRA 3FMNA 4CSVA 4H1MA 4UZDA 3WF9A 4I6QA 5A6NA 5ANEA 2XAMA 1U4DA 3I5NA 4A4LA 2XNGA 3F61A 2GU8A 3R71A 3NNVA 4FZ7A 4LL0A 2OBJA 2QOHA 4U45A 3ZO3A 3C5IA 1H25A 3WIGA 4NTTA 4WKQA 3UYTA 2C0OA 3RPRA 3ZUUA 5HO7A 2C6MA 3EL7A 4QYYA 3H3CA 4FGBA 4YO4A 1J3HA 3F69A 3OC1A 4QEBA 3VN9A 4RIYB 2XZSA 2O63A 4X2NA 4EJNA 4KIPA 2CJMA 2E9VA 4ENXA 3R21A 4M8TA 4F9CA 4DT9A 4JDHA 4ASEA 1UV5A 1DI9A 2WTJA 4IZAA 5TO8A 4PPCA 3R1YA 3FQSA 1FMKA 4O7SA 5B2MA 3W2RA 4KAOA 4DH3A 3ID6C 4Y46A 4PNKA 3E8CA 3NUUA 4FIHA 4X3JA 4EZ5A 4TNBA 4X3FB 2C6IA 4RJ5A 3AGMA 4BTJA 2Y4IB 4RX9A 5LMBA 1OZ1A 4IXPA 3RHKA 4ZZOA 3KMMA 4N57A 3TXOA 4YTFA 5HNBA 2YDJA 4B8MA 5J7HA 2UW0A 3K5VA 4Y5QA 4C57A 4EKKA 4UMPA 4JBVA 2PUUA 4R6VA 4AE9A 4G3DA 4DN5A 1WBNA 5C4KA 3P23A 3PLSA 2ZV9A 4B7TA 1PXPA 3R1QA 3EYHA 4WUAA 5HLPA 1QPDA 3Q2JA 4PMTA 3AC5A 4WT6A 1REKA 4FNWA 5A4TA 4AAYA 4LV5A 2X7GA 2E9UA 4U8ZA 5LXMA 3CPCA 1GZ8A 1UVRA 5CNOA 3DFAA 3NNUA 4USFA 4YTIA 3JXWA 4NIFB 3NW6A 5IUHA 4FV8A 4L8MA 5CSXA 4MVFA 3TZMA 3NAXA 1MQBA 5IUGA 4RC3A 1G8SA 2PVKA 4ANQA 2XEYA 4PL5A 4BWXA 3BYUA 3VWAA 2HENA 3IDPA 3O8TA 5L2WA 3R8PA 1DI8A 4E73A 3GNIB 1G8AA 1G8JA 4ZXTA 2DYLA 3FC1X 4UEUA 4TYHB 3B8RA 4F78A 4E20A 2PMOX 4EYJA 2J4ZA 3IW4A 4YSMA 4BKYA 4I22A 5CALA 2LGCA 2Y9QA 2YAKA 5E8SA 5HO8A 3EQBA 2CN8A 3FWQA 4J52A 5C8NA 2UW8A 2UVXA 3EQDA 4HYIA 4ZS4A 3S00A 3NYXA 3PVUA 3TCPA 1AQ1A 3NVMB 5C27A 1M17A 4BKJA 4K6ZA 3E7VA 4FL1A 3FLWA 2VO6A 3SX9A 1F0QA 4IZ7A 4CG9A 4AT3A 4CTCA 5CXHA 3MFTA 4C3PA 5M56A 3L9MA 4BF2A 4FT5A 3AOXA 4GUEA 3GVUA 5A3XA 1W98A 4DHFA 3KK8A 4GMYA 4AW2A 3W0RA 3AMBA 3NYNA 5H9BA 1BL6A 4CG8A 3RJCA 4IC8A 3ANRA 3Q9XA 3U4WA 5FEQA 1G3NA 4AOJA 2NYAA 3F2NA 1OL1A 3HECA 3F3UA 4KKHA 2YN8A 2I7QA 3PY1A 5JMSA 3GP0A 4WG4A 4C35A 4OT6A 4EH2A 4PP7A 3UNKA 3ATSA 4BGQA 4WUNA 1SNUA 3DBQA 3LLTA 4UXQA 4E1ZA 5LARA 4MTAA 2JEDA 1PKGA 3WZUA 2PMNX 4YSJA 3PG1A 3GQLA 4ZAUA 5HOAA 5HZNA 2PTKA 3BLHA 3LCDA 2UVYA 5DI1A 3BL7A 3R7VA 4O0RA 3U9NA 2ETKA 3VBWA 5CENA 2B9IA 5IQDA 1XH5A 4A4OA 4NCTC 4FVQA 3SG9A 2R4BA 3R04A 4EORA 5A14A 2XNPA 3ULIA 4QO9A 4ZSGA 2I6LA 3FHRA 3ORLA 1JKTA 4JR3A 4GKIA 1SM2A 1CKJA 1OIQA 4JAIA 2OW3A 3RAIA 3LOKA 4KIQA 3FKOA 1NVSA 4H3BA 2RFSA 2YFXA 4IB0A 2OH0E 5GJDA 5H8GA 2B9HA 2BIKB 3IK3A 3VBXA 5AR4A 5KBRA 2WB8A 4RZVA 2YISA 4HVDA 3Q5IA 4LV7A 4ZTHA 5JGBA 4B8LA 5IQHA 2QR7A 3FSKA 3CE3A 1UWHA 3PYYA 4PMMA 4TWOA 5ANDA 5LOHA 4ZTQA 2BRMA 1YXUA 4BIDA 4PP9A 4M84A 5DG5A 3Q96A 3WIKA 3AKJA 3SW7A 3LCTA 4FT3A 4X6QC 5IEXA 4GW8A 2PZYA 4IB1A 3W16A 1O6YA 4E4XA 2IN6A 4L7FA 1H00A 1OKYA 3NUXA 4HJOA 3RWPA 4FBXA 4DA5A 2C69A 3ZC5A 2O0UA 4MNEB 3DBCA 4OT5A 3QAME 4JXFA 4LOQA 4O4EA 3NPCA 2WXVA 5AR3A 3RPSA 3VUMA 1IR3A 1A9UA 4G5PA 3THBA 1IAJA 2BDJA 2AUHA 3ZMMA 4M14A 4FG7A 3ZZEA 5CT0A 2QLUA 5FWKK 4DC2A 4Y8DA 4F9YA 4BHNA 4CLJA 4D5HA 4FL2A 5I9XA 3TTJA 4MWIA 1Y8GA 4YR8A 1UU3A 3PFYA 3QQUA 3ZYAA 3WYXA 3PE1A 4F0IA 4F09A 4FT9A 3QQGA 4FV9A 2VN9A 4AT4A 5LJJA 3AQVA 4MD7E 4WNKA 2VTOA 2WTIA 4KSQA 3HLLA 3VUTA 2BZJA 3MDYA 3WZJA 1BX6A 1NA7A 1Q41A 2B53A 3EHAA 4PPAA 3AC4A 3QC9A 4BJJB 2C6DA 2BZIB 4YLJA 3DTCA 5CU3A 4WG5A 2P33A 4FYNA 1XQZA 4BICA 3BHTA 5E92A 4BI0A 5K4JA 4DFUA 3FLYA 3BYMA 3H4JA 4FSRA 5CF6A 4YMJA 4EHEA 4XV3A 5FTGA 4O22A 4PRJA 5IQGA 3UIMA 4ACGA 3BEGA 3C0HA 3MTFA 2VTTA 3Q52A 3QTUA 1UNHA 4O27B 2IVVA 5M44A 5AADA 3N51A 4ID7A 2JIUA 4M7IA 3OUNB 3PG3A 3SOCA 1XH9A 4TTHB 2W05A 2BRBA 4X7QA 2R7BA 4UMQA 5ETFA 3TNWA 2XARA 2CLQA 1M2RA 1IRKA 2VTLA 4G6NA 4G9RA 4TW9A 4AOIA 3FZTA 5CAQA 3GBZA 4KIOA 5IQEA 4NUSA 4O2ZA 4O6EA 3HAVA 4YNEA 3N4VA 5KMNA 3ZU7A 3SGCA 3F3VA 3MJ1A 2YJSA 4IMYA 4OTIA 3W0PA 4FOCA 2R0UA 2PHKA 3RPOA 2W99B 3R01A 4MK0A 3GGFA 5HESA 4D2TA 3PJCA 2VO3A 4R7IA 5HE3A 3V5LA 1TVOA 3OZ6A 4BYJA 2C5NA 3HP5A 3QA0A 3IW7A 3UBDA 2ZMDA 3W8LA 2PVHA 1UNGA 3NEWA 3T8OA 1YI3A 5EHOA 4RJ6A 4EK6A 5IQFA 2DQ7X 3IOKA 4JG8A 1PXKA 4X3FA 3U51A 3R83A 4KRCA 4O7LA 5F20A 4ALWA 5C4LA 3DKOA 1X8BA 2VWWA 2R3JA 1K9AA 1YXTA 1JVPP 4IM2A 4DGNA 1DM2A 4J8MA 5EW9A 3CTJA 4ANSA 5A6OA 2OIBA 4W9WA 3SXFA 4FNXA 2HY81 2YCFA 4QRCA 4AU8A 4CNHA 4FKIA 5AM6A 5JN2A 3DK3A 3DLSA 5FP6A 3R8ZA 5CF4A 4O82A 1ZMVA 2QOCA 2VWYA 1Q8WA 1OKWA 2XMYA 1TZDA 1Q62A 1M14A 1ZRZA 2QLQA 3HRBA 1UU8A 4AGDA 5JZJA 3TUDA 5L2TA 4CMOA 4O7NA 5M53A 3ZHPC 4JIAA 3PIXA 3CC6A 3F66A 5HO6A 1PXIA 4XG6A 3ZTXA 5EM8A 5I9UA 2V22A 3UO4A 5GIPE 4ITJA 2CKPA 4IVCA 3TV6A 3BE2A 4HPUE 2CGWA 4TKSA 4FKWA 3BLQA 1TQIA 2QO9A 3VS5A 1QL6A 2WHBA 3W0QA 5BX0A 4IW0A 2XJ1A 2XANA 4AE6A 3C4ZA 1WBTA 1ND4A 5AMNA 3OWPA 3F5GA 5I3RA 4HPTE 3RZFA 1KE7A 3UOJA 3W55A 3UIUA 4H36A 5AAGA 1XH6A 5C03A 4BDDA 2F9GA 3LJ2A 2UZLA 3PSDA 3HMOA 4PDSA 4TYHA 3MA3A 3MH0A 3ANQA 3HP2A 2XCKA 2GS6A 3VUGA 4ERKA 5IPJA 4FT0A 3BLAA 4NM3A 4CYJA 3BKBA 4DFXE 3BQRA 2RFDA 5HCYA 5DGZA 4CEGA 4L3LA 1OL6A 4GL9A 2CN5A 3CY3A 5FEDA 3KF7A 4QT1A 3UVPA 3UDBA 4NJ3A 2CKEA 5DT3A 1AGWA 4BHZA 3R8VA 4N6YA 4AXCA 2GDOA 4GUBA 1GY3A 3FZRA 5C8KA 1YDSE 3S4QA 5CZIA 3TKHA 3RAKA 4L45A 4CZYB 2NRYA 3WILA 2XIXA 4L01A 3A62A 1OVEA 4FICA 4GEOA 2ITYA 4PQNA 2W5BA 1YWNA 2YWVA 2WU7A 1RQQA 3ODYX 1P4FA 3O17A 4NK9A 5J7BA 2OXYA 4ANMA 3KRXA 2X81A 4AQKA 3SG8A 3K5UA 4A9SA 5KO1A 3VW8A 1OIYA 3BU3A 2R3HA 3C9WA 4KNBA 4MKCA 3KQ7A 1Q8YA 3REPA 1M2PA 3AT2A 4QMOA 3P7BA 3R1NA 4IAIA 4OTGA 3CD8A 1OECA 4AACA 4LOPA 4WOVA 2GHMA 5LVNA 2HAKA 4FK6A 4G34A 3K3IA 4AFJA 2Q83A 2X8EA 2ZMCA 1WBOA 5AUWA 4DITA 5A4EA 3EKKA 4B9DA 4YURA 4O1OA 4UWCA 2R2PA 4R1VA 4CMUA 2UW9A 5L8KA 2Z8CA 3V5PA 1YXVA 2V5QA 4FTOA 4IX5A 3E93A 2F2CB 3NW5A 5CU0A 5FBNC 5LWMA 5EK7A 1K3AA 1P5EA 5J8IA 1QPCA 1SVGA 3UG1A 4UBAA 5DMZA 3OG7A 1STCE 2O5KA 3BGQA 3D5UA 5JQ5A 2J0MB 4APPA 5JT2A 4YTHA 4IEBA 3DJ6A 3HA6A 5EQPA 4AG8A 1GAGA 1JNKA 1ATPE 3OY1A 3RK7A 3BYSA 4A9TA 3KCKA 1Q99A 4UYAA 3VUKA 3PXRA 4ZTNA 3II5A 2ZAZA 3W2SA 5AP4A 4F99A 3BX5A 2CLXA 4HGTA 2BUJA 2QOIA 3CXWA 4ZLOA 2VV9A 4I93A 1XJDA 3FHIA 2HWOA 5AM7A 4WBBB 1KWPA 5JFWA 2WEIA 3QC4A 4J8NA 4O0YA 4D4YA 2IVTA 1WFCA 2YACA 4AN2A 3ZRKA 2OO8X 2AC5A 3HRCA 2JKMA 3OY3A