3VN9A

Rifined crystal structure of non-phosphorylated map2k6 in a putative auto-inhibition state
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
291
structure length
291
Chain Sequence
QNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dual specificity mitogen-activated protein kinase kinase 6
publication title Crystal structure of non-phosphorylated MAP2K6 in a putative auto-inhibition state
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 291
sequence length 291
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2012-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3vn9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3vn9A01
4YZNA 3JS2A 3U6JA 1H01A 4UX9A 1J7LA 3E8EA 4QP7A 3IW5A 2X0GA 3DTCA 2W17A 4CFMA 2QG5A 1QL6A 4PMSA 2C3JA 3LE6A 2G2IA 3ORMA 4ANSA 4ZTMA 2R0IA 3I0OA 4BGGA 1J3HA 3CY2A 3M1SA 2QOFA 3QRKA 4JX3A 4FEUA 3HEGA 2JFLA 1PF8A 4BCMA 4NJDA 3R9HA 4I4EA 5DLSA 4G9CA 3PJ8A 2BZJA 5HBEA 1ZZLA 2EUFB 4FSQA 4UMQA 3RK7A 4E4NA 4BWXA 2CNQA 4YC8A 4RIXB 3OOGA 4IWQA 4ASZA 5IQBA 3V6SA 3MH2A 2WIHA 4U81A 2B54A 2JIVA 3UC4A 4F1MA 4ZSJA 4CMTA 3FZ1A 2Q0NA 1Q8WA 2BTSA 5IEXA 4M66A 4ACHA 4EH3A 2DYLA 5DPVA 4G3FA 4CT2A 4F7LA 3FLYA 5K3YA 3QTZA 4O0XA 4EH9A 2JAVA 3E88A 1YI6A 2VTLA 3BU5A 3FQHA 1H07A 5HLPA 3VW6A 5A6OA 4I1ZA 4CVAA 5CSHA 2PVKA 4U43A 5EDQA 3TZ8A 5HO8A 2W06A 3BKBA 3KXMA 3ZC6A 3NNVA 4X7QA 2OH4A 4F9WA 2PPQA 4OT5A 2W5HA 2XK3A 4GK4A 3EQGA 4UN0C 2GQSA 2QKWB 4AT5A 3EZRA 2HK5A 1MUOA 2I1MA 3DNDA 4WNOA 3TN8A 2Z2WA 3G9NA 4E4XA 1RW8A 3PZEA 3R8PA 2W1ZA 4MNEA 4FR4A 2PU8A 4FKPA 3IW8A 4KKHA 4W4WA 3W18A 2C6OA 2QOBA 3RZFA 2JD5A 3CKWA 2OI4X 3CTQA 4FKTA 3ZO3A 1WMKA 5JGBA 2VGOA 3OCTA 3D9VA 5BVNA 4YHTA 2QLQA 2ERKA 4I3ZA 4XMOA 4BCOA 2OIBA 3AC1A 3GCQA 4RJ4A 4ALVA 4D0XA 3RM6A 3VAPA 3PPZA 3FI2A 5CVGA 3UO6A 3DB8A 2W1CA 3FPMA 2XKCA 3BLHA 4K6ZA 1NY3A 3P79A 1V0BA 1PYEA 4FYNA 2ETKA 4AACA 4MCVA 4BICA 3COIA 4YJSA 4C57A 2J2IB 5IQIA 3R02A 3EN5A 2BPMA 4F4PA 3FZSA 2RSVA 3RALA 3ORZA 3TV7A 1OUYA 3ACKA 3E92A 3HMMA 4IX6A 1W84A 4UWYA 4UZDA 2XB7A 4ASEA 4AZVA 3QL8A 2QOLA 3Q6WA 4G3DA 3OHTA 2XNGA 5CNNA 4PPAA 4NM3A 2FVDA 4KAOA 4LOPA 2R7BA 1S9IA 3L8VA 4PDOA 2XH5A 4HGEA 1JBPE 1QCFA 3BWFA 5HIBA 3H0ZA 4AA5A 2Z8CA 5J8IA 4NUSA 3ULIA 5DEWA 4DEGA 3TACA 4YJOA 5GNKA 4A9SA 1YRPA 1KV2A 1JQHA 5B2LA 3BI6A 2PUUA 5DWRA 5KHWA 4N70A 3UO5A 3MN3A 5L2SA 3ZFMA 1R39A 3NW6A 4PP9A 5KMJA 2YLEA 3LFFA 3ZO2A 5CSWA 1VYZA 4O81A 2O5KA 2VWZA 4X2NA 4CFWA 4ZJVA 3FLWA 2ZOQA 4BB4A 3Q96A 4UWCA 2WMVA 1V0OA 4QMLA 2WQBA 4OBQA 3GC8A 4NM0A 3HMNA 5ANKA 4GK2A 2OO8X 4BDFA 5FTGA 3NUNA 2GS7A 1LPUA 3NUUA 2Z7SA 2X7OA 3PZHA 1Y6AA 4LOOA 4R3RA 3ZBXA 4BCPA 3BBTB 3FKOA 4I24A 3EN7A 3LJ1A 4PTCA 4GEOA 4X2KA 2FSTX 2ZM3A 2OLCA 4E8AA 2OJFE 4WUAA 4HVGA 2XYNA 5CF6A 4OAVB 3I4BA 1JKKA 5GHVA 1FVTA 4YJPA 4FVRA 4IC7A 3TT0A 3ZH8A 2Z7RA 5IQFA 4YLJA 1DI9A 3CGFA 3KMUA 2WMAA 2OKRA 1YHVA 3MB7A 3RWPA 4FTCA 4AQCA 5HTIA 2BR1A 4C3RA 3CQUA 3RAIA 4GV1A 2UUEA 2XEYA 4USEA 2NRUA 4D4YA 4Q2AA 5EK7A 3II5A 4FIEA 2BZHB 3EJ1A 4H3BA 2JDVA 5C03A 3QBNA 2PHKA 3MIAA 2WU6A 4E73A 2YM5A 5AX3A 3F61A 4DFXE 5C8NA 3UQFA 1I09A 3FY2A 3QRJA 3RMFA 4GYIA 2OIDA 3MTFA 5BYZA 4DCAA 3PY0A 4F9BA 3HECA 2YIRA 1IA8A 4MWHA 3HX4A 4TYHB 3R9DA 5DN3A 3F2AA 3F2RA 2J5EA 2ZV8A 3V5WA 3FMMA 2JC6A 4FGBA 4QMVA 3UYTA 4ZSAA 3UNKA 3E5AA 3R1YA 5CEKA 4DT9A 1URWA 4FT9A 2IW8A 4QYGA 3BLRA 4AZTA 5M57A 4WKQA 4O7LA 4PL3A 4Q5EA 3WIGA 4PF4A 3HUBA 4PL5A 5AX9A 2VTRA 3O8UA 2CDZA 5F95A 5AJQA 1DAYA 4CFFA 2OWBA 4QP1A 4BZDA 3UG2A 4FEVA 5HD4A 4MXOA 5CF8A 4AZWA 3LM0A 3KRXA 4NU1A 1UWHA 5LQFA 4I5PA 1IR3A 3ODZX 5KE0A 3H9RA 4BTFA 3HL7A 2GNIA 4FI1A 3F66A 2ONLA 4FKJA 1FMOE 3VJOA 4C3FA 5A6NA 4FL3A 4G3CA 5ANEA 3RJCA 5I9VA 1YWVA 5KMIA 2VWIA 2WAJA 4EOJA 5EKNA 3Q52A 1OPJA 4RVTA 2V7AA 4P5QA 5CSXA 4GSBA 5M07A 3EOCA 1OL7A 4NH1A 3W2SA 1PKDA 2H9VA 3IG7A 2C5NA 3U4UA 4DGGA 1QMZA 1IA9A 3P7BA 3DT1A 4G5JA 3L8SA 1H8FA 4NKAA 4E5WA 5JKGA 1M14A 2JKQA 3TTJA 2O0UA 4X6QC 2WTIA 4EC9A 3ORTA 4HZSA 4ZTQA 3WYYA 4N57A 2PZPA 3DAKA 3OF0A 4BCNA 4QP6A 4CV8A 3MGYA 3QCSA 4N6YA 4EEVA 2PVRA 5IQAA 3VBXA 2A2AA 4GMYA 2PMNX 3AT3A 4FEWA 4B7TA 3W2QA 2CHLA 4LMUA 5AUWA 3R30A 4HW7A 3TEIA 4GIIA 4ZZMA 3IOPA 3MS9A 5JH6A 3ZZEA 2VTJA 3P7AA 4JDKA 3LFCA 4QNAA 4FT0A 3G6HA 4H39A 2GSFA 5B2KA 3BHTA 5CEOA 2R3JA 4IZ7A 2O3PA 4NWMA 4D9UA 4FKGA 2O2UA 2CPKE 3EWHA 3KXHA 3BU3A 3QRUA 1AQ1A 4FIGA 4DFLA 4EK3A 3A7IA 5AA8A 2XNBA 4B0GA 4B8MA 5J9ZA 4EHGA 4KKGA 4L3PA 2XZSA 3VS3A 4R7IA 4WT6A 3QRIA 3VUDA 4AT3A 3ZS5A 3FLZA 3IK3A 5IH5A 3ZBFA 4QTDA 4LM5A 1Q8UA 4ZTRA 4RC2A 4RZWA 5AV4A 5F94A 2P0CA 2WZJA 2BVAA 2YN8A 2ITYA 3ERKA 4I0RA 5HCXA 5KMMA 5DHJA 5L4QA 4GUEA 3UODA 3DBEA 3QQFA 4JQ7A 4WBBB 3NPCA 4IJPA 2F57A 4RPVA 3LOKA 4AP7A 1OKWA 2R3NA 2REIA 3OOMA 3DK7A 4JVGA 5E91A 5EW8A 5HCYA 3ZYAA 5TKDA 4AAAA 1WBSA 3ZSGA 3NUAA 5IQEA 3K54A 4KBCA 3GP0A 3AD5A 1OL6A 3AOXA 1W98A 3GEQA 5AIKA 4BKZA 5IPJA 4R3CA 5CNOA 4J53A 1LEZA 4WNMA 4BHZA 3OCSA 5FGKA 4A4OA 3DJ6A 2W1EA 5EM7A 5LWMA 1WFCA 5LMAA 4ZMEA 1UNHA 1YXTA 2F7ZE 2ZAZA 4IADA 4G6OA 2I0EA 4XG8A 3BGPA 2YZAA 3EYHA 3L1SA 4A9YA 3PXZA 2OF2A 3TKHA 1ZY5A 3ZSIA 5CXHA 5AUZA 4ZTHA 5HEZA 3RZBA 5E8UA 4U42A 3NWWA 2IZUA 4EK5A 2BROA 2ZJWA 3DKCA 4XP3A 2PVFA 4GJ2A 5M4CA 3V8SA 4CZYB 3S1HA 2B55A 2PVLA 2BMCA 4JBOA 4AW5A 2YFXA 1Y91A 2ITPA 3QD2B 2H34A 4MVFA 2OXDA 2XKFA 5C26A 4RC4A 5J95A 4MK0A 5GJDA 3EHAA 1CTPE 3PE1A 4NCTA 2IVSA 1H1PA 3T8OA 4XRLA 4Y85A 4MD9E 4EH8A 1CMKE 3CLYA 3RHKA 4QMXA 3ODYX 3UOJA 1GIHA 1Q3WA 2PZYA 4UXQA 4AFEA 3TM0A 5J7BA 4EUTA 5JGAA 3UPZA 4H1MA 3ATSA 1KSWA 3A7HA 4IFGA 3R2YA 2X2LA 1UVRA 2VWXA 3GI3A 4ZZNA 1HCLA 5B0XA 4D28A 4EOMA 3SKCA 3UP2A 4CKJA 2PSQA 5JFXA 4FC0A 4QMYA 5F9EA 2A0CX 2QU5A 5KKRB 1XH5A 2WMQA 2QOOA 3LFSA 4X3FB 2OGVA 3RK9A 5IDNA 2CKPA 4DE4A 1TVOA 1IRKA 2UW0A 4FIJA 4DBXA 3CJFA 1J1CA 2E2BA 3MFUA 4XG9A 4PMPA 2OK1A 4DN5A 4QMTA 5M06A 4CZTA 3OS3A 4BZNA 3OMVA 5EYDA 4C4FA 5HX8A 2ZM4A 5FEEA 2CN8A 1JSTA 3UIXA 3P78A 4OT6A 2C69A 2XA4A 2R3RA 4MXCA 4TWCA 4NT4A 4A4LA 3D5VA 4OBOA 1U4DA 1UV5A 3TIYA 2OJ9A 5HO6A 3C5IA 1T46A 5IQGA 4FV2A 2OBJA 3Q9XA 2YCFA 1OI9A 4U44A 2LGCA 3NLBA 3TJCA 2PE1A 2VO7A 4MD8E 3C4ZA 2PMIA 3F82A 1TQPA 3MVMA 3JXWA 3POOA 5LCKA 5BVKA 4BVUA 3EB0A 3E93A 4E20A 5LVPA 1JSVA 4FV6A 1UNLA 2XIYA 5HG9A 5BVEA 4O1PA 5CU4A 4FUYA 4XRJA 2J4ZA 4IB3A 3DXQA 3FLNC 3O2MA 4ZSLA 3KRRA 1JWHA 4O7NA 4ZMFA 4CCUA 1ERKA 4K11A 2XK9A 4V05A 4TTHB 3VJNA 4G3EA 2QHNA 4FYOA 4BBMA 4ZLYA 5HVKA 4RRVA 2OXXA 5EG3A 1W8CA 1QPJA 4BYIA 3TJDA 3KCFA 4A9UA 4DITA 3JVSA 2UZDA 2XNPA 3W16A 3FQSA 3BYOA 3RK5A 4BGHA 5F4NA 4RQKA 3IW6A 2BHEA 4F0IA 4GH2A 4KA3A 1JLUE 2IVTA 4JI9A 5E8XA 4Y8DA 3LMIA 3JY9A 4IH8A 2R3MA 4KNBA 2CKOA 3W32A 4EH2A 3UIMA 4FG8A 3UQCA 4JX7A 2Y4IC 3COKA 4G6NA 4OTDA 4AXAA 1SYKA 3QTXA 2J6MA 3E3BX 2A1AB 2UW6A 4MNEB 5CVFA 3D2KA 3S4QA 3P4KA 3WE8A 5JQ8A 3MY5A 5CU0A 3G33A 1P4OA 4DTKA 1P5EA 4FV5A 3ACJA 4KIKB 3NYVA 4U5JA 4BIEA 2OJIA 2YIQA 3IONA 1GZNA 3ZFXA 4XG2A 4EBWA 4PTEA 2UW7A 4H3PA 3IDBA 5D7VA 3Q2JA 5A4LA 3UZRA 3TI1A 4FIIA 3HMPA 5GJGA 4B99A 3HV6A 4F7SA 1KUTA 5IQHA 3DV3A 4IHPA 4PP7A 4M14A 1OMWA 2W0JA 5DR2A 2YIYA 4YLLA 4F64A 5L2TA 2JBPA 5ETIA 4TYHA 2NNWB 1TQIA 4FSUA 1Q5KA 3EQCA 4W9WA 4DCEA 4ERWA 5HD7A 3ZO4A 1YXSA 4CV9A 4MXYA 1KE8A 4XBUA 4XOZA 5AP4A 5LMKC 2XKDA 2ZDUA 3E8CA 4JIAA 1XO2B 2GHLA 3LCTA 4XX9A 4DHFA 3E8DA 3PUPA 2YWPA 1FGKA 4HCTA 4ENXA 2JDRA 3G15A 4BIDA 4XJ0A 1PMNA 2BCJA 3OUNB 3TXOA 1WBVA 3OWKA 4R1VA 5ICPA 4KIQA 2PULA 4FV9A 1QPCA 2W99B 1U46A 1IAJA 5FEQA 3PRIA 3SV0A 4RG0A 2GDOA 5CZIA 5EW9A 3G0EA 4IB1A 1CSNA 4DH3A 2Q83A 2R9SA 3EL7A 2VO3A 1H27A 2AYPA 3MSSA 3ZUVA 3AQVA 1MRVA 3MFSA 4BFMA 4E6AA 5AP2A 4I21A 3MH0A 4F9YA 3TV6A 2CGUA 1KE6A 1HCKA 1Q99A 1FGIA 4YMJA 4YNOA 4J96A 4BC6A 3GQIA 2CKQA 3OBJA 3R7OA 5AADA 3FYKX 3LFBA 3SOAA 1CM8A 4EK8A 4FBXA 4MWIA 4WA9A 4R78A 4LV8A 5H8BA 5DT0A 3A2CA 3M42A 3QAME 4YC3A 5A4CA 2OJJA 1VZOA 2RFDA 5KHXA 3AMYA 4G17A 4YZCA 3UYSA 3RNYA 3GCVA 4WRSA 3VW8A 2AC3A 2QLUA 3ATTA 4ZXTA 2BILB 4M3QA 3P1AA 4AOTA 1DS5A 4RX5A 4EJ7A 2EXMA 2QOQA 4C34A 4BY9E 1BKXA 3QQGA 4C38A 3SG8A 3R21A 5L3AA 3A7GA 3PPKA 4EKLA 3O96A 1WZYA 3O17A 2CNVA 3P23A 4PMMA 4YR8A 1PXKA 3JPVA 2JIUA 2H6DA 1PXPA 4E26A 2JIIA 2GTMA 2WTKB 4YO6A 4BDGA 1LEWA 3WARA 3R0TA 3QZGA 1PYXA 5AR8A 3UGCA 4RZVA 4QO9A 1ND4A 2QD9A 1FVVA 3E7OA 2YM3A 4XCUA 4EOPA 4LRMA 2QU6A 2QNJA 4O0YA 3E64A 3DFAA 2GNGA 5J7HA 4QNYA 1ATPE 3F3ZA 3NR9A 4YZDA 3W55A 5GINE 2HY0A 2ITXA 3UIUA 2X2KA 4I20A 2CJMA 3MV5A 2VTSA 2BRBA 4LG4A 5D7AA 5CENA 4ASDA 2XYUA 5IUGA 4LMNA 5DA3A 4U7ZA 2HENA 3ULZA 1FBNA 3BHYA 4A9TA 1JNKA 4FKOA 3EFWA 5JRSA 3QRTA 5JZJA 3QXOA 3ETAA 2NO3A 4GFMA 4CG8A 3E63A 4ARKA 1WVXA 2BALA 2C47A 2F49A 4RJ3A 3AC4A 3R7VA 3HV4A 4LV5A 3VF9A 5HOAA 5CU2A 5EM5A 2UZUE 3UIBA 1WBOA 4CLIA 3BBWA 4PPCA 4U41A 5JEBA 5DGZA 4FTUA 4J8MA 1WAKA 2Y6OA 4ERKA 1FPUA 2VN9A 4IX5A 3ZONA 4PUZA 4QQCA 3GCPA 3HAVA 2HZ4A 3FEGA 2CGXA 2QO2A 4KWPA 4S33A 2IJMA 3HV5A 4XG3A 2XRUA 4YJUA 3FC1X 4C4JA 3O71A 2XK6A 4GU9A 4Q5HA 2YCSA 4U6RA 2VWBA 2WFYA 1PXOA 4BKJA 4C02A 4NW6A 2EVAA 3S2PA 3VUMA 1CDKA 1UWJA 2R3LA 4OR5A 4E6DA 1OBGA 5CEPA 4QMNA 3WZJA 2YAKA 3G90X 3LW0A 4Z55A 3DGKA 4L68A 2IZRA 3VQHA 4BIBA 4XUFA 2ETMA 3PXYA 1O6KA 1GAGA 1Q3DA 4UB7A 5FQDC 5HBJA 4MQ1A 4B6LA 3BPRA 2R3GA 1IG1A 4Y5QA 4OTWA 5BQ0A 1JOWB 3IO7A 3A7FA 4BBEA 5BVDA 2OG8A 4FK3A 1ZAOA 4BCFA 4JBVA 1O9UA 3IQ7A 1ZXEA 5M4FA 4UMPA 4AW2A 4FZAB 3AC8A 4EOIA 4FTOA 2OICA 3BYSA 2VWUA 3BV3A 3IGGA 3LCDA 4FV7A 2IW9A 3V04A 4R7HA 4ASXA 4UALA 3FYJX 4X3FA 3TNIA 2GS2A 3QX2A 4QYHA 3RBWA 5AP6A 2ZMCA 3UTOA 1DI8A 5IQDA 4D58A 3PYYA 4YGAA 4QYYA 4F9CA 3QC4A 3QKMA 4U3ZA 1QPDA 4RA5A 2WTWA 4IM2A 4O27B 2B9JA 2YIWA 3Q4TA 4UMUA 4DFUA 4HZRA 4FF8A 4RBLA 3FI8A 1KOAA 5IUHA 2VAGA 4YZ9A 2GNLA 4ZZOA 3ZM9A 4BTJA 3NCZA 3NVKI 5EQPA 3ET7A 3CEKA 4XNEA 4Y95A 1XH9A 5DE2A 1UKIA 4YLKA 3WZEA 5I9YA 1M2PA 1Z5MA 5DOSA 3RINA 1YVJA 3QU0A 3ZEWA 2ITQA 2W1IA 4PDPA 2X2MA 3F6XA 3HDMA 5ACBC 3BHHA 3TNQB 3VBVA 1R0PA 4W8DA 4AE6A 2E9VA 3PP0A 3TUCA 3PLSA 4RIWB 2WMSA 5FXRA 3QUEA 4K8AA 5M09A 2Q0BA 3NYXA 3I0QA 3ZO1A 3KA0A 1PHKA 2BDJA 3BYMA 3FSFA 3LFQA 5I9ZA 4AF3A 1XBAA 1ZLTA 2UVZA 3DOGA 4F70A 2R3FA 1RDQE 2WKMA 3GT8A 3U87A 4D5HA 2WB8A 3R04A 1Z57A 2G1TA 3VULA 4Z7GA 5HLNA 3QUDA 4YZBA 3FMLA 4PNIA 1ZOEA 5CAQA 4BCHA 1ZRZA 1GY3A 2YM4A 4EH6A 4UMRA 3PIYA 2QONA 4RJ7A 3EMGA 2XVDA 2BAKA 2OFVA 2C6KA 1W82A 3H3CA 5CZHA 2W05A 4I22A 3ZUUA 3QX4A 2XCKA 5ETCA 3RAWA 2V0DA 5DIAA 4Y46A 3ZC5A 3TTIA 3RM7A 1WBWA 3KQ7A 3SW4A 3F3WA 3KGAA 3KL8A 4O84A 1H1SA 3RHXA 1ZMWA 2C4GA 4KIKA 3H9OA 4E4LA 4UMTA 1GOLA 3KF4A 2ITUA 3FBVA 3CPCA 2ESMA 2H96A 4BCKA 5DMZA 5LWNA 3CC6A 3GOPA 2GU8A 3BHVA 3SRVB 3GXLA 4C61A 3ENHA 5IMXA 3PRFA 2OH0E 3TIZA 5AP1A 2C5YA 3L9NA 3MDYA 2PVMA 3DDPA 3QQLA 3A7JA 4L00A 1ZYLA 3DKFA 1H25A 2OU7A 3AGLA 4ZAUA 1UU3A 5EM6A 2CGVA 5AR4A 3Q04A 4C37A 4JNWA 4O0UA 3DNEA 4D2TA 4I6HA 4C2VA 5L8LA 2X7GA 5KO1A 4JOAA 4YBJA 3OXIA 3NRMA 5DT4A 1GJOA 3O8PA 4FUXA 4ZTLA 5JZNA 1NT2A 4F9AA 3PTGA 2CCIA 4BR3A 1OECA 4J52A 3F7WA 4I6BA 3LJ0A 5DR6A 2XUUA 4QD6A 4ZLZA 3DXNA 1XWSA 3AD4A 2RFSA 3W10A 4RVKA 1VYWA 3R7EA 1OBDA 4D2SA 4R7BA 3O7LD 3O8TA 3WZKA 2B9FA 3R28A 5TO8A 5C9CA 4DGLC 2J50A 2IPXA 2WEVA 3R73A 1AGWA 5BVOA 2DUVA 4HOKA 4MXXA 3LMGA 4G2FA 4LL5A 4CRSA 4D9TA 3REPA 4DG0E 3TZMA 2C6EA 4JQ8A 4C59A 1QPEA 3ORKA 4EC8A 4LUDA 3EL8A 2R3QA 2JBOA 4ANOA 2CGWA 2PVNA 4EH5A 2ZV7A 5A4EA 3I5NA 4FT7A 1Q97A 4YC6A 1RE8A 3I7CA 3LVPA 4RVMA 3VS2A 5HU9A 4MBLA 5FDXA 4ANLA 4FV8A 3HAMA 2XNEA 4U3YA 4AN9A 3ZRKA 5HVJA 3HVCA 3CS9A 4WSYA 3LLAA 3C51A 3PVGA 3CQWA 3EZVA 4NTSA 4F08A 3LCKA 4DGOA 2QI8A 2ZMDA 5HU3A 5J9YA 3UZPA 4HGLA 4IWPA 4FV4A 4PX6A 5BX0A 4ZS0A 2ITWA 4WRGA 5GZAA 1M2RA 3N4UA 2HIWA 2XJ1A 4FODA 5EH0A 3QD3A 3VS7A 4V01A 3FXZA 1KOBA 3R1SA 4TNBA 4JR3A 2X6EA 4EJNA 4BF2A 3MPAA 1VEBA 5FXSA 4GCJA 3KXZA 2J0JA 4Y73A 3VUIA 2PE2A 4J95A 5EHYA 3F9NA 4BCQA 5A9UA 3WF6A 2RFEA 2XKEA 4FTJA 4AZFA 4BCJA 1PKGA 2GFSA 2Y7JA 3OROA 2QHMA 2BDFA 4JS8A 4L44A 4YTFA 4YURA 4JXFA 3HRFA 5JFVA 1NVSA 2XIKA 3D2IA 3CJGA 1XBBA 3F3TA 3GB2A 4XV1A 4BDKA 4FSTA 1W83A 3G0FA 4ZK5A 2XF0A 1Z9XA 2XJ0A 1KWPA 2YCRA 3KB7A 3Q3BA 4XV3A 2PZRA 4HPUE 4ALUA 3UVPA 4IACA 4GU6A 5M56A 3MB6A 5HI2A 5HNGA 4M15A 4BHNA 3AG9A 4WHZA 5HBHA 3LMHA 4G31A 2Z02A 5L6OA 4BZOA 4V04A 1REKA 4R8QA 4BDHA 2SRCA 4YSMA 3ZEPA 1V0PA 4XV2A 4BKYA 1L8TA 1M2QA 5KKRC 3DBCA 3R8LA 5KNJA 4X3FC 3OWPA 4RA4A 5BMSA 4OLIA 2C3IB 2PL0A 2X39A 3VS0A 5BNJA 2V5QA 4QMWA 4UV0A 1SVGA 2RF9A 2VNYA 3DBFA 3GBZA 2VTNA 4J8NA 5ACKA 1I44A 3AC2A 3FMNA 3WF7A 2VUWA 2X1NA 5FTQA 5HTCA 2QOCA 4TRLA 4U9AA 2VWYA 5D1JA 2R7IA 5AAGA 1IAHA 3EYGA 3TZ9A 4XLVA 1LUFA 4C8BA 2A19B 1KE9A 3C1XA 2WTVA 3MVLA 3A8WA 2C6LA 5DT3A 3ZM4A 2QOKA 4EUUA 5I5ZA 3DCVA 5CTPA 5C8MA 2F2UA 4XHKB 2KULA 4JDHA 4BTKA 4C58A 3FSKA 3IW4A 3S95A 3DQWA 3GC9A 4CZUA 2ACXA 4TZRA 1SVHA 3PXKA 4EZ3A 1X8BA 4GIHA 4C0TA 5BUIA 4AZSA 4QTEA 5C8KA 2JGZA 2UZWE 2YDJA 3OW4A 4AA4A 3QQKA 2W5BA 3AXWA 3TDVA 2VTOA 2XNMA 4O82A 1YW2A 3EKKA 3OFMA 2GPHA 3PA4A 3DS6A 3RP9A 2JKOA 4BYJA 4FG9A 4KS7A 1XH8A 2OZAB 4ZY4A 2V62A 3QCQA 4FKVA 2BDWA 2HZIA 5EYCA 1GNGA 2GNJA 1LP4A 1FINA 2C68A 5D11A 5EDRA 4FKQA 4LFIA 3WILA 4D1ZA 3D94A 2C0TA 3BIZA 3H30A 2IWIA 2ZDTA 4D1XA 2RIOA 4EWHA 5HO7A 2UVYA 4ZJIA 4D5KA 3MH3A 1OIRA 1R1WA 4GVAA 5E8WA 4GT5A 1KV1A 4O0RA 4OTRA 4RWLA 5ETAA 3ALNA 1SVEA 5K5XA 3HYHA 4UBAA 2VV9A 3VWAA 3C13A 4FZ7A 4RVLA 5AM6A 4Q9ZA 3AT4A 4OTIA 2E9OA 1NW1A 4CFNA 2P33A 5L6PA 5E8TA 3CTJA 4W9XA 3BHUA 4BDEA 3V5LA 5EKOA 3VF8A 2IVVA 2WMTA 2BIKB 4BWPA 4E5AX 3E3PA 4JDJA 5LCJA 3WF9A 2P4IA 4ORKA 5FM2A 1XJDA 4L01A 5ANDA 1IASA 4M8TA 1OL2A 4FSWA 4N0SA 2J9MA 5M55A 4KUJA 3L8PA 3WIKA 4AGDA 4RIWA 2XJ2A 5I3RA 4QPMA 4QP2A 5L8JA 5IKWA 5CEIA 1U5RA 2GHGA 1G5SA 3LIJA 3FUPA 5J87A 3VN9A 4OUCA 2JFMA 2WMRA 3NUSA 5HTBA 3UQGA 4F0FA 4EONA 1H1QA 4KSPA 3FKNA 4IC8A 2C5XA 3LQ3A 1RQQA 3A8XA 1HOWA 5HE1A 2WO6A 4I4FA 2XNOA 3EFLA 5IISA 3FI4A 5K0KA 2YHVA 4IAAA 3Q2MA 4UYNA 4JAJA 5BMMA 4WG4A 2W1GA 5E7RA 5KMKA 2W9ZB 3UC3A 5AEPA 2OXYA 2PZ5A 5CF4A 3E7VA 5FBOA 3DJ5A 3WI6A 3FZRA 4FTIA 1XBCA 2W1FA 4CD0A 4O7RA 4ACCA 4CT1A 2YJSA 2HXQA 2HZ0A 4B4LA 3MPTA 4JJRA 5CANA 3PIZA 4NFNA 3MWUA 4AGCA 2WMWA 3RNIA 5JRQA 3IGOA 2R3OA 2C6IA 2IZSA 3P5KA 1P14A 3A4PA 3WF8A 2JDOA 2YM6A 3EIDA 4WSQA 3PA5A 3SRVA 5A46A 2HOGA 2B9HA 4GW8A 3NYNA 1SZMA 3B2WA 4LGDA 4DLJA 5A3XA 3L9LA 3DLZA 5M08A 3V01A 3HDNA 4KABA 1U5QA 4R3PA 3VC4A 2JKKA 2HW7A 3R8UA 3R63A 4X3JA 4BTMA 2UV2A 5FTOA 3UBDA 3UO4A 5IZFA 4ANMA 3R1NA 4FV1A 3KU2A 3S0OA 5F1ZA 2DWBA 2W9FB 3BU6A 2AUHA 3CCNA 4LRKA 3RVGA 4U45A 2CMWA 3KN5A 2C6MA 2QCSA 3M2WA 4IW0A 3UJGA 4CCBA 1LR4A 2EWAA 3DZQA 3VUHA 4CYIA 1H1RA 4I0SA 4U0IA 5C4LA 5AMNA 3KMWA 4JG6A 4DGMA 3QKLA 2WEIA 3LPBA 3B8QA 4FSNA 3K5UA 1RJBA 2XBJA 4TKSA 4WO5A 4YJNA 1PMEA 4IVBA 3ZUTA 4YUQA 4X2JA 3Q6UA 4XG6A 2CSNA 2WQOA 5HG8A 1KE5A 3ZRLA 2ZYBA 3OBGA 2BTRA 2UVXA 3PG3A 2C3KA 3RKBA 3CE3A 1J91A 1Q24A 2WTDA 3EQFA 5EOLA 3C4CA 2HW6A 4E5BA 3UG1A 5CVHA 4EORA 4S31A 2R3HA 2W1HA 4CFVA 4KD1A 5E92A 4JAIA 2XIZA 3TCPA 4LQMA 3LQ5A 3QYWA 2UW4A 1APME 4M97A 5AP0A 1PXLA 4JBPA 5HNBA 3ZXZA 3JR1A 3NVMB 4MD7E 3ORIA 4S30A 1OIYA 1GZOA 3GFWA 5EQYA 4WUNA 5DR9A 4F09A 5EHLA 2IZTA 3DJ7A 3TG1A 1PXJA 5FWKK 1YXXA 3QALE 2RKUA 3CTHA 1YOLA 3VRZA 2WQEA 1BX6A 3BE9A 3EQRA 3GENA 3W8QA 4TWOA 3QD0A 2J0KA 2HCKA 3DXPA 2ONLC 3PY3A 5IG1A 2WMUA 2PWLA 5I0BA 4DEDA 2Y4PA 2B4SB 3PVWA 4QPAA 5DFPA 2VRXA 2V55A 4JDIA 4W4YA 3FL4A 4HCVA 3C4FA 3DPKA 5CQWA 4DEIA 4ZLOA 3O23A 1Q62A 5J1WA 4J71A 3UOKA 3RPRA 2E9UA 1KE7A 3FWQA 4G1WA 3MH1A 5FDPA 5HX6A 1Q61A 3JYAA 3OEFX 1W0XC 4ENYA 2XK8A 4F6UA 2I40A 4L46A 4IE9A 5H8EA 3R1QA 5CAUA 1U59A 4L52A 1CKJA 5HVYA 4HVHA 4TYGA 4D1SA 2VTQA 3DAEA 4H3QA 4JQEA 3EQBA 3KKVA 4O7YA 4EHVA 5AUXA 2R4BA 2HXLA 4IANA 5FP5A 5JFSA 4F1TA 4D4SA 4FZ6A 4NFMA 4XBRA 4APPA 1ZARA 1JKTA 5AV3A 4A06A 4AWIA 3BELA 2QR8A 4GG5A 4DFBA 1YHSA 1OUKA 1SMHA 2W5AA 3PSCA 2XNNA 4PL4A 1YQJA 4DTAA 4M67A 1A48A 5I9UA 2ITOA 1V1KA 3GVUA 4YBKA 3O50A 2FSLX 5JSMA 3A4OX 1ZYDA 3I6WA 3Q5ZA 1NXKA 3LXKA 3MVJA 3COHA 4HGSA 2C5VA 5KBRA 3R7UA 2YIXA 2OZOA 5HNIX 4O38A 1JVPP 4D2WA 2BRMA 5TT7A 1OB3A 3MVHA 3FPQA 4GFGA 3RPSA 2VO6A 3H0YA 4MQ2A 1Q4LA 4DH7A 4K18A 4L43A 2PVYA 3UNZA 1BI7A 4EOSA 5HG7A 4IDTA 3TNPC 4YP8A 3MFRA 3AMBA 3TWJA 2RG6A 4RWIA 3HMIA 4GRBA 1ZYSA 4J99A 4AG8A 5AUVA 1YI4A 3F5PA 3HP2A 4QMUA 4YJTA 3HP5A 3PWDA 3E62A 4OTGA 3FLQA 2VTMA 4L7SA 4BDIA 5IMEA 4CFXA 2X8IA 4DG3E 3CKXA 3GCSA 5E8VA 4BDJA 4ZTNA 1JAMA 2EB3A 4QMMA 5AAEA 4APCA 3MPMA 1CKIA 1G8AA 3PPJA 4XLIA 1GIJA 2OZAA 1BLXA 2ITTA 2WPAA 4NK9A 4U8ZA 2JDTA 3CY3A 1E1VA 3QCYA 4JR7A 4BI2A 1BYGA 4FKUA 4GUBA 3WZUA 3C50A 1O6LA 2FUMA 2GHMA 1YI3A 2BFYA 3F2NA 3ORXA 4GVJA 1ZWSA 4L8MA 4PY1A 3H9FA 5G1XA 4DTBA 3I81A 3GGFA 2BAJA 5K5NA 2UZBA 1Q8TA 2UW8A 3NNXA 3SVVA 1F0QA 1XH7A 4IWDA 3UPXA 4EYMA 4E6QA 3D7ZA 4QP4A 3PP1A 2Z7QA 3OXZA 1B6CB 4JRVA 3PVUA 4EZ7A 2F4JA 3FXXA 5HHWA 5HKMA 3KCKA 3PXFA 5M4UA 2R64A 4O0SA 3QC9A 5J5TA 3QQUA 5FG8A 2JITA 4YTCA 4MBJA 4O6LA 5EOBA 4D2RA 4FNWA 3KRJA 4EQCA 4F63A 3PG1A 1H00A 3GQLA 4NCTC 4M12A 1XH4A 5DNRA 5TOZA 2GFCA 4XYFA 4FA2A 3ZU7A 2E9PA 5CSPA 3DKOA 5DEYA 2VO0A 4G34A 4LGHA 4TWNA 1H1WA 4XG7A 5CU6A 4YU2A 5LOHA 5LMBA 1U54B 3F88A 3MIYA 3PJCA 5CQUA 3KRWA 2PUPA 2HWOA 3ITZA 2X4FA 3Q4CA 4N6ZA 5DVRA 2BUJA 5CEQA 4O7ZA 4P4CA 5CASA 2WQMA 3BZ3A 3E87A 4EHEA 2X8EA 3NIZA 5JFWA 2NP8A 4MBIA 4DYMA 2CKEA 4FE2A 3P0MA 4ALWA 3W2PA 3L8XA 3FL5A 4E3CA 3DK3A 3AGMA 2JEDA 4XV9A 3FMKA 3FMJA 3TNHA 4J98A 4Y5HA 2YM8A 2GQRA 1K3AA 3QZFA 1F3MC 2VZ6A 5L6WL 5BYLA 4CKIA 5T3QA 2YLFA 1FQ1B 3Q60A 4QP9A 2O65A 3OWJA 4QYFA 3R7GA 2G9XA 2HZNA 3G9LX 4LL0A 4ZEGA 4BDDA 3OP5A 4IAFA 4NSTA 2JDSA 3QZIA 4CFUA 4RLKA 4NM7A 3PFQA 2UZNA 3N51A 4QT1A 3KMMA 3UOLA 1A9UA 4HYIA 4ITHA 2EXEA 1WBTA 1XKKA 2PY3A 4GKHA 1XQZA 2C3LA 5EFQA 2FSOX 5B2MA 4WOVA 5H9BA 3HV3A 4G5PA 5I9XA 3SXSA 5JT2A 2V7OA 2HY81 2A4LA 1UNGA 3HMOA 1SNXA 3FQEA 4IVDA 5D9HA 2QR7A 5KX8A 4R77A 2IVUA 2Z60A 4NKSA 5L8KA 5LVLA 2YM7A 5ANGA 3DU8A 2P55A 2VGPA 4ITIA 4RX7A 3G6GA 3ZSHA 5IQCA 4USDA 2H8HA 3AMAA 5CLPA 2F9GA 4FICA 4G6LA 3LXNA 5CSVA 5AP5A 3S00A 1WBPA 1TKIA 2FGIA 2RG5A 2WTCA 3BLQA 4J97A 3FHRA 1W7HA 2ETRA 3BQRA 4I94A 4RIYA 5DH3A 3O7LB 2QG7A 3CSVA 1XHAA 1ZOHA 4RQVA 3CR0A 2Y0AA 3T3VA 2VX0A 4TPTA 1AD5A 2PYWA 2W96B 4NJ3A 1JKLA 2BFXA 5L2IA 2R3KA 4F99A 1REJA 3C0GA 4RLLA 3ZZWA 1YHWA 3WYXA 3RPVA 2YEXA 3WBLA 2VWWA 3U55A 1PXMA 3CP9A 2WMBA 3C0IA 3PXRA 4MF0A 4IAYA 4N4SA 3WOWA 3O0GA 1ZYJA 3LXLA 3THBA 4CTBA 3QWKA 3ALOA 4P90A 4DA5A 2FH9A 2O63A 2QO7A 3CIKA 5C27A 4DFYA 4RIOA 3FY0A 4KB8A 4K0YA 4HVSA 1WCCA 2ZB0A 2VTHA 4LOQA 5FBNC 3RAKA 3QKKA 4JL9A 3AT2A 3RI1A 2QODA 1MQBA 2C1AA 3KVWA 1Y8YA 1Y57A 2FYSA 3BQCA 4OTHA 5AV0A 5IH6A 3KK9A 3LQ8A 3FC2A 4PDSA 4F1OA 4PQNA 3FMHA 4FX3A 5EI6A 2FB8A 2J51A 4M84A 2BRHA 3DAJA 3OCBA 3ORPA 2R2PA 3PSBA 4H36A 1OPKA 1ZOGA 4FKRA 4X0MA 4ACDA 4KKEA 4NIFB 4XOYA 3VIDA 2G2HA 4L67A 2A27A 4O0VA 3CD8A 4I5MA 5LARA 4IWOA 5AV1A 5FUTA 3NAXA 3FZOA 2EXCX 4YO4A 5KMLA 4B9DA 3TZ7A 4F7NA 4Q9SA 3MY1A 2YJRA 1K9AA 3VQUA 3I60A 3OXTA 2B0QA 4FTQA 4W4VA 4NL0A 4DAWA 4IX4A 4RGJA 4S32A 4X21A 3O51A 4YZMA 5FD2A 3NNWA 4KRDA 5DRDA 5LVNA 4XH6A 4L7FA 4HYHA 2WU7A 4HNFA 4BDAA 3R71A 3V5JA 4G9RA 2XM9A 2GNFA 3QTQA 3GCUA 4CMOA 3OT8A 3FDNA 4MF1A 3CBLA 3VUGA 5IU2A 5AR3A 4C3PA 4GL9A 3JVRA 4FTKA 1MQ4A 4UY9A 1G8SA 5FXQA 5ANJA 1YDTE 3QYZA 1GZ8A 4C62A 3U8WA 2IW6A 4I0TA 4OW8A 4RX8A 4FZFB 4BBFA 5CXZA 3TUDA 2XIRA 3PDTA 4NYEA 4D2VA 4IAZA 4ACMA 4AU8A 3MJ1A 3LFNA 3SLSA 2PMOX 3MY0A 4I5CA 2OFUA 5G6VA 2G01A 4PWNA 5LJJA 4IZAA 2F7XE 4EOLA 4O2PA 4G3GA 3SDJA 3FZTA 4UWBA 3V6RA 3IDCA 2P2IA 5TR6A 3T9TA 1JSUA 4MXAA 2UZEA 3HA8A 5FM3A 1WVYA 1T45A 2WHBA 4BN1A 4D4VA 3PE2A 3R9NA 4EOKA 3C4WA 3A99A 3D7TB 3Q9ZA 3C9WA 3E8NA 3AD6A 4RT7A 2X4ZA 2BHHA 3BYVA 3FHIA 3RCJA 3V5TA 3V8WA 3SC1A 3ZLSA 4X2GA 5CU3A 2F2CB 4HVIA 3Q32A 2OW3A 4EH4A 3R8VA 3HKOA 3NNUA 3PVBA 4RFMA 4KINA 4NM5A 3ZRMA 2V22A 2EB2A 4IZ5A 4MTAA 4IJ9A 4QOXA 4O86A 1OPLA 3EH9A 2XEZA 5C1QB 3JY0A 3ORNA 5HZNA 5J1VA 3QF9A 3LFDA 2C1BA 4U97A 2ITVA 3U51A 3KFAA 1PY5A 3QFVA 4O0TA 2J5FA 3EN9A 3H4JA 4ITJA 5CI6A 5K4IA 4ZS4A 2JAMA 5BUJA 3B8RA 4GJ3A 4K2RA 1K2PA 4RC3A 5EI8A 1H0VA 3OY1A 4HJOA 5T6KA 5E4HA 3S3IA 1FVRA 4EL9A 5CS6A 2HWPA 3OC1A 3GU8A 3VUKA 4DG2E 3R7YA 4X2FA 2YDKA 4RJ5A 5I9WA 2WMXA 5E8SA 4KRCA 4H05A 3PA3A 1E1XA 3QQHA 3VNTA 5FRIA 4QTAA 1MRYA 3QTUA 4DBNA 3Q4UA 3QHRA 2QURA 4FZDB 4ZJJA 5H8GA 3UMWA 1MRUA 4TNDA 4ANQA 4EQUA 4D4RA 4PDYA 3LCSA 3F3VA 4TYEA 3GU5A 3PJ1A 3V5PA 3GU6A 5TF9A 4O22A 3K3IA 2B7AA 3C4EA 3W2CA 5KMOA 2CNUA 1M52A 2X81A 3LXPA 2GNHA 5IA3A 3MESA 3D5WA 5E90A 5HGIA 3SXRA 4FSYA 3ZCLA 4I23A 4OAUC 3OCGA 1P4FA 3OZ6A 4FOBA 2UZTA 3MJ2A 3R22A 4PV0A 4IDVA 2XIXA 2R5TA 5A14A 3R8ZA 4RWJA 3POZA 4Y72A 2YCQA 1MP8A 3OVVA 4GYGA 4O96A 4AOJA 5H2UA 3K2LA 4DEAA 2BRNA 5KUPA 3R6XA 2B1PA 4AGWA 3IECA 4QQJA 3NAYA 4TL0A 3VBQA 3ANQA 1B38A 3KK8A 4KIOA 3F69A 1YKRA 1VJYA 3HZTA 4R1YA 4ZIMA 1NVQA 5JMSA 4FNZA 5K4JA 1H24A 2RFNA 2Y6MA 1R0EA 2XBAA 4IEBA 4XG4A 2OIQA 4B8LA 3OD6X 4E1ZA 1ZMVA 4E6CA 3QTWA 1U54A 2ZVAA 4M0ZA 4MHAA 2XS0A 4L3LA 4E7WA 3VBTA 3V5QA 3W33A 4JBQA 4QP3A 4IAIA 4LYNA 1PJKA 2J7TA 4ACGA 2BKKA 3ROYA 1BI8A 4A4XA 4WG5A 1XH6A 4BI1A 3ZOSA 1DM2A 1O6YA 4F0GA 5FLFA 3UMXA 1G3NA 3UZTA 2XRWA 5HE0A 1PRYA 1BL7A 1WVWA 2C0IA 3A62A 3PIXA 4RFYA 5D41A 4CGAA 2I6LA 5EM8A 1R3CA 3CPBA 5M4IA 3C4XA 3GUBA 4FTAA 3VHKA 1JKSA 2EU9A 4EZ5A 3QHWA 4MH7A 4I6FA 5DG5A 4JRNA 2WGJA 3KXNA 3Q4ZA 5JQ5A 4GG7A 4BDBA 1A06A 4BRXA 1Q8ZA 2UW9A 2WOTA 4FKLA 2JKMA 5CAPA 4I92A 3B2TA 3CXWA 3RTPA 2I0HA 3IPHA 1OVEA 3QLGA 4V0GB 3W1FA 5DI1A 3GU7A 2PVJA 4MKCA 4C4GA 3LJ2A 4W8EA 5FP6A 2VNWA 4RSSA 4DGNA 3U54A 4M69B 4AT4A 3BGZA 3N4VA 4O83A 2C30A 1IEPA 3QTIA 5KZIA 4UEUA 5IA4A 3OY3A 4FG7A 4R5YA 2Y8OA 3QLFA 5AR5A 4GT4A 3TV4A 3VBWA 3NMUF 3U6IA 5AV2A 3Q5IA 2GCDA 1M17A 4K9YA 3LAUA 2VU3A 1UKHA 3Q9YA 2BZIB 3RGFA 4TY1A 2C6TA 3GC7A 5HIDA 3UNJA 5LVMA 2CLXA 2X6DA 4FIHA 2WTJA 3LCOA 2XM8A 3FAAA 3NS9A 4QTCA 4YTHA 2B53A 2WNTA 4C4EA 4PNKA 5KCVA 5M44A 3DKGA 4WG3A 4LRJA 2FA2A 1UU9A 3DB6A 3U9CA 3VS4A 3KC3A 2CN5A 3HGKA 4AGUA 3RPYA 3WZDA 4I6QA 4IAKA 3I79A 3JUHA 5AA9A 5FEDA 5J9LA 4QQTA 4WBOA 4G16A 3HA6A 4MEDA 4C7TA 5IUIA 3K3JA 2RL5A 4BI0A 4CEGA 2J0LA 2OJGA 2YISA 3IW7A 2Y9QA 1YXUA 4RJ6A 1TQMA 2XCHA 5CALA 5EQEA 4CYJA 3EFJA 4QMPA 5IA0A 3PLAE 2WD1A 4ZSGA 4C35A 2GMXA 4J1RA 3EN6A 4IX3A 5AM7A 5HESA 2X9FA 4FVQA 1STCE 2P3GX 2UW5A 4KS8A 5CX9A 5BUEA 3GNIB 5C4KA 2GTNA 5BVFA 2BIYA 1YOMA 3EN4A 4L6QA 4TXCA 4NIFA 4OBPA 5GZ9A 3ZDUA 3IS5A 4A9RA 5LMKA 4L45A 2VX1A 4ZSEA 5K9IA 4YPDA 3RAHA 3ORLA 3FKLA 5KMNA 2GQGA 5TE0A 4FNYA 4USFA 3ZLWA 4EH7A 4MXZA 2UZLA 3KRLA 5CYIA 4Z3VA 5CAOA 1YOJA 2CLQA 3FJQE 4MYGA 3UE4A 3UVRA 4DH1A 3QWJA 3R01A 5M51A 4I93A 4CQEA 4FL2A 2UZVA 3GOKA 1ZYCA 4S2ZA 4S34A 5J79A 4O6EA 1SM2A 4J7BA 4FSMA 4RIXA 2WXVA 5AWMA 3ENMA 3FZPA 1VR2A 3NUXA 4HNIA 4AE9A 3V8TA 4AFJA 4YHFA 2UZOA 1ZY4A 4FT5A 2WELA 3M11A 3SHEA 2QC6A 3FLSA 1GZKA 5ITAA 4GKIA 1UA2A 4LUEA 4JT3A 4Y83A 3SX9A 4C36A 3QD4A 3ID6C 4LGGA 3TNWA 4XS2A 4AS0A 3W8LA 4LI5A 3NSZA 2GS6A 4NEUA 5A54A 3I5ZA 4KBKA 3QTRA 4F6SA 4DINA 3HRBA 5ETFA 2W1DA 1H4LA 3U6HA 1J1BA 4AW1A 5H3QA 3VVHA 4KBAA 2F7EE 4EYJA 1H08A 1H26A 1OL5A 3D4QA 3IKAA 3KF7A 4IZYA 4K77A 5KBQA 3F5GA 4QRCA 5EI2A 3ROCA 2ERZE 3PSDA 2BAQA 4YJQA 4E4MA 2WTKC 2J90A 5HE2A 4XEYA 4ZTSA 5J5SA 2X8DA 3PWYA 4H58A 4RIYB 3OEZA 3RPOA 3D7TA 4ANBA 5DYJA 3PJ3A 1OL1A 3I1AA 1OKZA 4O1OA 3VHEA 3I6UA 3NW7A 2ZV2A 5A4QA 4FL1A 3BGQA 4RFZA 3R9OA 4IIRA 4L3JA 2I7QA 2YABA 2I0VA 4WIHA 4DC2A 2NPQA 3SOCA 5AR2A 4DH5A 3SA0A 4JLCA 5DBXA 5E1EA 4ZY5A 3NX8A 5CY3A 1CKPA 4FMQA 3ZMMA 3ZLYA 5D12A 3ZFYA 4Z16A 4O2ZA 5HG5A 3HV7A 4IQ6A 3SXFA 1YDSE 2KTYA 4ANNA 3DTWA 3KXXA 5CT0A 2PZIA 3CD3A 5C01A 5LVOA 2HELA 4C2WA 1M7QA 3G2FA 5AUTA 3NW5A 3NEWA 4ID7A 3R8MA 5HLWA 2XK4A 4FTLA 2BRGA 4F7JA 4JG7A 2Z7LA 1BMKA 2ZV9A 3NIEA 4FEXA 4CG9A 3KULB 3MA6A 5CEMA 2WIPA 2PVHA 3D5UA 2R3IA 4I41A 4C4IA 5E8ZA 2DQ7X 4R5SA 3OTVA 3V3VA 3G51A 2LAVA 3RWQA 2ITZA 2IG7A 4HVDA 4PPBA 4TYJA 2YWVA 4FSZA 3MA3A 5IA2A 3G5DA 2FO0A 3VS1A 4YHJA 5L2QA 1H28A 2VTIA 3IOKA 3V51A 2HYYA 3FE3A 3QZHA 3W2RA 3VS6A 4OTFA 2C0OA 4O91A 3ZDIA 4EKKA 4W4XA 2DS1A 4M7IA 4EOOA 4DT8A 3ANRA 3MFTA 1M7NA 1YWNA 2B9IA 2C5OA 4FGRA 3CQEA 4FTMA 2IN6A 5CWZA 4L9IA 3DY7A 4IVAA 3QGYA 4IBMA 3QA0A 1OIUA 4C33A 5LXMA 2JLDA 2B52A 3OTUA 1BUHA 1B39A 4FEQA 3MYGA 4M68A 1J7UA 4II5A 4QQ5A 4BL1A 4F6WA 3BV2A 4O0WA 4OTQA 3EKNA 5IA5A 4FNXA 2QO9A 3LLTA 1FOTA 4NZWB 3BWJA 4UZHA 3A61A 4ZY6A 4CTCA 3DA6A 4ZP5A 4AA0A 3DBQA 2UW3A 3AC5A 5M53A 1JPAA 2W7XA 4EBVA 2X7FA 2P2HA 3AC3A 4TYIA 1J7IA 2G2FA 3DFCB 3PXQA 3R9RA 4JIKA 3HNGA 2PUNA 1BL6A 3EQIA 4EQMA 4QMSA 3KREA 2BZKB 5KZ0A 3VO3A 5K0XA 2PK9A 4D0WA 3WE4A 4X6RA 4C4HA 4TWPA 4O7VA 4NW5A 4HGTA 3NGAA 5GIPE 4AN3A 1P2AA 2CCHA 4PTGA 1OM1A 3NZ0A 5EYMA 2BKZA 3BEGA 1H0WA 2W4OA 5BVWA 3OT3A 3ZXTA 4IM0A 5IDPA 4GFOA 4AW0A 5AR7A 4PMTA 4WD5A 3MBLA 4RJ8A 2X9EA 3QGWA 4Z9LA 2E9NA 2QOHA 4BCIA 2W4KA 4DH8A 3OW3A 4QYEA 3F5UA 4V0GA 2ZB1A 4DEHA 4DFNA 3SG9A 4MNFA 1Y8GA 4IVCA 2WQNA 2QKRA 2O64A 2ZM1A 3PJ2A 4FKSA 4M69A 2RGPA 5F20A 4RWKA 4MX9A 3D0EA 5HQ0A 5EHOA 3DBDA 5AUUA 1Y6BA 3KVXA 5BYYA 3D15A 2XMYA 4GS6A 3UVQA 1OKVA 3IDPA 4YNEA 3UOHA 4A7CA 4O7TA 5EYKA 3FXWA 3TL8A 3U9NA 1GIIA 3L9PA 3LFAA 5T68A 4EOQA 3HLLA 1YWRA 1F5QA 4FV0A 4HYUA 4QTBA 5IEVA 5AP3A 2FSMX 3R7IA 2G15A 3HRCA 3BCEA 3FV8A 4KSQA 4CKRA 3FI3A 4E93A 4YTIA 1WBNA 4BGQA 3Q53A 4JG8A 4QMQA 3SGCA 3TDWA 2VWVA 5GIOE 4HYSA 1URCA 3NDMA 4M0YA 5ANIA 5AIRA 3F3UA 3OG7A 3HUCA 4DLIA 3R83A 1NA7A 3CGOA 5GZ8A 1SNUA 3ELJA 3T3UA 5CI7A 1DAWA 2I0YA 5JGDA 4Z7HA 3P86A 3BYUA 4O21A 1EH4A 2O8YA 3EQDA 1YDRE 3MTLA 3Q9WA 3TKUA 5B7VA 4WNPA 3TUBA 2XK7A 3LHJA 3NUPA 2VX3A 4QPSA 5CAVA 4L53A 3KN6A 1OITA 3U4WA 3QCXA 3VUTA 4DEBA 3QA8A 2YA9A 3KY2A 3K5VA 4FVPA 4KIPA 1E9HA 3D83A 4AOIA 4D55A 5IEYA 1OGUA 2PTKA 2HAKA 2YITA 4IB0A 4P5ZA 3VRYA 4M13A 3ZLXA 1PXNA 4ONAA 4EI4A 5JN2A 4GT3A 5CF5A 4FTNA 1FMKA 4TW9A 4DFZE 3VBYA 3GC0A 2W4JA 3NYOA 5JK3A 4RX9A 5EW3A 1R78A 2R3PA 3R2BA 4FIFA 3BE2A 4FTRA 3SD0A 4CLJA 3NUYA 5ANOA 4WNKA 1XR1A 5GJFA 3H10A 4FT3A 4D2PA 2OSCA 2YDIA 3DLSA 5BPYA 1S9JA 4OGRA 3DQXA 3PY1A 1YXVA 2AC5A 3C7QA 4DEEA 4CRLA 1ZMUA 5EDPA 2R0UA 4HPTE 3NCGA 5AFVA 1NVRA 3GU4A 5AUYA 2OF4A 2IO6A 3D5XA 4QMZA 3D14A 4QP8A 5AP7A 5E8YA 1UU8A 4NTTA 2YZLA 2WOUA 2QOIA 3P7CA 3OUKA 4FKIA 3MI9A 1PMUA 4CMUA 3F7ZA 2VTPA 4IMYA 4BDCA 3OWLA 3C5UA 3SAYA 4EK4A 4A07A 4H1JA 3WF5A 5L2WA 1Q41A 2NRYA 4K1BA 2J0IA 4DF3A 3MW1A 4HCUA 3EQPA 4IB5A 4AN2A 4AUAA 3COMA 4O7WA 4QMOA 4EHZA 3DK6A 2QVSE 4YJRA 3UDBA 3LKMA 3P08A 3KEXA 4RMZA 3W2OA 5HORA 4IXPA 3C0HA 4TN6A 2VD5A 3LM5A 4AX8A 5E9EA 4TT7A 2ITNA 4ZOGA 3A60A 3F5XA 4CNHA 2J0MB 3DZOA 4U40A 2VTTA 3UP7A 3SW7A 4CXAA 4OTPA 3SQQA 3BX5A 1L3RE 4FKWA 4FSRA 1OZ1A 3L9MA 4FK6A 5HCZA 3KXGA 4UXLA 5HICA 4FTTA 4XP0A 3QQJA 4YPSA 5I4NA 5A4TA 3TKIA 4YJVA 3I7BA 5IA1A 3DDQA 3LZBA 4EK6A 3N4TA 5DRBA 1UU7A 1OIQA 1ZZ2A 4MAOA 3RCDA 4U79A 3EQHA 5HE3A 3VS5A 4XP2A 3ZHPC 2C6DA 2PUIA 3BRBA 1PMVA 2QQ7A 3N9XA 3QTSA 2Y4IB 5HIEA 5IH4A 4IFCA 3QUPA 2YAAA 2PE0A 2YERA 1PXIA 1Q8YA 4IM3A 2PMLX 2VTAA 3QXPA 5I3OA 3P9JA 3T9IA 3ZTXA 3GFEA 4I5HA 4AZEA 4YSJA 4FOCA 3LFEA 2XP2A 4PRJA 5IF1A 3EFKA 4BWKA 4EWQA 3BEAA 5CT7A 4L42A 4FV3A 4CSVA 4F65A 4P2KA 4BCGA 4UYAA 2YACA 3FMDA 4K33A 5E1SA 3R00A 1OKYA 4R6VA 4O7SA 5AAFA 3FMEA 5D10A 3KULA 4U80A 4CQGA 4GK3A 4P7EA 1PW2A
chains in the Genus database with same CATH superfamily
4YZNA 3JS2A 3U6JA 1H01A 4UX9A 1J7LA 3E8EA 4QP7A 3IW5A 2X0GA 3DTCA 2W17A 4CFMA 2QG5A 1QL6A 4PMSA 2C3JA 3LE6A 4O4EA 2G2IA 3ORMA 4ANSA 4ZTMA 2R0IA 4DHIB 3I0OA 4BGGA 1J3HA 3CY2A 3M1SA 2QOFA 3QRKA 4JX3A 4FEUA 3W0OA 3HEGA 2JFLA 1PF8A 4BCMA 4NJDA 3R9HA 4I4EA 5DLSA 4G9CA 3PJ8A 2BZJA 5HBEA 1ZZLA 2EUFB 4FSQA 4UMQA 3RK7A 4E4NA 4BWXA 2AEGA 4YC8A 2CNQA 4RIXB 3OOGA 4IWQA 4ASZA 5IQBA 3V6SA 3MH2A 2WIHA 4U81A 2B54A 2JIVA 3UC4A 4F1MA 4ZSJA 4CMTA 3FZ1A 2Q0NA 1Q8WA 2BTSA 5IEXA 4M66A 4ACHA 4EH3A 2DYLA 5DPVA 4G3FA 4CT2A 4F7LA 3FLYA 5K3YA 3QTZA 4O0XA 4EH9A 2JAVA 3E88A 1YI6A 2VTLA 3BU5A 3FQHA 1H07A 5HLPA 3VW6A 5A6OA 4I1ZA 4CVAA 5CSHA 2PVKA 4U43A 5EDQA 3TZ8A 5HO8A 2W06A 3BKBA 3KXMA 3ZC6A 3NNVA 4X7QA 2OH4A 4F9WA 2PPQA 4OT5A 2W5HA 2XK3A 4GK4A 3EQGA 4UN0C 2GQSA 2QKWB 4AT5A 3EZRA 2HK5A 1MUOA 2I1MA 3DNDA 4WNOA 3TN8A 2Z2WA 3G9NA 4E4XA 1RW8A 3PZEA 3R8PA 2W1ZA 4MNEA 4FR4A 2PU8A 4FKPA 3IW8A 4KKHA 4W4WA 3W18A 2C6OA 2QOBA 3RZFA 2JD5A 3CKWA 2OI4X 3CTQA 4FKTA 3ZO3A 1WMKA 5JGBA 2VGOA 3OCTA 3D9VA 5BVNA 3W0SA 4YHTA 2QLQA 2ERKA 4I3ZA 4XMOA 4BCOA 2OIBA 3AC1A 3GCQA 4RJ4A 4ALVA 4D0XA 3RM6A 3VAPA 4DHZA 3PPZA 3FI2A 5CVGA 3UO6A 3DB8A 2W1CA 3FPMA 2XKCA 3BLHA 4K6ZA 1NY3A 3P79A 1V0BA 1PYEA 4FYNA 4BJJA 2ETKA 4AACA 4MCVA 4BICA 3COIA 4YJSA 4C57A 2J2IB 5IQIA 3R02A 3EN5A 2BPMA 4F4PA 3FZSA 2RSVA 3BLAA 3RALA 3ORZA 3TV7A 1OUYA 3ACKA 3E92A 3HMMA 4IX6A 1W84A 4UWYA 4UZDA 2XB7A 4ASEA 4AZVA 3QL8A 2QOLA 3Q6WA 4G3DA 3OHTA 2XNGA 5CNNA 4PPAA 4NM3A 2FVDA 4KAOA 4LOPA 2R7BA 1S9IA 3L8VA 4PDOA 2XH5A 4HGEA 1JBPE 1QCFA 3BWFA 5HIBA 3H0ZA 4FJVA 4AA5A 2Z8CA 5J8IA 4NUSA 3ULIA 5DEWA 4DEGA 3TACA 2IF8A 4YJOA 5GNKA 4A9SA 1YRPA 1KV2A 1JQHA 5B2LA 3BI6A 2PUUA 5DWRA 5KHWA 4N70A 3UO5A 3MN3A 5L2SA 3ZFMA 1R39A 3NW6A 4PP9A 5KMJA 2YLEA 3LFFA 3ZO2A 5CSWA 1VYZA 4O81A 2O5KA 2VWZA 4X2NA 3W0QA 4CFWA 4ZJVA 3FLWA 2ZOQA 4BB4A 3Q96A 4UWCA 2WMVA 1V0OA 4QMLA 2WQBA 4OBQA 3GC8A 4NM0A 3HMNA 5ANKA 4GK2A 2OO8X 4BDFA 5FTGA 3NUNA 2GS7A 1LPUA 3NUUA 2Z7SA 2X7OA 3PZHA 1Y6AA 4LOOA 4R3RA 3ZBXA 4BCPA 3BBTB 3FKOA 4I24A 3EN7A 3LJ1A 4PTCA 4GEOA 4X2KA 2FSTX 2ZM3A 2OLCA 4E8AA 2OJFE 4WUAA 4HVGA 2XYNA 5CF6A 4OAVB 1XMMA 3I4BA 1JKKA 5GHVA 1FVTA 4YJPA 4FVRA 4IC7A 3TT0A 3ZH8A 2Z7RA 5IQFA 4YLJA 1DI9A 3CGFA 3KMUA 2WMAA 2OKRA 1YHVA 3MB7A 3RWPA 4FTCA 4AQCA 5HTIA 2BR1A 4C3RA 3CQUA 3RAIA 4GV1A 2UUEA 2XEYA 4USEA 2NRUA 4D4YA 4Q2AA 5EK7A 3II5A 4FIEA 2BZHB 3EJ1A 4H3BA 2JDVA 5C03A 3QBNA 2PHKA 3MIAA 2WU6A 4E73A 2YM5A 5AX3A 3F61A 4DFXE 5C8NA 3UQFA 1I09A 3FY2A 3QRJA 3RMFA 4GYIA 2OIDA 3MTFA 5BYZA 4DCAA 3PY0A 4F9BA 3HECA 2YIRA 1IA8A 4MWHA 3HX4A 4TYHB 3R9DA 5DN3A 3F2AA 3F2RA 2J5EA 2ZV8A 3V5WA 3FMMA 2JC6A 4FGBA 4QMVA 3UYTA 4ZSAA 3UNKA 3E5AA 3R1YA 5CEKA 4DT9A 1URWA 4FT9A 2IW8A 4QYGA 3BLRA 4AZTA 1W2FA 5M57A 4WKQA 4O7LA 4PL3A 4Q5EA 3WIGA 4PF4A 3HUBA 4PL5A 5AX9A 2VTRA 3O8UA 2CDZA 5F95A 5AJQA 1DAYA 4CFFA 2OWBA 4QP1A 4BZDA 3UG2A 4FEVA 5HD4A 4MXOA 5CF8A 4AZWA 3LM0A 3KRXA 4NU1A 1UWHA 5LQFA 4I5PA 1IR3A 3ODZX 5KE0A 3H9RA 4BTFA 3HL7A 2GNIA 4FI1A 3F66A 2ONLA 4FKJA 1FMOE 3VJOA 4C3FA 5A6NA 4FL3A 4G3CA 5ANEA 3RJCA 2XALA 5I9VA 1YWVA 5KMIA 3W0MA 2VWIA 2WAJA 4EOJA 5EKNA 3Q52A 1OPJA 4RVTA 2V7AA 4P5QA 5CSXA 4GSBA 5M07A 3EOCA 1OL7A 4NH1A 3W2SA 1PKDA 2H9VA 3IG7A 2C5NA 3U4UA 4DGGA 1QMZA 1IA9A 3P7BA 3DT1A 4G5JA 3L8SA 1H8FA 4NKAA 4E5WA 5JKGA 1M14A 2JKQA 3TTJA 2O0UA 4X6QC 2WTIA 4EC9A 3ORTA 4HZSA 4ZTQA 3WYYA 4N57A 2PZPA 3DAKA 3OF0A 4BCNA 4QP6A 4CV8A 3MGYA 3QCSA 4N6YA 4EEVA 2PVRA 5IQAA 3VBXA 2A2AA 4GMYA 2PMNX 3AT3A 4FEWA 4B7TA 3W2QA 2CHLA 4LMUA 5AUWA 3R30A 4HW7A 3TEIA 4GIIA 4ZZMA 3IOPA 3MS9A 5JH6A 3ZZEA 2VTJA 3P7AA 4JDKA 3LFCA 4QNAA 3VONA 4FT0A 3G6HA 4H39A 2GSFA 5B2KA 3BHTA 5CEOA 2R3JA 4IZ7A 2O3PA 4NWMA 4D9UA 4FKGA 4AXDA 2O2UA 2CPKE 3EWHA 3KXHA 3BU3A 3QRUA 1AQ1A 4FIGA 4DFLA 4EK3A 3A7IA 5AA8A 2XNBA 4B0GA 4B8MA 5J9ZA 4EHGA 4KKGA 4L3PA 2XZSA 3VS3A 4R7IA 4WT6A 3QRIA 3VUDA 4AT3A 3ZS5A 3FLZA 3IK3A 5IH5A 3ZBFA 4QTDA 4LM5A 1Q8UA 4ZTRA 4RC2A 4RZWA 5AV4A 5F94A 2P0CA 2WZJA 2BVAA 2YN8A 2ITYA 3ERKA 4I0RA 5HCXA 5KMMA 5DHJA 5L4QA 4GUEA 3UODA 4AXCA 3DBEA 3QQFA 4JQ7A 4WBBB 3NPCA 4IJPA 2F57A 4RPVA 3LOKA 4AP7A 1OKWA 2R3NA 2REIA 3OOMA 3DK7A 4JVGA 5E91A 5EW8A 5HCYA 3ZYAA 5TKDA 4AAAA 1WBSA 3ZSGA 3NUAA 5IQEA 3K54A 4KBCA 3GP0A 3AD5A 1OL6A 3AOXA 1W98A 3GEQA 5AIKA 4BKZA 5IPJA 4R3CA 5CNOA 4J53A 1LEZA 3TMOA 4WNMA 4BHZA 3OCSA 5FGKA 4A4OA 3DJ6A 2W1EA 5EM7A 5LWMA 1WFCA 5LMAA 4ZMEA 1UNHA 1YXTA 2F7ZE 2ZAZA 4IADA 4O4CA 4G6OA 2I0EA 4XG8A 3BGPA 2YZAA 3EYHA 3L1SA 4A9YA 3PXZA 2OF2A 3TKHA 1ZY5A 3ZSIA 5CXHA 5AUZA 4ZTHA 5HEZA 3RZBA 5E8UA 4U42A 3NWWA 2IZUA 4EK5A 2BROA 2ZJWA 3DKCA 4XP3A 2PVFA 4GJ2A 5M4CA 3V8SA 4CZYB 3S1HA 1ST4A 2B55A 2PVLA 2BMCA 4JBOA 4AW5A 2YFXA 1Y91A 2ITPA 3QD2B 2H34A 4MVFA 2OXDA 2XKFA 5C26A 4RC4A 5J95A 4MK0A 5GJDA 3EHAA 1CTPE 3PE1A 4NCTA 2IVSA 1H1PA 3T8OA 4XRLA 4Y85A 4MD9E 4EH8A 1CMKE 3CLYA 3RHKA 4QMXA 3ODYX 3UOJA 1GIHA 1Q3WA 2PZYA 4UXQA 4AFEA 3TM0A 5J7BA 4EUTA 5JGAA 3UPZA 4H1MA 3ATSA 1KSWA 3A7HA 4IFGA 3R2YA 2X2LA 1UVRA 2VWXA 3GI3A 4ZZNA 1HCLA 5B0XA 4D28A 4EOMA 3SKCA 3UP2A 4CKJA 2PSQA 5JFXA 4FC0A 4QMYA 5F9EA 2A0CX 2QU5A 5KKRB 1XH5A 2WMQA 2QOOA 3LFSA 4X3FB 2OGVA 3RK9A 5IDNA 2CKPA 4DE4A 1TVOA 1IRKA 2UW0A 4FIJA 4DBXA 3CJFA 1J1CA 2E2BA 3MFUA 4XG9A 4PMPA 2OK1A 4DN5A 4QMTA 5M06A 4CZTA 3OS3A 4BZNA 3OMVA 5EYDA 4C4FA 5HX8A 2ZM4A 5FEEA 2CN8A 1JSTA 3UIXA 3P78A 4OT6A 2C69A 2XA4A 2R3RA 4MXCA 4TWCA 4NT4A 4A4LA 3D5VA 4OBOA 1U4DA 1UV5A 3TIYA 2OJ9A 5HO6A 3C5IA 1T46A 5IQGA 4FV2A 2OBJA 3Q9XA 2YCFA 1OI9A 4U44A 2LGCA 3NLBA 3TJCA 2PE1A 2VO7A 4MD8E 3C4ZA 2PMIA 3F82A 1TQPA 3MVMA 3JXWA 3POOA 5LCKA 5BVKA 4BVUA 3EB0A 3E93A 4E20A 5LVPA 1JSVA 4FV6A 1UNLA 2XIYA 5HG9A 5BVEA 4O1PA 5CU4A 4FUYA 4XRJA 2J4ZA 4IB3A 3DXQA 3FLNC 3O2MA 4ZSLA 3KRRA 1JWHA 4O7NA 4ZMFA 4CCUA 1ERKA 4K11A 2XK9A 4V05A 4TTHB 3VJNA 4G3EA 2QHNA 4FYOA 4BBMA 4ZLYA 5HVKA 4RRVA 2OXXA 5EG3A 1W8CA 1QPJA 4BYIA 3TJDA 3KCFA 4A9UA 4DITA 3JVSA 2UZDA 2XNPA 3W16A 3FQSA 3BYOA 3RK5A 4BGHA 5F4NA 4RQKA 3IW6A 2BHEA 4F0IA 4GH2A 4KA3A 1JLUE 2IVTA 4JI9A 5E8XA 4Y8DA 3LMIA 3JY9A 4IH8A 2R3MA 4KNBA 2CKOA 3W32A 4EH2A 3UIMA 4FG8A 3UQCA 4JX7A 2Y4IC 3COKA 4G6NA 4OTDA 4AXAA 1SYKA 3QTXA 2J6MA 3E3BX 2A1AB 2UW6A 4MNEB 5CVFA 3D2KA 3S4QA 3P4KA 3WE8A 5JQ8A 3MY5A 5CU0A 3G33A 1P4OA 4DTKA 1P5EA 4FV5A 3ACJA 4KIKB 3NYVA 4U5JA 4BIEA 2OJIA 2YIQA 3IONA 1GZNA 3ZFXA 4XG2A 4EBWA 4PTEA 2UW7A 4H3PA 3IDBA 5D7VA 3Q2JA 5A4LA 3UZRA 3TI1A 4FIIA 3HMPA 5GJGA 4B99A 3HV6A 4F7SA 1KUTA 5IQHA 3DV3A 4IHPA 4PP7A 4M14A 1OMWA 2W0JA 5DR2A 2YIYA 4YLLA 4F64A 5L2TA 2JBPA 5ETIA 4TYHA 2NNWB 1TQIA 4FSUA 1Q5KA 3EQCA 4W9WA 4DCEA 4ERWA 5HD7A 1VLRA 3ZO4A 1YXSA 4CV9A 4MXYA 3W0PA 1KE8A 4XBUA 4XOZA 5AP4A 5LMKC 2XKDA 2ZDUA 3E8CA 4JIAA 3TYKA 1XO2B 2GHLA 3LCTA 4XX9A 4DHFA 3E8DA 3PUPA 2YWPA 1FGKA 4HCTA 4ENXA 2JDRA 3G15A 4BIDA 4XJ0A 1PMNA 2BCJA 3OUNB 3TXOA 1WBVA 3OWKA 4R1VA 5ICPA 4KIQA 2PULA 4FV9A 1QPCA 2W99B 1U46A 1IAJA 5FEQA 3PRIA 3SV0A 4RG0A 2GDOA 5CZIA 5EW9A 3G0EA 4IB1A 1CSNA 4DH3A 2Q83A 2R9SA 3EL7A 2VO3A 1H27A 2AYPA 3MSSA 3ZUVA 3AQVA 1MRVA 3MFSA 4BFMA 4E6AA 5AP2A 4I21A 3MH0A 4F9YA 3TV6A 2CGUA 1KE6A 1HCKA 1Q99A 1FGIA 4YMJA 4YNOA 4J96A 4BC6A 3GQIA 2CKQA 3OBJA 3R7OA 5AADA 2NYAA 3FYKX 3LFBA 3SOAA 1CM8A 4EK8A 4FBXA 4MWIA 4WA9A 4R78A 4LV8A 5H8BA 5DT0A 3A2CA 3M42A 3QAME 4YC3A 5A4CA 2OJJA 1VZOA 2RFDA 5KHXA 3AMYA 4G17A 4YZCA 3UYSA 3RNYA 3GCVA 4WRSA 3VW8A 2AC3A 2QLUA 3ATTA 4ZXTA 2BILB 4M3QA 3P1AA 4AOTA 1DS5A 4RX5A 4EJ7A 2EXMA 2QOQA 4C34A 4BY9E 1BKXA 3QQGA 4C38A 3SG8A 3R21A 5L3AA 3A7GA 3PPKA 4EKLA 3O96A 1WZYA 3O17A 2CNVA 3P23A 4PMMA 4YR8A 1PXKA 3JPVA 2JIUA 2H6DA 1PXPA 4E26A 4AXEA 2JIIA 2GTMA 2WTKB 4YO6A 4BDGA 1LEWA 3WARA 3R0TA 3QZGA 1PYXA 5AR8A 3UGCA 4RZVA 4QO9A 1ND4A 2QD9A 1FVVA 3E7OA 2YM3A 4XCUA 4EOPA 4LRMA 2QU6A 2QNJA 4O0YA 3E64A 3DFAA 2GNGA 5J7HA 4QNYA 1ATPE 3F3ZA 3NR9A 4YZDA 3W55A 5GINE 2HY0A 2ITXA 3UIUA 2X2KA 4I20A 2CJMA 3MV5A 2VTSA 2BRBA 4LG4A 5D7AA 5CENA 4ASDA 2XYUA 5IUGA 4LMNA 5DA3A 4U7ZA 2HENA 3ULZA 1FBNA 3BHYA 4A9TA 1JNKA 4FKOA 3EFWA 5JRSA 3QRTA 5JZJA 3QXOA 1TFFA 3ETAA 2NO3A 4GFMA 4CG8A 3E63A 4ARKA 1WVXA 2BALA 2C47A 2F49A 4RJ3A 3AC4A 3R7VA 3HV4A 4LV5A 3VF9A 5HOAA 5CU2A 5EM5A 2UZUE 3UIBA 1WBOA 4CLIA 3BBWA 4PPCA 4U41A 5JEBA 2IEWA 5DGZA 4FTUA 4J8MA 1WAKA 2Y6OA 4ERKA 1FPUA 2VN9A 4IX5A 3ZONA 4PUZA 4QQCA 3GCPA 3HAVA 2HZ4A 3FEGA 2CGXA 2QO2A 4KWPA 4S33A 2IJMA 3HV5A 4XG3A 2XRUA 4YJUA 3FC1X 4C4JA 3O71A 2XK6A 4GU9A 4Q5HA 4AXFA 2YCSA 4U6RA 2VWBA 2WFYA 1PXOA 4BKJA 4C02A 4NW6A 2EVAA 3S2PA 3VUMA 1CDKA 1UWJA 2R3LA 4OR5A 4E6DA 1OBGA 5CEPA 4QMNA 3WZJA 2YAKA 3G90X 3LW0A 4Z55A 3DGKA 4L68A 2IZRA 3VQHA 4BIBA 4XUFA 2ETMA 3PXYA 1O6KA 1GAGA 1Q3DA 4UB7A 5FQDC 5HBJA 4MQ1A 4B6LA 3BPRA 2R3GA 1IG1A 4Y5QA 4OTWA 5BQ0A 1JOWB 3IO7A 3NFFB 3A7FA 4BBEA 5BVDA 3BL7A 2OG8A 4FK3A 1ZAOA 4FRFA 4BCFA 4JBVA 1O9UA 3IQ7A 1ZXEA 5M4FA 4UMPA 4AW2A 4FZAB 3AC8A 4EOIA 4FTOA 2OICA 3BYSA 2VWUA 3BV3A 3IGGA 3LCDA 4FV7A 2IW9A 3V04A 4R7HA 4ASXA 4UALA 3FYJX 1TZDA 4X3FA 3TNIA 2GS2A 3QX2A 4QYHA 3RBWA 5AP6A 2ZMCA 3UTOA 1DI8A 5IQDA 4D58A 3PYYA 4YGAA 4QYYA 4F9CA 3QC4A 3QKMA 4U3ZA 1QPDA 4RA5A 2WTWA 4IM2A 4O27B 2B9JA 2YIWA 3Q4TA 4UMUA 3W0NA 4DFUA 4HZRA 4FF8A 4RBLA 3FI8A 1KOAA 5IUHA 2VAGA 4YZ9A 2GNLA 4ZZOA 3ZM9A 4BTJA 3NCZA 3NVKI 5EQPA 3ET7A 3CEKA 4XNEA 4Y95A 1XH9A 5DE2A 1UKIA 4YLKA 3WZEA 5I9YA 1M2PA 1Z5MA 5DOSA 3RINA 1YVJA 3QU0A 3ZEWA 2ITQA 2W1IA 4PDPA 2X2MA 3F6XA 3HDMA 5ACBC 3BHHA 3TNQB 3VBVA 1R0PA 4W8DA 4AE6A 2E9VA 3PP0A 3TUCA 3PLSA 4RIWB 2WMSA 5FXRA 3QUEA 4K8AA 5M09A 2Q0BA 3NYXA 3I0QA 3ZO1A 3KA0A 1PHKA 2BDJA 3BYMA 3FSFA 3LFQA 5I9ZA 4AF3A 1XBAA 1ZLTA 2UVZA 3DOGA 4F70A 2R3FA 1RDQE 2WKMA 3GT8A 3U87A 4D5HA 2WB8A 3R04A 1Z57A 2G1TA 3VULA 4Z7GA 5HLNA 3QUDA 4YZBA 3FMLA 4PNIA 1ZOEA 5CAQA 4BCHA 1ZRZA 1GY3A 2YM4A 4EH6A 4UMRA 3PIYA 2QONA 4RJ7A 3EMGA 2XVDA 2BAKA 2OFVA 2C6KA 1W82A 3H3CA 5CZHA 2W05A 4I22A 3ZUUA 3QX4A 2XCKA 5ETCA 3RAWA 2V0DA 5DIAA 4Y46A 3ZC5A 3TTIA 3RM7A 1WBWA 3KQ7A 3SW4A 3F3WA 3KGAA 3KL8A 4O84A 1H1SA 3RHXA 1ZMWA 2C4GA 4KIKA 3H9OA 4E4LA 4UMTA 1GOLA 3KF4A 2ITUA 3FBVA 3CPCA 2ESMA 2H96A 4BCKA 5DMZA 5LWNA 3CC6A 3GOPA 2GU8A 3BHVA 3SRVB 3GXLA 4C61A 3ENHA 5IMXA 3PRFA 2OH0E 3TIZA 5AP1A 2C5YA 3L9NA 3MDYA 2PVMA 3DDPA 3QQLA 3A7JA 4L00A 1ZYLA 3DKFA 1H25A 2OU7A 3AGLA 4ZAUA 1UU3A 5EM6A 2CGVA 5AR4A 3Q04A 4C37A 4JNWA 4O0UA 3DNEA 4D2TA 4I6HA 4C2VA 4I6LA 5L8LA 2X7GA 3AKKA 5KO1A 4JOAA 4YBJA 3OXIA 3NRMA 5DT4A 1GJOA 3O8PA 4FUXA 4ZTLA 5JZNA 1NT2A 4F9AA 3PTGA 2CCIA 4BR3A 2ZFYA 1OECA 4J52A 3F7WA 4I6BA 3LJ0A 5DR6A 2XUUA 4QD6A 4ZLZA 3DXNA 1XWSA 3AD4A 2RFSA 3W10A 4RVKA 1VYWA 3R7EA 1OBDA 4D2SA 4R7BA 3O7LD 3O8TA 3WZKA 2B9FA 3R28A 5TO8A 5C9CA 4DGLC 2J50A 2IPXA 2WEVA 3R73A 1AGWA 5BVOA 2DUVA 4HOKA 4MXXA 3LMGA 4G2FA 4LL5A 4CRSA 4D9TA 3REPA 4DG0E 4F78A 3TZMA 2C6EA 4JQ8A 4C59A 1QPEA 3ORKA 4EC8A 4AQKA 4LUDA 3EL8A 2R3QA 2JBOA 4ANOA 2CGWA 2PVNA 4EH5A 2ZV7A 5A4EA 3I5NA 4FT7A 1Q97A 4YC6A 1RE8A 3I7CA 3LVPA 4RVMA 3VS2A 5HU9A 4MBLA 5FDXA 4ANLA 4FV8A 3HAMA 2XNEA 4U3YA 4AN9A 3ZRKA 5HVJA 3HVCA 3CS9A 4WSYA 3LLAA 3UDSA 3C51A 3PVGA 3CQWA 3EZVA 4NTSA 4F08A 3LCKA 4DGOA 2QI8A 2ZMDA 5HU3A 5J9YA 3UZPA 4HGLA 4IWPA 4FV4A 4PX6A 5BX0A 4ZS0A 2ITWA 4WRGA 5GZAA 1M2RA 3N4UA 2HIWA 2XJ1A 4FODA 5EH0A 3QD3A 3VS7A 4V01A 3FXZA 1KOBA 3R1SA 4TNBA 4JR3A 2X6EA 1XMLA 4EJNA 4BF2A 3MPAA 1VEBA 4O4BB 4GCJA 3KXZA 2J0JA 4Y73A 5FXSA 3VUIA 2PE2A 4J95A 5EHYA 3F9NA 4BCQA 5A9UA 3WF6A 2RFEA 2XKEA 4FTJA 4AZFA 4BCJA 1PKGA 2GFSA 2Y7JA 3OROA 2QHMA 2BDFA 4JS8A 4L44A 4YTFA 4YURA 4JXFA 3HRFA 5JFVA 1NVSA 2XIKA 3D2IA 3CJGA 3UDZA 1XBBA 3F3TA 3GB2A 4XV1A 4BDKA 4FSTA 1W83A 3G0FA 4ZK5A 2XF0A 1Z9XA 2XJ0A 1KWPA 2YCRA 3KB7A 3Q3BA 4XV3A 2PZRA 4HPUE 4ALUA 3UVPA 4IACA 4GU6A 5M56A 3MB6A 5HI2A 5HNGA 4M15A 4BHNA 3AG9A 4WHZA 5HBHA 3LMHA 4G31A 2Z02A 5L6OA 4BZOA 4V04A 1REKA 4R8QA 4BDHA 2SRCA 4YSMA 3ZEPA 1V0PA 4XV2A 4BKYA 1L8TA 1M2QA 5KKRC 3DBCA 3R8LA 5KNJA 4X3FC 3OWPA 3KIOC 4RA4A 5BMSA 4OLIA 2C3IB 2PL0A 2X39A 3VS0A 5BNJA 2V5QA 4QMWA 4UV0A 1SVGA 2RF9A 2VNYA 3DBFA 3GBZA 2VTNA 4J8NA 5ACKA 1I44A 3AC2A 3FMNA 3WF7A 2VUWA 2X1NA 5FTQA 5HTCA 2QOCA 4TRLA 4U9AA 2VWYA 5D1JA 2R7IA 5AAGA 1IAHA 3EYGA 3TZ9A 4XLVA 1LUFA 4C8BA 2A19B 1KE9A 3C1XA 2WTVA 3MVLA 3A8WA 2C6LA 5DT3A 3ZM4A 2QOKA 4EUUA 5I5ZA 3DCVA 5CTPA 5C8MA 2F2UA 4XHKB 2KULA 4JDHA 4BTKA 4C58A 3FSKA 3IW4A 3S95A 3DQWA 3GC9A 4CZUA 2ACXA 4TZRA 1SVHA 3PXKA 4EZ3A 1X8BA 4GIHA 4C0TA 5BUIA 4AZSA 4QTEA 5C8KA 4QEBA 2JGZA 2UZWE 2YDJA 3OW4A 4AA4A 3PUFC 3QQKA 2W5BA 3AXWA 1ST0A 2VTOA 3TDVA 2XNMA 4O82A 1YW2A 3EKKA 3OFMA 2GPHA 3PA4A 3DS6A 3RP9A 2JKOA 4BYJA 4FG9A 4KS7A 1XH8A 2OZAB 4ZY4A 2V62A 3QCQA 4FKVA 2BDWA 2HZIA 5EYCA 1GNGA 2GNJA 1LP4A 1FINA 2C68A 5D11A 5EDRA 4FKQA 4LFIA 3WILA 4D1ZA 3D94A 4DDIA 2C0TA 3BIZA 3H30A 2IWIA 2ZDTA 4D1XA 2RIOA 4EWHA 5HO7A 2UVYA 4ZJIA 4D5KA 3MH3A 1OIRA 1R1WA 4GVAA 5E8WA 4GT5A 1KV1A 4O0RA 4OTRA 2X0QA 4RWLA 5ETAA 3ALNA 1SVEA 5K5XA 3HYHA 4UBAA 2VV9A 3VWAA 3C13A 4FZ7A 4RVLA 5AM6A 4LDTA 4Q9ZA 3AT4A 4OTIA 2E9OA 1NW1A 4CFNA 2P33A 5L6PA 5E8TA 3CTJA 4W9XA 3BHUA 4BDEA 3V5LA 5EKOA 3VF8A 2IVVA 2WMTA 2BIKB 4BWPA 4E5AX 3E3PA 4JDJA 5LCJA 3WF9A 2P4IA 4ORKA 5FM2A 1XJDA 4L01A 5ANDA 1IASA 4M8TA 1OL2A 4FSWA 4N0SA 2J9MA 5M55A 4KUJA 3L8PA 3WIKA 4AGDA 4RIWA 3BL9A 2XJ2A 5I3RA 4QPMA 4QP2A 5L8JA 5IKWA 5CEIA 1U5RA 2GHGA 1G5SA 3LIJA 3FUPA 5J87A 3VN9A 4OUCA 2JFMA 2WMRA 3NUSA 5HTBA 3O5AA 3UQGA 4F0FA 4EONA 1H1QA 4KSPA 3FKNA 4IC8A 2C5XA 3LQ3A 1RQQA 3A8XA 1HOWA 5HE1A 2WO6A 4I4FA 2XNOA 3EFLA 5IISA 3FI4A 5K0KA 2YHVA 4IAAA 3Q2MA 4UYNA 4JAJA 5BMMA 4WG4A 2W1GA 5E7RA 4DDGA 5KMKA 2W9ZB 3UC3A 5AEPA 2OXYA 2PZ5A 5CF4A 3E7VA 5FBOA 3DJ5A 3WI6A 3FZRA 4FTIA 1XBCA 2W1FA 4CD0A 4O7RA 4ACCA 4CT1A 2YJSA 2HXQA 2HZ0A 4B4LA 3MPTA 4JJRA 5CANA 3PIZA 4NFNA 3MWUA 4AGCA 2WMWA 3RNIA 5JRQA 3IGOA 2R3OA 2C6IA 2IZSA 3P5KA