4BBEA

Aminoalkylpyrimidine inhibitor complexes with jak2
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
288
structure length
288
Chain Sequence
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRNLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TYROSINE-PROTEIN KINASE JAK2
publication title Sar and in Vivo Evaluation of 4-Aryl-2-Aminoalkylpyrimidines as Potent and Selective Janus Kinase 2 (Jak2) Inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 288
sequence length 288
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bbeA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bbeA01
4QYGA 3UO5A 2DS1A 3E7OA 5AJQA 5AM7A 2O64A 4DH5A 5FXRA 4O22A 2PYWA 3WIKA 1Q24A 5LWMA 3E88A 1PXJA 2OJJA 3T9IA 3LJ0A 1XJDA 2PVRA 2WFYA 1LPUA 2UVZA 1APME 1YWVA 2G2HA 2Q0BA 5E91A 2BHEA 3GU4A 4FNYA 2G9XA 2HENA 3MVJA 4XEYA 2IPXA 3DV3A 2VWIA 4MK0A 5F4NA 3EQRA 2WZJA 4QYFA 4RIXB 1J1CA 5HO7A 4BTJA 1Q8YA 3RAIA 4GMYA 5F95A 2BRBA 4EK4A 4FTQA 4GK4A 5CU6A 5J95A 4QTBA 4EH4A 1Y57A 4FTLA 3Q4CA 3JYAA 4I3ZA 5ACKA 3RPSA 3SX9A 4MVFA 3EQPA 3O50A 4TXCA 5HLNA 3P0MA 2GHLA 4X6RA 2UVYA 5CU2A 3OT8A 2WIHA 2HY81 4CYJA 1H1PA 4OTHA 4WSQA 3EN6A 4UWCA 4EWQA 2CCHA 4OAVB 2GMXA 5EI6A 3FLSA 4KKEA 3UC4A 2F7EE 4QMQA 2J7TA 2GFCA 3QQLA 3P08A 4EJNA 1H1RA 3KB7A 3WIGA 1G5SA 3QCSA 2YACA 4BBFA 4C35A 1FINA 4ANNA 1U46A 3A61A 3LE6A 3P78A 3HDMA 2C5OA 3BLHA 2YM8A 4FE2A 3OD6X 2ITUA 5EYCA 4GSBA 2O65A 3IQ7A 3CY2A 4XG8A 5ANIA 4FSMA 4ERWA 2R3HA 1XR1A 3KMUA 2VWWA 4RFMA 4KBCA 1ZWSA 3D2IA 4O7YA 2JDTA 2OO8X 1ZYSA 3VQUA 5EG3A 4D4RA 3FEGA 3NUAA 4HYSA 3OW4A 2R3KA 4G3GA 3PJ8A 3UP7A 5J7HA 2VTMA 4RLLA 4Z7HA 4RC3A 1DM2A 3DKOA 1W98A 4ZTQA 5AV0A 4EHGA 3LFDA 3WZEA 4YC8A 4PMSA 3TNHA 4AACA 4ZJIA 2WTKB 3VF9A 4BDAA 3LHJA 3R63A 3RBWA 3A8WA 5AV4A 1OL6A 2GS6A 3PXKA 3QXOA 3UIMA 4TWOA 2ITWA 3LZBA 5JRQA 4ZS4A 2PZ5A 3MN3A 2PVKA 4J96A 3QTZA 1PY5A 2C6MA 3C7QA 3QA8A 4H3BA 3AMAA 1P5EA 3OXTA 4BDEA 4CCBA 4YLJA 4YJNA 3BHHA 3TUBA 3P23A 3WYXA 4ZMFA 2VTQA 4QD6A 5AP7A 3PIXA 4IM2A 5CEKA 4C3PA 2GDOA 4R3PA 4YJQA 1B39A 1JLUE 2ZAZA 3RAWA 4JBPA 3PXYA 2WTIA 4EOQA 2RL5A 3O71A 3FMJA 4LRKA 1EH4A 2W1EA 2WMRA 4KSPA 4YZBA 3FBVA 3H0ZA 3ORNA 4IAFA 3R9HA 1V0OA 3E7VA 3BHUA 1Q8UA 2W9ZB 2B54A 4PMTA 5FTQA 1NVQA 3I4BA 5IKWA 4A4OA 4TNBA 3EN9A 4RJ4A 4BKZA 3U55A 4O81A 2BKZA 2A19B 3LFAA 5CSWA 4IM3A 3CKWA 1U54B 1UVRA 3R83A 4EC8A 4EKKA 3WF7A 2UZNA 4BR3A 2BDFA 3PPKA 3DLZA 4AGCA 4FV2A 2VWUA 4ZTLA 2FH9A 4YHTA 3E5AA 4FTOA 4EH9A 5AIRA 3AC5A 5AWMA 2GNIA 5GIOE 1BX6A 3R7IA 3QZHA 1KE6A 4IB3A 4O1PA 2BRNA 2XIKA 3QLFA 2WTWA 4QMZA 5HQ0A 3QU0A 1QPEA 4BBEA 4V0GB 3BZ3A 1KSWA 4JG7A 3W8LA 3CGFA 4ZSJA 2HXLA 2IJMA 2XB7A 4CRSA 3I1AA 3L9NA 2AC5A 4JDIA 1MQBA 3LFBA 5HX6A 2YAAA 5DA3A 5CANA 3DKFA 3G0EA 4HZSA 5A54A 5FDXA 3WE8A 2C3KA 4TN6A 3PJCA 4GT3A 4KIKA 4U6RA 2IVTA 2UUEA 3WYYA 3O8TA 4XG2A 4K8AA 4RJ8A 5ETIA 3T8OA 4AN2A 3SW4A 4OTDA 5AMNA 4DEHA 3MFSA 4HCTA 1BMKA 4TYEA 3RINA 3CLYA 3BRBA 3SHEA 2B53A 3FWQA 2Y7JA 4Q9SA 3PXZA 4IDTA 3PPZA 2JAVA 2CMWA 4M68A 3DJ5A 5EW3A 3R8LA 2BILB 2BAJA 4IAYA 4BKJA 3FE3A 4CZUA 3NIZA 4YR8A 5AX9A 3UZTA 3EQIA 2BAKA 3R21A 5EM8A 4ZIMA 4U81A 2VX0A 1XH7A 4U3YA 4XNEA 4R5SA 3TG1A 3IW4A 3HMOA 4XX9A 5TOZA 4I0RA 2GNHA 2ZM1A 4O0UA 3ALOA 4AX8A 1BL6A 2WQOA 2Q83A 3U54A 1SVEA 3QCQA 3NSZA 3W55A 4O0SA 4BDBA 1DI8A 2CLQA 1OECA 3ZSHA 3EKNA 3M1SA 1OZ1A 3MY5A 3QHWA 4JLCA 4CV9A 3GP0A 4YZMA 3LMGA 4IMYA 1CMKE 2J2IB 3LIJA 3Q4UA 4QTDA 3HRFA 2V22A 3R9RA 2UW4A 5BQ0A 2EWAA 3N4UA 3MA3A 4V01A 4X2FA 2WTCA 4LMNA 1ZY4A 2QOCA 4FC0A 1YXTA 3M11A 3PA4A 4DEGA 4X3FB 4D4YA 1F5QA 4DGLC 4U0IA 1H08A 5CZIA 3D4QA 4QNYA 4C38A 3K3IA 2NRYA 2V55A 2XJ0A 4GW8A 1AQ1A 2X4ZA 2OIBA 2QQ7A 5AP0A 4AZTA 3UC3A 5CEMA 4RFZA 2PY3A 4ZLOA 4N0SA 3R73A 3QD2B 4AXAA 2XYNA 3QD3A 4EZ3A 3D0EA 4FGBA 4GFOA 5D12A 4UMRA 5LJJA 2DUVA 2JITA 4D1ZA 5BNJA 4OAUC 3PLAE 2J0IA 2PVYA 5A4TA 4C33A 4ZLZA 2W06A 4F9CA 2Y9QA 1XO2B 3TDVA 3NNUA 4BDIA 1YQJA 3TT0A 1BI7A 2IWIA 4K0YA 4UX9A 2ZM3A 3FMHA 2J9MA 3SRVB 2XK9A 5ANGA 2JFMA 4YNOA 4TRLA 3RGFA 2W1ZA 4S31A 1H1WA 4UYNA 3HYHA 3S00A 3D7TB 3UE4A 2BKKA 2WQEA 3F9NA 2Y8OA 3DBEA 1GIIA 3N51A 4QP3A 4QMSA 5CSHA 3RWPA 4B8MA 4CGAA 3VULA 3RPYA 5AUWA 4HNFA 1P2AA 3WI6A 4BCQA 2CLXA 4FT0A 4DCEA 4F0IA 3EFJA 2PE2A 3IK3A 3PRIA 5C8MA 4IBMA 2GS7A 4D2VA 5JQ5A 3RMFA 4L8MA 3HVCA 4OTGA 4GVJA 2ZV7A 1BUHA 2QURA 4F0GA 1O6KA 3EZRA 2BZHB 5FP6A 1Q41A 3MWUA 2ITVA 2C6TA 3COMA 4GIHA 4IE9A 4GEOA 5CAVA 1NY3A 3ACJA 5IQHA 2I6LA 4F9AA 3OS3A 4BWKA 3ZEWA 1JKTA 3ZZWA 2JIIA 2PZPA 4ZTNA 2Z7RA 3C1XA 2XA4A 2IZSA 4F6WA 2V0DA 4QP4A 3HX4A 1PMEA 2JEDA 5M51A 1Q8ZA 4MXYA 2B9IA 2W5AA 3HKOA 4O83A 4IANA 4F9BA 3C13A 4YJOA 3ZFYA 3DZQA 4WKQA 2UVXA 5IA1A 4IHPA 3CP9A 5JGAA 4G9CA 3IDBA 4D1SA 2BMCA 4RIWA 3RNYA 3QD0A 3QUEA 2WTKC 3DPKA 4FSUA 3UNJA 4O7LA 1J7IA 2QNJA 1ZRZA 2ITXA 2O8YA 3A4OX 3ZDUA 3R2YA 4MNFA 1YWNA 3QYWA 2B7AA 2OIQA 5DBXA 4FSZA 2VWBA 2IW6A 2OI4X 2W99B 4IX3A 4KABA 3PPJA 5CAOA 1O9UA 1YXUA 2OLCA 2R0UA 2C3IB 3OUKA 3EMGA 2UZBA 2W4OA 4X2GA 4EOOA 3QX2A 1Q99A 4M12A 4II5A 3U4WA 5G1XA 1PYXA 4IJ9A 4TT7A 4NM7A 3UDBA 3LMIA 3KXMA 3TN8A 5C8NA 5LVNA 2X8EA 2ETKA 4S2ZA 2X7GA 4L7SA 3S95A 4YTCA 4YO4A 2VNYA 1TKIA 5FBOA 4ZK5A 5A46A 3HL7A 5CI6A 2ZMDA 2QU5A 2QD9A 4CNHA 5AAFA 5AV1A 4TL0A 2OH4A 4CFXA 1GOLA 4EZ7A 4WNKA 4ONAA 1H25A 4EHEA 2H9VA 4FZDB 3BLRA 4AT3A 4CFVA 2ZDUA 4NM5A 2C0IA 5JRSA 5I9XA 3DKCA 4IJPA 3U6IA 5CVGA 4FA2A 4PUZA 4PX6A 1IRKA 1B6CB 1W8CA 2XNGA 1GZNA 1PJKA 4MNEB 4ZSLA 3TNIA 3UP2A 3ZRLA 2ZJWA 1M7QA 1SVHA 2R9SA 5F1ZA 4KRDA 4O38A 4PF4A 4DEBA 2WEVA 3L8PA 3VUKA 2QODA 3HA6A 4EUTA 4EKLA 1GIHA 3A7JA 3NUUA 5CF5A 2HOGA 3GU5A 4FK3A 2W1GA 3QTSA 4HGSA 2VWZA 4IH8A 1YXSA 4G3FA 3TJDA 3KRJA 4F64A 4OTIA 5IG1A 4DN5A 4G5JA 5HNBA 4FTAA 3EFWA 3ZBFA 5E7RA 4EBVA 5J9YA 2P0CA 3ZLWA 5KMLA 3R7EA 4DCAA 2WIPA 2XNNA 2IVUA 3LCTA 4YLKA 3UOHA 4DHFA 3DDQA 4IAZA 3EQBA 4LQMA 4B6LA 4W9WA 4WNOA 3PE2A 4LL5A 1XBCA 2ZYBA 1PMUA 3O2MA 5CT7A 3SG8A 2WGJA 5DFPA 4O6EA 4JBQA 4Y46A 3CTJA 3UJGA 1OM1A 4EOKA 4PDSA 5LCKA 1ZMWA 3THBA 3LPBA 4KKHA 3ZFXA 2PUUA 2VX1A 4FL1A 5AUYA 3VBQA 5KE0A 5IISA 3FUPA 3S1HA 4IB0A 4WRSA 4AW5A 3MB6A 2OXYA 5I9WA 2HELA 3EN5A 5CF6A 3TV6A 4AWIA 1RE8A 3BIZA 2EUFB 3PFQA 4E6CA 1NW1A 4AZEA 1OIYA 4HCVA 2R64A 5LVMA 4CRLA 3AC4A 4RRVA 4RVMA 3P7CA 3FKNA 5HO6A 5EI8A 1CKIA 1YRPA 4DT9A 4M84A 4AZVA 3R8ZA 1H8FA 3LLTA 5FG8A 2V7OA 3DQXA 3PWDA 3OVVA 4RG0A 3EIDA 4FIEA 5KZIA 2OU7A 5IQGA 2QONA 4D2WA 3GFEA 2YIQA 2IVSA 1KV1A 5IEXA 2F7ZE 4X3FC 4L3LA 4FKLA 5CT0A 5BVOA 3MIYA 1UU9A 3DKGA 4YZCA 3F66A 1CKJA 3NNXA 3ZYAA 4EEVA 4QMUA 3IW5A 2QC6A 2I40A 4Y85A 2OZAA 2BVAA 4XBUA 4YUQA 4C37A 2BPMA 4QOXA 3QFVA 2WMBA 3VNTA 3VUGA 2GHGA 2VU3A 3QL8A 5B2KA 3FZSA 4I22A 3II5A 4L68A 5AM6A 1S9IA 3EQHA 3OOMA 3UVPA 3BLQA 4H1JA 1DAWA 3HEGA 3KVXA 3QLGA 1QPCA 3V8SA 4BY9E 1WCCA 2ZDTA 1OIRA 1Z5MA 5HIBA 4YPSA 3W2SA 4BBMA 1ATPE 5IDNA 4UV0A 3Q04A 5B2MA 2A27A 4WBOA 3WILA 3PYYA 4IX6A 3TIYA 4XLIA 4D0WA 2A4LA 2VTNA 3BYOA 5GJFA 3E3BX 2C4GA 2FB8A 2WMXA 3PIYA 4FTIA 4LV8A 3UNZA 3FMLA 4FV8A 2X0GA 3OROA 4PQNA 4KINA 3NW7A 5EOLA 3S2PA 5B2LA 4UMTA 4FUYA 2PVJA 4OR5A 4DFXE 3W1FA 5HG7A 3NLBA 4AN9A 4GYIA 5DG5A 3GC7A 4RVTA 3QRUA 4FKOA 3D9VA 3R1YA 4GFGA 4JQ7A 3R28A 4BC6A 3MH3A 3COIA 3HMNA 2X39A 4XG4A 5E8UA 1WVXA 3PVBA 3GXLA 3IOKA 3MV5A 2OW3A 4RIYA 2XH5A 5JT2A 5KHWA 2JDSA 2Y4IC 3FC2A 3UNKA 3VC4A 4IWQA 5FGKA 5GJGA 5FWKK 3V5LA 2JAMA 4TYJA 1DI9A 2CNVA 1URCA 3RM6A 5A4EA 3LCKA 5CU0A 4FKQA 4O6LA 1OBDA 2SRCA 1UKIA 4TY1A 4BCOA 2OXDA 4LM5A 3UVRA 3F2RA 3H0YA 1WBVA 1YOMA 4IEBA 2WOUA 4XV2A 2UZEA 3MESA 4RJ7A 3ENMA 3JR1A 5H8GA 4FL3A 4X6QC 3AT2A 4ZMEA 2WU6A 1WBSA 2XUUA 3NUSA 4PWNA 4WNMA 4WSYA 3K2LA 3QC9A 5FDPA 4AZFA 2CKQA 2UW8A 3FL4A 4L6QA 4ZY4A 3UBDA 4E5WA 3Q32A 4JRVA 4C3RA 4CCUA 2X7FA 1FOTA 4IZYA 4FSRA 2ETMA 3LJ2A 3CJFA 4ITJA 2XNPA 1J3HA 3QRJA 4RJ6A 4S34A 5HE2A 4EH8A 4FICA 2PL0A 4GK2A 4DAWA 4QTEA 3CC6A 3B8QA 3AD5A 4ENXA 1OITA 1VYWA 2BIYA 2YCRA 3R2BA 4RJ5A 3F5PA 5AUVA 2XK7A 4FNWA 2YCSA 3QQHA 4L43A 3KQ7A 4ZS0A 2ITOA 2PWLA 3HNGA 4FVRA 2GQGA 3F69A 4NT4A 3UVQA 4YZ9A 4ZOGA 2X9FA 3RM7A 1OL2A 4RFYA 4M66A 3TDWA 1S9JA 5M07A 4XV3A 4BTMA 2X2MA 4BDCA 2HW6A 4TYHA 2YDIA 3GGFA 3ATSA 3L9LA 3I6UA 4W4YA 3CPBA 4UYAA 5JKGA 3IG7A 3KXGA 1R0EA 4MCVA 1YI6A 4UMPA 3LM0A 3DOGA 3PZHA 4NTSA 5M53A 1X8BA 4DFUA 3HDNA 4RA4A 4FTCA 4G34A 2WTDA 4QRCA 1XWSA 3Q6WA 4JXFA 4YJRA 2BRMA 3KXNA 2B52A 2XJ1A 3FMNA 5CQWA 5C01A 3CPCA 3FLNC 2PK9A 3ZXZA 3A99A 3GEQA 5CSVA 1Q8TA 2X6DA 1YWRA 4KIQA 4ITHA 2YCQA 3DBDA 3DAKA 2PUNA 1U4DA 1UU7A 4G6OA 3ZRMA 2C1BA 1J7UA 4FX3A 3UQGA 1V0BA 4FV7A 3O0GA 4CG8A 3QQFA 3LCDA 4A07A 3HZTA 3QX4A 3ZMMA 3LFNA 3EOCA 5CNNA 3EKKA 1FPUA 3EQDA 4QPSA 2C5YA 5FEDA 4BTFA 2CNUA 5DYJA 4YMJA 3QWKA 1JQHA 3MJ2A 2Q0NA 4QTCA 2G15A 2XYUA 4YNEA 4FG9A 4AUAA 4NL0A 2I0HA 4XV1A 4FV9A 2BAQA 4L00A 3RPVA 3UQFA 3OY1A 3D5VA 4HPUE 3MH1A 5CQUA 4FEVA 4E73A 5JMSA 2JDOA 4C3FA 3DNDA 4MWHA 2VX3A 3BGQA 5GJDA 2XBAA 4AT5A 5L4QA 5DLSA 2GTMA 3B8RA 3ZSGA 5M57A 2PUIA 3QA0A 3OXZA 4JDJA 4M67A 3VUDA 4HVIA 3IW7A 1PYEA 2C47A 2FSTX 4OTPA 5E8WA 2R3OA 4ID7A 4YC3A 4F08A 5K5XA 4WOVA 3C0GA 4BVUA 2EXCX 1QPDA 3IGGA 3RK9A 3GCUA 1K9AA 4JAIA 5EDRA 3OUNB 4DFNA 4F7LA 1YDRE 3OT3A 3OG7A 2XEZA 4GIIA 3MH0A 1QL6A 4QTAA 1GIJA 2VAGA 4F99A 1UKHA 2GNLA 1XKKA 2OFVA 4ZEGA 4TYGA 2R4BA 4QMMA 1QMZA 3GCPA 1UNLA 1WBPA 3VWAA 4AOJA 4EOSA 3MYGA 3EHAA 2QLUA 1R0PA 3D5WA 3GNIB 5A6OA 3LFQA 5B7VA 4FOBA 2WQMA 3FMMA 4GKHA 2XS0A 1JAMA 3VS3A 1OPJA 3QYZA 3OWKA 2UZLA 4JT3A 4ZZNA 3LCOA 3QKKA 3GOPA 4B7TA 4M0YA 5H8BA 2PE0A 4BICA 4FR4A 3I6WA 5EM7A 5TKDA 2XKFA 4NCTA 5LARA 3DS6A 3FI2A 3RZFA 3VS5A 4EH6A 5EKNA 5EQYA 3V5QA 1UWJA 2VTIA 3ETAA 4BGQA 3IECA 3TUCA 4DEEA 1W82A 3FZPA 2P2HA 5I9UA 3DQWA 3MJ1A 5TR6A 4C0TA 3QZIA 5DT4A 4EK8A 2RSVA 3NUXA 3DK7A 4N57A 2C6DA 5AP1A 1OGUA 4R1YA 5CX9A 3PTGA 3VVHA 4NM3A 5EHOA 4C58A 1ZMUA 3L9PA 4H05A 4KIKB 3UMXA 1ZOEA 3P86A 4EYMA 4PL5A 4BIEA 1VZOA 2Z8CA 2FYSA 3QZFA 4J97A 2F2CB 2YM5A 3I81A 2Z60A 4NEUA 3BE2A 2PU8A 5D7VA 2CKPA 3MVMA 5BYYA 2WOTA 2HZ0A 3DNEA 3NEWA 3OCSA 1M17A 4PP9A 5AR3A 3V51A 3ZO2A 4IFCA 4FT7A 3UIBA 4P5ZA 2GPHA 5G6VA 5AIKA 3PDTA 4FVQA 5D10A 2OFUA 4JQEA 1ZAOA 4U44A 3TCPA 4BCKA 4EK3A 5JH6A 4F63A 2ITYA 4C34A 4AOIA 2HZNA 4O7VA 2C69A 4FT5A 4O84A 3Q52A 3SA0A 2CPKE 2GNGA 4QP9A 2QOQA 2V62A 3RCJA 4O7ZA 4GJ3A 5KZ0A 4ZAUA 3NS9A 3DXNA 4DLIA 4W8DA 4Q9ZA 1CKPA 4N4SA 5CY3A 5HKMA 4E6QA 4R7IA 1NT2A 3ID6C 3PE1A 4LL0A 1O6YA 1SNUA 2QLQA 3UG2A 3TJCA 4YLLA 3UZPA 5ICPA 3PY3A 4PL3A 2QHNA 2ZVAA 1V0PA 3ORTA 5KBQA 1M2PA 3ELJA 3D2KA 5HCZA 4O7RA 3ODZX 4HVSA 3HMPA 2PVLA 3NW5A 5KUPA 3Q9YA 3AD4A 3ZO3A 4U42A 4G3DA 5I3OA 4D4SA 3IPHA 5BUIA 2ZB0A 3IGOA 1HOWA 3V04A 4AT4A 2J0MB 3LM5A 4LUEA 5HIDA 4DH1A 4AS0A 4UZDA 4GRBA 5C03A 2HYYA 2I1MA 1Y6BA 3RZBA 2VN9A 4XG6A 2CHLA 3H9FA 4ZXTA 4DGGA 4I1ZA 3FHRA 4EONA 1H01A 3EFLA 4FBXA 3SXSA 4U41A 2QOFA 4UWYA 4FYNA 4G3EA 3R1SA 4TWNA 4UALA 3HLLA 5ANDA 3TXOA 3WF8A 3PSBA 5KMMA 3BGZA 4AGWA 4CLJA 3OTVA 4ACMA 3MDYA 3R7OA 3D94A 3E93A 2REIA 4I5HA 1ZOHA 5IZFA 3HA8A 3QHRA 3ZXTA 5A4QA 5L8KA 5EW8A 2JKKA 3DBQA 4F70A 3PUPA 2QOIA 4JDKA 4JNWA 4YBJA 4MF0A 4RVLA 4CT2A 5EYDA 2J6MA 2QG7A 1CSNA 3ENHA 2P4IA 2VZ6A 2XNMA 3C4WA 2E9PA 4ASZA 3AGLA 2YM4A 3H10A 3D7ZA 2UW6A 4HOKA 4ZY5A 3QRKA 4FNXA 1Y8GA 4LRJA 4OLIA 4XOYA 3AC2A 3GB2A 2NP8A 3TNQB 1H00A 4GJ2A 4UEUA 4A06A 4DH8A 5L8LA 3SDJA 3TZ9A 1A48A 3PP1A 4XHKB 3AC3A 4NK9A 4JBVA 5H8EA 3FMDA 3EJ1A 5AP3A 3JS2A 2OK1A 1E9HA 5M4CA 3P7AA 3Q4TA 2C68A 4QMOA 3HRBA 3MW1A 4GH2A 5HU3A 5EI2A 3BQCA 2QHMA 3ZUVA 4OTFA 3KCFA 4WUAA 5JFSA 4KAOA 2VNWA 1F0QA 2HY0A 3CE3A 1WBWA 4BCGA 4Z55A 5E4HA 2QU6A 2VV9A 2XNOA 4FTTA 4YZDA 5HD7A 4MHAA 3RNIA 5HE3A 2VTRA 4NIFA 4M69A 2G01A 4PPAA 5A6NA 2QO7A 4L3PA 4FV6A 4MBLA 3QGYA 3QUDA 4G1WA 4UZHA 2WQBA 5CSXA 2VTSA 5FQDC 2VGOA 5L6PA 3DA6A 1R78A 1YOJA 1KE9A 2PVHA 5HHWA 5IQIA 2A0CX 4K11A 3NAYA 2HW7A 4I94A 3U51A 2OSCA 5HE0A 3T3UA 5AV3A 3QKLA 2ITZA 2J0LA 4G3CA 3R04A 3PXRA 4K9YA 3CCNA 2H34A 5EYMA 4KA3A 2JFLA 3NYVA 4WG3A 1OL7A 4DFLA 4PY1A 4QMYA 4BFMA 1SZMA 2C3LA 3FY0A 5IUIA 3ANRA 4YTFA 2G2FA 5JZNA 3W16A 4ANQA 5JQ8A 3TTJA 2RGPA 4GFMA 4XG3A 4FZ6A 2W1DA 3EQGA 4G16A 3FMEA 3Q96A 1NXKA 2XK3A 4EC9A 4GL9A 4DA5A 4FV1A 3G5DA 4BGGA 4YU2A 4A9SA 1IA9A 2C6EA 4OGRA 3BV2A 3COHA 4ANBA 1U5QA 2J5EA 4HYUA 3W8QA 4I21A 2HWPA 4B99A 5CAPA 4IWPA 1R1WA 3V8WA 3ITZA 1PXNA 1KE5A 4O0XA 4D58A 3ZLYA 1Q61A 4CLIA 3ZLXA 1IG1A 1VR2A 3EWHA 3F5GA 5AUTA 5FM3A 4J99A 3R9DA 2HAKA 4USDA 2R3IA 4UWBA 2WMAA 3DK6A 3LXNA 4OUCA 4PL4A 4ZJVA 5K5NA 3IOPA 2HXQA 4KKGA 4MBIA 4E93A 2YABA 3GI3A 3N4TA 5EKOA 2UZDA 2UV2A 4F1MA 4F0FA 4TNDA 2IVVA 3GU7A 4JVGA 3UPXA 5LCJA 2Y6OA 3OCBA 3MA6A 4XBRA 5DRDA 4CFMA 4ZSEA 3PZEA 4OBOA 3LFEA 4I4EA 3VS0A 4DEIA 2F4JA 2WTJA 4ZTSA 2C0TA 5HIEA 3EQCA 5EQEA 4U40A 1YI4A 5AA8A 2W1CA 1VEBA 4FKSA 3EFKA 1JBPE 1Q5KA 4JDHA 4MXAA 1H0VA 2F2UA 4R8QA 4W9XA 4ASEA 3SXFA 4W8EA 3L1SA 5F20A 5BVKA 1W7HA 3ZLSA 5FTOA 2CGWA 1IASA 4FF8A 4A9UA 3G90X 3GT8A 4L9IA 4O91A 5HO8A 5J1VA 1IEPA 4PV0A 3DFAA 4B4LA 3TUDA 3NIEA 4Y72A 5I9VA 2NNWB 1OPLA 1REJA 2BRHA 4QMWA 3C0HA 4YSJA 1BYGA 3TACA 3OP5A 5CF4A 1FVTA 3AGMA 4QNAA 5HNIX 3GU6A 2HIWA 4O0WA 2W0JA 4AN3A 3CS9A 3DLSA 4FTJA 2GQSA 5T68A 1H27A 1RJBA 4NW6A 2R7IA 4JRNA 4X0MA 4C62A 2VGPA 3BU3A 2W96B 3C5UA 2BR1A 3RK5A 3RK7A 4MF1A 3A7GA 4FKWA 4N6YA 4Z9LA 4D9TA 5IA2A 4Z7GA 5EHLA 4WHZA 4EZ5A 5K9IA 4IQ6A 3KGAA 3FZ1A 3CJGA 1Y8YA 3NVKI 2JKQA 2J0JA 3TL8A 5AUUA 4NW5A 5DNRA 3UZRA 3AD6A 4HZRA 4O21A 3FPMA 5DIAA 3NGAA 4E5AX 3D83A 3OWLA 3F5XA 4W4XA 2V7AA 4MD9E 4FMQA 2UZTA 4JR3A 2LAVA 3WF5A 4PNKA 5BUEA 4C8BA 5I4NA 3R30A 2EVAA 2IW8A 4NTTA 4JIKA 4NWMA 2OZAB 4HVGA 4GS6A 4V04A 3DDPA 4WO5A 4AZSA 4C4HA 4HVHA 4LGHA 3MH2A 1M14A 1PXOA 3QQKA 4PDOA 4R3RA 2XF0A 3QRIA 4BRXA 2YM6A 5CWZA 3W10A 5I9ZA 3NVMB 5C4KA 3PJ1A 3KREA 4QT1A 2EXMA 2BZKB 4KWPA 4BTKA 1ZY5A 2FGIA 2JDRA 4J8MA 3ZTXA 2EB3A 3P5KA 4YC6A 3VBWA 5ANOA 3SGCA 4MAOA 5DHJA 4D2TA 1AD5A 1FQ1B 1CDKA 3R7GA 5KKRB 1YOLA 4PDPA 2XM8A 5L3AA 5LVPA 2WMVA 4CQEA 5JFVA 1E1XA 2DQ7X 3AXWA 4WBBB 2QO2A 3VJOA 4MQ2A 1UU8A 4LOPA 4JX3A 5M4UA 5CSPA 2VTLA 1LEWA 2JIUA 4NKAA 3KULA 1H26A 2OICA 4U79A 4FV4A 4Q5HA 4FIJA 3LJ1A 5CNOA 5B0XA 3E92A 4X21A 5AR7A 3ZS5A 4BWXA 2X4FA 1WVYA 5J1WA 3MFTA 4IVDA 4HNIA 2WXVA 4U5JA 4U97A 2ETRA 2UZWE 4IZ5A 2JDVA 2OJIA 5BVDA 5AFVA 1I44A 2WMTA 2LGCA 4PP7A 3FLYA 3C5IA 4IZ7A 4JIAA 3ZDIA 3EN7A 3GCQA 1FMOE 3QGWA 2Z2WA 2GSFA 3R9NA 1UNGA 5FRIA 2VO3A 4RIYB 4CMUA 2XVDA 3TNPC 5L2IA 5DT0A 3TKUA 4A7CA 3S3IA 3ET7A 4O27B 3FKOA 2BTSA 4FEQA 4IVCA 4CTBA 4C61A 3CR0A 3FAAA 3ORIA 3Q3BA 5HICA 3VUIA 4R1VA 4EOPA 4CEGA 3A7FA 3O96A 2QOBA 5E8TA 1IR3A 5JGBA 4M8TA 5JFWA 4F7SA 4D55A 4O0TA 4LYNA 3PVGA 5BMSA 4MXOA 2GNFA 2Y4PA 5E8ZA 3WBLA 1QCFA 3VUHA 1KUTA 4BGHA 3NRMA 5LMKA 4BCIA 4L46A 3NUYA 1WAKA 3RPRA 4O7TA 2JLDA 5JK3A 5IQFA 1UNHA 2R3QA 1RQQA 5K0KA 4EH3A 3V5WA 4DH7A 4G5PA 1ND4A 5DEWA 4EQUA 4G17A 3AT3A 4DG0E 1Q4LA 2UW0A 4DFYA 1WMKA 4E8AA 2QVSE 3QCXA 3Q60A 4CMTA 4EYJA 1PRYA 3R7VA 3LXLA 2OXXA 3TKHA 3DB6A 4W4WA 4USEA 4BYIA 1Q97A 3DAJA 3JY0A 3DAEA 3I0OA 1FMKA 5K4IA 5D41A 5FD2A 1XQZA 4M3QA 4NKSA 4PNIA 3W32A 1TQMA 3ZU7A 5DMZA 5IEYA 3B2WA 5DRBA 2C6IA 3KKVA 4TYHB 4NYEA 3BYMA 5HG5A 2OZOA 1J7LA 3ZCLA 3CQWA 4D5KA 1OL1A 5LQFA 5I0BA 3DJ6A 3F3UA 3GU8A 3OXIA 4AE9A 4BCHA 3FSFA 5HOAA 4F1TA 5AAGA 4DEAA 4RVKA 4RQKA 2RFDA 5DH3A 1XH8A 1SNXA 2RIOA 4XP0A 1R39A 5DGZA 1WBNA 1GJOA 4EUUA 1ZYDA 2ZB1A 3DTCA 3G9LX 4GK3A 4MWIA 5C27A 4E5BA 3W2RA 3DXQA 1YXXA 3LQ3A 5EQPA 3W2OA 5M08A 4AOTA 1BL7A 3OWJA 4D2RA 4UMQA 3BWJA 3KRRA 4QMTA 1HCLA 2PZYA 4O7WA 1JKSA 1REKA 3ZHPC 2XM9A 3E63A 3HUBA 4DF3A 3WE4A 3KN5A 1CTPE 1ZXEA 1RDQE 3CSVA 4E7WA 1K3AA 2OF4A 1NVSA 5IQCA 3L8SA 3OWPA 4IAIA 2R3LA 4XV9A 5AUXA 4DG3E 3SXRA 1SM2A 2R5TA 3R8VA 3G9NA 3QRTA 3MVLA 3QXPA 3NYOA 3HAMA 3BEAA 4XS2A 3POOA 4Y5HA 2OGVA 4FG8A 4IVBA 3DU8A 3BHTA 2PZRA 5J7BA 3EB0A 5HORA 3GQIA 4RX5A 5FP5A 4GCJA 5M4IA 4BI0A 4LI5A 4M15A 3ZSIA 2XIYA 3G2FA 3R00A 4H3PA 2ITTA 2O0UA 2YM7A 4HGEA 1OB3A 4P5QA 4XUFA 5TT7A 4DLJA 1PKDA 5I3RA 3UPZA 2CKOA 4Y83A 5IMXA 3FPQA 1G8SA 2YJRA 4GV1A 4ACHA 3OTUA 3T3VA 3LXPA 4U45A 5GNKA 4O86A 3U87A 4JBOA 2JGZA 3C0IA 5AR8A 3F6XA 1M52A 2FA2A 2W1IA 2X81A 2XK8A 3E87A 3GOKA 3IO7A 3F3VA 3PVUA 4FTMA 4MX9A 4MYGA 4BDJA 4D28A 4ASXA 3UYSA 4MH7A 2PZIA 2I0YA 2ITNA 3CQUA 3D15A 3NUNA 4HGTA 4D9UA 3F61A 3NCZA 4G9RA 4RWIA 1IAJA 3UODA 2OJGA 3UOLA 5BVNA 1STCE 1FVVA 3QBNA 4GUBA 3ZO1A 4H36A 5IH5A 4E4NA 1JWHA 3LLAA 3PJ2A 4P90A 3DZOA 4IWDA 3ZOSA 2OH0E 3MFRA 4ERKA 2VTTA 2XJ2A 4MBJA 1GAGA 4O2ZA 3OBJA 5AAEA 5CAQA 3HV4A 4I5CA 2YIYA 1XBBA 4X3JA 4LRMA 1RW8A 2J4ZA 5CI7A 4EHZA 2UW9A 4A4XA 4EL9A 2AYPA 2UW7A 3KFAA 4FSQA 3C4CA 4I92A 2QI8A 3KVWA 4U8ZA 3UO4A 4WIHA 4B0GA 5KX8A 3VS2A 5TF9A 3FDNA 4RZWA 1P4FA 2C0OA 3DB8A 4JAJA 3HAVA 4J1RA 2I0VA 5CF8A 3NYXA 4C36A 5CYIA 2YA9A 3AC8A 4WNPA 4I24A 3I0QA 3FV8A 4ENYA 2NO3A 3BHVA 4JS8A 4NUSA 3I60A 2E9NA 4I23A 5AR2A 2XKCA 3KMWA 2PVMA 2R3FA 4CZYB 1SYKA 3U6JA 1H28A 5H2UA 4HGLA 4IZAA 1KE8A 5CXHA 5C1QB 2F57A 1PW2A 2WB8A 5HNGA 3RVGA 2UW5A 5DVRA 4DBXA 4RBLA 1WBTA 5JGDA 5BVWA 3GENA 4NZWB 2NPQA 2FUMA 2GTNA 2PHKA 3FZRA 2R2PA 3PXFA 3L8VA 3IKAA 4FSTA 4WD5A 4GUEA 4DGOA 3M2WA 4GKIA 5ETCA 1UU3A 3Q2MA 4A4LA 4EQMA 4UMUA 4D4VA 1OKZA 4J52A 1ZYLA 2IW9A 2IO6A 4IB5A 3P1AA 3CTHA 3DFCB 4YO6A 2UZUE 3BQRA 5AP5A 3ORMA 4IAAA 5AEPA 4JOAA 3GUBA 3BI6A 4UY9A 1K2PA 2RFEA 3A8XA 3QQGA 3V6RA 3PWYA 4AE6A 3VF8A 3BKBA 2QOLA 5DE2A 3MTLA 4RQVA 4FZ7A 4A9RA 2OG8A 2E9VA 1AGWA 5L2TA 3FJQE 1ZZLA 1WVWA 1WBOA 3RAHA 4BDDA 4IACA 2GHMA 2UW3A 3FYKX 4FL2A 4PRJA 2PMIA 4FK6A 4PTCA 5IA3A 5J5TA 5LVOA 4E20A 2ONLC 2A2AA 4NSTA 5CZHA 3D5XA 1QPJA 3FLZA 1OIQA 2FO0A 4U43A 4F09A 2X8IA 2W4KA 4YGAA 4AZWA 3EL8A 4RJ3A 3L9MA 2BHHA 2C1AA 3R02A 4QMNA 5BX0A 2RFSA 4M13A 1GZ8A 3HUCA 5KMKA 3UYTA 2Y6MA 1W0XC 4DFZE 2EXEA 1M2QA 1LUFA 2WKMA 4O0YA 4A9TA 1OKYA 2C5VA 1TQPA 4EOLA 2GCDA 4APPA 1P4OA 3F3WA 3V01A 5HU9A 5JEBA 2Z02A 4IC8A 3BBTB 4DC2A 3S4QA 1JOWB 4YHJA 3OEFX 3C4XA 4CFWA 4CV8A 5J9LA 5EFQA 4ASDA 4J53A 4I93A 4ANMA 3GC9A 5ANEA 4O1OA 4BZDA 3AQVA 3KRLA 4GVAA 2WELA 4FI1A 2X2LA 3ZUUA 5CAUA 2PPQA 4JR7A 4YJVA 5IQDA 3FI4A 1FGIA 3ATTA 4TZRA 3BU6A 1OUKA 4M7IA 2ERZE 2XRUA 4ACDA 2CGUA 2VO0A 3PXQA 5HI2A 4X2KA 5LMBA 3MB7A 4R7BA 3DK3A 4FV3A 3OC1A 4ZP5A 1PXKA 3MY1A 1OBGA 4BN1A 4P7EA 3HV6A 3GBZA 5J8IA 4BZOA 5EDQA 4QYYA 2C6LA 3MPTA 2Y0AA 5DWRA 5GZ8A 2IZRA 3OHTA 5CENA 2YIWA 3GCVA 3IDCA 4RWLA 5IQAA 4EORA 3TZ8A 3EN4A 4K1BA 2YDKA 3Q9WA 4IX5A 2H6DA 4L44A 2B0QA 4JL9A 3AMBA 2W4JA 3HMMA 4JJRA 1J1BA 3ZBXA 4QQJA 4QMPA 1T46A 3HGKA 3IS5A 2WU7A 4B9DA 3PVWA 2YERA 4BCFA 3ERKA 4LG4A 1W84A 4CKJA 4PPCA 5KBRA 2VRXA 5KCVA 4ZTMA 4OBQA 4RX7A 1IA8A 1VYZA 2G2IA 4H39A 4K2RA 2YHVA 4NM0A 4NIFB 4M69B 4IAKA 4FODA 3RHKA 3W2QA 4CQGA 3UMWA 1NA7A 3NDMA 4FKJA 4ZTHA 3FXZA 3O8PA 2QKRA 4PMMA 4GU9A 4BB4A 4FEXA 3Q9XA 1T45A 4BZNA 3RALA 5HLWA 1OMWA 4EI4A 4KBKA 1U5RA 4GT5A 4CVAA 5AR5A 3FLWA 2NRUA 4NFMA 2OIDA 4RT7A 2BFYA 4PDYA 3FC1X 5J87A 2B9FA 4J95A 4KSQA 5D1JA 3PRFA 4C4IA 3A4PA 4QMVA 1M2RA 4M97A 2XCHA 3EQFA 5HE1A 4IB1A 2KTYA 3GC0A 4BL1A 1PXLA 3BYUA 2ZV9A 4XG7A 5E90A 5DR9A 4RX8A 3WF9A 3QCYA 3G6HA 2YWPA 3FLQA 3OFMA 3VS1A 1MRYA 3R1NA 3H3CA 2WMQA 3R0TA 5GINE 4BHZA 2DYLA 4RC4A 3HV5A 3DJ7A 3F5UA 4TTHB 4Z16A 4MXXA 2BFXA 2FSOX 4DT8A 1P14A 3K54A 4FSNA 4AP7A 5LWNA 1XH9A 3U9CA 4IFGA 2XCKA 3U4UA 4NH1A 4I0TA 4I41A 4IX4A 4Q5EA 1FVRA 4HJOA 4APCA 5KMNA 4I6QA 3W33A 2AC3A 3VW8A 3FSKA 4J98A 2GNJA 5AA9A 5JN2A 3BWFA 4BDKA 3FQSA 3UTOA 4AA5A 2VD5A 5E8YA 4NCTC 3JUHA 3UIXA 3UGCA 3E64A 5DOSA 4C4EA 4R78A 4G2FA 4DINA 4FZFB 4TW9A 5JSMA 3Q5ZA 3H9RA 3CY3A 5TE0A 2R3RA 3DXPA 1PXMA 1MRVA 2OJ9A 1XBAA 4AGDA 5LOHA 2JBOA 2YITA 3ALNA 4QP8A 2QR7A 4FUXA 4MD7E 4EBWA 4I6HA 4I6FA 4X2NA 5CU3A 1OKWA 5CALA 3D14A 3DY7A 3MIAA 4ZY6A 3COKA 4U7ZA 1OI9A 2XMYA 3DT1A 4KBAA 4AGUA 1MP8A 4DTKA 5CASA 2BRGA 2JBPA 4O2PA 4BCPA 2E9OA 3RAKA 4LMUA 1KV2A 3MY0A 2QOHA 1Y6AA 3UQCA 3R01A 4X7QA 3OEZA 3B2TA 4YPDA 1LR4A 1Q62A 2QCSA 4NJ3A 2W05A 3IDPA 3QKMA 3NNVA 2VUWA 4HYIA 2ZV2A 3U6HA 3TZ7A 1JNKA 3ORLA 3WZDA 3WOWA 5J5SA 3BYSA 3RHXA 2I0EA 4E26A 4O7NA 3QTQA 1B38A 2B55A 2IZTA 4ITIA 2IG7A 2BROA 4DH3A 4C2WA 5C8KA 5CLPA 5ITAA 3CD3A 3R6XA 5HCYA 5KMOA 3C4ZA 5CU4A 5BPYA 3I7BA 3L8XA 3Q5IA 2YFXA 4HYHA 4RC2A 3SAYA 4BDGA 4WG4A 1E1VA 1ZYCA 3H30A 2ITPA 2QG5A 4AF3A 5HLPA 5IMEA 1G3NA 3ULIA 3NZ0A 3F82A 3GFWA 3TEIA 2YEXA 2F49A 3PY1A 4RZVA 4O96A 5IA0A 2C30A 3KXZA 4MXZA 4QP6A 4WA9A 4IDVA 5L8JA 3VHEA 3QQUA 4DG2E 4GU6A 5H9BA 4DBNA 3OCGA 2X7OA 1UWHA 3O8UA 2RKUA 5M55A 4XCUA 5K0XA 5IU2A 4FTRA 3F2NA 4ZZMA 3O17A 4L45A 4DGNA 2HWOA 1OUYA 3C9WA 3EZVA 3IW6A 3PJ3A 1JSUA 4FOCA 4RIWB 5AP2A 4BIBA 5IA4A 4FG7A 3TV4A 3PA3A 4BWPA 4IVAA 2R3MA 3QTWA 2W7XA 4LGDA 5EDPA 3ZFMA 4BCJA 4BIDA 4D2PA 4CYIA 2JKOA 2YLEA 3TV7A 4RIXA 4K18A 4HW7A 1XHAA 5KMIA 2XIZA 4AA0A 2CN5A 5ANJA 5HGIA 3SQQA 2FSMX 4DGMA 4F4PA 5AX3A 3BX5A 4H1MA 1U59A 3VS4A 3VBYA 4F9YA 5KNJA 3RCDA 4EOIA 2X8DA 1JPAA 1OVEA 4ACGA 4AW1A 4AFEA 4TWCA 2R3PA 5AP4A 4FTNA 4OW8A 4BCNA 2PMOX 3ZO4A 3BYVA 2YDJA 4FYOA 5JZJA 1HCKA 3KULB 4TPTA 3TZMA 2J50A 4FZAB 2YLFA 4G31A 3KXXA 5HD4A 3PIZA 3EYHA 4EOJA 3MTFA 4L7FA 4FT9A 3NW6A 4RMZA 5E8XA 4AA4A 1ZOGA 1ZARA 5K3YA 3MI9A 4CG9A 4MKCA 4EH7A 3VHKA 3FYJX 2XNEA 3PSDA 5BVEA 4XMOA 3JY9A 2W1HA 4FIHA 3QD4A 4BI1A 1H1QA 2QKWB 5C9CA 4CSVA 4ZLYA 2DWBA 3RPOA 4E4LA 1TQIA 4IC7A 2JD5A 2WAJA 1KWPA 5GHVA 2CKEA 4F1OA 3SC1A 3TNWA 2ERKA 5E1EA 5E92A 5M06A 4YURA 1GZKA 4V05A 5FEEA 3VBVA 3EYGA 3G33A 2WHBA 1J91A 4WUNA 2B4SB 5CVHA 2OJFE 1FBNA 4ALVA 4YTIA 4AU8A 1H07A 4OBPA 1H4LA 3V8TA 4EK5A 3DBCA 3HV3A 5AADA 3IONA 2IN6A 3AMYA 3KF7A 3ANQA 5A4LA 1IAHA 3E8DA 3O7LB 3MBLA 5IQBA 2VO6A 4F7JA 3V6SA 1MUOA 1YW2A 3WZUA 4AW0A 3FZTA 4CKRA 3E8EA 3K3JA 4FSWA 4QP2A 1WZYA 1ZMVA 4Y73A 3SG9A 3FQEA 4FEWA 2BZJA 2HK5A 3A7HA 3CXWA 3LMHA 1BI8A 5FLFA 4FKIA 1PMNA 5T3QA 1ZYJA 2PTKA 3SW7A 3KF4A 3AT4A 5ETFA 4QYHA 5HVYA 2H96A 4HPTE 4BCMA 2H8HA 5M09A 4FV0A 2FVDA 4GT4A 5HESA 4KS7A 3VS6A 4FEUA 1L3RE 4YJSA 2CJMA 3KRWA 4Q2AA 3AC1A 3P4KA 3U9NA 4DTBA 4D2SA 3RWQA 3NMUF 3D5UA 4XH6A 4F7NA 2ITQA 1JSVA 2ACXA 5HTIA 3KA0A 4L42A 5JFXA 3N4VA 1U54A 5HVJA 1H24A 3KK9A 4ALWA 2OKRA 4KB8A 1ERKA 5DN3A 2YJSA 4ANOA 2ESMA 5EM5A 3ORPA 3ZRKA 4V0GA 4EH2A 2XK4A 4J7BA 5K4JA 2F7XE 3I5ZA 4ARKA 2Y4IB 5KMJA 4TKSA 4U80A 3FMKA 1MRUA 3HV7A 4H58A 4C4FA 2X2KA 2WO6A 3AG9A 5E1SA 4BDFA 5FM2A 2BUJA 3G51A 3PY0A 3A60A 4R7HA 4ZTRA 4I4FA 4CMOA 1A06A 4FTUA 4LGGA 3C4EA 1L8TA 4K33A 5ETAA 2XP2A 1JKKA 3SOCA 3CEKA 4NU1A 4RGJA 4NJDA 1JVPP 1R3CA 3C4FA 3EH9A 4WT6A 4BI2A 3OBGA 4E3CA 1YXVA 4ACCA 3F7ZA 3OW3A 2VTJA 3UIUA 3CTQA 3E62A 4L67A 3Q6UA 3ORXA 1XH5A 4XP2A 4BKYA 4YHFA 3TWJA 3W18A 5HG8A 4IXPA 4I0SA 1H1SA 4MD8E 3WF6A 3LFCA 4UN0C 4KNBA 2BALA 1KOBA 2R0IA 4FSYA 4YJTA 5HVKA 1FGKA 2J51A 3BV3A 3VW6A 4F6UA 4D5HA 3O23A 5J79A 3QAME 5IUGA 1DS5A 2B1PA 2YZLA 3PG1A 4J8NA 3POZA 4O0RA 5HTBA 3HP5A 4N6ZA 3Q2JA 4QPAA 3VUMA 3LQ8A 4R77A 2W1FA 3KY2A 2UZVA 2WD1A 4O7SA 1JKLA 5I9YA 4FKTA 5HCXA 3CKXA 4EWHA 3LFSA 4BF2A 3KMMA 3IW8A 2PVNA 3F7WA 4HVDA 2F9GA 4FGRA 4DEDA 1ZLTA 3P9JA 4XG9A 2HCKA 3JPVA 3MFUA 4QQ5A 3V3VA 3OZ6A 4FKGA 4QP1A 4RWKA 5FTGA 5M44A 1KE7A 2WMSA 3N9XA 3G6GA 4EK6A 4MEDA 2PE1A 5GIPE 5D7AA 2WMWA 1OL5A 3LXKA 5IEVA 5E8VA 1TVOA 3LW0A 3BELA 4X3FA 5AR4A 4HCUA 4C4JA 3KL8A 3P79A 1Y91A 4CD0A 4U3ZA 5HEZA 3PP0A 1ZZ2A 4RA5A 2O2UA 4FNZA 3JVSA 5L6WL 4YP8A 5IDPA 1BKXA 2C6KA 3FXWA 5L2QA 3KCKA 2RG5A 3RKBA 2G1TA 3DBFA 4H3QA 3R8MA 4FKVA 3RI1A 1YHSA 3VRZA 3BEGA 1I09A 3MPMA 5BMMA 2XKDA 4UBAA 1PKGA 4AQCA 5I5ZA 3JXWA 4MTAA 3ZC6A 2PULA 2CCIA 4OTWA 4LOQA 3FZOA 3NYNA 2VTPA 3LQ5A 5DR6A 2YCFA 3BPRA 3ULZA 1YHWA 5HTCA 2V5QA 4CFNA 5IPJA 3ORKA 4RIOA 3F2AA 4Y95A 2R3JA 2XIRA 2Z7SA 3MS9A 4DITA 5IA5A 2CSNA 3FHIA 3ORZA 4NFNA 3QTIA 3T9TA 3K5UA 5A3XA 5F9EA 2QO9A 3SRVA 1PXPA 5T6KA 2VWXA 4EHVA 3D7TA 2Z7QA 4GG5A 3PSCA 5EHYA 2XKEA 5IF1A 5AV2A 3CIKA 1Q8WA 3ZH8A 5D11A 3SOAA 4XYFA 5EK7A 4KIPA 3OOGA 3R7UA 3KRXA 4ZZOA 5IUHA 5EM6A 3RJCA 4EOMA 4XRJA 4IADA 4F6SA 5HBJA 4OT5A 4TWPA 5EH0A 5HBHA 3TIZA 3CBLA 5A9UA 4FIGA 3VJNA 4YBKA 2X9EA 4DE4A 3REPA 2VO7A 4I6BA 2RFNA 3WZKA 4AFJA 4ANLA 2BIKB 5CEQA 3A2CA 2ZM4A 2IZUA 3QALE 3QTXA 3Q4ZA 2KULA 2XRWA 2XNBA 5KO1A 3R8PA 5DEYA 3ZM4A 4S32A 5DT3A 5DI1A 4YSMA 3HMIA 3W2PA 3LKMA 4ZSGA 4MQ1A 4XP3A 3ROCA 4L3JA 2RF9A 5CTPA 4R3CA 3UOKA 4A9YA 5GZ9A 4YJUA 5BVFA 2WNTA 4PTEA 4L01A 2QOOA 1JSTA 3SLSA 2X1NA 4QQTA 4P2KA 2W5HA 5EW9A 5HZNA 2PMLX 2BDWA 2R3NA 4BDHA 5LMKC 4C57A 3NAXA 2HZ4A 4O82A 4WG5A 5CEOA 2J0KA 1SVGA 3I5NA 3DTWA 2PVFA 4BYJA 2GQRA 3LAUA 5IH6A 1M7NA 2JIVA 4AAAA 3VUTA 4OTQA 2YAKA 3TM0A 1KOAA 4M14A 3F88A 2PSQA 3Q53A 5CVFA 5KHXA 3G15A 4C2VA 5BYZA 2XZSA 1UA2A 3QQJA 3PLSA 4CT1A 2W17A 4TYIA 3VIDA 5M56A 3ZC5A 4ALUA 2J90A 3O7LD 3QC4A 3NWWA 4UXQA 4Y8DA 4G6NA 3DCVA 4KUJA 3BCEA 2OWBA 2Z7LA 2O63A 4IW0A 4YTHA 3U8WA 1GZOA 3MGYA 2B9HA 3KU2A 4S30A 2C3JA 5C4LA 4EJ7A 4FKRA 2CNQA 2WQNA 4E1ZA 4B8LA 4C4GA 2J5FA 3V5TA 4E6AA 4RLKA 5FBNC 3EL7A 3WZJA 3NX8A 3BHYA 4KS8A 3GQLA 3SKCA 3FI8A 3OMVA 4IM0A 4XOZA 2C5NA 4D0XA 3QUPA 2ZMCA 4JX7A 4Y5QA 4CKIA 4XRLA 3A62A 2ZV8A 1YHVA 4QPMA 4GYGA 2OBJA 4F65A 4MNEA 3GCSA 1A9UA 4DYMA 4LUDA 4I5MA 1PXIA 5E8SA 4Z3VA 1SMHA 4PTGA 2OF2A 2YZAA 3VAPA 3NUPA 5C26A 3HECA 4FV5A 3VBTA 3I7CA 3G0FA 4RX9A 4IIRA 5J9ZA 5L6OA 4QO9A 3V5PA 3RTPA 1OPKA 1Q3DA 5A4CA 3UOJA 3NPCA 1MQ4A 4KIOA 4OT6A 1GNGA 2GS2A 3MVHA 2B9JA 2ONLA 3ODYX 4FTKA 3TKIA 2QR8A 5ACBC 2VWVA 3QF9A 4I5PA 4F9WA 5L2SA 3SVVA 2WMUA 5KKRC 5A14A 2O3PA 2CDZA 3FKLA 4LV5A 3H4JA 3H9OA 3KN6A 4CZTA 4K6ZA 3GC8A 4DFBA 3KK8A 5H3QA 1DAYA 2C5XA 4QP7A 3TTIA 1V1KA 2ZOQA 4QMXA 3UO6A 3BU5A 2P33A 2A1AB 2FSLX 2YN8A 3LFFA 1G8AA 2GFSA 2BTRA 3F3TA 3A7IA 4USFA 2XBJA 5E9EA 3RP9A 4D1XA 1YVJA 2WPAA 4CTCA 3E8CA 3DGKA 3VRYA 4KRCA 4OTRA 1PMVA 3HRCA 3VQHA 2XEYA 1LP4A 4QQCA 4MXCA 2CN8A 3V5JA 3QTUA 2BZIB 2YIRA 3OCTA 4L52A 2HZIA 3C51A 1UV5A 2PMNX 3CGOA 4FIFA 4QYEA 2PUPA 4N70A 3QTRA 2VTHA 3ZZEA 2E9UA 3NNWA 5LXMA 1NVRA 4LOOA 5BUJA 3VN9A 4R6VA 3ZM9A 5DPVA 3M42A 3ACKA 4JQ8A 3I79A 2YM3A 3FQHA 4O0VA 4E4XA 3VS7A 4W4VA 5GZAA 4XJ0A 3ZUTA 3WARA 4E4MA 5IQEA 1XH4A 4P4CA 3JVRA 4EQCA 5TO8A 3GVUA 2I7QA 3R8UA 2QOKA 4G6LA 1URWA 3VO3A 3LOKA 2R3GA 2W5BA 5D9HA 3BGPA 1YI3A 3HP2A 4PPBA 4UXLA 3OF0A 2YWVA 1F3MC 2YISA 5EOBA 2EU9A 3LVPA 3C50A 5AP6A 5IH4A 5HG9A 2P3GX 4FKUA 3R22A 3QWJA 2WTVA 3NR9A 4GG7A 5ANKA 4FKPA 1BLXA 3KEXA 3P7BA 3KXHA 5EYKA 5FXQA 5HX8A 4I20A 4CFFA 1Z9XA 4AG8A 4BHNA 1VJYA 2JKMA 4ANSA 1O6LA 3KC3A 3TI1A 3FL5A 3K5VA 3CD8A 3PG3A 3R9OA 5CS6A 1OKVA 3R1QA 4C02A 2XK6A 2WEIA 5F94A 5AUZA 4WRGA 1WFCA 2BDJA 4C7TA 1H0WA 2EB2A 2P2IA 4XLVA 4ORKA 5FEQA 3R71A 4PMPA 3R7YA 4EH5A 5BYLA 4CXAA 3MPAA 1XH6A 2VWYA 3LCSA 5CEPA 3ZEPA 4U9AA 4AW2A 2CGXA 4ZSAA 5FUTA 2R7BA 3BE9A 1Z57A 2YIXA 2GU8A 3BBWA 1YDSE 4UB7A 4X2JA 2JC6A 4FT3A 2AUHA 4FVPA 2BCJA 4S33A 5DR2A 5CEIA 1YKRA 5LMAA 3AOXA 5LVLA 3F3ZA 2VTAA 4LFIA 1Q3WA 4M0ZA 3E8NA 2X6EA 5FXSA 3ROYA 2W9FB 1PHKA 4QMLA 3FI3A 4FIIA 2XIXA 4ZJJA 4YJPA 1GY3A 4K77A 3UG1A 3W2CA 4E6DA 3PA5A 2UZOA 3Q9ZA 4C59A 4R5YA 1PF8A 2O5KA 3CQEA 4CFUA 4JG6A 3SD0A 4DTAA 3MSSA 3E3PA 4RWJA 3SV0A 3QZGA 3OY3A 4KD1A 2CGVA 3VBXA 3ZONA 1LEZA 4IWOA 3FXXA 2VTOA 4JI9A 4L53A 3S0OA 3O51A 4JG8A 5L2WA 1W83A 2C6OA 2RG6A 2E2BA 4J71A 3NCGA 4RPVA 1OIUA 4RSSA 5HBEA 5CXZA 2P55A 5M4FA 4YZNA 1CM8A 3FY2A 1YDTE
chains in the Genus database with same CATH superfamily
4QYGA 3UO5A 2DS1A 3E7OA 5AJQA 5AM7A 2O64A 4DH5A 5FXRA 4O22A 2PYWA 3WIKA 1Q24A 5LWMA 3E88A 1PXJA 2OJJA 3T9IA 3LJ0A 1XJDA 2PVRA 2WFYA 1LPUA 2UVZA 1APME 1YWVA 2G2HA 2Q0BA 5E91A 2BHEA 3GU4A 4FNYA 2G9XA 2HENA 3MVJA 4XEYA 2IPXA 3DV3A 2VWIA 4MK0A 5F4NA 3EQRA 2WZJA 4QYFA 4RIXB 1J1CA 5HO7A 4BTJA 1Q8YA 3RAIA 4GMYA 5F95A 2BRBA 4EK4A 4FTQA 4GK4A 5CU6A 5J95A 4QTBA 4EH4A 1Y57A 4FTLA 3Q4CA 3JYAA 4I3ZA 5ACKA 3RPSA 3SX9A 4MVFA 3EQPA 3O50A 4TXCA 5HLNA 3P0MA 2GHLA 4X6RA 4BJJB 2UVYA 5CU2A 3OT8A 2WIHA 2HY81 2X0PA 4CYJA 1H1PA 4OTHA 4WSQA 3EN6A 4UWCA 4EWQA 2CCHA 4OAVB 2GMXA 5EI6A 3FLSA 4KKEA 3UC4A 2F7EE 4QMQA 2J7TA 2GFCA 3QQLA 4DHIB 3P08A 4O4EA 4EJNA 1H1RA 3KB7A 3WIGA 1G5SA 3QCSA 2YACA 4BBFA 4C35A 1FINA 4ANNA 1U46A 3A61A 3LE6A 3P78A 3HDMA 2C5OA 3BLHA 2YM8A 4FE2A 3OD6X 2ITUA 5EYCA 4GSBA 2O65A 3IQ7A 3CY2A 4XG8A 3TMOA 5ANIA 4FSMA 4ERWA 2R3HA 1XR1A 3KMUA 2VWWA 4RFMA 4KBCA 1ZWSA 3D2IA 4O7YA 2JDTA 2OO8X 1ZYSA 3VQUA 5EG3A 4D4RA 3FEGA 3NUAA 4HYSA 3OW4A 2R3KA 4G3GA 3PJ8A 3UP7A 5J7HA 2VTMA 4RLLA 4Z7HA 4RC3A 1DM2A 3DKOA 1W98A 4ZTQA 5AV0A 4EHGA 3LFDA 3WZEA 4YC8A 4PMSA 3TNHA 4AACA 4ZJIA 2WTKB 3VF9A 4BDAA 3LHJA 3R63A 3RBWA 3A8WA 5AV4A 1OL6A 2GS6A 3PXKA 3QXOA 3UIMA 4TWOA 2ITWA 3LZBA 5JRQA 4ZS4A 2PZ5A 3MN3A 1W2DA 2PVKA 4J96A 3QTZA 1PY5A 2C6MA 3C7QA 3QA8A 4H3BA 3AMAA 1P5EA 3OXTA 4BDEA 4CCBA 4YLJA 4YJNA 3BHHA 3TUBA 3P23A 3WYXA 4ZMFA 2VTQA 4QD6A 5AP7A 3PIXA 4IM2A 5CEKA 4C3PA 2GDOA 4R3PA 4YJQA 1B39A 1JLUE 2ZAZA 3RAWA 4JBPA 3PXYA 2WTIA 4EOQA 2RL5A 3O71A 3FMJA 4LRKA 1EH4A 2W1EA 2WMRA 4KSPA 4YZBA 3FBVA 3H0ZA 3ORNA 4IAFA 3R9HA 1V0OA 3E7VA 3BHUA 1Q8UA 2W9ZB 2B54A 4PMTA 5FTQA 1NVQA 3I4BA 5IKWA 4A4OA 4TNBA 3EN9A 4RJ4A 4BKZA 3U55A 4O81A 2BKZA 2A19B 3LFAA 5CSWA 4IM3A 3CKWA 1U54B 1UVRA 3R83A 4EC8A 4EKKA 3WF7A 2UZNA 4BR3A 2BDFA 3PPKA 3DLZA 4AGCA 4FV2A 2VWUA 4ZTLA 2FH9A 4YHTA 3E5AA 4FTOA 4EH9A 5AIRA 3AC5A 5AWMA 2GNIA 5GIOE 1BX6A 3R7IA 3QZHA 1KE6A 4IB3A 4O1PA 2BRNA 2XIKA 3QLFA 2WTWA 4QMZA 5HQ0A 3QU0A 1QPEA 4BBEA 4V0GB 1W2CA 3BZ3A 1KSWA 4JG7A 3W8LA 3CGFA 4ZSJA 2HXLA 2IJMA 2XB7A 4CRSA 3I1AA 3L9NA 2AC5A 4JDIA 1MQBA 3LFBA 5HX6A 2YAAA 5DA3A 5CANA 3DKFA 3G0EA 4HZSA 5A54A 5FDXA 3WE8A 1G8JA 2C3KA 4TN6A 3PJCA 4GT3A 4KIKA 4U6RA 2IVTA 2UUEA 3WYYA 3UDTA 3O8TA 3KIOC 4XG2A 4K8AA 4RJ8A 5ETIA 3T8OA 4AN2A 3SW4A 4OTDA 1VLRA 5AMNA 4DEHA 3MFSA 4HCTA 1BMKA 4TYEA 3RINA 3CLYA 3BRBA 3SHEA 2B53A 3FWQA 2Y7JA 4Q9SA 3PXZA 2NYAA 4IDTA 3PPZA 2JAVA 2CMWA 4M68A 3DJ5A 5EW3A 3R8LA 2BILB 2BAJA 4IAYA 4BKJA 3FE3A 4CZUA 3NIZA 4YR8A 5AX9A 3UZTA 3EQIA 2BAKA 3R21A 5EM8A 4ZIMA 4U81A 2VX0A 1XH7A 4U3YA 4XNEA 4R5SA 3TG1A 3IW4A 3HMOA 4XX9A 5TOZA 4I0RA 2GNHA 2ZM1A 4O0UA 3ALOA 4AX8A 1BL6A 2WQOA 2Q83A 3U54A 1SVEA 3QCQA 3NSZA 3W55A 4O0SA 4BDBA 1DI8A 2CLQA 1OECA 3ZSHA 3EKNA 3M1SA 1OZ1A 3MY5A 3QHWA 4JLCA 4CV9A 3GP0A 4YZMA 3LMGA 4IMYA 1CMKE 2J2IB 3LIJA 3Q4UA 4QTDA 3HRFA 2V22A 3R9RA 2UW4A 5BQ0A 2EWAA 3N4UA 3MA3A 4V01A 4X2FA 2WTCA 4LMNA 1ZY4A 2QOCA 4FC0A 1YXTA 3M11A 3PA4A 2XANA 4DEGA 4X3FB 4D4YA 1F5QA 4DGLC 4U0IA 1H08A 5CZIA 3D4QA 4QNYA 4C38A 3K3IA 2NRYA 2V55A 2XJ0A 4GW8A 1AQ1A 2X4ZA 2OIBA 2QQ7A 5AP0A 4AZTA 3UC3A 5CEMA 4RFZA 2PY3A 4ZLOA 4N0SA 3R73A 3QD2B 4AXAA 2XYNA 3QD3A 4EZ3A 3D0EA 4FGBA 4GFOA 5D12A 4UMRA 5LJJA 2DUVA 2JITA 4D1ZA 5BNJA 4OAUC 3PLAE 2J0IA 2PVYA 5A4TA 4C33A 4ZLZA 2W06A 4F9CA 2Y9QA 1XO2B 3TDVA 3NNUA 4BDIA 1YQJA 3TT0A 1BI7A 2IWIA 4K0YA 4UX9A 2ZM3A 3FMHA 2J9MA 3SRVB 2XK9A 5ANGA 2JFMA 4YNOA 4TRLA 3RGFA 2W1ZA 4S31A 1H1WA 4UYNA 3HYHA 3S00A 3D7TB 3UE4A 2BKKA 2WQEA 3F9NA 2Y8OA 3DBEA 1GIIA 3N51A 4QP3A 4QMSA 5CSHA 3RWPA 4B8MA 4CGAA 3VULA 3RPYA 5AUWA 4HNFA 1P2AA 3WI6A 4BCQA 2CLXA 4FT0A 4DCEA 4F0IA 3EFJA 2PE2A 3IK3A 3PRIA 5C8MA 4IBMA 2GS7A 4D2VA 5JQ5A 3RMFA 4L8MA 3HVCA 4OTGA 4GVJA 2ZV7A 1BUHA 2QURA 4F0GA 1O6KA 3EZRA 2BZHB 5FP6A 1Q41A 3MWUA 2ITVA 2C6TA 3COMA 4GIHA 2XARA 4IE9A 4GEOA 5CAVA 1NY3A 3ACJA 5IQHA 2I6LA 3AKLA 4F9AA 2IEWA 3OS3A 4BWKA 3ZEWA 1JKTA 3ZZWA 2JIIA 2PZPA 4ZTNA 2Z7RA 3C1XA 2XA4A 2IZSA 4F6WA 2V0DA 4QP4A 3HX4A 1PMEA 2JEDA 5M51A 1Q8ZA 4MXYA 2B9IA 2W5AA 3HKOA 4O83A 4IANA 4F9BA 3C13A 4YJOA 3ZFYA 3DZQA 4WKQA 2UVXA 5IA1A 4IHPA 3CP9A 4O4FA 4G9CA 5JGAA 3IDBA 4D1SA 1W2FA 2BMCA 4RIWA 3RNYA 3QD0A 3QUEA 2WTKC 3DPKA 4FSUA 3UNJA 4O7LA 1J7IA 2QNJA 1ZRZA 2ITXA 2O8YA 3A4OX 3ZDUA 3R2YA 4MNFA 1YWNA 3QYWA 2B7AA 2OIQA 5DBXA 4FSZA 2VWBA 2IW6A 2OI4X 2W99B 4AQKA 4IX3A 4KABA 3PPJA 5CAOA 1O9UA 1YXUA 2OLCA 2R0UA 2C3IB 3OUKA 3EMGA 2UZBA 2W4OA 4X2GA 4EOOA 3QX2A 1Q99A 4M12A 4II5A 3U4WA 5G1XA 1PYXA 4IJ9A 4TT7A 4NM7A 3UDBA 3LMIA 3KXMA 3TN8A 5C8NA 5LVNA 2X8EA 2ETKA 4S2ZA 2X7GA 4L7SA 3S95A 4YTCA 4YO4A 2VNYA 1TKIA 5FBOA 4ZK5A 5A46A 3HL7A 5CI6A 2ZMDA 2QU5A 2QD9A 4CNHA 5AAFA 5AV1A 4TL0A 2OH4A 4CFXA 1GOLA 4EZ7A 4WNKA 4ONAA 1H25A 4EHEA 2H9VA 4FZDB 3BLRA 4AT3A 4CFVA 2ZDUA 4NM5A 2C0IA 5JRSA 5I9XA 3DKCA 4IJPA 3U6IA 5CVGA 4FA2A 4PUZA 4PX6A 1IRKA 1B6CB 1W8CA 2XNGA 1GZNA 1PJKA 4MNEB 4ZSLA 3TNIA 3UP2A 3ZRLA 2ZJWA 1M7QA 1SVHA 2R9SA 5F1ZA 4KRDA 4O38A 4PF4A 4DEBA 2WEVA 3L8PA 3VUKA 2QODA 3HA6A 1OGYA 4EUTA 4EKLA 1GIHA 3A7JA 3NUUA 5CF5A 2HOGA 3GU5A 4FK3A 2W1GA 3QTSA 4HGSA 2VWZA 4IH8A 1YXSA 4G3FA 3TJDA 3KRJA 4F64A 4OTIA 5IG1A 4DN5A 4G5JA 5HNBA 4FTAA 3EFWA 3ZBFA 5E7RA 4EBVA 5J9YA 2P0CA 3ZLWA 5KMLA 4FJVA 3R7EA 4DCAA 2WIPA 2XNNA 2IVUA 3LCTA 4YLKA 3UOHA 4DHFA 3DDQA 4IAZA 3EQBA 4LQMA 4B6LA 4W9WA 4WNOA 3PE2A 4LL5A 1XBCA 2ZYBA 1PMUA 3O2MA 5CT7A 3SG8A 2WGJA 5DFPA 4O6EA 4JBQA 4Y46A 3W0OA 3CTJA 3UJGA 1OM1A 4EOKA 4PDSA 5LCKA 1ZMWA 3THBA 3LPBA 4KKHA 3ZFXA 2PUUA 2VX1A 4FL1A 5AUYA 3VBQA 5KE0A 5IISA 3FUPA 3S1HA 4IB0A 4WRSA 4AW5A 3MB6A 2OXYA 5I9WA 2HELA 3EN5A 5CF6A 3TV6A 4AWIA 1RE8A 3BIZA 3AKJA 2EUFB 3PFQA 4E6CA 1NW1A 4AZEA 1OIYA 4HCVA 2R64A 5LVMA 4CRLA 3AC4A 4RRVA 4RVMA 3P7CA 3FKNA 5HO6A 5EI8A 1CKIA 1YRPA 4DT9A 4M84A 4AZVA 3R8ZA 1G8KA 1H8FA 3LLTA 5FG8A 2V7OA 3DQXA 3PWDA 3OVVA 4RG0A 3EIDA 4FIEA 5KZIA 2OU7A 5IQGA 2QONA 4D2WA 3GFEA 2YIQA 2IVSA 1KV1A 5IEXA 2F7ZE 4X3FC 4L3LA 4FKLA 5CT0A 5BVOA 4DHZA 3MIYA 1UU9A 3DKGA 4YZCA 3F66A 4AAYA 1CKJA 3NNXA 3ZYAA 4EEVA 4QMUA 3IW5A 2QC6A 2I40A 4Y85A 2OZAA 2BVAA 4XBUA 4YUQA 4C37A 2BPMA 4QOXA 3QFVA 2WMBA 3VNTA 3VUGA 2GHGA 2VU3A 3QL8A 5B2KA 3FZSA 4I22A 3II5A 4L68A 5AM6A 1S9IA 3EQHA 3OOMA 3UVPA 3BLQA 4H1JA 1DAWA 3HEGA 3KVXA 3QLGA 1QPCA 3V8SA 4BY9E 2ZDTA 1WCCA 1OIRA 1Z5MA 5HIBA 4YPSA 3W2SA 4BBMA 1ATPE 5IDNA 4UV0A 1XMMA 3Q04A 5B2MA 2A27A 4WBOA 3WILA 3PYYA 4IX6A 3TIYA 4XLIA 4D0WA 2A4LA 2VTNA 3BYOA 5GJFA 3E3BX 2C4GA 2FB8A 2WMXA 3PIYA 4FTIA 4LV8A 3UNZA 3FMLA 4FV8A 2X0GA 3OROA 4PQNA 4KINA 3NW7A 5EOLA 3S2PA 5B2LA 4UMTA 4FUYA 2PVJA 4OR5A 4DFXE 3W1FA 5HG7A 3NLBA 4AN9A 4GYIA 5DG5A 3GC7A 4RVTA 3QRUA 4FKOA 3D9VA 3R1YA 4GFGA 4JQ7A 3R28A 4BC6A 3MH3A 3COIA 3HMNA 2X39A 4XG4A 5E8UA 1WVXA 3PVBA 3GXLA 3IOKA 3MV5A 2OW3A 4RIYA 2XH5A 5JT2A 5KHWA 2JDSA 2Y4IC 3FC2A 3UNKA 3VC4A 4IWQA 5FGKA 5GJGA 5FWKK 3V5LA 2JAMA 4TYJA 1DI9A 2CNVA 1URCA 3RM6A 5A4EA 3LCKA 5CU0A 4FKQA 4O6LA 1OBDA 2SRCA 4AXEA 1UKIA 4TY1A 4BCOA 2OXDA 4LM5A 3UVRA 3F2RA 3H0YA 1WBVA 1YOMA 4IEBA 2WOUA 4XV2A 2UZEA 3MESA 3O5AA 4RJ7A 3ENMA 3JR1A 5H8GA 4FL3A 4X6QC 3AT2A 4ZMEA 2WU6A 1WBSA 2XUUA 3NUSA 4PWNA 4WNMA 4WSYA 3K2LA 3QC9A 5FDPA 4AZFA 2CKQA 2UW8A 3FL4A 4L6QA 4ZY4A 3UBDA 4E5WA 3Q32A 4JRVA 4C3RA 4CCUA 2X7FA 1FOTA 4IZYA 4FSRA 2ETMA 3LJ2A 3CJFA 4ITJA 2XNPA 1J3HA 3QRJA 4RJ6A 4S34A 5HE2A 4EH8A 4FICA 2PL0A 4GK2A 4DAWA 4QTEA 3CC6A 4AXFA 3B8QA 3AD5A 4ENXA 1OITA 1VYWA 2BIYA 2YCRA 3R2BA 4RJ5A 3F5PA 5AUVA 2XK7A 4FNWA 2YCSA 3QQHA 4L43A 3KQ7A 4ZS0A 2ITOA 2PWLA 3HNGA 4FVRA 2GQGA 3F69A 4NT4A 3UVQA 3NFFB 4YZ9A 4ZOGA 2X9FA 3RM7A 1OL2A 4RFYA 4M66A 3TDWA 1S9JA 5M07A 4XV3A 4BTMA 2X2MA 4BDCA 2HW6A 4TYHA 2YDIA 3GGFA 3ATSA 3L9LA 3I6UA 4W4YA 3CPBA 4UYAA 5JKGA 3IG7A 3KXGA 1R0EA 4MCVA 1YI6A 4UMPA 3LM0A 3DOGA 3PZHA 4NTSA 3P5JC 5M53A 1X8BA 2X0QA 4DFUA 3HDNA 4RA4A 4FTCA 4G34A 2WTDA 4QRCA 1XWSA 3AKKA 3Q6WA 4JXFA 4YJRA 2BRMA 3KXNA 2B52A 2XJ1A 3FMNA 5CQWA 5C01A 3CPCA 3FLNC 2PK9A 3ZXZA 3A99A 3GEQA 5CSVA 1Q8TA 2X6DA 4AXCA 1YWRA 4KIQA 4ITHA 2YCQA 3DBDA 3DAKA 2PUNA 1U4DA 1UU7A 4G6OA 3ZRMA 2C1BA 1J7UA 4FX3A 3UQGA 1V0BA 4FV7A 3O0GA 4CG8A 3QQFA 3LCDA 4A07A 3HZTA 3QX4A 3ZMMA 3LFNA 3EOCA 5CNNA 3EKKA 1FPUA 1TFFA 3EQDA 4QPSA 2C5YA 5FEDA 4BTFA 2CNUA 5DYJA 4YMJA 3QWKA 1JQHA 3MJ2A 2Q0NA 4QTCA 2G15A 2XYUA 4YNEA 4FG9A 4AUAA 4NL0A 2I0HA 4XV1A 4FV9A 2BAQA 4L00A 3RPVA 3UQFA 3OY1A 3D5VA 4HPUE 3MH1A 5CQUA 3ML1A 4E73A 4FEVA 5JMSA 2JDOA 4C3FA 3DNDA 4MWHA 2VX3A 3BGQA 5GJDA 2XBAA 4AT5A 5L4QA 5DLSA 2GTMA 3B8RA 3ZSGA 5M57A 2PUIA 3QA0A 3OXZA 4JDJA 4M67A 3VUDA 4HVIA 3IW7A 1PYEA 2C47A 2FSTX 4OTPA 5E8WA 2R3OA 4ID7A 4YC3A 4F08A 5K5XA 4WOVA 3C0GA 4BVUA 2EXCX 1QPDA 3IGGA 3RK9A 3GCUA 1K9AA 4JAIA 5EDRA 3OUNB 4DFNA 4F7LA 1YDRE 3OT3A 3OG7A 2XEZA 4GIIA 3MH0A 1QL6A 4QTAA 1GIJA 2VAGA 4F99A 1UKHA 2GNLA 1XKKA 2OFVA 4ZEGA 4TYGA 2R4BA 4QMMA 1QMZA 3GCPA 1UNLA 1WBPA 3VWAA 4AOJA 4EOSA 3MYGA 3EHAA 2QLUA 1R0PA 3D5WA 3GNIB 5A6OA 3LFQA 5B7VA 4FOBA 2WQMA 3FMMA 4GKHA 2XS0A 1JAMA 3VS3A 1OPJA 3QYZA 3OWKA 2UZLA 4JT3A 4ZZNA 3LCOA 3QKKA 3GOPA 4B7TA 4M0YA 5H8BA 2PE0A 4BICA 4FR4A 3I6WA 5EM7A 5TKDA 2XKFA 4NCTA 5LARA 3DS6A 3FI2A 3RZFA 3VS5A 4EH6A 5EKNA 5EQYA 3V5QA 1UWJA 2VTIA 3ETAA 4BGQA 3IECA 3TUCA 4DEEA 1W82A 3FZPA 2P2HA 5I9UA 3DQWA 3MJ1A 5TR6A 4C0TA 3QZIA 5DT4A 4EK8A 2RSVA 3NUXA 3DK7A 4N57A 2C6DA 5AP1A 1OGUA 4R1YA 5CX9A 3PTGA 3VVHA 4NM3A 5EHOA 4C58A 1ZMUA 3L9PA 4H05A 4KIKB 3UMXA 1ZOEA 3P86A 4EYMA 4PL5A 3W0NA 4BIEA 1VZOA 2Z8CA 2FYSA 3QZFA 4J97A 2F2CB 2YM5A 3I81A 2Z60A 4NEUA 3BE2A 4O4DA 5D7VA 2CKPA 3MVMA 5BYYA 2WOTA 2HZ0A 3DNEA 3NEWA 3OCSA 1M17A 4PP9A 5AR3A 3V51A 3ZO2A 4IFCA 4FT7A 3UIBA 4P5ZA 2GPHA 5G6VA 5AIKA 3PDTA 4FVQA 5D10A 2OFUA 4JQEA 1ZAOA 4U44A 3TCPA 4BCKA 4EK3A 3VONA 5JH6A 4F63A 2ITYA 4C34A 4AOIA 2HZNA 4O7VA 2C69A 4FT5A 4O84A 3Q52A 3SA0A 2CPKE 2GNGA 4QP9A 2QOQA 2V62A 3RCJA 4O7ZA 4GJ3A 5KZ0A 4ZAUA 3NS9A 3DXNA 4DLIA 4W8DA 4Q9ZA 1CKPA 4N4SA 5CY3A 5HKMA 4E6QA 4R7IA 1NT2A 3ID6C 3PE1A 4LL0A 1O6YA 1SNUA 2QLQA 3UG2A 3TJCA 4YLLA 3UZPA 5ICPA 3PY3A 4PL3A 2QHNA 2ZVAA 1V0PA 3ORTA 5KBQA 1M2PA 3ELJA 3D2KA 5HCZA 4O7RA 3ODZX 4HVSA 3HMPA 2PVLA 3NW5A 5KUPA 3Q9YA 3AD4A 3ZO3A 4U42A 4G3DA 5I3OA 4D4SA 3IPHA 5BUIA 2ZB0A 3IGOA 1HOWA 3V04A 4AT4A 2J0MB 3LM5A 4LUEA 5HIDA 4DH1A 4AS0A 4UZDA 4GRBA 5C03A 2HYYA 2I1MA 1Y6BA 3RZBA 2VN9A 4XG6A 2CHLA 3H9FA 4ZXTA 4DGGA 4I6LA 4I1ZA 3FHRA 4EONA 1H01A 3EFLA 4FBXA 3SXSA 4U41A 2QOFA 4UWYA 4FYNA 4G3EA 3R1SA 4TWNA 4UALA 3HLLA 5ANDA 3TXOA 3WF8A 3PSBA 5KMMA 3BGZA 4AGWA 4CLJA 3OTVA 4ACMA 3MDYA 3R7OA 3D94A 3E93A 2REIA 4I5HA 1ZOHA 5IZFA 3BL9A 3HA8A 3QHRA 3ZXTA 5A4QA 5L8KA 5EW8A 2JKKA 3DBQA 4F70A 3PUPA 2QOIA 4JDKA 4JNWA 4YBJA 4MF0A 4RVLA 4CT2A 5EYDA 2J6MA 2QG7A 1CSNA 3ENHA 2P4IA 2VZ6A 2XNMA 3C4WA 2E9PA 4ASZA 3AGLA 2YM4A 3H10A 3D7ZA 2UW6A 4HOKA 4ZY5A 3QRKA 4FNXA 1Y8GA 4LRJA 4OLIA 4XOYA 3AC2A 3GB2A 2NP8A 3TNQB 1H00A 4GJ2A 4UEUA 4A06A 4DH8A 5L8LA 3SDJA 3TZ9A 1A48A 3PP1A 4XHKB 3AC3A 4NK9A 4JBVA 5H8EA 3FMDA 3EJ1A 5AP3A 3JS2A 2OK1A 1E9HA 5M4CA 3P7AA 3Q4TA 2C68A 4QMOA 3HRBA 3MW1A 4GH2A 5HU3A 5EI2A 3BQCA 2QHMA 3ZUVA 4OTFA 3KCFA 4WUAA 5JFSA 4KAOA 2VNWA 1F0QA 4QEBA 2HY0A 3CE3A 1WBWA 4BCGA 4Z55A 5E4HA 2QU6A 2VV9A 2XNOA 4FTTA 4YZDA 5HD7A 4MHAA 3RNIA 5HE3A 2VTRA 4NIFA 4M69A 2G01A 4PPAA 5A6NA 2QO7A 4L3PA 4FV6A 4MBLA 3QGYA 3QUDA 4G1WA 4UZHA 2WQBA 5CSXA 2VTSA 5FQDC 2VGOA 5L6PA 3DA6A 1R78A 1YOJA 1KE9A 2PVHA 5HHWA 5IQIA 2A0CX 4K11A 3NAYA 2HW7A 4I94A 3U51A 2OSCA 5HE0A 3T3UA 5AV3A 3QKLA 2ITZA 2J0LA 4G3CA 3R04A 3PXRA 4K9YA 3CCNA 2H34A 5EYMA 4KA3A 2JFLA 3NYVA 4WG3A 1OL7A 4DFLA 4PY1A 4QMYA 4BFMA 1SZMA 1ST4A 2C3LA 3FY0A 5IUIA 3ANRA 4YTFA 2G2FA 5JZNA 3W16A 4ANQA 5JQ8A 3TTJA 2RGPA 4GFMA 4XG3A 4FZ6A 2W1DA 3EQGA 4G16A 3FMEA 3Q96A 1NXKA 2XK3A 4EC9A 4GL9A 4DA5A 4FV1A 3G5DA 4BGGA 4YU2A 4A9SA 1IA9A 2C6EA 4OGRA 3BV2A 3COHA 4ANBA 1U5QA 2J5EA 4HYUA 3W8QA 4I21A 2HWPA 4B99A 5CAPA 4IWPA 1R1WA 3V8WA 3ITZA 1PXNA 1KE5A 4O0XA 4D58A 3ZLYA 1Q61A 4CLIA 3ZLXA 1IG1A 1VR2A 3EWHA 3F5GA 3PUFC 5AUTA 5FM3A 4J99A 3R9DA 2HAKA 4USDA 2R3IA 4UWBA 2WMAA 3DK6A 3LXNA 4OUCA 4PL4A 4ZJVA 5K5NA 3IOPA 2HXQA 4KKGA 4MBIA 4E93A 2YABA 3GI3A 3N4TA 5EKOA 2UZDA 2UV2A 4F1MA 4F0FA 4TNDA 2IVVA 3GU7A 4JVGA 3UPXA 5LCJA 2Y6OA 3OCBA 3MA6A 4XBRA 5DRDA 4CFMA 4ZSEA 3PZEA 4OBOA 3LFEA 4I4EA 3VS0A 4DEIA 2F4JA 2WTJA 4ZTSA 2C0TA 5HIEA 3EQCA 5EQEA 4U40A 1YI4A 5AA8A 2W1CA 1VEBA 4FKSA 3EFKA 1JBPE 1Q5KA 4JDHA 4MXAA 1H0VA 2F2UA 4R8QA 4W9XA 4ASEA 3SXFA 4W8EA 3L1SA 5F20A 5BVKA 1W7HA 3ZLSA 5FTOA 2CGWA 1IASA 4FF8A 4A9UA 3G90X 3GT8A 4L9IA 4O91A 5HO8A 5J1VA 1IEPA 4PV0A 3DFAA 4B4LA 3TUDA 3NIEA 4Y72A 5I9VA 2NNWB 1OPLA 1REJA 2BRHA 4QMWA 3C0HA 4YSJA 1BYGA 3TACA 3OP5A 5CF4A 1FVTA 3AGMA 4QNAA 5HNIX 3GU6A 2HIWA 4O0WA 2W0JA 4AN3A 3CS9A 3DLSA 3PFYA 4FTJA 2GQSA 5T68A 1H27A 1RJBA 4NW6A 2R7IA 4JRNA 4X0MA 4C62A 2VGPA 3BU3A 2W96B 3C5UA 2BR1A 3RK5A 3RK7A 4MF1A 3A7GA 4FKWA 4N6YA 4Z9LA 4D9TA 5IA2A 4Z7GA 5EHLA 4WHZA 4EZ5A 5K9IA 4IQ6A 3KGAA 3FZ1A 3CJGA 1Y8YA 4LDTA 2JKQA 3NVKI 2J0JA 3TL8A 5AUUA 4NW5A 5DNRA 3UZRA 3AD6A 4HZRA 4O21A 3FPMA 5DIAA 3NGAA 4E5AX 3D83A 3OWLA 3F5XA 4W4XA 2V7AA 4MD9E 4FMQA 2UZTA 4JR3A 2LAVA 3WF5A 4PNKA 5BUEA 4C8BA 5I4NA 3R30A 2EVAA 2IW8A 4NTTA 4JIKA 4NWMA 2OZAB 4HVGA 4GS6A 4V04A 3DDPA 4WO5A 4AZSA 4C4HA 4HVHA 4LGHA 3MH2A 1M14A 1PXOA 3QQKA 4PDOA 4R3RA 2XF0A 3QRIA 4BRXA 2YM6A 5CWZA 3W10A 5I9ZA 3NVMB 5C4KA 3PJ1A 3KREA 4QT1A 2EXMA 2BZKB 4KWPA 4BTKA 1ZY5A 2FGIA 2JDRA 4J8MA 3ZTXA 2EB3A 3P5KA 4YC6A 3VBWA 5ANOA 3SGCA 4MAOA 4MUQA 5DHJA 4D2TA 1AD5A 1FQ1B 1CDKA 3R7GA 5KKRB 1YOLA 4PDPA 2XM8A 5L3AA 5LVPA 2WMVA 4CQEA 2A98A 5JFVA 1E1XA 2DQ7X 3AXWA 4WBBB 2QO2A 3VJOA 4MQ2A 1UU8A 4LOPA 4JX3A 5M4UA 5CSPA 2VTLA 1LEWA 2JIUA 4NKAA 3KULA 1H26A 2OICA 4U79A 4FV4A 4Q5HA 4FIJA 3LJ1A 5CNOA 5B0XA 3E92A 4X21A 5AR7A 3ZS5A 4BWXA 2X4FA 1WVYA 5J1WA 3MFTA 4IVDA 4HNIA 2WXVA 4U5JA