4BBEA

Aminoalkylpyrimidine inhibitor complexes with jak2
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
288
structure length
288
Chain Sequence
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRNLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYROSINE-PROTEIN KINASE JAK2
publication title Sar and in Vivo Evaluation of 4-Aryl-2-Aminoalkylpyrimidines as Potent and Selective Janus Kinase 2 (Jak2) Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 288
sequence length 288
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bbeA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bbeA01
4FNZA 3KL8A 3QQGA 4QQCA 1FGKA 3GFEA 5BQ0A 5CXZA 2OZAB 5DEYA 4FSQA 4UYNA 2HW7A 4G6NA 2ITQA 2I1MA 3TN8A 3LMIA 4G16A 4C33A 4BHZA 5AP1A 3C4ZA 2JC6A 2G9XA 5FWKK 4I92A 3DAEA 3VRYA 3PYYA 4F08A 4GK2A 3QL8A 2YCQA 1S9JA 3IDPA 3LXPA 1PXKA 1QL6A 3BQCA 2ITPA 2YIQA 4HNIA 3S3IA 1WVYA 2FSLX 4DBXA 3AC8A 3UMXA 1YXXA 4D9TA 1U4DA 5HICA 3G0FA 4USFA 4KUJA 2J0MB 1Q8UA 3EQFA 5AX9A 4C4GA 5AJQA 5HHWA 2X2KA 3G6HA 5JFXA 3CCNA 4G1WA 4E1ZA 4FKVA 1FOTA 3SLSA 5F20A 3C0HA 4AFJA 4I6FA 5C01A 5CALA 3Q32A 2BIKB 4FKUA 5KMOA 3EN5A 3T9TA 5JFSA 5IA0A 4BCQA 3R1SA 5J7BA 3ZLSA 5CEKA 3U55A 2OKRA 4O7NA 4GW8A 4L42A 2YDKA 1CMKE 3BIZA 3ZRLA 3PJ1A 4AN9A 4E5BA 3C5UA 3EQCA 5JGDA 2GNLA 3ZDUA 3GQIA 2QOLA 1HOWA 4TRLA 4R5YA 1H25A 3COKA 4RZWA 5I9ZA 2OGVA 1QPDA 3MVLA 4MWIA 4CT2A 2ZVAA 2ITZA 4O84A 5FTGA 3T3VA 1Q3WA 5ETAA 3BLQA 5DOSA 2LAVA 3TNPC 5HTIA 5JZJA 3FLQA 5FXQA 3POZA 5D9HA 3R9DA 2RF9A 2WQNA 3BU5A 4I20A 4O0UA 3RBWA 3N4UA 2B0QA 3D5XA 4IZAA 4NCTA 4DGMA 5T3QA 3H9OA 4BIBA 2YJRA 5M08A 4NIFB 3EQPA 4U5JA 4OR5A 3N4VA 2OG8A 4A9SA 5M4FA 4WNKA 3K5UA 4IE9A 4AZSA 4RWIA 1ZOEA 2XP2A 4PDPA 5JEBA 2PHKA 4RJ6A 2HXQA 4OAVB 3F7ZA 3Q6WA 2XJ1A 1U59A 3U4UA 4C4EA 4AG8A 3UOJA 3KVWA 3OY1A 2VTMA 4ZAUA 2XEYA 3VBWA 4KIPA 3DKCA 5DHJA 3KREA 2WMBA 2YLEA 4W4XA 3KU2A 4XRLA 4AACA 5I9YA 1ZMVA 2BPMA 1R0PA 3BV2A 1PXIA 2C4GA 1OPLA 4FMQA 3WE8A 4ZSGA 3PZHA 2RSVA 4A9TA 4X7QA 5FBOA 4CT1A 2B9IA 3L9LA 3UC4A 1UNGA 5L3AA 4BYJA 3IECA 3P1AA 2WOUA 3FLSA 4TZRA 3VWAA 2XYUA 3OWLA 4X3FC 2B7AA 5DBXA 2JBOA 2X81A 3R6XA 4DGOA 3MY5A 5GJGA 5BX0A 4C36A 2PUNA 2PVFA 2WFYA 2C5YA 4OW8A 4DEEA 4IWOA 2HENA 4I6QA 4C35A 5BUJA 2R3RA 5J7HA 2UW6A 4QQTA 2OLCA 2C1AA 1M14A 3E8NA 4FTJA 5CSHA 4PRJA 3BYOA 3MPTA 5KE0A 1TKIA 4P7EA 2W9ZB 4ZY6A 4LMNA 3OOGA 3OTVA 4YNOA 3RPRA 4HYIA 1PHKA 3REPA 4TXCA 4YLJA 3HV7A 2X9EA 2G01A 3RVGA 3CY3A 3W33A 4AZVA 4S2ZA 4LOQA 5DYJA 5LXMA 5HLPA 2WMAA 4UB7A 3FXZA 4EH8A 4UMRA 4P2KA 4NFNA 4JBQA 2JIIA 4ZK5A 5IQGA 2W1IA 3MI9A 1K9AA 3VHKA 5CZIA 3V3VA 3VS5A 4EQUA 2ETMA 3IG7A 3ZONA 4TYHB 1O9UA 1BUHA 4O38A 2JKKA 5KUPA 2YLFA 3SC1A 1Q8WA 5G6VA 4X3FA 3ELJA 4CKRA 4M13A 3BV3A 4LL5A 5JFWA 3LZBA 4AW1A 4PY1A 1H00A 4HCUA 2VWVA 1Q3DA 2R64A 2AC5A 4L7FA 3EN6A 4YBKA 1JKKA 4YPDA 4U7ZA 5DR6A 4EH7A 4EH6A 2F9GA 1LR4A 5JZNA 4IM0A 2JDSA 1WBWA 2XYNA 4L8MA 4QP8A 5HGIA 5EM7A 3A61A 3KMMA 4U79A 2WEIA 3KRLA 5ACBC 5IEYA 5CXHA 4F7NA 5HE2A 2PVYA 4K2RA 3DKGA 5IA3A 5L6OA 5AUUA 3PRFA 3TZ7A 2XNOA 1PXPA 1VJYA 3NIZA 4HVDA 3W1FA 3FBVA 3NIEA 5BPYA 4E4LA 1GIHA 2F7XE 5IQBA 1Q24A 4EBVA 1ZOHA 2VTIA 3EFKA 4QMNA 4LRMA 5M07A 3WF5A 1KE7A 1PKGA 4A4OA 3Q9WA 4B99A 2PE1A 1IAHA 2CDZA 3MH0A 5AWMA 4AP7A 1G8AA 4Q2AA 2Z7LA 4DBNA 2YEXA 4BKJA 4FIGA 4HW7A 3HA8A 4JQ7A 2ZB0A 5AUTA 5H3QA 4C37A 4X0MA 2W0JA 4KABA 2C6DA 3VUMA 3WBLA 4HVGA 3MY0A 4QMQA 4FF8A 4Y83A 2W4OA 3ITZA 4UMUA 4BDHA 4AW5A 1TVOA 1TQPA 4B9DA 2ITOA 4M0ZA 3WYYA 4PNKA 3IW4A 3MTLA 4PDSA 3TKUA 4MH7A 3DBEA 4YZDA 4MBIA 4IIRA 1W7HA 4EH9A 4GK3A 4BDEA 3NNWA 3NUUA 3DJ6A 4TN6A 3O7LB 5KMJA 4DT8A 3JVRA 2GTMA 1P5EA 1QCFA 2LGCA 4S33A 4AA0A 2IVVA 3R8MA 4RZVA 2IVSA 3DDQA 1GZ8A 3FQHA 4P5ZA 1Y8GA 3ZU7A 3CGOA 2PWLA 4Z9LA 2RFDA 2V55A 2PYWA 3LXNA 3ATSA 1RW8A 4F1OA 3PWDA 3PVWA 5T68A 4OTDA 3SXSA 3OY3A 2CN5A 1PXJA 3C50A 3D5WA 2BRBA 3DNDA 4K18A 1K3AA 4FV8A 4E4MA 3PPKA 4PP9A 3W8QA 4ZMEA 5CAOA 2BVAA 4DH8A 2QHMA 4HGTA 3KVXA 4X21A 4ZJVA 2O5KA 4TT7A 3HV6A 1H07A 3T3UA 3I1AA 5IU2A 3VBVA 3CD8A 4F6SA 3R02A 3W2OA 3RAIA 2I0HA 4QP7A 4ZLOA 3RCDA 5LMKA 2YZAA 3HRFA 4H3QA 4IZ7A 4QTCA 4GG7A 4HVSA 3TM0A 3A8WA 1Q5KA 4X2KA 2XK9A 1LEWA 3AT4A 2W5BA 3QQHA 3R01A 5E91A 5HTCA 5IH5A 2WTDA 4A9RA 4RJ3A 2OICA 1UWHA 1XH5A 2PVMA 4JLCA 5E1SA 3EQDA 3GNIB 3MA3A 4FIIA 4JQEA 1V0PA 4TYEA 4XG6A 4YZBA 3ZH8A 5L2TA 3ZEPA 4CFFA 3BWFA 1SVEA 2WEVA 2YCRA 4MD9E 3W8LA 3ZLYA 3NUYA 2R0UA 5J9LA 2WTIA 3COHA 3MJ1A 3R63A 4I5MA 4ZXTA 2E9VA 2XNBA 3EYGA 3MH3A 4UWCA 4HYUA 2ITTA 2YABA 3OWJA 2B9HA 2C3IB 3F3VA 5CU6A 3QTRA 3PE1A 2QO2A 3PY1A 4JXFA 1A06A 3C51A 3FUPA 4CMTA 2UW3A 3A7GA 3O50A 4LRJA 1LP4A 4BIDA 4XOYA 2WELA 3KMWA 4QYFA 1P4FA 4J98A 2XRUA 4D1XA 3RZBA 5EOLA 5CEQA 4PMTA 2VD5A 2X8IA 3AT2A 2RG6A 2CNQA 1OI9A 1BI8A 2CGXA 3DS6A 4O7WA 4M69B 4MXZA 3CIKA 4FTMA 4NU1A 1XKKA 4I41A 3VQHA 3NUAA 5BVNA 4CEGA 5I3OA 3RPYA 2OK1A 3KFAA 4MCVA 5EHLA 4R1VA 3OZ6A 3SRVA 5HVJA 4RX7A 4NFMA 4TYIA 1KE9A 1H4LA 5EQEA 5IUIA 2HZNA 4LRKA 1UU3A 3V04A 3EFJA 4FOCA 4KBKA 5AV4A 4IMYA 4EQCA 4I4FA 4GKIA 2BTSA 3DBFA 3ZFMA 4D2RA 2W1FA 4YSJA 3UQGA 3QCXA 3DKFA 5CVFA 5AIRA 3CQWA 3PJ8A 4TNBA 4BBMA 4YURA 2B53A 2ONLC 2YDJA 5KHWA 4BCHA 4FKGA 1OL1A 4ZS0A 3QUPA 2QQ7A 4MF0A 1UV5A 5LVLA 1ZYJA 4WD5A 2IZUA 2WQOA 5F1ZA 2YM8A 5DA3A 2QHNA 4NT4A 2QU6A 3MW1A 4BDFA 1TQIA 4IACA 3THBA 2QO9A 2I0YA 2HW6A 4TWCA 3TG1A 2EB2A 3DK6A 5ANIA 4LYNA 5DN3A 1PMVA 3QRTA 3O17A 3TZ8A 4JR7A 4E5WA 2HWPA 5CS6A 5AUZA 4TYGA 4HJOA 3HDMA 3PXYA 4RWJA 2PULA 3LMHA 1FMOE 2X4ZA 3MFSA 3MS9A 4GYIA 4V04A 4LOPA 5HIDA 2DUVA 4DITA 3NYOA 3FY0A 2J5FA 4O1OA 3VBQA 1M7NA 3JPVA 4YZMA 1AQ1A 2FYSA 3CJGA 1IEPA 1P2AA 3NNUA 3UNZA 1JWHA 2XNPA 1MQ4A 4EOKA 2CJMA 3DV3A 2EXEA 2OJJA 4TYJA 1H1RA 3OEZA 4LV5A 4QMPA 5JQ5A 2JBPA 3DBQA 4GJ3A 3U51A 4J52A 3NPCA 3C4WA 4I24A 2G2FA 4ZY4A 1XH9A 4KS8A 4PL5A 4AU8A 2VX3A 4LQMA 5GHVA 5IEVA 2XNNA 2R3QA 4W9XA 2IZTA 4U3YA 3DB8A 1QPJA 4R77A 4M68A 4F99A 4UMPA 3CTJA 3OHTA 3EOCA 5KZIA 3QA0A 3QWJA 3EL7A 3PP0A 4YHJA 2J0JA 4MNEB 5HVKA 2B9JA 3FV8A 4G5JA 2WTJA 4YLKA 4KD1A 3LHJA 3QTIA 3SW4A 3A7IA 5TF9A 2DQ7X 2WGJA 2WTVA 2W17A 5HG5A 2XCKA 3ORNA 2QG7A 2UUEA 5IUHA 5CTPA 4XS2A 4FEUA 3RNIA 1YXVA 4JNWA 4BCKA 1OKZA 3UVQA 4BN1A 3R71A 4ZLZA 2WQMA 3R28A 5CYIA 3TZMA 4BB4A 2XH5A 1Y57A 1PYEA 3TKIA 2W1GA 5LVNA 3JXWA 1X8BA 3QTXA 3IONA 4CD0A 1M52A 3DU8A 5AP7A 4ZSJA 3TJCA 5CI7A 1JPAA 5EOBA 4LUDA 4OBOA 5HBJA 1U5QA 4LUEA 4JDKA 3RAHA 3WF8A 4EK6A 3V6RA 4DG0E 3PSDA 2NP8A 3NUNA 1SNXA 4E93A 3OCTA 4EC9A 4EZ5A 4YTCA 3VBXA 2VWZA 4NM0A 3O23A 4WNPA 4ZTSA 3VF8A 3L9NA 3DAJA 4CRLA 1URWA 4FSTA 3GCQA 3Q3BA 3QZHA 4LV8A 4O7VA 3PXZA 1HCLA 2WMWA 3LW0A 4FKLA 4QTEA 5L2IA 3IW7A 4D2PA 4DFNA 1H0VA 1AD5A 1R78A 4IJ9A 3RK7A 1PMNA 5KKRC 5J1WA 4YPSA 3JY0A 4G34A 3BBTB 1M2RA 1YI3A 2HCKA 2QI8A 3CP9A 3V5LA 3E7OA 4M15A 2WTKB 3U9NA 4OTFA 4OTHA 2XIXA 3ACKA 3QCSA 3AXWA 4QMUA 3EIDA 4G17A 4L68A 4CGAA 4WSQA 2GU8A 1P14A 4BBFA 3GU7A 3B2TA 3UO5A 3FMMA 3QFVA 4QMMA 5EM8A 4UMTA 4UALA 3QCQA 3KXHA 5E7RA 2VWBA 1W82A 5HG8A 4DFUA 3D7ZA 2HZ4A 3RM6A 4I0TA 4JDIA 4CYJA 1RE8A 2OBJA 4YUQA 4FSUA 2C1BA 4HGEA 2CKEA 4OUCA 5KO1A 2UW0A 3I6WA 4FTQA 4O2ZA 4M97A 3EYHA 4BI2A 2VTNA 2EXCX 4XG7A 4M67A 4WBBB 1H08A 5J95A 4OT5A 4B0GA 4BFMA 2BAJA 2X0GA 5EDPA 3R9HA 3IPHA 3TCPA 3FYKX 4EBWA 1BX6A 2OI4X 3OTUA 4Y46A 3ZRMA 4F65A 4RGJA 5HIEA 2QLQA 4C4JA 2R5TA 4XCUA 5KBRA 3HNGA 4AGWA 4FT7A 4E5AX 4CLJA 5K9IA 2J6MA 3F9NA 5KMKA 2J90A 5CSXA 4CFVA 1SYKA 3R1YA 5EYCA 5I9VA 3RM7A 2C30A 5FTOA 5L4QA 3CPCA 3EFWA 2C0IA 3ORMA 3D15A 3EMGA 2XVDA 3MN3A 3VHEA 4F4PA 2OIBA 4F9CA 2OO8X 1W0XC 3JR1A 2YFXA 2YIXA 4G9CA 4EYJA 1R1WA 2XF0A 4QOXA 4BGGA 3TKHA 5KBQA 3CS9A 3FKOA 5HCYA 3R8PA 4IM2A 2ERKA 4IAFA 3EB0A 4QMSA 5AUXA 2BKKA 1OUYA 4CKIA 4HCTA 4BDAA 4BYIA 3DT1A 5IH6A 4LL0A 4QT1A 2ITVA 2PVKA 3LJ0A 2ZMCA 3C4FA 3DQWA 1GAGA 5HNBA 4R78A 3KF4A 4RSSA 2OW3A 3GCUA 3RMFA 5M4IA 3NUXA 3UNJA 1YW2A 2OFVA 1CKPA 4EH5A 4AZTA 4EONA 4X3FB 4KSQA 1YHVA 2HY81 1VYZA 3E7VA 3DTCA 3RKBA 3TL8A 4CFMA 4TY1A 4DH3A 4EOLA 4ZTMA 3P08A 3V01A 4LM5A 4JBOA 5AV0A 5BVDA 3KXNA 4ZSAA 2W4JA 2PY3A 3LFQA 5IKWA 1CKJA 1WMKA 3L8XA 3OMVA 4IB3A 4IX5A 4CMOA 4YJRA 4F9BA 2WMXA 4MX9A 3FEGA 2XUUA 4XG4A 1GY3A 5CSVA 3QYZA 2I7QA 2QURA 5HORA 5DR9A 2PZRA 2C69A 3PXQA 1Z9XA 3HMNA 4IDVA 2BRNA 1ZY5A 5ETIA 3KF7A 4ZJJA 5EK7A 4FI1A 5IISA 4WRGA 2XZSA 1H26A 1OPKA 2VTLA 3OCSA 4QP9A 5C26A 2ZOQA 4O7RA 3AC3A 2FA2A 5CU2A 2OXDA 5ETFA 3LLAA 4K8AA 1KWPA 1QPEA 3BU6A 3HP2A 3UO4A 3KEXA 2Y4PA 2UW9A 4FV7A 3P5KA 5I0BA 2J5EA 1JSVA 2JDVA 3QRUA 4P90A 5AR7A 5KHXA 3VW8A 5AV2A 4F7SA 2J4ZA 1Y6BA 3TTIA 3E8DA 4QTDA 5BYLA 3A7FA 1ZMUA 2PTKA 4ZTHA 4MQ2A 2W4KA 4YHTA 3DFCB 1L8TA 4NJDA 3GU8A 4RQVA 4EOIA 5M4CA 1GNGA 3R21A 4FR4A 1YWNA 5CU4A 4BCJA 4EJ7A 1IRKA 5EW9A 3ZZEA 3KGAA 4GFMA 3ZSGA 3OC1A 4AT3A 4LFIA 3C4EA 3AMAA 2VO3A 3MGYA 2AUHA 3EN4A 4IANA 4J1RA 4JJRA 2YACA 4QMYA 4FSZA 3F5XA 3GBZA 3CTQA 3WE4A 2NRUA 3ZCLA 2BRGA 1WAKA 2VNYA 4MXXA 4PMPA 5CF6A 1OL7A 2QD9A 5AR3A 4O0WA 4ALUA 3CJFA 3TUDA 1J1CA 2IW9A 1MQBA 1B38A 1NVRA 2ZAZA 4FZ7A 1YDTE 3QWKA 4FZFB 4DA5A 4AN2A 1P4OA 3PVUA 4R7HA 3E5AA 5GINE 1OVEA 2YERA 4GL9A 4W4WA 4O91A 5E8SA 3EQGA 2PPQA 2VAGA 3MSSA 2BZHB 4MNFA 5L6PA 4JR3A 3IGGA 3ENHA 3F5UA 4H36A 4QTAA 3NYXA 2CCHA 4HYSA 4I21A 4II5A 5IMEA 3UOKA 1AGWA 4D2SA 2W96B 1OIUA 3WF6A 3ETAA 1V0OA 1M17A 4FKTA 1PXNA 4FZ6A 4IFGA 3VAPA 3ZBFA 3PUPA 3B8QA 3QLGA 1M2PA 2GNJA 2XS0A 3B2WA 4S32A 3TACA 3ZC5A 2JDTA 2R0IA 3M42A 5AAGA 2GDOA 5A4LA 4TPTA 3R8VA 4KNBA 2NRYA 3UNKA 3UIXA 2GHMA 4KRDA 4AGUA 1IA9A 4IHPA 3HX4A 2G2HA 4WSYA 3O0GA 4GEOA 2W06A 3QTSA 4ALWA 1ERKA 3KQ7A 4FKJA 3E64A 4MXYA 1V1KA 2FSMX 4PX6A 4W8DA 4WOVA 1OKYA 3R7YA 2A19B 4PMMA 4BWPA 4CNHA 3R1NA 4CQEA 3FMHA 4GIIA 4X6RA 4DHFA 4MWHA 4FSMA 2XM8A 4ZTQA 3UMWA 4BCMA 5E9EA 2XK7A 4U6RA 1OIQA 2HYYA 2WTKC 3DLSA 4UWYA 3KXMA 5FEEA 5GJDA 3WIKA 4AXAA 4BI0A 1APME 2XNGA 1ZZLA 4WUAA 3RWPA 1KOBA 3LFFA 1YHSA 3BYVA 2W1ZA 4C57A 5JT2A 1YXTA 4QPSA 4FNXA 4O86A 3KXZA 2IPXA 4NCTC 2YWVA 2C6OA 5EG3A 4C4IA 1ZY4A 2O0UA 4DINA 4EI4A 5HNIX 3HUCA 3QC9A 4QPMA 4ANSA 2YCSA 2ZJWA 2GHLA 3GCVA 4G6OA 5J9YA 1Q8TA 3MWUA 1IR3A 4L3PA 1YVJA 1GZNA 2OH0E 4XLVA 1XH6A 2QKRA 2ZV9A 4J8NA 3UZPA 4WO5A 2A1AB 1UA2A 2VNWA 5A3XA 2DWBA 2CLQA 2WD1A 4FOBA 4R8QA 4IC8A 5I9UA 3CKXA 2G1TA 4J96A 5ITAA 4IWDA 5JQ8A 3S00A 1KSWA 4XRJA 5GZAA 3SQQA 2VTRA 4XOZA 4CLIA 3LFNA 3SRVB 4MHAA 5BYYA 1SVHA 5E8ZA 3RPSA 5M06A 2KTYA 3DK3A 3MDYA 5EFQA 1NY3A 4UEUA 3LXKA 4AW0A 1ZYLA 1FGIA 3ET7A 1SM2A 3KK9A 2R3GA 5CF4A 4FK6A 4IFCA 2J0IA 4PP7A 3OT3A 3EQHA 4GFOA 4BCPA 2BR1A 4L52A 2CNVA 2X39A 2UVXA 3R8UA 2C6IA 1BYGA 4M7IA 5AA8A 2I40A 3WYXA 4DG3E 4NSTA 3O51A 2GMXA 4X3JA 3FSKA 2F7ZE 4F0GA 4ACHA 2OXXA 4JX3A 5B7VA 4C8BA 3PVGA 5DGZA 3ORLA 4MBJA 2JITA 2R3JA 2WMQA 3ZM4A 3HVCA 3ORZA 5GIOE 1H1SA 4RWKA 2VWIA 3ZO2A 1YKRA 3OBJA 3L8VA 4FNWA 3TJDA 1KUTA 5C9CA 3R8LA 3I60A 4R3CA 4X2GA 5CU3A 3LJ2A 3LM5A 3QAME 4QMWA 3Q2JA 5AM6A 3GUBA 5HD4A 2BZKB 4D58A 3KB7A 3UDBA 3ZO3A 4FUXA 4FL3A 4S31A 3BYUA 5D10A 4IM3A 5HESA 3P0MA 4I4EA 3FAAA 4KKHA 2Q83A 2FGIA 3C5IA 4GS6A 4P4CA 4PTCA 2ZDTA 3P79A 5JSMA 1UKIA 3OWKA 4KSPA 4KS7A 4FZDB 5FP6A 5A14A 3L1SA 2VV9A 3EQRA 2PVJA 4O81A 1J7UA 3RPOA 5CEPA 3R7VA 1BI7A 3ZLXA 4RWLA 2YISA 3KN5A 3ULZA 4GCJA 5CEIA 4OBQA 5KMIA 4J99A 3PXRA 2J51A 4OT6A 2EXMA 4BDIA 3GOKA 5EI2A 3UIMA 2QKWB 1WBTA 5BMSA 3SXFA 3LIJA 2ACXA 4N57A 3WZDA 3FWQA 3KMUA 3LFAA 4TTHB 4Y8DA 5I4NA 2B9FA 2VTPA 3D83A 4XEYA 4RLKA 4H39A 4M3QA 4DEGA 3DQXA 2Q0BA 5FRIA 2VTTA 3QQKA 2JGZA 3WARA 1CTPE 4HGLA 5E1EA 4B4LA 3U6IA 3E8CA 4FA2A 5A4TA 2PVLA 4S30A 2C0TA 5BUEA 4EJNA 2IN6A 1UKHA 5JFVA 2VX0A 5AUWA 3BEAA 3C0GA 3HYHA 3FMJA 2WPAA 2XNMA 4YJNA 2A2AA 4FGBA 4FTAA 4BGQA 5M09A 4L3LA 3I5NA 3IKAA 4IWPA 3ERKA 4U43A 5HX6A 4NM7A 3OG7A 3DJ7A 3Q4UA 4WNOA 3W2SA 3JVSA 3MY1A 2E9OA 5L2WA 3CXWA 4QYHA 1G3NA 4EQMA 4XMOA 2Y6MA 4FIJA 4GRBA 3FMDA 1J7IA 4U3ZA 2ESMA 4Q9ZA 4AT4A 3V5TA 3UQCA 2VGOA 3K5VA 4RC3A 4EHEA 2VTJA 2UW7A 4I0RA 5LJJA 1OGUA 2PU8A 4PL3A 4E6QA 5ICPA 3E63A 3F7WA 4ACDA 5LQFA 2PUIA 2Q0NA 4GKHA 1BMKA 3I7BA 4DGLC 3PPZA 2Z02A 3MIYA 3OVVA 1SZMA 2ETKA 3E88A 1KV1A 3V51A 5EI8A 3UP2A 4FTIA 4BDJA 4U81A 4BTJA 1H0WA 4UV0A 1ZMWA 2PZYA 3RHKA 4DC2A 5A46A 3TZ9A 3QQFA 2XKDA 3LLTA 2P0CA 3G5DA 3E3PA 4FBXA 1H1WA 1CSNA 5GZ9A 3RGFA 3VS0A 1XQZA 4ANQA 4CCUA 1JNKA 3TV6A 2O8YA 4CG9A 2GS7A 4FV5A 2P4IA 5EHOA 3BHUA 3UVRA 4V01A 2VUWA 4NH1A 4FV4A 2DYLA 4NKSA 3TV7A 4ZY5A 5A6NA 4G9RA 4F6UA 3Q5ZA 4O0SA 3F2RA 2HXLA 4AQCA 3GP0A 3LE6A 2BFYA 3QTWA 4AAAA 4IVCA 5J5SA 3QUDA 3ENMA 3VS6A 2CMWA 5E8UA 1TQMA 5CQWA 5LMKC 3D9VA 2GQSA 4I3ZA 2PUUA 5LMAA 4IAAA 2JLDA 2C6MA 2QOIA 4FODA 3TXOA 3DPKA 4U44A 2IW6A 5IA1A 2E9NA 3I0QA 2CKOA 2ITWA 3LOKA 1Q41A 1IA8A 3UPXA 4DYMA 4F09A 4I5PA 5HO6A 5KMMA 4GVAA 5HBEA 4FEQA 4XP0A 3LAUA 3A60A 3W18A 3EWHA 5KKRB 2R3HA 4BR3A 2I0EA 4ITIA 5HG7A 5T6KA 4IW0A 5E92A 2UW5A 3FMKA 1ATPE 3Q4ZA 3ROYA 4DN5A 3LFEA 5FDPA 3VVHA 3ZXTA 4RIXA 4F70A 1ZWSA 4FVPA 5I5ZA 4EKLA 4EL9A 5E8XA 5K3YA 2R3IA 3MVHA 1WZYA 2PUPA 4IEBA 4D4YA 4ANMA 5AFVA 1H1QA 2KULA 2ZMDA 3R7OA 3EQIA 4WBOA 3UZTA 1GZKA 1PMUA 4ERKA 4I5CA 3VUTA 1Q61A 4I94A 4KKGA 4W9WA 4WA9A 4F0FA 5CNNA 1J91A 1Q8ZA 2SRCA 2VTAA 4AW2A 1WBOA 2Z7SA 4C61A 3Q04A 4KKEA 2BFXA 4K33A 2NO3A 3V5QA 3ZHPC 2A4LA 4FL2A 2P2IA 4ASDA 4ZSLA 4OTGA 4E6AA 4MD8E 2IVUA 3E8EA 3A62A 4D5HA 1WBPA 1ZLTA 2BAKA 4ANBA 3W16A 3ANRA 3E87A 3VS1A 5C8KA 5IPJA 2R3PA 3MFTA 2GTNA 5D11A 3QRJA 4EOPA 3NWWA 3O71A 5K4IA 4OLIA 5DPVA 3PA3A 2W9FB 4E4XA 4UN0C 3S4QA 3S1HA 4DEIA 5IQCA 3EHAA 3KXXA 3GXLA 1VEBA 2REIA 4YSMA 5EI6A 5DWRA 4MVFA 2HK5A 3E93A 5HE0A 3P7BA 5BMMA 2JKQA 2QVSE 1YI4A 3BYSA 3VS7A 4FV0A 3TT0A 4M12A 5JRSA 4CQGA 4DGGA 4FSRA 2FSTX 4LOOA 2Y9QA 3QXOA 2A0CX 3Q4TA 4F7JA 3P9JA 2QC6A 3NDMA 5B0XA 4IB5A 3RAWA 2H8HA 5B2MA 3R04A 3IW5A 4ITJA 4GFGA 1OB3A 3P23A 4RX9A 2C6KA 1JQHA 3VUDA 5D7VA 4AOTA 1DM2A 2XK4A 3BHYA 3IQ7A 3R7GA 4IDTA 4KB8A 5FD2A 4F0IA 3NYNA 3LVPA 1ZAOA 2XIYA 4O0RA 5D1JA 5CAUA 1WVXA 3ANQA 4I5HA 5AP3A 2BDWA 2W1EA 4E20A 1PXOA 2GCDA 4GVJA 4BZOA 4F64A 5AR2A 3ZLWA 4FG9A 4J97A 4FKWA 4MF1A 3SA0A 5IUGA 4XG2A 3MJ2A 3HGKA 5DH3A 4JT3A 5DVRA 4MD7E 5TO8A 2VWUA 3D94A 2GPHA 4ASXA 4BF2A 3RP9A 3C13A 3CQUA 3TDWA 2VGPA 3DKOA 4U45A 4A9YA 4BDDA 3EKNA 3EKKA 2C6LA 5H8GA 1URCA 2YAKA 2UVYA 1FVTA 1WCCA 4FIEA 2X8EA 4QYEA 3PXKA 5AM7A 2C0OA 3WZEA 3ZC6A 4RA4A 5CVHA 3AGMA 2BIYA 3H3CA 5AAFA 3SW7A 4EH3A 3C0IA 3ODZX 3ZYAA 5IH4A 4JBPA 4KIKB 1YDRE 5BVFA 3GU4A 4NTTA 4WT6A 2PVNA 3QZIA 4J8MA 3TNWA 3ORKA 4XNEA 2Z60A 1JAMA 4DFZE 4JVGA 2Y8OA 3KULA 1Z57A 3NS9A 4KA3A 4JRNA 3EJ1A 4DT9A 4YZ9A 3LCOA 5HLWA 3K2LA 4DEBA 2F49A 2FO0A 3Q9XA 5CAQA 2V7AA 3LQ5A 3WZKA 3QKLA 4YC6A 4FKPA 3UJGA 2YHVA 4FEWA 3I7CA 4F6WA 4ANNA 2XIKA 3HAVA 3AD6A 3DK7A 1BL6A 1OPJA 2CGWA 4O0XA 3DTWA 4PNIA 3H4JA 3G6GA 4D28A 5C4LA 5IF1A 3PA5A 2ZDUA 3G90X 4BKZA 3LCSA 3FLNC 2HZ0A 2GHGA 2QOKA 4FT3A 4ITHA 3QZGA 2UZOA 5FG8A 5L2SA 3UYTA 2QR8A 3MPMA 2VO0A 2Z8CA 3T9IA 1G8SA 3MBLA 3ZMMA 2OXYA 4BCFA 4AZEA 3O8UA 5K5XA 4YO4A 2JAVA 1GIIA 2Y0AA 2YM6A 4M8TA 4O1PA 2R3MA 3BLHA 5K4JA 4D9UA 4HZRA 3U9CA 3TNIA 3H9FA 3F5PA 3TNHA 4QP6A 1LPUA 2PE2A 3FC2A 3PPJA 3R22A 4JAIA 4NL0A 4IQ6A 1OECA 1O6KA 3SKCA 3W32A 1GZOA 1MUOA 4HZSA 4OGRA 4U80A 1E1XA 3HL7A 3IK3A 4UY9A 3HMIA 2YIYA 4C62A 4YP8A 3QCYA 4F1MA 3PIYA 3FLYA 2WOTA 3HAMA 4NJ3A 5HX8A 4J53A 1ZZ2A 4RMZA 5CX9A 2YM4A 4XBRA 2XK8A 4H3PA 3NSZA 4FTTA 4IJPA 3NEWA 4EC8A 4JS8A 4PQNA 2QOOA 2UZBA 3FXWA 4RT7A 3ZTXA 2UW8A 1ZYDA 2AC3A 4B6LA 3PG3A 3FZPA 4D4VA 4FT0A 2QO7A 3VBTA 3SOCA 2UZNA 3PSCA 4GT5A 4IB1A 5J8IA 4ZTRA 3VRZA 3TIYA 2R7IA 5AP2A 3DA6A 3VW6A 4BTMA 4ZMFA 5ETCA 1T46A 1JSUA 3HV3A 4QMLA 4DH7A 1IAJA 4CG8A 4IVDA 4RVMA 3FSFA 3TIZA 5CAVA 3C9WA 4A7CA 1YRPA 3K54A 4BDKA 3PRIA 1J7LA 2WU6A 4RX8A 3PJCA 3EN7A 4U0IA 3O8TA 1RDQE 3PFQA 3QC4A 5J79A 4RVTA 3AC4A 4FVQA 3OROA 2WZJA 4O21A 5A54A 5K5NA 2X8DA 5CU0A 3U54A 5CQUA 4IWQA 4AT5A 2UZTA 1GJOA 3CC6A 5CY3A 2UW4A 3OW3A 1JVPP 2X1NA 1OM1A 2XA4A 5FP5A 3TEIA 5JN2A 4R1YA 4KINA 3ZO4A 2WXVA 3VJOA 3G51A 4O82A 2B55A 2PK9A 3KA0A 3QTQA 3W55A 4EORA 2OWBA 2PZPA 4C34A 4AX8A 4CRSA 3FZSA 4FGRA 4GT3A 2Z7QA 1KV2A 3P86A 4AOJA 4B8MA 5EM6A 4CFUA 2XBAA 5E90A 3FHRA 3MFUA 4RLLA 4WNMA 2BKZA 3ZRKA 2AYPA 2BTRA 2G15A 1YHWA 2R9SA 3F69A 3D5VA 3MIAA 3PTGA 3WZJA 4HPUE 3R9OA 3KN6A 3ZOSA 2XJ0A 2O64A 3BWJA 3GENA 1WBNA 5ANKA 3S95A 4RIYA 3QTUA 4CTCA 3HUBA 4PDOA 2OJGA 3TNQB 4AA4A 4DTBA 4MXOA 1CM8A 3NLBA 3KK8A 4IH8A 3G33A 4C4HA 2YZLA 4L67A 5TE0A 4EZ3A 3ZUVA 1OIRA 3QHWA 3ACJA 4M0YA 3QD0A 4FC0A 3E3BX 3QUEA 3NAYA 2JIUA 4QQJA 2XKEA 4FT5A 4G3FA 4K11A 4O6EA 4E73A 5AEPA 3FI8A 1U54A 4HVHA 5FM3A 4IX6A 2UZDA 3R83A 2ZM4A 2CGUA 2EVAA 2JAMA 3UG2A 5IA5A 1NA7A 2E9PA 3RINA 3BHTA 4PL4A 4W4VA 1R39A 3WZUA 1OUKA 3BI6A 2YN8A 4IVBA 4D0WA 4LGGA 3IDBA 2EB3A 3D14A 4RJ8A 5E8TA 3R73A 2GQRA 3AC2A 2XNEA 3BLRA 2OH4A 2PL0A 4X2NA 3C7QA 1FMKA 3OP5A 5JGAA 4BWXA 2HELA 5EYDA 3PJ2A 5CVGA 1FQ1B 1O6YA 4MTAA 3RAKA 1UNHA 5M53A 3V8SA 5IQEA 3HV5A 1JKSA 3OWPA 4XG3A 2CLXA 4L53A 5KNJA 4KRCA 3DGKA 4C7TA 4OAUC 5EH0A 4FNYA 5FBNC 3VF9A 3F3UA 4O2PA 3TWJA 3V6SA 3QBNA 3DXQA 2WNTA 3UG1A 4RBLA 3SG9A 1H24A 5HBHA 4E4NA 4GUBA 4FTOA 4U97A 3PY3A 3MYGA 3ROCA 3VUIA 4C02A 4D5KA 2DS1A 3VBYA 1DAWA 3IGOA 3ORPA 4EOMA 5ANDA 4V0GA 5A9UA 2C47A 3A99A 3GCSA 1M2QA 3N51A 2CSNA 1YWVA 4PF4A 4HCVA 1WBSA 3NR9A 4UXQA 1KOAA 3LFSA 1XBBA 3QHRA 4PTEA 3R7UA 1MRUA 4M14A 4QYYA 4CZYB 3MV5A 1F3MC 4EOJA 4AE6A 2QONA 2WMTA 4BGHA 3AD5A 3Q60A 4MEDA 4ZLYA 4XG8A 5DR2A 2PZIA 3PE2A 3LJ1A 4HPTE 4CSVA 3KC3A 5EDQA 3NZ0A 3TUBA 1JKLA 4PV0A 2YCFA 5A4CA 5IQFA 1ZYSA 2IZSA 1FINA 3UYSA 1ND4A 4L6QA 4BCGA 2CKPA 1OIYA 5HO7A 4DH1A 3KRWA 5IG1A 1GOLA 4YZCA 2GFCA 3HECA 5HD7A 1SVGA 3GEQA 3UOLA 4DFXE 1VZOA 4O7TA 4AUAA 4V05A 1WFCA 3HLLA 2PZ5A 5CF8A 5HTBA 5CT7A 3NCZA 3LPBA 4K77A 4ZEGA 4F7LA 5HU9A 2W5AA 3VQUA 2A27A 4QPAA 4YJOA 3C4CA 3QGWA 2P33A 5TT7A 2Z2WA 4PPAA 4ZP5A 2OU7A 4NZWB 4BZNA 2WB8A 4YJUA 1DI9A 2UZWE 3OUNB 2YM7A 3UIBA 5EDRA 5I9WA 2HWOA 3Q2MA 1YOMA 4Z7GA 3NCGA 2OSCA 2R4BA 4PWNA 4MBLA 4X6QC 1V0BA 3WOWA 4ZTNA 4FG8A 4RJ4A 3W2CA 1Z5MA 4D2VA 4BI1A 5H8BA 2VTHA 4Z55A 3OFMA 2QR7A 3PLSA 2O65A 5FDXA 4EOOA 3A4PA 5JKGA 2G2IA 3CGFA 3N4TA 1UU8A 2XCHA 5GIPE 2VTOA 3HZTA 2PMNX 3R1QA 4U41A 3WI6A 3L8SA 5LVMA 1H8FA 1MRVA 5AX3A 4QP1A 5AR5A 4YJQA 5I3RA 1NVSA 4XP3A 4B7TA 2WO6A 3VUGA 2C3KA 3BGPA 5B2LA 2IVTA 3DLZA 4FV1A 3NVMB 3DFAA 4DH5A 3QU0A 1PJKA 4QRCA 2OJFE 1MP8A 3NYVA 4KWPA 2R3LA 2W1HA 2XBJA 4ID7A 4NK9A 3QA8A 5KMLA 2Z7RA 3PJ3A 4Z16A 2WMVA 2W05A 3IOKA 3GC0A 3Q4CA 3UIUA 5DLSA 3UE4A 4BCNA 2HAKA 3FLZA 3UPZA 1YXSA 5AR8A 2BRHA 3RALA 3AOXA 2I6LA 3ZM9A 1H1PA 3OXZA 1YDSE 3MH2A 3ZUTA 3CBLA 2GNGA 1B39A 4QMZA 4S34A 5JMSA 3ODYX 3CPBA 4TW9A 4XP2A 5JGBA 2JEDA 3PSBA 4A4LA 1NT2A 3SD0A 4UBAA 4M66A 1MRYA 4LG4A 2V0DA 5BYZA 4A9UA 4UZDA 3VS4A 4ZZOA 1ZYCA 1J1BA 3FXXA 2QOBA 4JX7A 2O63A 2WMSA 3MB7A 4KBCA 4APPA 5AP4A 5EYKA 4WKQA 3RWQA 4CXAA 3QTZA 2WMRA 5AV1A 3EFLA 1FVVA 5GNKA 4RFZA 1PXMA 2XM9A 5CNOA 5DT3A 3NX8A 4DCEA 5HLNA 2WMUA 2F2UA 2UVZA 5BVEA 4WG3A 4DFLA 3RNYA 1ZRZA 2W5HA 2CCIA 4G2FA 2ZV7A 3NMUF 2HOGA 4EHGA 1L3RE 2H96A 3FKNA 4FICA 3QF9A 3L9MA 3II5A 4NEUA 4BTFA 2CPKE 3KRRA 4FT9A 4ENXA 4EWQA 1OZ1A 4IAYA 3QRIA 3IW6A 2ERZE 5EM5A 3ALOA 4QP4A 3F5GA 3COMA 3FC1X 5AP5A 4JAJA 3MA6A 5M51A 3PVBA 3CLYA 3F6XA 3Q52A 5ACKA 3VC4A 2CNUA 5CI6A 4FYNA 5TR6A 5HOAA 1ZARA 3B8RA 4UXLA 3TV4A 4AGCA 5DE2A 4ONAA 4EYMA 4DE4A 4F1TA 3FZTA 4L3JA 3U6JA 3RK5A 2IW8A 3NVKI 3CE3A 2RFEA 5D7AA 4C4FA 4YTFA 5DNRA 4AGDA 2OZOA 3GQLA 2BCJA 1Y6AA 2OF2A 3LCKA 4XJ0A 3U87A 4RX5A 1JBPE 1YWRA 3C4XA 3GC7A 5HCZA 5EYMA 1RJBA 2BROA 4NWMA 3GGFA 5C03A 5L6WL 4CCBA 1H28A 4D4RA 1REJA 3CSVA 1S9IA 5CENA 4GMYA 3VULA 4ACMA 5FQDC 5EQYA 4OBPA 3BKBA 3BE9A 3K3JA 2PMIA 5FEDA 4DLJA 4GUEA 5DMZA 3NW5A 2WQEA 4L9IA 5EW8A 4N0SA 4XV2A 3KULB 2J0LA 5D12A 5GJFA 4YR8A 5LVOA 4DEHA 2YA9A 2JFLA 2FSOX 4IVAA 4J95A 1FBNA 4O7YA 2C5OA 3WILA 5JRQA 3PDTA 4E8AA 4KBAA 1XWSA 3W2QA 4YBJA 4R6VA 2VX1A 4BIEA 1LEZA 3D5UA 2OJ9A 1QMZA 5LOHA 3MVMA 1JSTA 2PE0A 2RGPA 4ARKA 2BALA 1XR1A 1BL7A 1W98A 2PSQA 3C1XA 2F2CB 4FKSA 3D0EA 4G31A 1IASA 3OOMA 4FSWA 2FVDA 2QOQA 3BE2A 2RL5A 5TKDA 5IMXA 4BBEA 4CFWA 3F88A 5KCVA 2C5VA 4W8EA 1DI8A 4BDCA 1YQJA 4N4SA 2XIZA 1F0QA 3U4WA 3PLAE 4NM3A 3G2FA 4AF3A 2BHEA 2GNFA 2QCSA 2VTSA 3Q53A 4G6LA 4TNDA 2BAQA 4LGDA 4D4SA 3G15A 3I81A 3BX5A 3RZFA 2JD5A 2XK3A 1UWJA 2YM3A 4R5SA 1OL5A 5IEXA 1LUFA 3QD2B 4QNYA 4YTHA 4ERWA 2JKMA 4F9AA 3T8OA 3AC5A 4FV3A 4RG0A 3GFWA 1OBDA 5FUTA 3ZXZA 3EZVA 4NUSA 2E2BA 3FL4A 2ITXA 3ULIA 2EUFB 2JDRA 5CSWA 2Y4IC 5TOZA 3UGCA 4FX3A 3DCVA 3SGCA 1K2PA 1O6LA 4EOQA 5LWMA 3FMNA 3MVJA 4WHZA 3ORTA 2E9UA 5CAPA 2XK6A 4Y73A 3QD4A 3UODA 3SXRA 2X7GA 3NUPA 2YIRA 5G1XA 5CSPA 5M57A 5FLFA 3O96A 4WUNA 3R9NA 3BBWA 5I9XA 5KX8A 4D1ZA 5J1VA 2FUMA 4RJ5A 3COIA 5GZ8A 5E8WA 2VO6A 1E9HA 3E92A 4USDA 3F2AA 4G3DA 4BZDA 3FJQE 1BKXA 3AQVA 2X9FA 4FIFA 3HMPA 4BCIA 5LCJA 3D7TA 4O0VA 3R00A 4FUYA 4CMUA 3BGZA 4HNFA 4E3CA 4JL9A 2QOFA 2UZUE 4YJSA 5BVKA 3AD4A 3BU3A 2C3JA 3LFDA 4FZAB 4CV8A 4D2TA 4EK8A 1T45A 4ZZNA 4C0TA 5CF5A 5BVWA 5EKNA 3S0OA 3IDCA 3R9RA 3NGAA 4AN3A 4ANOA 1DS5A 4EHZA 4NYEA 5AA9A 4I1ZA 2ZYBA 5E4HA 4M84A 2FH9A 1XHAA 2IZRA 5LVPA 2FB8A 2HZIA 4EH4A 3OS3A 5ANOA 4YHFA 4H3BA 4YJVA 4C38A 3UP7A 5C1QB 2V62A 1ZXEA 4R3RA 1U5RA 5IQHA 5CT0A 5AAEA 2IWIA 4ACCA 2RKUA 3I0OA 3ZS5A 5HG9A 2ZM1A 2X2LA 3OCBA 4OTPA 3FE3A 5DRBA 2QLUA 3QQLA 2IJMA 4JI9A 1XBAA 3A4OX 3R0TA 2CKQA 3LFCA 4GU9A 3FMEA 5AUVA 3QX4A 3CQEA 3ATTA 3V8WA 2HY0A 4TWOA 3PIZA 3L8PA 4O96A 1H27A 2GQGA 3AC1A 5HZNA 4J71A 2X7FA 3NW7A 3ORXA 4Z3VA 2VWYA 4BHNA 4R7IA 3WF7A 4UX9A 2XB7A 3OUKA 3ORIA 3FL5A 4WIHA 4DTKA 3PZEA 4JIKA 3VN9A 4A4XA 2BILB 4BDGA 4D2WA 4RIYB 3OXTA 5C8NA 5HO8A 4K9YA 4EZ7A 4EK3A 4D0XA 3R8ZA 3OF0A 3NUSA 4RIWA 4MXCA 3ZFXA 4IAZA 4MK0A 3G9LX 4FKQA 4WG5A 1OBGA 3BPRA 1HCKA 2WHBA 3MH1A 5HKMA 5M44A 1XH4A 1WBVA 2C6TA 4PPCA 3F66A 4P5QA 3EH9A 4R7BA 3S2PA 4XV1A 2J50A 2ZV8A 3BQRA 4CTBA 4JDJA 4E7WA 2BUJA 2CGVA 1U54B 3LM0A 3VS2A 1A9UA 5FXRA 1VYWA 2XKCA 1XO2B 2WAJA 5CEMA 4I93A 4UYAA 4RFYA 3HP5A 4ASZA 3QKMA 4O6LA 3SV0A 3W10A 2O3PA 3PIXA 4H05A 2RFSA 3AGLA 2XKFA 4XG9A 1U46A 4BRXA 2R2PA 4RFMA 4HOKA 2BRMA 4MYGA 4QP3A 3BELA 5L2QA 4GYGA 2OZAA 4WG4A 4KAOA 5A4EA 3KRXA 1YOJA 4ORKA 3GOPA 4G5PA 4PTGA 4IX3A 4Y5HA 4CFNA 4E6DA 2W99B 4YZNA 4KIOA 4DFBA 4FTRA 4C59A 4DLIA 2BMCA 4YC3A 1KE5A 4FL1A 3FHIA 2ZB1A 2ITUA 4RC2A 3W2RA 4IADA 5C8MA 2WKMA 4GIHA 2IO6A 2R3KA 4FTNA 5LWNA 4FEVA 4Q9SA 2RG5A 4F9WA 1KE6A 4C3RA 4DF3A 2JDOA 4V0GB 3D2KA 3FKLA 4C3PA 5HIBA 4PPBA 4JG8A 4FTLA 3MPAA 1DAYA 4RQKA 4TWNA 4E26A 5B2KA 2XEZA 3MB6A 4Z7HA 3PXFA 4KIQA 4WRSA 5DT0A 5IDPA 2PVRA 3HV4A 5DEWA 5A6OA 1EH4A 4GU6A 4JG7A 2QODA 2NNWB 3CEKA 2I0VA 3KRJA 2C5NA 3R2BA 3DDPA 4FV6A 1E1VA 2J9MA 2UV2A 3VUKA 2B54A 2X6EA 2VTQA 2X4FA 4BICA 3A8XA 4I6HA 3FQEA 5JK3A 3WF9A 3UVPA 3NAXA 2F57A 4ALVA 2WIHA 4CYIA 4HVIA 1PRYA 4Q5EA 5D41A 3GI3A 3QALE 3AMBA 3FZ1A 5HNGA 4W4YA 3ZDIA 2PMLX 1PYXA 1CDKA 5BVOA 1H01A 2J2IB 4FYOA 2RFNA 3DOGA 3OCGA 3QQUA 4FKOA 1REKA 3EL8A 2YM5A 5AV3A 4G3GA 2Y6OA 4NIFA 4JRVA 4O22A 3V5WA 3H0YA 2F4JA 1PMEA 5L8JA 3R7EA 5HU3A 3FI3A 2CN8A 3DXNA 4C2WA 1Y8YA 4F63A 2H6DA 2XIRA 2VWWA 5BNJA 4FG7A 4O0YA 3BCEA 2VN9A 3ZSHA 3WIGA 4XUFA 4TL0A 3RTPA 3ZUUA 4IZ5A 3VUHA 3I5ZA 3KKVA 5J5TA 2F7EE 3ZEWA 3BGQA 2Y7JA 4ZSEA 1OMWA 3UOHA 4EUUA 2R3FA 4GJ2A 4MAOA 4AOIA 4ZOGA 1W83A 4NW6A 1RQQA 5IA2A 3GC8A 3FPQA 2ITNA 3DB6A 2ONLA 2C6EA 2ZV2A 3JY9A 3P78A 4JDHA 4RJ7A 3RCJA 3LQ3A 2UZVA 3UBDA 4MXAA 3OD6X 4OTWA 3VNTA 3QLFA 4QO9A 2GFSA 5FTQA 5LCKA 1Q8YA 2BHHA 3ALNA 3GU6A 3M2WA 4K6ZA 3AT3A 3QGYA 3BEGA 3CKWA 3GC9A 5ANGA 3QYWA 4BCOA 5H2UA 2OFUA 1OL2A 2CHLA 5IQAA 4YJPA 3CTHA 2X2MA 5H9BA 4AS0A 4NTSA 3HMOA 3H30A 4XLIA 4YC8A 3V5PA 2YITA 5K0XA 5KMNA 4D1SA 2H9VA 3P7CA 3I79A 5A4QA 2YJSA 4ZIMA 1Q99A 2X7OA 4FTCA 3HEGA 3UZRA 1FVRA 3LFBA 4BY9E 1OL6A 4TYHA 3SVVA 2GNIA 3F3TA 3Q6UA 1J3HA 3CR0A 3BHHA 1NVQA 3A7HA 4CZTA 2GS6A 4FTUA 4UWBA 4D55A 3MFRA 2VRXA 4BDBA 4JOAA 5F9EA 2YAAA 1I09A 2J7TA 3SHEA 2BDJA 2W1DA 4JQ8A 2OIQA 4RVKA 4FV2A 4BKYA 3AG9A 3QRKA 4O7LA 3TDVA 2HIWA 2VO7A 3CY2A 4K1BA 4Q5HA 1XH8A 4RC4A 3FY2A 3LQ8A 3CD3A 3ZFYA 3SX9A 3RPVA 4DEAA 5IZFA 1G5SA 5E8YA 3UQFA 4I0SA 1IG1A 5DIAA 3L9PA 5L8KA 1VR2A 5DRDA 1R3CA 3PG1A 5FGKA 4FK3A 3P7AA 4AZFA 5JH6A 4U9AA 2P55A 5EHYA 5F95A 4EK5A 2QOCA 4QP2A 4DTAA 2ITYA 4APCA 3QX2A 4EOSA 4YU2A 3IS5A 5HCXA 1W8CA 4E6CA 1F5QA 1KE8A 3N9XA 5F4NA 3F3WA 2QNJA 4L00A 3UTOA 3NNXA 3R7IA 4ZZMA 4QQ5A 4PMSA 2P3GX 5M4UA 5FEQA 3JUHA 2GNHA 3EN9A 3DJ5A 3G0EA 3QKKA 1YI6A 1SNUA 1UVRA 3FQSA 4JIAA 4DGNA 4CKJA 4DCAA 3H0ZA 2R7BA 1PY5A 5CANA 1JLUE 4EWHA 5IQIA 4I23A 1W84A 4X2FA 4CVAA 4QD6A 5FXSA 4K0YA 4USEA 4AA5A 2RIOA 2QOHA 3R30A 3DZQA 5AADA 4Y72A 4Y85A 1UU9A 5IDNA 3V8TA 2C68A 1QPCA 3GU5A 3A2CA 4YTIA 3POOA 3U8WA 3HRCA 2H34A 4TKSA 2OJIA 3BYMA 3OEFX 4BWKA 3H10A 4XH6A 3JYAA 3M11A 4FSYA 4N70A 3ZSIA 3I6UA 3DNEA 3MTFA 2B52A 4QYGA 4H58A 4QMTA 4XV9A 1SMHA 2XRWA 4DG2E 2PVHA 3FMLA 4ANLA 1Y91A 4CV9A 4OTIA 2EU9A 3OT8A 4U8ZA 5HEZA 4O7SA 2X6DA 4XBUA 2NPQA 1OITA 2V5QA 3TTJA 2O2UA 3D2IA 3F82A 4GSBA 4YO6A 3I4BA 4RRVA 1XJDA 3ID6C 3H9RA 4ZJIA 3FDNA 2C5XA 3W2PA 4ACGA 3Q5IA 5AP0A 5KZ0A 3VIDA 4DEDA 2B4SB 3GB2A 4FE2A 1B6CB 3RJCA 4XV3A 4O27B 1PKDA 3LMGA 4I22A 3F61A 2JFMA 4QMVA 4QNAA 4EUTA 4G3EA 4AFEA 2PMOX 4OTRA 4O7ZA 2YIWA 5CWZA 1PXLA 1GIJA 4NKAA 4IB0A 4L7SA 4GH2A 2P2HA 2XJ2A 3FZRA 3QQJA 4BVUA 4F9YA 5HI2A 3QD3A 2BZIB 1Q4LA 2VWXA 2WTCA 4AE9A 4CZUA 5CZHA 1FPUA 1UU7A 2C3LA 3O7LD 3IW8A 4GV1A 4RPVA 3RK9A 5BUIA 4IXPA 3JS2A 3SOAA 1M7QA 5HE3A 4C58A 2IG7A 4N6YA 4FIHA 1XH7A 3KY2A 5LARA 5DG5A 4U42A 2JKOA 4DFYA 3QZFA 4EEVA 4YGAA 2JIVA 2ZM3A 5IQDA 3LCTA 2V7OA 4BC6A 4YLLA 2J0KA 2VU3A 5CASA 1UNLA 4RVLA 3EQBA 3TUCA 3PWYA 4LMUA 4GG5A 1A48A 3VJNA 3IO7A 5EKOA 3UC3A 3SAYA 1I44A 3KCKA 4EK4A 5IA4A 3DXPA 5C27A 5DI1A 5HE1A 5E8VA 2OIDA 4ASEA 4DAWA 4ZS4A 4LI5A 5CEOA 3FZOA 4AWIA 4L01A 4L43A 3OW4A 4LGHA 4YMJA 3VS3A 3OBGA 4M69A 3PP1A 5M55A 5J9ZA 2WU7A 4IAKA 3DZOA 4H1MA 1JKTA 4XHKB 4O83A 1Q97A 3NNVA 3F2NA 3GVUA 3D7TB 4IBMA 1STCE 3VO3A 1XBCA 2V22A 1ZOGA 3FI4A 4UZHA 1YOLA 1WVWA 3HMMA 3SG8A 3ZBXA 2ETRA 2XMYA 4NW5A 3Q9ZA 2GSFA 2EWAA 4QMXA 5K0KA 1CKIA 4MKCA 3V5JA 4FSNA 4O0TA 4R3PA 1BLXA 4ENYA 3LXLA 3P4KA 2QG5A 3HA6A 4IAIA 3UO6A 4FTKA 3BHVA 3IOPA 4Y95A 4FKRA 4B8LA 1JOWB 2B1PA 2Y4IB 3RI1A 1R0EA 4CFXA 3BRBA 1NXKA 4Y5QA 5J87A 5L8LA 3FPMA 4RA5A 4U40A 3O8PA 5M56A 4XX9A 3Q96A 3ZZWA 4ZTLA 3E62A 3HDNA 3HRBA 3O2MA 4HGSA 5AR4A 4JBVA 1OKVA 4JG6A 1OKWA 4IX4A 4L46A 4L45A 4H1JA 4IZYA 3OXIA 2WQBA 4GT4A 4I6BA 5ANJA 3DY7A 4GK4A 3ZO1A 3LKMA 4C3FA 4L44A 3FI2A 4YNEA 4FEXA 3G9NA 3FLWA 2W1CA 2WIPA 2R3NA 3NRMA 4A07A 4N6ZA 1PF8A 5AIKA 2WTWA 3AMYA 3U6HA 4RIXB 2YWPA 4KIKA 4A06A 1NW1A 3RHXA 3EZRA 2BDFA 4EKKA 3M1SA 4X2JA 4AZWA 2BZJA 4TWPA 2R3OA 4UMQA 3KCFA 3R2YA 1YXUA 5H8EA 5HQ0A 3GCPA 4OTQA 3NW6A 3LCDA 3GT8A 2UZLA 3PA4A 4G3CA 4QMOA 5EW3A 3KXGA 3TI1A 4C2VA 4FVRA 4XYFA 4RIWB 3A7JA 4FKIA 3QXPA 3DBDA 2VZ6A 3BZ3A 5EQPA 5AMNA 5FM2A 4EHVA 4RIOA 2QU5A 1PW2A 3Q9YA 4BTKA 2GS2A 4QTBA 5F94A 4BL1A 2UZEA 4PUZA 5CLPA 2W7XA 3SDJA 5AP6A 5AUYA 4FV9A 3HKOA 4YJTA 3FYJX 5LMBA 3MESA 5HVYA 4EH2A 1Q62A 4IC7A 2YDIA 3DBCA 5DFPA 4MNEA 2OF4A 4NM5A 3DAKA 3F3ZA 4HYHA 4J7BA 4MQ1A 5ANEA 4PDYA 5C4KA 3D4QA 3PY0A 5DT4A 3K3IA
chains in the Genus database with same CATH superfamily
4FNZA 3KL8A 3QQGA 4QQCA 1FGKA 3GFEA 5BQ0A 5CXZA 2OZAB 5DEYA 4FSQA 4UYNA 2HW7A 4G6NA 2ITQA 2I1MA 3TN8A 3LMIA 4G16A 4C33A 4BHZA 5AP1A 3C4ZA 2JC6A 2G9XA 5FWKK 4I92A 3DAEA 3VRYA 3PYYA 4F08A 4GK2A 3QL8A 2YCQA 1S9JA 3IDPA 3LXPA 1PXKA 1QL6A 3BQCA 2ITPA 2YIQA 4HNIA 3S3IA 1WVYA 2FSLX 4DBXA 3AC8A 3UMXA 1YXXA 4D9TA 1U4DA 5HICA 3G0FA 4USFA 4KUJA 2J0MB 1Q8UA 3EQFA 5AX9A 4C4GA 5AJQA 5HHWA 2X2KA 3G6HA 5JFXA 3CCNA 4G1WA 4E1ZA 4FKVA 1FOTA 3SLSA 5F20A 3C0HA 3PUFC 4AFJA 4I6FA 5C01A 5CALA 3Q32A 2BIKB 4FKUA 5KMOA 3EN5A 3T9TA 5JFSA 5IA0A 4BCQA 3R1SA 4O4EA 5J7BA 3ZLSA 5CEKA 3U55A 2OKRA 4O7NA 4GW8A 4L42A 2YDKA 1CMKE 3BIZA 3ZRLA 3PJ1A 4AN9A 4E5BA 3C5UA 3EQCA 5JGDA 2GNLA 3ZDUA 3GQIA 2QOLA 1HOWA 4TRLA 4R5YA 1H25A 2XALA 3COKA 4RZWA 5I9ZA 2OGVA 1QPDA 3MVLA 4MWIA 4CT2A 2ZVAA 2ITZA 1OGYA 4O84A 5FTGA 3T3VA 1Q3WA 5ETAA 3BLQA 5DOSA 2LAVA 3TNPC 5HTIA 5JZJA 3FLQA 5FXQA 3POZA 5D9HA 3R9DA 2RF9A 2WQNA 3BU5A 4I20A 4O0UA 3RBWA 3N4UA 2B0QA 3D5XA 4IZAA 4NCTA 4DGMA 5T3QA 3H9OA 4BIBA 2YJRA 5M08A 4NIFB 3EQPA 4U5JA 4OR5A 3N4VA 2OG8A 4A9SA 5M4FA 4WNKA 3K5UA 4IE9A 4AZSA 4RWIA 1ZOEA 2XP2A 4PDPA 5JEBA 2PHKA 4RJ6A 2HXQA 4OAVB 3F7ZA 3Q6WA 2XJ1A 1U59A 3U4UA 4C4EA 4AG8A 3UOJA 3KVWA 3OY1A 2VTMA 4ZAUA 2XEYA 3VBWA 4KIPA 3DKCA 5DHJA 3KREA 2WMBA 2YLEA 4W4XA 3KU2A 4XRLA 4AACA 5I9YA 1ZMVA 2BPMA 1R0PA 3BV2A 1PXIA 2C4GA 1OPLA 4FMQA 3WE8A 4ZSGA 3PZHA 2RSVA 4A9TA 4X7QA 5FBOA 4CT1A 2B9IA 3L9LA 3UC4A 1UNGA 5L3AA 4BYJA 3IECA 3P1AA 2WOUA 3FLSA 4TZRA 3VWAA 2XYUA 3OWLA 4X3FC 2B7AA 5DBXA 2JBOA 2X81A 3R6XA 4DGOA 3MY5A 5GJGA 5BX0A 4C36A 2PUNA 2PVFA 2WFYA 2C5YA 4OW8A 4DEEA 4IWOA 2HENA 4I6QA 4C35A 5BUJA 2R3RA 5J7HA 2UW6A 4QQTA 2OLCA 2C1AA 1M14A 3E8NA 4FTJA 5CSHA 4PRJA 3BYOA 3MPTA 5KE0A 1TKIA 4P7EA 4JMQA 2W9ZB 4ZY6A 4LMNA 3OOGA 3OTVA 4YNOA 3RPRA 4HYIA 1PHKA 3REPA 4TXCA 4YLJA 3HV7A 2X9EA 2G01A 3RVGA 3CY3A 3W33A 4AZVA 4S2ZA 4LOQA 5DYJA 5LXMA 5HLPA 2WMAA 4UB7A 3FXZA 4EH8A 4UMRA 4P2KA 4NFNA 4JBQA 2JIIA 4ZK5A 5IQGA 2W1IA 3MI9A 1K9AA 3VHKA 5CZIA 3V3VA 3VS5A 4EQUA 2ETMA 3IG7A 3ZONA 4TYHB 1O9UA 1BUHA 4O38A 2JKKA 5KUPA 2YLFA 3SC1A 2XAOA 1Q8WA 5G6VA 1W2DA 4X3FA 3ELJA 4CKRA 4QDVA 4M13A 3BV3A 4LL5A 5JFWA 3LZBA 4AW1A 4PY1A 1H00A 4HCUA 2VWVA 1Q3DA 2R64A 2AC5A 4L7FA 3EN6A 4YBKA 1JKKA 4YPDA 4U7ZA 5DR6A 4EH7A 4EH6A 2F9GA 1LR4A 5JZNA 4IM0A 2JDSA 1WBWA 2XYNA 4L8MA 4QP8A 5HGIA 5EM7A 3A61A 3KMMA 4U79A 2WEIA 3KRLA 5ACBC 5IEYA 5CXHA 4F7NA 5HE2A 2PVYA 4K2RA 3DKGA 5IA3A 5L6OA 5AUUA 3PRFA 3TZ7A 2XNOA 1PXPA 1VJYA 3NIZA 4HVDA 3W1FA 3FBVA 3NIEA 5BPYA 4E4LA 1GIHA 2F7XE 5IQBA 1Q24A 4EBVA 1ZOHA 2VTIA 3EFKA 4MUQA 4QMNA 4LRMA 5M07A 3WF5A 1KE7A 1PKGA 4A4OA 3Q9WA 4B99A 2PE1A 2IEWA 2CDZA 1IAHA 3MH0A 5AWMA 4AP7A 1G8AA 4Q2AA 2Z7LA 4DBNA 2YEXA 4BKJA 4FIGA 4HW7A 3HA8A 4JQ7A 2ZB0A 5AUTA 5H3QA 4C37A 4X0MA 2W0JA 4KABA 2C6DA 3VUMA 3WBLA 4HVGA 3MY0A 4QMQA 4FF8A 4Y83A 2W4OA 3ITZA 4UMUA 4BDHA 4AW5A 1TVOA 1TQPA 4B9DA 2ITOA 4M0ZA 3WYYA 4PNKA 3IW4A 3MTLA 4PDSA 3TKUA 4MH7A 3DBEA 4YZDA 4MBIA 4IIRA 1W7HA 4EH9A 4GK3A 4BDEA 3NNWA 3NUUA 3DJ6A 4TN6A 3O7LB 5KMJA 4DT8A 3JVRA 2GTMA 1P5EA 1QCFA 2LGCA 4S33A 4AA0A 2IVVA 3R8MA 3O5AA 4RZVA 2IVSA 3DDQA 1GZ8A 3FQHA 4P5ZA 1Y8GA 3ZU7A 3CGOA 2PWLA 4Z9LA 2RFDA 2V55A 2PYWA 3LXNA 3ATSA 1RW8A 4F1OA 3PWDA 3PVWA 5T68A 4OTDA 3SXSA 3OY3A 2CN5A 1PXJA 2ZFYA 3C50A 3D5WA 2BRBA 3DNDA 4K18A 1K3AA 4FV8A 4E4MA 3PPKA 4PP9A 3W8QA 4ZMEA 5CAOA 2BVAA 4DH8A 2QHMA 4HGTA 3KVXA 4X21A 4ZJVA 2O5KA 4TT7A 3HV6A 1H07A 3T3UA 3I1AA 5IU2A 3VBVA 3CD8A 4F6SA 3R02A 3W2OA 3RAIA 2I0HA 4QP7A 4ZLOA 3RCDA 5LMKA 2YZAA 3HRFA 4H3QA 4IZ7A 4QTCA 4GG7A 4HVSA 3TM0A 3A8WA 1Q5KA 4X2KA 2XK9A 1LEWA 3AT4A 2W5BA 3QQHA 3R01A 5E91A 5HTCA 5IH5A 2WTDA 4A9RA 4RJ3A 2OICA 1UWHA 1XH5A 2PVMA 4JLCA 5E1SA 3EQDA 3GNIB 3MA3A 4FIIA 4JQEA 1V0PA 4TYEA 4XG6A 4YZBA 3ZH8A 5L2TA 3ZEPA 4CFFA 3BWFA 1SVEA 2WEVA 2YCRA 4MD9E 3W8LA 3ZLYA 3NUYA 2R0UA 5J9LA 2WTIA 3COHA 3MJ1A 3R63A 4I5MA 4ZXTA 2E9VA 2XNBA 3EYGA 3MH3A 4UWCA 4HYUA 2ITTA 2YABA 3OWJA 2B9HA 2C3IB 3F3VA 5CU6A 3NFFB 3QTRA 3PE1A 2QO2A 3PY1A 3AKKA 4JXFA 1A06A 3C51A 3FUPA 4CMTA 2UW3A 3A7GA 3O50A 4LRJA 1LP4A 4BIDA 4XOYA 2WELA 3KMWA 4QYFA 1P4FA 4J98A 2XRUA 4D1XA 3RZBA 5EOLA 5CEQA 4PMTA 2VD5A 2X8IA 3AT2A 2RG6A 2CNQA 1OI9A 1BI8A 2CGXA 3DS6A 4O7WA 4M69B 4MXZA 3CIKA 4FTMA 4NU1A 1XKKA 4I41A 3VQHA 3NUAA 5BVNA 4CEGA 5I3OA 3RPYA 2OK1A 3KFAA 4MCVA 5EHLA 4R1VA 3OZ6A 3SRVA 5HVJA 4RX7A 4NFMA 4TYIA 1KE9A 1H4LA 5EQEA 5IUIA 2HZNA 4LRKA 1UU3A 3V04A 3EFJA 4FOCA 4KBKA 5AV4A 4IMYA 4EQCA 4I4FA 4GKIA 2BTSA 3DBFA 3ZFMA 4D2RA 2W1FA 4YSJA 3UQGA 3QCXA 3DKFA 5CVFA 5AIRA 3CQWA 3PJ8A 4TNBA 4BBMA 4YURA 2B53A 2ONLC 2YDJA 5KHWA 4BCHA 4FKGA 1OL1A 4ZS0A 3QUPA 2QQ7A 4MF0A 1UV5A 5LVLA 1ZYJA 4WD5A 2IZUA 2WQOA 5F1ZA 2YM8A 5DA3A 2QHNA 4NT4A 2QU6A 3MW1A 4BDFA 1TQIA 4IACA 3THBA 2QO9A 2I0YA 2HW6A 4TWCA 3TG1A 2EB2A 3DK6A 5ANIA 4LYNA 5DN3A 1PMVA 3QRTA 3O17A 3TZ8A 4JR7A 4E5WA 2HWPA 5CS6A 5AUZA 4TYGA 4HJOA 3HDMA 3PXYA 4RWJA 2PULA 3LMHA 1FMOE 2X4ZA 3MFSA 3MS9A 4GYIA 4V04A 4LOPA 5HIDA 2DUVA 4DITA 3NYOA 3FY0A 2J5FA 4O1OA 3VBQA 1M7NA 3JPVA 4YZMA 1AQ1A 2FYSA 3CJGA 1IEPA 1P2AA 3NNUA 3UNZA 1JWHA 2XNPA 1MQ4A 4EOKA 2CJMA 3DV3A 2EXEA 2OJJA 4TYJA 1H1RA 3OEZA 4LV5A 4QMPA 5JQ5A 2JBPA 3DBQA 4GJ3A 3U51A 4J52A 3NPCA 3C4WA 4I24A 2G2FA 4ZY4A 1XH9A 4KS8A 4PL5A 4AU8A 2VX3A 4LQMA 5GHVA 5IEVA 2XNNA 2R3QA 4W9XA 2IZTA 4U3YA 3DB8A 1QPJA 4R77A 4M68A 4F99A 4UMPA 3CTJA 3OHTA 3EOCA 5KZIA 3QA0A 3QWJA 3EL7A 3PP0A 4YHJA 2J0JA 4MNEB 5HVKA 2B9JA 3FV8A 4G5JA 2WTJA 4YLKA 4KD1A 3LHJA 3QTIA 3SW4A 3A7IA 5TF9A 2DQ7X 2WGJA 2WTVA 2W17A 5HG5A 2XARA 2XCKA 3ORNA 2QG7A 2UUEA 5IUHA 5CTPA 4XS2A 4FEUA 3RNIA 1YXVA 4JNWA 4BCKA 1OKZA 3UVQA 4BN1A 3R71A 4ZLZA 2WQMA 3R28A 5CYIA 3TZMA 4BB4A 2XH5A 1Y57A 1PYEA 3TKIA 2W1GA 5LVNA 3JXWA 1X8BA 3QTXA 3IONA 4CD0A 1M52A 3DU8A 5AP7A 4ZSJA 3TJCA 5CI7A 1JPAA 5EOBA 4LUDA 4OBOA 5HBJA 1U5QA 4LUEA 4JDKA 3RAHA 3WF8A 4EK6A 3V6RA 4DG0E 3PSDA 2NP8A 3NUNA 1SNXA 4E93A 3OCTA 4EC9A 4EZ5A 4YTCA 3VBXA 2VWZA 4NM0A 3O23A 4WNPA 4ZTSA 3VF8A 3L9NA 3DAJA 4CRLA 1URWA 4FSTA 3GCQA 3KIOC 3Q3BA 3QZHA 4LV8A 3BLAA 3PXZA 4O7VA 1HCLA 2WMWA 3LW0A 4FKLA 4QTEA 5L2IA 3IW7A 4D2PA 4DFNA 1H0VA 1AD5A 1R78A 4IJ9A 3RK7A 1PMNA 5KKRC 5J1WA 4YPSA 3JY0A 4G34A 3BBTB 1M2RA 1YI3A 2HCKA 2QI8A 3CP9A 3V5LA 3E7OA 4M15A 2WTKB 3U9NA 4OTFA 4OTHA 2XIXA 3ACKA 3QCSA 3AXWA 4QMUA 3EIDA 4G17A 4L68A 4CGAA 4WSQA 2GU8A 1P14A 4BBFA 3GU7A 3B2TA 3UO5A 3FMMA 3QFVA 4QMMA 5EM8A 4UMTA 4UALA 3QCQA 3KXHA 5E7RA 2VWBA 1W82A 5HG8A 4DFUA 3D7ZA 2HZ4A 3RM6A 4I0TA 2NYAA 4JDIA 4CYJA 1RE8A 2OBJA 4YUQA 4FSUA 2C1BA 4HGEA 2CKEA 4OUCA 5KO1A 2UW0A 3I6WA 4FTQA 4O2ZA 4M97A 3EYHA 4BI2A 2VTNA 2EXCX 4XG7A 4M67A 4WBBB 1H08A 5J95A 4OT5A 4B0GA 4BFMA 2BAJA 2X0GA 5EDPA 3R9HA 3IPHA 3TCPA 3FYKX 4EBWA 1BX6A 2OI4X 3OTUA 4Y46A 3ZRMA 4F65A 4RGJA 5HIEA 2QLQA 4C4JA 2R5TA 4XCUA 5KBRA 3HNGA 4AGWA 4FT7A 4E5AX 4CLJA 2AQXA 5K9IA 2J6MA 3F9NA 5KMKA 2J90A 5CSXA 4CFVA 1SYKA 3R1YA 5EYCA 5I9VA 3RM7A 2C30A 5FTOA 5L4QA 3CPCA 3EFWA 2C0IA 3ORMA 3D15A 3EMGA 2XVDA 3MN3A 3VHEA 4F4PA 2OIBA 4F9CA 2OO8X 1W0XC 3JR1A 2YFXA 2YIXA 4G9CA 4O4CA 4EYJA 1R1WA 2XF0A 4QOXA 4LV7A 4BGGA 3TKHA 5KBQA 3CS9A 5BV3A 3FKOA 5HCYA 3R8PA 4IM2A 2ERKA 4IAFA 3EB0A 4QMSA 5AUXA 2BKKA 1OUYA 4CKIA 4HCTA 4BDAA 4BYIA 3DT1A 5IH6A 4LL0A 4QT1A 2ITVA 2PVKA 3LJ0A 2ZMCA 3C4FA 3DQWA 1GAGA 5HNBA 4R78A 3KF4A 4RSSA 2OW3A 3GCUA 3RMFA 5M4IA 3NUXA 3UNJA 1YW2A 2OFVA 1CKPA 4EH5A 4AZTA 4EONA 4X3FB 4KSQA 1YHVA 2HY81 1VYZA 3E7VA 3DTCA 3RKBA 3TL8A 4CFMA 4TY1A 4DH3A 4EOLA 4ZTMA 3P08A 3V01A 4LM5A 4JBOA 5AV0A 5BVDA 3KXNA 4ZSAA 4AXDA 2W4JA 2PY3A 3LFQA 5IKWA 1CKJA 1WMKA 3L8XA 3OMVA 4IB3A 4IX5A 4CMOA 4YJRA 4F9BA 3TMOA 2WMXA 4MX9A 3FEGA 2XUUA 4XG4A 1GY3A 5CSVA 3QYZA 2I7QA 2QURA 5HORA 5DR9A 2PZRA 2C69A 3PXQA 1Z9XA 3HMNA 4IDVA 2BRNA 1ZY5A 5ETIA 3KF7A 4ZJJA 5EK7A 4FI1A 5IISA 4WRGA 2XZSA 1H26A 1OPKA 2VTLA 3OCSA 4QP9A 5C26A 2ZOQA 4O7RA 3AC3A 2FA2A 5CU2A 2OXDA 5ETFA 3LLAA 4K8AA 1KWPA 1QPEA 3BU6A 3HP2A 3UO4A 3KEXA 2Y4PA 3UDTA 2UW9A 4FV7A 3P5KA 5I0BA 2J5EA 1JSVA 2JDVA 3QRUA 4P90A 5AR7A 5KHXA 3VW8A 5AV2A 4F7SA 2J4ZA 1Y6BA 3TTIA 3E8DA 4QTDA 5BYLA 3A7FA 1ZMUA 2PTKA 4ZTHA 4MQ2A 2W4KA 4YHTA 3DFCB 1L8TA 4NJDA 3GU8A 4RQVA 4EOIA 5M4CA 1GNGA 3R21A 4FR4A 3AKLA 1YWNA 5CU4A 4BCJA 4EJ7A 1IRKA 5EW9A 3ZZEA 3KGAA 4GFMA 3ZSGA 3OC1A 4AT3A 4LFIA 3C4EA 3AMAA 2VO3A 3MGYA 2AUHA 3EN4A 4IANA 4J1RA 4JJRA 2YACA 4QMYA 4FSZA 3F5XA 3GBZA 3CTQA 3WE4A 2NRUA 3ZCLA 2BRGA 1WAKA 2VNYA 4MXXA 4PMPA 5CF6A 1OL7A 2QD9A 5AR3A 4O0WA 4ALUA 3CJFA 3TUDA 1J1CA 2IW9A 1MQBA 1B38A 1NVRA 2ZAZA 4FZ7A 1YDTE 3QWKA 4FZFB 4DA5A 4AN2A 1P4OA 3PVUA 4R7HA 3E5AA 5GINE 1OVEA 2YERA 4GL9A 4W4WA 4O91A 5E8SA 3EQGA 2PPQA 2VAGA 3MSSA 2BZHB 4MNFA 5L6PA 4JR3A 3IGGA 3ENHA 3F5UA 4H36A 4QTAA 3NYXA 2CCHA 4HYSA 4I21A 4II5A 5IMEA 3UOKA 1AGWA 4D2SA 2W96B 1OIUA 3WF6A 3ETAA 1V0OA 1M17A 4FKTA 1PXNA 4FZ6A 4IFGA 3VAPA 3ZBFA 3PUPA 3B8QA 3QLGA 1M2PA 2GNJA 2XS0A 3B2WA 4S32A 3TACA 3ZC5A 2JDTA 2R0IA 3M42A 5AAGA 2GDOA 5A4LA 4O4BB 4TPTA 3R8VA 4KNBA 2NRYA 3UNKA 3UIXA 2GHMA 4KRDA 4AGUA 1IA9A 4IHPA 3HX4A 2G2HA 4WSYA 3O0GA 4GEOA 2W06A 3QTSA 4ALWA 1ERKA 3KQ7A 4FKJA 3E64A 4MXYA 1V1KA 2FSMX 4PX6A 4W8DA 4WOVA 1OKYA 3R7YA 2A19B 4PMMA 4BWPA 4CNHA 3R1NA 4CQEA 3FMHA 4GIIA 4X6RA 4DHFA 4MWHA 4FSMA 2XM8A 4ZTQA 3UMWA 4BCMA 5E9EA 2XK7A 4U6RA 1OIQA 2HYYA 2WTKC 3DLSA 4UWYA 3KXMA 5FEEA 5GJDA 3WIKA 4AXAA 4BI0A 1APME 2XNGA 1ZZLA 4WUAA 3RWPA 1KOBA 3LFFA 1YHSA 3BYVA 2W1ZA 4C57A 5JT2A 1YXTA 4QPSA 4FNXA 4O86A 3KXZA 2IPXA 4NCTC 2YWVA 2C6OA 5EG3A 4C4IA 1ZY4A 2O0UA 4DINA 4EI4A 5HNIX 3HUCA 3QC9A 4QPMA 4ANSA 2YCSA 2ZJWA 2GHLA 3GCVA 4G6OA 5J9YA 1Q8TA 3MWUA 1IR3A 4L3PA 1YVJA 1GZNA 2OH0E 4XLVA 1XH6A 2QKRA 2ZV9A 4J8NA 3UZPA 4WO5A 2A1AB 1UA2A 2VNWA 5A3XA 2DWBA 2CLQA 2WD1A 4FOBA 4R8QA 4IC8A 5I9UA 3CKXA 2G1TA 4J96A 5ITAA 4IWDA 5JQ8A 3S00A 1KSWA 4XRJA 5GZAA 3SQQA 2VTRA 4XOZA 4CLIA 3LFNA 3SRVB 4MHAA 5BYYA 1SVHA 5E8ZA 3RPSA 5M06A 2KTYA 3DK3A 3MDYA 5EFQA 1NY3A 4UEUA 3LXKA 4AW0A 1ZYLA 1FGIA 3ET7A 1SM2A 3KK9A 2R3GA 5CF4A 4FK6A 4IFCA 2J0IA 4PP7A 3OT3A 3EQHA 4GFOA 4BCPA 2BR1A 4L52A 2CNVA 2X39A 2UVXA 3R8UA 2C6IA 1BYGA 4M7IA 5AA8A 2I40A 3WYXA 4DG3E 4NSTA 3O51A 2GMXA 4X3JA 3FSKA 2F7ZE 4F0GA 4ACHA 2OXXA 4JX3A 5B7VA 4C8BA 3PVGA 5DGZA 3ORLA 4MBJA 2JITA 2R3JA 2WMQA 3ZM4A 3HVCA 3ORZA 5GIOE 1H1SA 4RWKA 2VWIA 3ZO2A 1YKRA 3OBJA 3L8VA 4FNWA 3TJDA 1KUTA 5C9CA 3R8LA 3I60A 4R3CA 4X2GA 5CU3A 3LJ2A 3LM5A 3QAME 4QMWA 3Q2JA 5AM6A 3GUBA 5HD4A 2BZKB 4D58A 3KB7A 3UDBA 3ZO3A 4FUXA 4FL3A 4S31A 3BYUA 5D10A 4IM3A 5HESA 3P0MA 4I4EA 3FAAA 4KKHA 2Q83A 2FGIA 3C5IA 4GS6A 4P4CA 4PTCA 2ZDTA 3P79A 5JSMA 1UKIA 3OWKA 4KSPA 4KS7A 4FZDB 5FP6A 5A14A 3L1SA 2VV9A 3EQRA 2PVJA 4O81A 1J7UA 3RPOA 5CEPA 3R7VA 1BI7A 3ZLXA 4RWLA 2YISA 3KN5A 3ULZA 4GCJA 5CEIA 4OBQA 5KMIA 4J99A 3PXRA 2J51A 4OT6A 2EXMA 4BDIA 3GOKA 5EI2A 3UIMA 2QKWB 1WBTA 5BMSA 3SXFA 3LIJA 2ACXA 4N57A 3WZDA 4BJJA 3FWQA 3KMUA 3LFAA 1XMMA 4TTHB 4Y8DA 5I4NA 2B9FA 2VTPA 3D83A 4XEYA 4RLKA 4H39A 4M3QA 4DEGA 3DQXA 2Q0BA 5FRIA 2VTTA 3QQKA 2JGZA 3WARA 1CTPE 4HGLA 5E1EA 4B4LA 3U6IA 3E8CA 4FA2A 5A4TA 2PVLA 4FJVA 4S30A 2C0TA 5BUEA 4F78A 4EJNA 2IN6A 1UKHA 5JFVA 2VX0A 5AUWA 3BEAA 3C0GA 3HYHA 3FMJA 2WPAA 2XNMA 4YJNA 2A2AA 4FGBA 4FTAA 4BGQA 5M09A 4L3LA 3I5NA 3IKAA 4IWPA 3ERKA 4U43A 5HX6A 4NM7A 3OG7A 3DJ7A 3Q4UA 4WNOA 3W2SA 3JVSA 3MY1A 2E9OA 5L2WA 3CXWA 4QYHA 1G3NA 4EQMA 4XMOA 2Y6MA 4FIJA 4GRBA 3FMDA 1J7IA 4U3ZA 2ESMA 4Q9ZA 4AT4A 3V5TA 3UQCA 2VGOA 3K5VA 4RC3A 4EHEA 2VTJA 2UW7A 4I0RA 5LJJA 1OGUA 2PU8A 4PL3A 4E6QA 5ICPA 3E63A 3F7WA 4ACDA 3AKJA 5LQFA 2PUIA 2Q0NA 4GKHA 1BMKA 3I7BA 4DGLC 3PPZA 2Z02A 3MIYA 3OVVA 1SZMA 2ETKA 3E88A 1KV1A 3V51A 5EI8A 3UP2A 4FTIA 4BDJA 4U81A 4BTJA 1H0WA 4UV0A 1ZMWA 2PZYA 3RHKA 4DC2A 5A46A 3TZ9A 3QQFA 2XKDA 3LLTA 2P0CA 3G5DA 3E3PA 4FBXA 1H1WA 1CSNA 5GZ9A 3RGFA 3VS0A 1XQZA 4ANQA 4CCUA 1JNKA 3TV6A 2O8YA 3BL7A 4AAYA 4CG9A 2GS7A 4FV5A 2P4IA 5EHOA 3BHUA 3UVRA 4V01A 2VUWA 4NH1A 4FV4A 2DYLA 4NKSA 3TV7A 4ZY5A 5A6NA 4G9RA 4F6UA 3Q5ZA 4O0SA 3F2RA 2HXLA 4AQCA 3GP0A 1XMLA 3LE6A 2BFYA 3QTWA 4AAAA 4IVCA 5J5SA 3QUDA 3ENMA 3VS6A 2CMWA 5E8UA 1TQMA 5CQWA 5LMKC 3D9VA 2GQSA 4I3ZA 2PUUA 5LMAA 4IAAA 2JLDA 2C6MA 2QOIA 4FODA 3TXOA 3DPKA 4U44A 2IW6A 5IA1A 2E9NA 3I0QA 2CKOA 2ITWA 3LOKA 1Q41A 1IA8A 3UPXA 4DYMA 4F09A 4I5PA 5HO6A 5KMMA 4GVAA 5HBEA 4FEQA 4XP0A 3LAUA 3A60A 3W18A 3EWHA 5KKRB 2R3HA 4BR3A 2I0EA 4ITIA 5HG7A 5T6KA 4IW0A 5E92A 2UW5A 3FMKA 1ATPE 3Q4ZA 3ROYA 4DN5A 3LFEA 5FDPA 3VVHA 3ZXTA 4RIXA 4F70A 1ZWSA 4FVPA 5I5ZA 4EKLA 4EL9A 5E8XA 5K3YA 2R3IA 3MVHA 1WZYA 2PUPA 4IEBA 4D4YA 4ANMA 5AFVA 1H1QA 2KULA 2ZMDA 3R7OA 3EQIA 4WBOA 3UZTA 1GZKA 1PMUA 4ERKA 4I5CA 3VUTA 1Q61A 4I94A 4KKGA 4W9WA 4WA9A 4F0FA 4AXEA 5CNNA 1J91A 1Q8ZA 2SRCA 2VTAA 4AW2A 1WBOA 2Z7SA 4C61A 3Q04A 4KKEA 2BFXA 4K33A 2NO3A 3V5QA 3ZHPC 2A4LA 4FL2A 2P2IA 4ASDA 4ZSLA 4OTGA 4E6AA 4MD8E 2IVUA 3E8EA 3A62A 4D5HA 1WBPA 1ZLTA 2BAKA 4ANBA 3W16A 3ANRA 3E87A 3VS1A 5C8KA 5IPJA 2R3PA 3MFTA 2GTNA 5D11A 3QRJA 4EOPA 3NWWA 3O71A 5K4IA 4OLIA 5DPVA 3PA3A 2W9FB 4E4XA 4UN0C 3S4QA 3S1HA 4DEIA 5IQCA 3EHAA 3KXXA 3GXLA 1VEBA 2REIA 4YSMA 5EI6A 5DWRA 4MVFA 2HK5A 3E93A 5HE0A 3P7BA 5BMMA 2JKQA 2QVSE 1YI4A 3BYSA 3VS7A 4FV0A 3TT0A 4I6LA 4M12A 5JRSA 4CQGA 4DGGA 4FSRA 2FSTX 4LOOA 2Y9QA 3QXOA 2A0CX 3Q4TA 4F7JA 3P9JA 2QC6A 3NDMA 5B0XA 4IB5A 3RAWA 2H8HA 5B2MA 3R04A 3IW5A 4ITJA 4GFGA 1OB3A 3P23A 4RX9A 2C6KA 1JQHA 3VUDA 5D7VA 4AOTA 1DM2A 2XK4A 3BHYA 3IQ7A 3R7GA 4IDTA 4KB8A 5FD2A 4F0IA 3NYNA 3LVPA 1ZAOA 2XIYA 4O0RA 5D1JA 5CAUA 1WVXA 3ANQA 4I5HA 5AP3A 2BDWA 2W1EA 4E20A 1PXOA 2GCDA 4GVJA 4BZOA 4F64A 5AR2A 3ZLWA 4FG9A 4J97A 4FKWA 4MF1A 3SA0A 5IUGA 4XG2A 3MJ2A 3HGKA 5DH3A 4JT3A 5DVRA 4MD7E 5TO8A 2VWUA 3D94A 2GPHA 4ASXA 4BF2A 3RP9A 3C13A 3CQUA 3TDWA 2VGPA 3DKOA 4U45A 4A9YA 4BDDA 3EKNA 3EKKA 2C6LA 5H8GA 1URCA 2YAKA 2UVYA 1FVTA 1WCCA 4FIEA 2X8EA 4QYEA 3PXKA