2PZ5A

Crystal structure of fgf receptor 2 (fgfr2) kinase domain harboring the pathogenic n549t mutation responsible for pfeiffer syndrome
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
299
structure length
280
Chain Sequence
LPEDPKWEFPRDKLTLGKPLQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIITLLGACTQDGPLYVIVEYASKGNLREYLRARRPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Fibroblast growth factor receptor 2
publication title A molecular brake in the kinase hinge region regulates the activity of receptor tyrosine kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 280
sequence length 299
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pz5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pz5A01
5HCYA 3QTRA 2C6OA 4PPBA 4XLIA 3C7QA 4FL3A 5AR7A 1U54A 1ZZLA 4MNEB 4LGHA 3UO6A 3P4KA 1IRKA 4O0SA 4MCVA 4DEDA 3GC9A 3LCSA 3BU3A 4ZTMA 4KNBA 2GTMA 4YJSA 4U45A 4GYGA 5ITAA 5IQHA 2SRCA 3VW6A 2PHKA 3QTUA 4Q5HA 1OITA 4GT5A 4BCNA 5AEPA 4WRGA 5TO8A 4A9SA 3VN9A 3VJOA 4IADA 3E3PA 4X3FA 5FM3A 2WHBA 4YJPA 3F7WA 3O8PA 2FYSA 2WPAA 3T9TA 4O0UA 4GVAA 4QMTA 2VNYA 2P4IA 5I3OA 3NUNA 3BV2A 3LFEA 4GL9A 4M12A 4IIRA 2UZDA 4K1BA 1PHKA 4F9AA 1W82A 4NYEA 5IG1A 4CGAA 2YCSA 5ANEA 3HNGA 3KN6A 5IQAA 3NYXA 5EW8A 3SLSA 5CSXA 3SQQA 4YLLA 5AR8A 4K0YA 5F9EA 4WOVA 4GYIA 4FV9A 3S1HA 4KKHA 3NNVA 3HYHA 4NUSA 2AC5A 4RJ7A 5IPJA 1GAGA 5HKMA 2JGZA 3HEGA 2PMLX 5J87A 3S3IA 3ZOSA 3HX4A 4GFOA 3BHUA 4AT4A 2IWIA 3KCFA 4EHZA 1H1RA 3G5DA 1KE8A 1UWHA 3F3ZA 5HG5A 5CEMA 2YWPA 4EJ7A 2B53A 4BCKA 5ANDA 2FSTX 4DH5A 1BKXA 4O2ZA 5HIDA 2GNLA 2XIKA 2WMUA 3QQFA 4PF4A 3BX5A 4D9UA 5A3XA 4YTIA 2CGUA 4RWJA 3D2KA 4EJNA 4MF0A 2X8EA 3KU2A 3P23A 4U0IA 3PFQA 4A4OA 2C30A 3H9OA 1UU9A 4AAAA 3L8SA 5IU2A 3Q3BA 2B54A 2OW3A 3OCBA 4LMNA 4QPMA 4RWKA 5F1ZA 4GT3A 1WZYA 4OTDA 2BROA 2Y6OA 2QLUA 3DA6A 3HV7A 1Q97A 2CN8A 3OCGA 3ZYAA 1SM2A 5AR4A 2YCRA 3SX9A 1OIQA 4QPAA 4G6NA 4O38A 3HAVA 5FDXA 2WMRA 5C26A 1SNXA 3SXSA 1QPDA 3QGYA 2GU8A 4OGRA 4RQVA 3NCGA 4UYAA 4WRSA 1YOJA 2HENA 3RAWA 4FT0A 1FVRA 1R78A 3QKKA 3QRTA 1QCFA 1K9AA 5CT0A 5CS6A 2NNWB 4O22A 4ZY4A 1KV1A 3A8XA 2ZV8A 3ZHPC 5CU0A 4YUQA 3R1YA 4ITIA 4LG4A 4NM3A 3CGFA 4FTLA 4RJ8A 5DBXA 3ZO1A 3LE6A 4BBFA 3GI3A 5C8MA 3TACA 1Y6BA 4RVKA 5BMSA 2JDSA 3ZM9A 2W1DA 3QHRA 3CEKA 5HNIX 1UWJA 4LRKA 2Q0BA 5IA4A 1ZXEA 2QI8A 3FLSA 3LFNA 4RRVA 4KB8A 4ANQA 4OAUC 1A48A 3W8LA 2J2IB 2ZM3A 3FQHA 3A8WA 3NYVA 2ITYA 3TUBA 1SZMA 3EKKA 1TQIA 3KMMA 2VO7A 5D7AA 2BIYA 2UUEA 3C9WA 3R1NA 4MK0A 3QCQA 1FVTA 2VTHA 5JZJA 2VD5A 2OIBA 2YLFA 4BTFA 4S2ZA 3B8RA 4NW6A 4IDVA 3ODYX 4MQ1A 4FEUA 3KFAA 2QHNA 2CJMA 1OKVA 4B8MA 4CVAA 2OWBA 3SAYA 1YXSA 4MXXA 5A4CA 3NUAA 3V51A 5CSHA 5C1QB 4KBCA 1KUTA 4GU6A 4X7QA 5ANOA 3QLFA 3EN7A 3KF4A 3O8UA 3UMWA 4JRNA 4YURA 4EK5A 1XH4A 3DNEA 5JFSA 3KVXA 3ZTXA 1PKDA 3RPOA 4O7SA 2X39A 2IZSA 3AC3A 4EOIA 5A4TA 3O96A 2WNTA 4D4RA 5E90A 5KO1A 4PDOA 2ZDUA 2VTIA 5D41A 1CTPE 5H8GA 2BR1A 4FSYA 4D28A 5E7RA 4QMXA 3G6HA 4ZMFA 5L2WA 4C62A 4KIQA 4RIYA 4IAIA 4F6WA 4DA5A 4KAOA 4AG8A 3TNWA 4W9WA 5HTIA 4U3YA 4IVBA 4ACHA 3DOGA 2IVSA 3VW8A 3AMYA 3PJ3A 2BTRA 2VN9A 1H4LA 1LEWA 2OJFE 3CPCA 5FP5A 2B9FA 4L8MA 3R8VA 3OOMA 4HVSA 3QQGA 4M68A 2O2UA 4O1OA 3IW6A 2RL5A 4ZTRA 3KEXA 4KRDA 1Q41A 4OTHA 4JLCA 3E88A 3NR9A 4G5JA 3M11A 4LFIA 4TPTA 2GS6A 4O96A 4E4XA 1G5SA 4ERWA 5CF6A 5GIOE 5BVDA 4C2VA 2Z8CA 4TRLA 3ZBFA 2PMOX 4H3PA 2YWVA 3A7HA 4DEGA 4LOOA 2OIDA 2XNOA 5HBEA 2JEDA 3BE9A 3JS2A 5TOZA 3C4WA 5DVRA 4FEQA 1DI9A 3W55A 2RG5A 3AC2A 3G9LX 5BVNA 2ZV9A 2CMWA 5LARA 4II5A 4Y5QA 3QCYA 3TV4A 2XH5A 3UNZA 4YTCA 3R2YA 1YXTA 4F64A 3QRIA 5M56A 4P4CA 3OG7A 3QA8A 4JR7A 3SRVA 3LFFA 5CI6A 2YLEA 2VO3A 4JI9A 1B38A 3DLZA 4V0GB 3COMA 4XP2A 1Z9XA 3IS5A 3UIBA 3R1SA 3TN8A 1J1BA 2X2MA 3ITZA 4CYIA 1RJBA 2GQGA 2C6EA 4XG7A 5BMMA 3ZSHA 3UG2A 2RF9A 3C4XA 5BVFA 4DLIA 3DKFA 3JR1A 3E64A 4YJQA 3TJDA 3EZRA 4O7NA 1YWNA 5B0XA 1YHSA 3DTWA 5M57A 2LGCA 2FH9A 2RGPA 4FTMA 3HRFA 2X8DA 1YI4A 3LQ3A 4CFFA 4DFUA 5AUYA 3GENA 4IBMA 2NRYA 4D1SA 2C0IA 4MNEA 4QT1A 4F0FA 3VRZA 5F95A 2CCIA 3TEIA 2QNJA 2UZTA 2VX3A 4AGUA 4C58A 4N6ZA 3O2MA 4ASEA 4AU8A 5EW9A 5ANGA 4RLLA 3H0ZA 2XMYA 4WHZA 2WOTA 1DAYA 1H1PA 3Q4ZA 4TXCA 4ZTNA 3WE8A 1RW8A 4I0RA 4E6DA 4AT3A 2B0QA 5L6WL 4D2RA 1UU7A 3KL8A 3KXNA 4CFWA 2GDOA 4FZFB 3RCDA 3PXZA 4HVGA 4EWHA 3OY3A 4BI1A 1Y57A 2CLXA 3R30A 4RWIA 4Z55A 5CXHA 4GUBA 5J95A 4BCIA 3Q52A 2PL0A 2R7IA 3GBZA 5HD4A 3TZ9A 4DFNA 4IMYA 1KOAA 4BCQA 4EYJA 4JAJA 1M17A 2JITA 3MTLA 3O7LD 5M4CA 4BVUA 3RHKA 4CQEA 5HOAA 2F4JA 3I6UA 5ETAA 4F09A 1QPJA 2PVJA 3FMEA 2UZNA 4TTHB 3OXZA 3VS4A 2QOKA 1PW2A 2R0UA 3IECA 2GS7A 2XJ0A 3BV3A 2WQBA 4EHEA 1H27A 1OIUA 4CFNA 3MIYA 5CZIA 4DGMA 2VWZA 4G31A 1S9JA 3F5XA 2XA4A 3RVGA 3I7BA 2C5XA 2RIOA 3MVLA 4I1ZA 4RC4A 4WA9A 3U51A 3BGQA 4BHNA 4LMUA 2VX0A 4YHTA 4ZSLA 3UQCA 2HIWA 4ALUA 1IEPA 3PPZA 2ETRA 2QO9A 3O7LB 3LJ2A 2GCDA 4MXYA 3W8QA 2YERA 3VBQA 3D7TB 5HIBA 3UIMA 4FSQA 2WTJA 2J0MB 3DGKA 3LCTA 4JR3A 2X7FA 1XH9A 4E5WA 3W1FA 2WZJA 4H1JA 4TW9A 3WBLA 4XRLA 4PDSA 4MWIA 2W1GA 4AZFA 2XBAA 4E6AA 2W4OA 4PTCA 1SYKA 2XKCA 4TT7A 3MSSA 3AMAA 5LJJA 4QP7A 1J7IA 3P7CA 4WIHA 1ZYDA 3AXWA 5HNBA 2X6DA 4E5AX 3PSBA 4C37A 2CKOA 4BDEA 4L52A 4G3CA 4FTAA 2PVHA 2R3IA 5GZ9A 1YXUA 4X2NA 3LAUA 1M2PA 4MXZA 5E8SA 2QR7A 4U5JA 2WTCA 4XH6A 2NPQA 5AR2A 3PWYA 4IC7A 3THBA 4L6QA 4RFYA 4AN2A 4OAVB 4E6QA 2FO0A 4BDHA 2VWXA 3MJ1A 4PWNA 4QMVA 3TV7A 2C68A 2WOUA 4NW5A 4U9AA 4FSMA 3SW4A 2VWBA 4PL3A 4UZHA 4YC6A 2BTSA 4RA5A 2OIQA 3FHIA 4JXFA 4F7JA 4YR8A 3EQGA 4I41A 4O83A 3DJ6A 3TUDA 4L9IA 3QQJA 4O1PA 3T8OA 4BCOA 5LVOA 4ALWA 4CKJA 1YHWA 4JT3A 1UV5A 5HX8A 4QYHA 3U9CA 3G2FA 3VQHA 4ANMA 2W0JA 1Q8YA 4FV6A 4G6LA 2ITOA 4YO6A 5EOLA 4F99A 4IW0A 2GMXA 3QX2A 3SA0A 4ZY5A 3W33A 5J9ZA 3ATSA 3FXZA 4IZ7A 1ZZ2A 3V6SA 3PTGA 3FZSA 2H8HA 4HGLA 5I9XA 4OTPA 5ANIA 4IACA 4XOZA 4D5KA 5HI2A 5E92A 1OBDA 4HOKA 2BAJA 4M69B 2W5AA 4F9BA 5IH4A 2VTRA 3NS9A 3QD0A 4UWYA 4UZDA 5HESA 2OG8A 5D1JA 3V8TA 5H8BA 3RCJA 2V62A 3W18A 2QOCA 4XX9A 5KE0A 2VTPA 3KK9A 4S30A 3UVQA 2XK3A 3EHAA 4G3FA 3IKAA 4FKGA 5A54A 5KMNA 4MNFA 2QOFA 3CTJA 3L9PA 4QMQA 3OROA 3PIXA 4FK3A 4LGDA 3BQCA 4E6CA 5L2SA 3ORIA 4PV0A 5FEEA 3R0TA 2CKQA 1YXVA 3LFAA 5E8WA 4WSYA 2UZLA 3PE2A 3FDNA 2UVZA 3IPHA 5JGAA 3KXHA 3PDTA 4GH2A 3RWPA 4R5SA 3C50A 4O81A 3W32A 4I21A 5L6PA 3FMMA 3PY3A 4FZAB 2VX1A 1H26A 4PQNA 2WTVA 1Q8TA 3MVHA 4ACMA 3EKNA 4BI2A 1TKIA 1CM8A 4DINA 3E5AA 3C4FA 3PZHA 3ZEPA 2C5VA 3LFCA 3MV5A 3FC1X 2WKMA 4IB0A 4J8NA 3HGKA 4YO4A 4ORKA 4GV1A 5HE1A 3K3IA 4FTUA 5LCKA 4MD9E 2YIQA 3WF8A 3UC3A 3D5XA 4PPCA 1OUYA 2GQSA 1LEZA 1IAJA 2I0VA 5KNJA 5IQDA 3PLAE 4FA2A 3D5VA 3AOXA 3V5JA 4BIBA 4FV5A 4GFGA 4X2GA 4C33A 3R1QA 4APPA 4E8AA 5B2KA 4FF8A 5DFPA 4BI0A 3KA0A 3NYNA 1O6KA 4V01A 1GY3A 3GQLA 2GHLA 3TV6A 3HUCA 4JNWA 4R7BA 4FKVA 4F7NA 4V0GA 3U4WA 3O51A 2BZHB 3OWKA 4LYNA 4ZS0A 3VS7A 5EQPA 4DGOA 1WBVA 2ZDTA 4FBXA 3F5PA 4AZEA 4DFYA 4EQUA 1X8BA 4AT5A 4EC9A 3OCSA 3BBWA 5A46A 4I24A 3PJ8A 4FKJA 5HD7A 3OFMA 2H6DA 4D9TA 3VHEA 4X2KA 3KXXA 5K3YA 3FPQA 3EFJA 3EIDA 3BYMA 3ANRA 5DIAA 4Y85A 3SDJA 3ZUTA 1OM1A 2XJ2A 2ZV2A 4JX3A 1ZYSA 4QQCA 4KIOA 5TE0A 4K9YA 2JDTA 3D83A 1OL5A 1M52A 2WTWA 2XM9A 4M84A 1JVPP 3C13A 3R28A 4CRLA 4R77A 2W96B 4RFZA 4F63A 3RP9A 1GZNA 3Q96A 3V6RA 4EOKA 2I0EA 5IQGA 3I0OA 4CZYB 3P7AA 3ZRMA 2PZRA 1HCKA 4C4GA 4YU2A 2WTKB 3I1AA 3KRWA 3F61A 3NX8A 5IA2A 5AWMA 2B9HA 2Q0NA 5K0XA 1IA9A 5FTQA 3CY3A 4AGWA 4AFJA 1JAMA 4I23A 1NW1A 1W83A 1IAHA 2ITPA 4EYMA 2PUNA 4Q9SA 4D55A 5JFWA 4GU9A 4FT9A 4CQGA 3PP1A 3MH2A 3L1SA 2R3PA 5C4KA 5AP4A 3FLYA 2OBJA 3HV5A 3SOCA 4ZZNA 4PP7A 2OFUA 4CLJA 1OGUA 2I6LA 4FTQA 5CU2A 3IDPA 5EHOA 5EYDA 4F9YA 1BL7A 2EU9A 4EOOA 4DLJA 4MKCA 2OF4A 4TWCA 4JIAA 3OCTA 5ACKA 1OUKA 4QMOA 2VTMA 4FOCA 4IHPA 5FM2A 5C8NA 1YDSE 4RX9A 3W10A 3RJCA 4RX7A 2C3KA 4G9RA 2IVTA 4XG3A 5GJFA 3R9DA 4A07A 2YDKA 4EOSA 3R7UA 3TNPC 3M1SA 3TNHA 5C03A 2NRUA 1YI3A 5F20A 3Q2MA 2XK7A 3D7TA 3HMPA 3LLAA 3PJCA 4PY1A 3RNIA 4I22A 4FT7A 5KCVA 3ACJA 4A4XA 2AUHA 2UV2A 2VAGA 3HL7A 3VUKA 3ZFYA 5HBJA 4C57A 3OUKA 4YC8A 3ROCA 1PMEA 3HRBA 4FKWA 2A1AB 4NM7A 2G01A 4LUEA 3BYOA 3F3TA 3BYVA 3EN4A 3QYZA 4GMYA 2X0GA 4FL1A 4OR5A 4IM3A 4DH1A 1H01A 2ERZE 2R9SA 5DR2A 3VBWA 4R7IA 2G2FA 3TM0A 4YHJA 1OKZA 2VTLA 2WU6A 3QGWA 4OBQA 2C1BA 4MEDA 3DB8A 2WTKC 4U3ZA 4AOJA 3NUSA 4FX3A 3KRLA 4FV3A 4BCFA 4BIEA 2PVMA 1SVHA 4K33A 5EM6A 5KBRA 4BR3A 4FTKA 3GT8A 3K54A 4LRJA 4UXLA 2XRUA 4CNHA 3AC4A 4L46A 2VO6A 4FC0A 3ORXA 5EYCA 3QQUA 3ORZA 4LL0A 3GU4A 4TZRA 3Q2JA 5AFVA 5L3AA 2BZJA 4O0YA 5JQ8A 2J9MA 2YIYA 3EZVA 2VTTA 1T45A 4AP7A 3ZDIA 4E4MA 5KHXA 4O7ZA 3IK3A 4TN6A 4EOMA 3OUNB 4CG8A 2R3LA 4A9UA 2YHVA 2O64A 3TIYA 4FKTA 4AA5A 2RFNA 3I0QA 4BC6A 4CMUA 1OVEA 4DEBA 3LQ5A 5H9BA 5HTBA 2V5QA 2XP2A 4PRJA 4TYEA 3R7YA 4C8BA 4QYGA 5L8KA 3MYGA 5BQ0A 5KZ0A 4FIGA 3LPBA 2HZ4A 2O65A 5AAFA 3S95A 5LQFA 3EFLA 1I09A 4GRBA 4JRVA 3PY0A 3WZJA 5CASA 2O8YA 1JSVA 1UA2A 5T68A 2HY81 2VV9A 3MDYA 1PMVA 2IVVA 4ENYA 5JQ5A 4X2JA 2A27A 4BICA 4GK4A 3ZLYA 2PU8A 4FVPA 5ICPA 3EQCA 3VS2A 2QKWB 4M69A 2YISA 3PXKA 3QRUA 4ANNA 1YQJA 4GK3A 2GS2A 5IA1A 3QQHA 5HICA 2BDFA 2CHLA 3DAKA 3F2AA 3FZTA 3F3UA 3PA3A 5CVFA 4DEIA 5I9UA 2PVYA 3P5KA 2PSQA 4BIDA 3Q53A 3GC7A 3R7OA 3CPBA 3FSFA 3JXWA 3AT4A 2ZV7A 2J0LA 1KE9A 4IFGA 2XJ1A 4CD0A 4FMQA 2YZLA 4IH8A 4W8DA 4O82A 3DV3A 3HA8A 4FNYA 3QALE 1FINA 4ONAA 4BWXA 4EHVA 1ZMWA 3MH3A 1XH7A 3ORPA 3ULIA 3UZPA 4O86A 3LW0A 2XYUA 4ASDA 2PK9A 4C0TA 3HDNA 3EH9A 3PLSA 2QCSA 4I3ZA 4YP8A 2C5YA 3FLZA 2F2CB 3PVUA 2X7OA 3DXQA 2W17A 1K3AA 4AF3A 3FHRA 2ITXA 5I9VA 4ZSAA 3V5QA 4Z7HA 3QKMA 1TQMA 2PVNA 5M4IA 3F82A 2Z60A 3EQPA 4KINA 2HWPA 4W4YA 3UZTA 3SGCA 5AA8A 3FUPA 4WNKA 3HVCA 4RIXB 3RAKA 2O5KA 3NIZA 3RGFA 2B4SB 3DXPA 5EDPA 5CWZA 5I9YA 4W4VA 4R78A 3F5UA 5IA0A 4D1XA 4FE2A 3LM5A 4JVGA 1RQQA 4IX4A 5ANJA 5IZFA 1JKLA 2Z2WA 5CU3A 4D2PA 4USFA 3UO5A 4FEVA 2XB7A 1XH6A 2W5BA 2OXXA 1QMZA 4BRXA 1SNUA 2QHMA 2UZWE 4IANA 5C4LA 5BVWA 1XHAA 3DDQA 1WBOA 3ZUVA 4DH8A 1IG1A 2C0TA 2PMNX 2BAKA 3C4EA 3R02A 4BDBA 3ZC5A 3ZSGA 3UP2A 2B9JA 4L44A 3ID6C 5EI6A 4MXCA 2VWYA 4AE6A 2O0UA 1J1CA 2ACXA 3MFUA 2YAAA 5IA5A 3KK8A 2ONLC 3ACKA 3BIZA 3H9RA 2GFSA 2ZMDA 3BHHA 4ZLZA 3EL8A 2WGJA 4EOJA 4ZEGA 5HLPA 3HA6A 2E9VA 2C5NA 1WBPA 4WBBB 4ZSJA 2OZOA 4BYIA 2WAJA 3R7GA 4KIKB 4UWCA 4BYJA 2WELA 1FQ1B 4RVLA 4QYYA 2WU7A 5EDQA 3VUMA 2YN8A 4R6VA 3CP9A 5KHWA 5IUIA 3WF7A 3WZEA 3U55A 1CKPA 4RVTA 3E93A 5BNJA 5IMEA 4UYNA 4FVQA 4JAIA 1GZOA 4EOPA 4ARKA 4M8TA 4R8QA 5HO8A 1ZY4A 1KWPA 4O27B 3RAHA 3WIKA 4EZ3A 3FLWA 3AC1A 4M14A 4MH7A 4ZTSA 5CSPA 4A7CA 2HWOA 5H8EA 3FQEA 4HGSA 5D7VA 1P4FA 3PE1A 3CCNA 4ID7A 2W4KA 3VUDA 4FEXA 4L53A 4LOQA 4IB1A 2B9IA 2CDZA 4IM0A 2OJJA 4XP3A 4M13A 4YJVA 4ZIMA 2R3MA 2QQ7A 1GZKA 1L3RE 3QTSA 4OW8A 2IZTA 1VJYA 4PMMA 4YHFA 4O21A 2IVUA 4IX5A 1REJA 5FEDA 3LKMA 4I5HA 3HECA 4JDJA 4L7SA 4UBAA 2BZIB 4O7WA 3UJGA 2Y6MA 5EM8A 4L3JA 5CSVA 1XR1A 1H1WA 3HUBA 4O0XA 2WB8A 4Y8DA 4E1ZA 3F7ZA 2CKPA 4IZAA 3DK3A 3V04A 3AC8A 3ZLXA 4CRSA 4OLIA 3F2NA 2EB2A 2HW7A 4M7IA 5EKOA 3G0EA 2C47A 2XZSA 3WF5A 3IOPA 4BN1A 1Y91A 4GKIA 1J7LA 4GK2A 2C5OA 3NNUA 4BWPA 4EUTA 5HNGA 2G2HA 2UW9A 2J7TA 3BGPA 4RPVA 4UB7A 4O6EA 4YZCA 5E8UA 5JH6A 2GHGA 1Z57A 2EXEA 3VVHA 3MPTA 2W1CA 3WARA 1ZY5A 2R3HA 3LHJA 4HPUE 5DYJA 3QTQA 4PUZA 2X1NA 2J50A 4MTAA 3D2IA 3I6WA 3W2PA 4TYGA 3TXOA 3ORNA 2QODA 3HP2A 3Q5ZA 3CGOA 3DBQA 3R2BA 3EQBA 3FKLA 2ZB0A 5E1EA 5KMJA 5J7HA 2ZJWA 4OT5A 4WG5A 3MW1A 1F0QA 4S31A 2XUUA 3ROYA 3GEQA 3VS1A 4DEAA 3I7CA 3KB7A 4FKOA 4IWPA 5GZAA 3OTVA 3EQFA 3FL5A 1YDTE 4HYIA 5J5SA 2ZVAA 4YZMA 2QONA 4H3BA 2A0CX 4FV1A 3HMMA 4WUAA 5IISA 5GNKA 3IW4A 4DITA 1U5RA 2YZAA 5J9LA 5CQWA 1W84A 3ZFXA 5A4LA 2GFCA 5DR6A 5AM6A 4IDTA 3G15A 3Q5IA 1Q61A 5LXMA 2VTOA 4C34A 1LUFA 3NWWA 4IVCA 5AIRA 4L7FA 2QO7A 4BFMA 5AP1A 1T46A 3NVMB 2PVFA 2YITA 3HMOA 5FGKA 3FI4A 5BVEA 1WMKA 4BZOA 5BX0A 5L8LA 4E4LA 4C61A 4F7SA 3KRXA 4YZDA 3QYWA 3WILA 1JKKA 2IN6A 3BEGA 4ANBA 5KKRB 4CMTA 1OKWA 1B6CB 4FICA 2X4FA 1WBTA 5TR6A 5CX9A 4ZTHA 3FLQA 3MBLA 3ALNA 5JKGA 2BPMA 5D9HA 5JK3A 2R7BA 1PXLA 3EN5A 4FSNA 4Z9LA 4XUFA 2OJ9A 4FTOA 2C6DA 4YJNA 2HZ0A 4G1WA 3QD2B 3FY0A 3VUHA 5KMIA 1H07A 2XIXA 5M55A 4ZZOA 3PIZA 1PXKA 4FKUA 3AGLA 3B8QA 5AX9A 4BDDA 5A6NA 3FZOA 3I5NA 4QP9A 3FMNA 2ONLA 3CR0A 4FSZA 4O91A 4RC3A 4ZJVA 4GFMA 5HTCA 3R9OA 3COIA 3NNXA 2PZIA 4ASZA 3KXGA 4F65A 4RZVA 4M97A 3DBDA 4X21A 3V5TA 2FSMX 1AD5A 3C4ZA 1L8TA 2I0YA 5HX6A 4RX8A 2CCHA 5EQEA 3TZ7A 1WVXA 4IAAA 4U42A 5CAVA 5DEWA 3C5IA 3A62A 2FSOX 2OH0E 4QOXA 4ZMEA 3EFWA 4D4YA 3VBTA 2WTIA 3UP7A 2JAVA 4WNOA 3GC0A 1OIYA 4L01A 2IW6A 4MQ2A 5EM7A 3UZRA 4FNWA 4FIHA 3UNJA 2C0OA 2W1IA 1H00A 2VGPA 3O8TA 5K5XA 3MB7A 2I0HA 5DEYA 4FR4A 4QTCA 4AN3A 4RIXA 3CQUA 4KD1A 3GCPA 5CEQA 4B0GA 4Y95A 2HCKA 3DJ7A 3DCVA 4AS0A 5I3RA 4QP3A 3MVMA 4ANLA 4FUXA 2IO6A 4EH4A 2JIVA 3MJ2A 3LMIA 2NP8A 3WZDA 3R73A 4GJ3A 2Q83A 2VTQA 4MXAA 3ZONA 3ZO4A 4CFMA 2PY3A 1PYXA 1ZOEA 4O0VA 5GHVA 4BGHA 2A19B 3PG1A 1YWVA 3LXPA 1M7NA 2CLQA 3C0HA 3P78A 3FXWA 3QTZA 4BDIA 4DTKA 4CG9A 2R2PA 5KKRC 4FZ6A 5E9EA 2P0CA 4XCUA 3UQFA 2WMSA 1UU8A 4IX3A 4JQEA 4BTJA 2XK8A 3KVWA 2WMAA 4Z16A 3D5WA 2J0KA 3KMWA 5FEQA 5G1XA 3VC4A 4YSJA 3CKWA 3H4JA 5BPYA 4DFBA 3NIEA 4EUUA 1U46A 3QX4A 5DHJA 4EZ5A 2OKRA 2QOBA 5L2IA 5AIKA 1IA8A 5LVNA 1OL6A 4PDPA 1XH8A 3R63A 4FZ7A 3MY1A 4BTMA 1IASA 4QTAA 3QWJA 2BUJA 1GIHA 1CMKE 3Q9WA 3Q4TA 3QD3A 3REPA 4H05A 2JDVA 3PXYA 5ETFA 5FDPA 1KSWA 4ZS4A 5FG8A 3UNKA 1BX6A 3K3JA 2UW6A 4KBAA 4CLIA 1W0XC 4O7YA 3ZBXA 3GQIA 4YTFA 3FQSA 2F2UA 2R3RA 5LWNA 2BVAA 3QLGA 4RC2A 1TQPA 4ZXTA 2OFVA 3E8NA 3P9JA 4D5HA 3WYYA 3LFSA 1E9HA 4IZ5A 4KIKA 3DT1A 3FYJX 5LVMA 2B52A 3BHTA 4TYJA 4WKQA 3BLRA 4U97A 5HQ0A 2BDJA 4MBLA 4NJDA 3O71A 4ZTLA 3R8LA 3WZUA 5CNOA 4H36A 5TF9A 2XM8A 3V3VA 3F2RA 4DN5A 5J1VA 2GPHA 1PXIA 3V5PA 4CV8A 5BVOA 4R5YA 3ORMA 5DNRA 3DKOA 4Q2AA 2OXDA 2EXCX 2JIIA 3GCVA 3W2SA 2QC6A 2BZKB 3CSVA 3KMUA 4G3GA 3BQRA 3OW3A 3SV0A 3VWAA 4C3FA 1URWA 5EH0A 2VU3A 2IJMA 3A61A 5LMBA 5L2QA 3HV4A 4ERKA 2PE2A 3LQ8A 4UEUA 3RBWA 4C7TA 3DBCA 5CENA 5AUWA 4BF2A 2OICA 3FZPA 2XKDA 4PMTA 3UDBA 3VHKA 5LWMA 4EONA 4OTWA 2BILB 4I6HA 2FSLX 3BE2A 4NTTA 5CEIA 1URCA 2UZOA 4GCJA 3OEFX 3C51A 3FPMA 1TVOA 3EMGA 4RQKA 4YBJA 1PRYA 2XEZA 3IGOA 4BL1A 1G8SA 2ZYBA 3F3VA 1RDQE 4APCA 2ITZA 4B9DA 3E7OA 2FB8A 4HCVA 5HVYA 3VAPA 4J71A 2JAMA 4NWMA 3RPRA 4IEBA 3NUPA 3WI6A 3ALOA 1JKTA 2ZB1A 3Q60A 3UVPA 1BL6A 3MS9A 2XS0A 3DY7A 3U8WA 3UC4A 2WMTA 5HHWA 4HZRA 3SXFA 3U54A 2HZIA 3G0FA 1FGKA 4BCPA 3ZEWA 1QPEA 3PRFA 2CNUA 3TI1A 3QCSA 2WMBA 4ITJA 4M67A 4RJ6A 4Z3VA 1OL7A 2YM4A 3Q4UA 2V7OA 3TJCA 4S33A 3A7IA 3OEZA 3S2PA 1P2AA 2C6LA 1O9UA 4AWIA 4YJTA 3BWFA 4J53A 5E8YA 4ZP5A 4WSQA 3EN6A 2BMCA 3R71A 2YFXA 2IPXA 3PVGA 5CYIA 3BWJA 2XNNA 5HEZA 5B2LA 4PL5A 1WBNA 1U4DA 2OSCA 4DC2A 5CY3A 1REKA 3VUGA 3ZFMA 4E4NA 2YCFA 5CLPA 3DAEA 1GOLA 2UW0A 4TNBA 3OHTA 4BBEA 4U41A 4J98A 2J4ZA 4ACDA 4D2SA 3RNYA 1A06A 4FG7A 2X9FA 5CAPA 4XBUA 3GU7A 4O6LA 4ZSGA 4WO5A 1MRVA 5KMMA 4I0SA 3NNWA 4ACGA 1KV2A 2XK6A 4DG2E 3QTWA 4MBIA 3R9HA 4P2KA 4U40A 5H3QA 4BZNA 4RIOA 3E8CA 4C59A 4TL0A 2PTKA 2J90A 4FTNA 2YIWA 2CGVA 3L8PA 4FIFA 5DE2A 3R7VA 4D2TA 5J7BA 4QTDA 5EI8A 2GTNA 3OWJA 4JS8A 4CCBA 1WBSA 3OOGA 5FLFA 4D4SA 3A4OX 2JBOA 3OS3A 3O17A 5KMKA 2REIA 1OECA 2QKRA 2XBJA 2QU5A 5DT3A 4ZJIA 3SOAA 2UW5A 5KBQA 3PSCA 3C0IA 3PJ2A 3FC2A 2HAKA 2C69A 2UZVA 1EH4A 3PIYA 5IQFA 5FXSA 4F9WA 4JL9A 4EH2A 1H1SA 5EOBA 3VUTA 3C4CA 3NUXA 4HYUA 3RHXA 4DH7A 1OPKA 3NYOA 4ZLYA 1Q24A 2JD5A 3QL8A 2WFYA 2J5FA 3FJQE 1ZYCA 5HVKA 4QD6A 3I81A 2FGIA 4FKIA 2HY0A 3DXNA 4WUNA 4FKPA 5K9IA 4KKEA 5H2UA 3ZO2A 4G3DA 3V8SA 2YDIA 3T3VA 3Q9YA 3CQEA 3F3WA 5AP7A 3DK7A 4UALA 1R0EA 4DT9A 5GJDA 4IVAA 5J79A 4FZDB 4M0YA 5IMXA 2E9NA 2HK5A 5LVLA 5FWKK 4EH5A 5CZHA 1UU3A 3L8XA 4F1OA 1ZAOA 3GC8A 4OTQA 3FMKA 4EK4A 2OJIA 3U6JA 3UG1A 5DGZA 4FIIA 1G3NA 4EI4A 5AUZA 2J5EA 3R6XA 4G2FA 4U43A 2JKKA 4FTRA 3H30A 3MY0A 2X81A 4KWPA 3JYAA 5EK7A 4IJ9A 2WD1A 3GNIB 2P3GX 4IB3A 4EWQA 5K0KA 4MX9A 2X9EA 3VS6A 3Q4CA 3TL8A 4GIIA 4DBXA 4RIWB 4QMWA 3CJFA 5AAEA 2J51A 3F6XA 2EXMA 1FMOE 3UYTA 3AD6A 4PP9A 4UMTA 5FD2A 4JG7A 1E1XA 1OIRA 1YHVA 4O7TA 3U6IA 4K18A 4K11A 4S32A 5CU6A 2BCJA 1S9IA 4D2VA 3IOKA 4DF3A 5A4EA 2CGWA 3A60A 4XG4A 3V5LA 5L2TA 2YJSA 2GNGA 2XKEA 3KREA 5C01A 3SD0A 2R0IA 3VULA 3TG1A 3FBVA 5DN3A 4NU1A 3NPCA 5KX8A 2PZPA 3H3CA 3DNDA 3ORKA 5HE2A 2UZUE 3EYGA 5BUEA 2UW7A 1H25A 4K2RA 1JKSA 4TWPA 4AACA 5FTOA 4YNEA 5EQYA 5E8VA 2E9UA 5CANA 4I5MA 5E8XA 3VIDA 2JKQA 3QQKA 1R39A 2H9VA 2ITTA 4J8MA 4FVRA 3AMBA 2ZAZA 5HVJA 5D11A 2Z02A 4X0MA 4QMYA 5IA3A 5EHLA 3PPJA 2YIXA 3HV6A 1MRUA 2J6MA 4FYNA 4G16A 5G6VA 3SXRA 3IG7A 2PVRA 5EW3A 4QMUA 4BY9E 2VTAA 3CXWA 3WIGA 2C1AA 3CBLA 1ZRZA 1VEBA 4PTGA 4RA4A 3RZFA 3N4VA 4C4JA 3IGGA 3ENMA 4BKYA 4XG9A 4AZVA 1UKHA 5DI1A 3AQVA 2XF0A 3NW5A 3NLBA 1XBCA 3UOLA 1JNKA 3FXXA 4XEYA 4BKJA 3PUPA 5DG5A 4OTIA 4CSVA 4AX8A 3BHYA 4X2FA 3EFKA 1F5QA 2H34A 4G6OA 4FKQA 4EKLA 1YKRA 4RJ5A 5EYKA 3R7EA 3O23A 4O0RA 4MAOA 3GU5A 3KF7A 3CD8A 4L42A 5AP3A 2QOLA 3EN9A 3A99A 3O0GA 2BRMA 3MPMA 5M09A 3L8VA 2Y4IB 4LOPA 3G90X 3G51A 5IQBA 1PXMA 4IAYA 4LI5A 5HCZA 3IDCA 5DT4A 4U8ZA 1Q5KA 5CSWA 2B55A 1NVQA 3LCOA 3C0GA 3H9FA 1P4OA 3VRYA 3D9VA 4IZYA 5DA3A 5CF4A 1PJKA 2F7EE 2YDJA 3M42A 4DGNA 3FMHA 3FWQA 4Y73A 4HGTA 3VBXA 2W1FA 1Q8WA 1OZ1A 4RSSA 2QOQA 2C3JA 3MTFA 3VS0A 5BUJA 1YI6A 1P14A 2JIUA 3D14A 1Y6AA 2AYPA 3FE3A 4IWOA 3GCSA 1KE7A 1U59A 2XNGA 2JFLA 3LFBA 3MI9A 4NTSA 4A4LA 4CV9A 1JWHA 4LRMA 1NT2A 4CYJA 4NKSA 3R8ZA 4AGDA 4O7RA 3RMFA 2DS1A 1PMNA 4QP4A 2UW8A 4NH1A 3DFAA 3TUCA 4D58A 4WT6A 3WZKA 5HU3A 3U9NA 3NEWA 2C6TA 2WMXA 4KUJA 5I5ZA 3H10A 4WD5A 4C4EA 2R4BA 4NIFB 2F9GA 2QO2A 5EHYA 2PPQA 4X6RA 2GSFA 3LCKA 4AA0A 2ERKA 4QP8A 5FXQA 3MH0A 3HV3A 4AZTA 4EK3A 2RKUA 2ZMCA 2VO0A 3I4BA 4FNZA 4JBVA 4NT4A 4RBLA 2C6MA 2QOHA 3I60A 4KS8A 5FXRA 2YEXA 4DYMA 4GSBA 3DBFA 3FSKA 3C1XA 3EYHA 5JMSA 3DTCA 1JSUA 3T9IA 4UMPA 2W06A 3ZXZA 2X2KA 4XHKB 4ANOA 4AW1A 2WIPA 3MFTA 2YA9A 5J1WA 3FI3A 2OO8X 4FNXA 4I4EA 5AP5A 2XNMA 4O84A 5ETIA 5HORA 2PUIA 2Y4IC 3F9NA 4RJ3A 2I40A 5F94A 3OC1A 4NFNA 5CF8A 4YZNA 5HO7A 5IQCA 2GNFA 5A9UA 3MESA 3DZQA 4HJOA 2BHEA 2VZ6A 1P5EA 4NSTA 2OZAB 5JRSA 2RG6A 3FKOA 1R1WA 5DT0A 4BCMA 3LJ1A 4Y46A 1ZYLA 1FGIA 2E2BA 4QYFA 4U7ZA 5AJQA 2OXYA 2PYWA 3VF8A 4OUCA 4XYFA 4IXPA 4IAFA 3MVJA 3ZZWA 3NGAA 4AFEA 4NKAA 3TDVA 3WOWA 1PF8A 4QQJA 4XG8A 3MB6A 4P5ZA 4BTKA 2P55A 5A14A 2G9XA 3ZLWA 4M0ZA 4YMJA 3R7IA 4PMSA 3R8PA 3ZS5A 1SMHA 3UE4A 5HG8A 4FK6A 3L9MA 2E9OA 4CFXA 2VWIA 4CXAA 1KE5A 3NW7A 4DCAA 5AMNA 1CKIA 4Y5HA 5M4FA 1CKJA 2BKKA 4XRJA 5HU9A 2R3OA 3F66A 4FSWA 3PP0A 4DGLC 4FYOA 4HPTE 5JEBA 4GS6A 5HO6A 5AP6A 4EKKA 3UODA 3DDPA 2E9PA 2GNHA 3RM7A 2JDOA 3E87A 3QC9A 3FMDA 1HCLA 1FPUA 3R8MA 3NVKI 4OTGA 3GXLA 1Q8UA 1VYWA 2H96A 3IW5A 4L68A 4V04A 4N6YA 3BU5A 2VWUA 4FTTA 2UVXA 5M08A 4DGGA 1M2RA 4FV7A 1E1VA 1KOBA 4QMLA 3TNIA 3M2WA 4AA4A 5JGBA 4W4XA 3Q6WA 4JBQA 4JG8A 4D1ZA 5AV4A 3SC1A 5K4JA 3PXFA 3W2QA 2QVSE 2WEIA 3KKVA 3TKUA 3TZMA 3LFDA 1RE8A 4E7WA 3MWUA 4GKHA 4C3PA 3RAIA 3WE4A 2XYNA 2Y4PA 2Y0AA 3E63A 4TYHB 4TKSA 1BUHA 4CZTA 2EVAA 3GFWA 4JQ8A 4RIWA 2BDWA 2V0DA 3EB0A 4UN0C 3CD3A 3R00A 1PXJA 3A7FA 2EB3A 4N0SA 3MGYA 2A4LA 5AM7A 4QTBA 3NDMA 1LR4A 4K77A 2ETMA 5EM5A 4P5QA 3QZHA 4KSQA 3FEGA 1SVGA 2WQEA 4YLJA 4DFZE 5IKWA 3R8UA 4TNDA 3GFEA 3QUEA 3G9NA 2WMQA 3KRJA 4R7HA 2FUMA 4G5PA 5EG3A 5L8JA 5ACBC 3DU8A 2CGXA 5I9WA 5FTGA 4QRCA 2BRHA 3DQWA 2W4JA 3OMVA 4L45A 4BWKA 4ZLOA 3AC5A 4L3PA 3ODZX 4YGAA 4ENXA 4RJ4A 4ZK5A 4JDIA 2KTYA 4CZUA 3Q32A 4DEEA 5IQEA 2YACA 4Q9ZA 4FUYA 1FMKA 3L9LA 5C27A 3ZC6A 3E8DA 3KULB 3KQ7A 3PA4A 4J52A 4B99A 4FKSA 5IEXA 4XOYA 2HXLA 1H8FA 4A9YA 5AUVA 4BCJA 4C35A 3D7ZA 2XCHA 2YM3A 3G33A 3ORTA 3DJ5A 3OWPA 4ZY6A 3R9NA 2JC6A 3TTIA 3FLNC 4YBKA 2X2LA 3P1AA 1JQHA 2C3IB 1R3CA 4ITHA 5IH6A 3A7GA 4BGQA 2PZ5A 3TNQB 4DE4A 4USDA 3IW8A 1GZ8A 2CNVA 5IH5A 2GHMA 5JRQA 2HYYA 1GIIA 3QXPA 3RKBA 3AG9A 3CS9A 4JQ7A 4HW7A 4DFXE 1UKIA 5EYMA 1ND4A 2RSVA 1PXOA 3LVPA 5HZNA 4KKGA 3GCQA 3RTPA 3FY2A 5HIEA 3WYXA 5TKDA 4HZSA 4N4SA 3VBYA 3IW7A 2OGVA 2XIRA 1WBWA 4NJ3A 3DS6A 3IQ7A 3V01A 4WNPA 4M3QA 3PXRA 2UVYA 3BGZA 4JOAA 1LPUA 3PVWA 4FT5A 4AW5A 2IZUA 5AAGA 3R83A 2CSNA 3HZTA 2G2IA 3KRRA 4FV8A 4GG5A 4UWBA 4EK8A 4QP1A 5DMZA 1H28A 2WXVA 4IAZA 3VF9A 2R3GA 4GEOA 2ITUA 2XVDA 3BELA 3BEAA 3COHA 2BKZA 4UMUA 2VWWA 4FGRA 1JBPE 2XCKA 2XNPA 3P79A 5E8ZA 5AUUA 2LAVA 4PMPA 3E8EA 4CFVA 5LCJA 4HCUA 4RX5A 3COKA 3P0MA 2EWAA 3KXZA 5M07A 3GP0A 1UNLA 3MN3A 4H3QA 3G6GA 5BUIA 4I4FA 3ERKA 4B4LA 4J1RA 3UO4A 3LFQA 3FI8A 4KSPA 1WVWA 4BBMA 5CNNA 1Y8YA 3LXKA 3GOPA 4QNYA 3KXMA 3WF6A 4EQCA 3T3UA 3HMIA 3OT3A 4HVIA 3MPAA 4TYIA 3QZIA 3NUUA 5CU4A 4GW8A 5CALA 3C5UA 2VTSA 3B2WA 4H1MA 1DM2A 2QG5A 5DWRA 2CPKE 3K5VA 2R3KA 1OPJA 1Q62A 4AXAA 3JY0A 3RK5A 1I44A 1MP8A 1YXXA 5LVPA 4EH3A 3ETAA 2HZNA 4X6QC 4D2WA 3UOJA 5IF1A 3FL4A 4QTEA 4AOIA 1HOWA 4RMZA 2WMVA 4NIFA 3UVRA 2OI4X 4DG3E 4NM0A 4JJRA 1AQ1A 4LGGA 3V5WA 4E26A 2R3FA 3QUDA 2FVDA 4H58A 3CTQA 2QR8A 2YABA 4HYSA 1DI8A 1BI8A 4C4IA 4FG9A 4P90A 4R3PA 3PG3A 3RM6A 3BZ3A 5HG9A 1UVRA 2PVLA 2VTJA 1Q3WA 3UIUA 3W2RA 3TDWA 2JKMA 3N4UA 1V0PA 5JFVA 5M4UA 5IUGA 3FAAA 1PKGA 3P08A 1R0PA 2G15A 3QAME 3ZM4A 3FI2A 5HE0A 5DLSA 1M7QA 2F7ZE 4CTBA 4IWQA 2Y8OA 3TZ8A 1NY3A 2IW9A 1VR2A 1FVVA 2OZAA 3RALA 3HDMA 4NM5A 2YM8A 3BHVA 3TKHA 3OT8A 3ULZA 4USEA 1NVSA 1Q8ZA 3BLQA 3PSDA 5DRDA 1ERKA 4ALVA 3U6HA 3OXTA 1XBBA 5E8TA 4B8LA 4CT1A 4M15A 5GIPE 3KGAA 2WEVA 1LP4A 2W99B 2C6IA 2OJGA 5CT7A 3VS5A 2CNQA 2P2HA 2RFDA 3H0YA 4YTHA 5DOSA 3ZMMA 4EC8A 2W1ZA 4NK9A 4DAWA 4XV1A 4GIHA 4BDAA 4F1TA 1STCE 2I7QA 2VWVA 4E3CA 2PUPA 4YLKA 1M2QA 5BYLA 2C3LA 4U6RA 3OTUA 2W1HA 3K5UA 2X6EA 1OI9A 3Q04A 4IE9A 4C2WA 4F7LA 4F6UA 3FYKX 2OH4A 2V55A 3D15A 4R1VA 4QQTA 5FUTA 1BI7A 4OBPA 2XK9A 4Y72A 2DQ7X 4U44A 4KABA 3CIKA 5I9ZA 3P7BA 3Q6UA 3KN5A 4AZWA 3VJNA 5FBNC 4AE9A 3CJGA 2AC3A 4RGJA 4AUAA 1OB3A 1B39A 5CF5A 4C4HA 4F9CA 2WQNA 3DBEA 5BYYA 3QCXA 4F70A 4O7VA 3ANQA 2EUFB 3Q9XA 4FT3A 4G34A 1ZYJA 2YCQA 5HGIA 3PZEA 4FG8A 3ZZEA 2ZM1A 5FBOA 5GINE 1OPLA 5IUHA 2C6KA 3BLHA 4KA3A 4QP6A 5EFQA 2UW3A 3FMJA 4YPSA 4FIJA 4BB4A 4XG6A 3JPVA 5CEKA 3UMXA 3OBJA 3CKXA 4FIEA 5HCXA 2YM6A 4EBVA 2DWBA 3BRBA 3GU8A 4CT2A 1H24A 4DFLA 4OTRA 2VUWA 3RI1A 4QMPA 3RPVA 2XK4A 5B2MA 3BI6A 1PMUA 4FGBA 4E5BA 4EH6A 4DT8A 4PNKA 2PWLA 4L3LA 4TYHA 1V0OA 3FZRA 4J95A 2RFSA 4LUDA 3HP5A 1YDRE 3QZGA 4I6BA 5M44A 3ATTA 3ZUUA 4FV2A 4XS2A 1F3MC 3E7VA 1ZLTA 4RFMA 4BGGA 1M14A 3FKNA 5IEVA 3LXLA 2P2IA 2VNWA 2R3QA 3TWJA 4EEVA 4RVMA 3ELJA 2KULA 4UX9A 2WMWA 4AW0A 3PJ1A 2BRBA 5E4HA 3EWHA 3JVSA 5D10A 3ZRKA 3AD5A 3CQWA 4WG3A 5BYZA 3UIXA 1OL1A 1V1KA 3UPXA 3QA0A 2OF2A 5LMAA 4UY9A 4O7LA 4PTEA 1O6LA 4P7EA 3QKLA 2PZYA 2J0IA 2VRXA 4LL5A 1BYGA 4K6ZA 4YZ9A 3N51A 4D0XA 2BRGA 1JSTA 3CC6A 4R3RA 3VO3A 3EQRA 5CVGA 2ITQA 1ZOHA 5K4IA 4IFCA 4K8AA 3W16A 2DUVA 4S34A 2DYLA 4IC8A 3KULA 3OZ6A 4AGCA 4DH3A 4XJ0A 4QO9A 3SHEA 2QLQA 4FSUA 4NEUA 3BU6A 4HVDA 4MD8E 3D94A 3UYSA 1WAKA 4MD7E 1NA7A 3NUYA 5FQDC 3LMHA 2GNIA 2XRWA 3LLTA 3OW4A 4FODA 1XKKA 2UZEA 2PUUA 2XNBA 4G9CA 4HNIA 4Q5EA 5T3QA 5TT7A 5AADA 1YOLA 4XV3A 3UBDA 1UNGA 3O50A 3QC4A 3GUBA 5EKNA 2WQMA 4GT4A 4PPAA 4FOBA 4WBOA 2XIYA 4G3EA 2X4ZA 3R22A 5AV3A 2YJRA 4F6SA 3FMLA 4NCTC 2B7AA 3LOKA 5M51A 4F1MA 3KY2A 1H0WA 1H1QA 5AR3A 3QBNA 3ZDUA 5AV2A 2Z7QA 5LMKC 4FSRA 4BDKA 1ZARA 4EORA 3HKOA 3PPKA 2V22A 3VS3A 1SVEA 3TCPA 1QL6A 3GVUA 3NSZA 3ZLSA 4MXOA 3ZO3A 3R9RA 2YM7A 2QU6A 4TY1A 4WNMA 5IDNA 2XEYA 4QMNA 5A6OA 2Y7JA 4XNEA 1OKYA 1YOMA 3DB6A 1PY5A 5AR5A 5AX3A 4D4VA 5HLWA 4M66A 4YSMA 3PVBA 2ITVA 3DPKA 3B2TA 2XKFA 1BLXA 5L4QA 4HGEA 4J97A 3EOCA 4MBJA 4RLKA 3OP5A 2W1EA 4HYHA 4EH8A 4F4PA 5IQIA 2ZOQA 3F69A 1PYEA 3DFCB 5ETCA 3EJ1A 4EOQA 1XBAA 3R04A 5EDRA 1DS5A 3QD4A 3ORLA 4IJPA 3OY1A 2W05A 1ZMUA 3QZFA 3GGFA 3MA6A 3UOKA 4C4FA 1JPAA 3QRKA 4YJRA 5ANKA 5J9YA 3N4TA 4IAKA 4EBWA 3DZOA 4DTAA 2IG7A 4LM5A 2QURA 4BCGA 2QD9A 2YIRA 3MIAA 5KZIA 1WVYA 4MWHA 4CMOA 2BFYA 3JVRA 5DR9A 1QPCA 3U87A 5JZNA 1FOTA 5AV1A 4DG0E 4CCUA 4G17A 2XNEA 2PULA 2VTNA 4IQ6A 4XLVA 4XMOA 4U80A 3BYUA 4C3RA 2F57A 4ZSEA 3QHWA 4FKLA 5CAUA 1Q99A 4W4WA 5CAOA 5JT2A 2QOOA 1U54B 2P33A 3LIJA 1XO2B 3MFSA 4I93A 3QUPA 4KS7A 1VZOA 3POZA 1A9UA 2JDRA 4C02A 3A2CA 2R3NA 2VGOA 4KBKA 3TIZA 3LZBA 2YM5A 3F88A 1AGWA 5DRBA 4UV0A 3LCDA 4I94A 1YVJA 2Z7SA 4CFUA 4X3FB 1VYZA 1XQZA 2CKEA 3UQGA 5KMOA 1XH5A 2WTDA 2B1PA 4KRCA 3AD4A 3QTIA 3S0OA 3JUHA 1H0VA 3BBTB 3EL7A 3Q9ZA 4ACCA 3DAJA 4CTCA 1GNGA 3GOKA 5JFXA 3ENHA 1YRPA 2R5TA 3IO7A 3R01A 1WCCA 4QNAA 2A2AA 4HCTA 4TWOA 3K2LA 4W9XA 1APME 4GG7A 4BKZA 3ZSIA 4DHFA 2F49A 2YAKA 5DH3A 4F0GA 4FKRA 1WFCA 1KE6A 3A7JA 2O63A 4PL4A 3OVVA 3IDBA 3MH1A 1ZMVA 1Q4LA 3A4PA 3FV8A 3II5A 4BDFA 4FTCA 5HBHA 5HG7A 2ITWA 1XJDA 3AT2A 3OXIA 4JBPA 4U81A 5E1SA 3OBGA 4MVFA 4A9RA 5CAQA 3DQXA 3ZRLA 5J5TA 3CY2A 3TKIA 4LV5A 5B7VA 4AW2A 2Z7LA 5F4NA 3SVVA 4FSTA 4FL2A 3MA3A 3NW6A 3PYYA 4MF1A 3U4UA 4W8EA 5AP2A 1YWRA 2IZRA 4FI1A 4Z7GA 1J91A 1NVRA 3CE3A 4IVDA 5T6KA 4EH7A 4Y83A 5C8KA 5M06A 3OD6X 4ZAUA 2OLCA 4OBOA 4YJUA 1Q3DA 4XV9A 3HMNA 3PA5A 5HLNA 5JSMA 3AT3A 2UZBA 3V8WA 1V0BA 2W9FB 3QXOA 4UMRA 4C38A 5IDPA 1DAWA 2PMIA 1UNHA 4YJOA 2BAQA 3HRCA 1Y8GA 4FV0A 5AA9A 5CI7A 3DKCA 3IONA 4EH9A 5IEYA 3OF0A 3D5UA 4ZOGA 2J0JA 4L43A 3QFVA 4I6FA 1ATPE 4IB5A 4DCEA 3RZBA 2CN5A 1FBNA 1MUOA 2I1MA 2JKOA 2Z7RA 1U5QA 3KCKA 3LM0A 3N9XA 4C36A 3VUIA 2WIHA 5I0BA 4AQCA 4WG4A 4E73A 4HVHA 4JIKA 3HAMA 2R64A 3EQHA 4EK6A 1H08A 4X3FC 2HOGA 4HNFA 4ZTQA 4AN9A 4UXQA 4QYEA 5CXZA 2XIZA 1GJOA 2QG7A 3BYSA 3VBVA 4IM2A 4RT7A 2F7XE 4FTJA 4QP2A 5BVKA 4NCTA 3W2CA 2NO3A 4R3CA 2OK1A 2OU7A 4XG2A 5LOHA 4GUEA 2GQRA 3MY5A 5LMKA 5FRIA 4CKRA 1G8AA 4CEGA 5E91A 4KIPA 4QPSA 2W9ZB 1GIJA 4JDHA 3SG8A 3S00A 4X3JA 2G1TA 4A9TA 1Z5MA 4IX6A 2ETKA 2V7AA 2BIKB 3QTXA 4MYGA 3UOHA 4PDYA 2PVKA 4JBOA 2JLDA 2O3PA 4PNIA 3RWQA 5AUTA 3E3BX 5DPVA 3I5ZA 5C9CA 3TT0A 3RPSA 5CTPA 1XWSA 2R3JA 5AV0A 4ASXA 2BFXA 1CDKA 4QMSA 1O6YA 2C4GA 5I4NA 2BHHA 4I5PA 3HLLA 2PE1A 5HE3A 4ANSA 4EL9A 4L67A 4OTFA 1K2PA 3FZ1A 4YNOA 4EHGA 4NFMA 3PRIA 4RZWA 2FA2A 3E92A 3CTHA 4J99A 3RINA 3RPYA 4CKIA 2ZM4A 4AOTA 3SW7A 1NXKA 2ESMA 4RG0A 3ZH8A 4N70A 5J8IA 5KUPA 4XBRA 4YZBA 2HELA 2W5HA 3DKGA 3SG9A 1OL2A 3QWKA 3ZCLA 2WQOA 5EI2A 1ZWSA 3S4QA 4ZJJA 3L9NA 3ZXTA 4BHZA 3AGMA 4I5CA 4UMQA 4DEHA 4I6QA 1CSNA 4FTIA 4JDKA 4E93A 4O0TA 3GB2A 4L00A 3BPRA 3NZ0A 5D12A 3PWDA 5AUXA 3RK9A 2JBPA 3UPZA 3EQIA 3MFRA 4BDCA 3DLSA 3UTOA 4BDJA 4QMMA 3QF9A 4O2PA 3NRMA 4J7BA 4RIYB 3PXQA 4PX6A 4IWDA 1BMKA 1JLUE 4E20A 1PXPA 1OBGA 4YC3A 2HW6A 5CQUA 5KMLA 3BCEA 3LXNA 4I92A 4TWNA 2RFEA 1MRYA 2UW4A 3NAYA 4O0WA 3TTJA 5GJGA 3VQUA 4B7TA 3OWLA 5L6OA 4RWLA 5K5NA 4BCHA 4OT6A 4XV2A 3D0EA 1W98A 2HXQA 2PE0A 4BDGA 5GZ8A 2W7XA 4ZZMA 4LV8A 3NCZA 4LQMA 3NAXA 4F0IA 4AZSA 4DBNA 3CLYA 1MQ4A 2Y9QA 4GJ2A 3EQDA 3UGCA 4FV4A 4U79A 5FP6A 4R1YA 4D0WA 4EZ7A 3QU0A 4NZWB 2GNJA 3P86A 3SKCA 4V05A 1ZOGA 4F08A 4J96A 4DTBA 3R21A 4A06A 5CEOA 4JX7A 4QMZA 1JOWB 3KC3A 4EOLA 4B6LA 4I0TA 4H39A 2JFMA 3ZU7A 4JG6A 3RK7A 1MQBA 5M53A 2BALA 3WF9A 3NMUF 5JN2A 3DK6A 3GU6A 5JGDA 3POOA 1IR3A 2BRNA 2WO6A 3E62A 3JY9A 2IW8A 3SRVB 4EQMA 2ITNA 3D4QA 3BKBA 5CEPA 1PXNA 3PY1A 3GCUA 4MHAA 1OMWA 3LJ0A 3LMGA 4I20A 1W7HA 2X7GA 4NL0A 1J7UA 1W8CA 5CVHA 4BZDA 3QQLA 4YPDA 4N57A 1J3HA 3I79A 5A4QA 4XP0A 3W2OA 4GVJA 4FEWA 3ET7A 4QQ5A 2X8IA 1YW2A 5AP0A 3F5GA 3VNTA 3QRJA 2QOIA
chains in the Genus database with same CATH superfamily
5HCYA 3QTRA 2C6OA 4PPBA 4XLIA 3C7QA 4FL3A 5AR7A 1U54A 1ZZLA 4MNEB 4LGHA 3UO6A 3P4KA 1IRKA 4O0SA 4MCVA 4DEDA 3GC9A 3LCSA 3BU3A 4ZTMA 4KNBA 2GTMA 4YJSA 4U45A 4GYGA 5ITAA 5IQHA 2SRCA 3VW6A 2PHKA 3QTUA 4Q5HA 1OITA 4GT5A 4BCNA 5AEPA 4WRGA 5TO8A 4A9SA 3VN9A 3VJOA 4IADA 3E3PA 4X3FA 5FM3A 2WHBA 4YJPA 3F7WA 3O8PA 2FYSA 2WPAA 3T9TA 4O0UA 4GVAA 4QMTA 2VNYA 2P4IA 5I3OA 3NUNA 4DDGA 3BV2A 3LFEA 4GL9A 4M12A 4IIRA 2UZDA 4K1BA 1PHKA 4F9AA 1W82A 4NYEA 5IG1A 4CGAA 2YCSA 5ANEA 3HNGA 3KN6A 5IQAA 3NYXA 5EW8A 3SLSA 5CSXA 3SQQA 4YLLA 5AR8A 4K0YA 5F9EA 4WOVA 4GYIA 4FV9A 3S1HA 4KKHA 3NNVA 3HYHA 4NUSA 2AC5A 4RJ7A 5IPJA 1GAGA 5HKMA 2JGZA 3HEGA 2PMLX 5J87A 3S3IA 3ZOSA 3HX4A 4GFOA 3BHUA 4AT4A 2IWIA 3KCFA 4EHZA 1H1RA 3G5DA 1KE8A 1UWHA 3F3ZA 5HG5A 5CEMA 2YWPA 4EJ7A 2B53A 4BCKA 5ANDA 2FSTX 4DH5A 1BKXA 4O2ZA 5HIDA 2GNLA 2XIKA 2WMUA 3QQFA 4PF4A 3BX5A 4D9UA 5A3XA 4YTIA 2CGUA 4RWJA 3D2KA 4EJNA 4MF0A 2X8EA 3KU2A 3P23A 4U0IA 3PFQA 4A4OA 2C30A 3H9OA 1UU9A 4AAAA 3L8SA 5IU2A 3Q3BA 2B54A 2OW3A 3OCBA 4LMNA 4QPMA 4RWKA 5F1ZA 4GT3A 1WZYA 4OTDA 2BROA 2Y6OA 2QLUA 3DA6A 3HV7A 1Q97A 2CN8A 3OCGA 3ZYAA 1SM2A 5AR4A 2YCRA 3SX9A 1OIQA 4QPAA 4G6NA 4O38A 3HAVA 5FDXA 2WMRA 5C26A 1SNXA 3SXSA 1QPDA 3QGYA 2GU8A 4OGRA 4RQVA 3NCGA 4UYAA 4WRSA 1YOJA 2HENA 3RAWA 4FT0A 1FVRA 1R78A 3QKKA 3QRTA 1QCFA 1K9AA 5CT0A 5CS6A 2NNWB 4O22A 4ZY4A 1KV1A 3A8XA 2ZV8A 3ZHPC 5CU0A 4YUQA 3R1YA 4ITIA 4LG4A 4NM3A 3CGFA 4FTLA 4RJ8A 5DBXA 3ZO1A 3LE6A 4BBFA 3GI3A 5C8MA 3TACA 1Y6BA 4RVKA 5BMSA 2JDSA 3ZM9A 2W1DA 3QHRA 3CEKA 5HNIX 1UWJA 4LRKA 2Q0BA 5IA4A 1ZXEA 2QI8A 3FLSA 3LFNA 4RRVA 4KB8A 4ANQA 4OAUC 1A48A 3W8LA 2J2IB 2ZM3A 3FQHA 3A8WA 3NYVA 2ITYA 3TUBA 1SZMA 3EKKA 1TQIA 3KMMA 2VO7A 5D7AA 2BIYA 2UUEA 3C9WA 3R1NA 4MK0A 3QCQA 1FVTA 2VTHA 5JZJA 2VD5A 2OIBA 2YLFA 4BTFA 4S2ZA 3B8RA 4NW6A 4IDVA 3ODYX 4MQ1A 4FEUA 3KFAA 2QHNA 2CJMA 1OKVA 4B8MA 3AKJA 4CVAA 2OWBA 3SAYA 1YXSA 4MXXA 4AAYA 5A4CA 3NUAA 3V51A 5CSHA 5C1QB 4KBCA 1KUTA 4GU6A 4X7QA 5ANOA 3QLFA 3EN7A 3KF4A 3O8UA 3UMWA 4JRNA 4YURA 4EK5A 1XH4A 3DNEA 5JFSA 3KVXA 3ZTXA 1PKDA 3RPOA 4O7SA 2X39A 2IZSA 3AC3A 4EOIA 5A4TA 3O96A 2WNTA 4D4RA 5E90A 5KO1A 4PDOA 2ZDUA 2VTIA 5D41A 1CTPE 5H8GA 2BR1A 4FSYA 4D28A 5E7RA 4QMXA 3G6HA 1W2DA 4ZMFA 5L2WA 4C62A 4KIQA 4RIYA 4IAIA 4F6WA 4DA5A 4KAOA 4AG8A 3TNWA 4W9WA 5HTIA 4U3YA 4IVBA 4ACHA 3DOGA 2IVSA 3VW8A 3AMYA 3PJ3A 2BTRA 2VN9A 1H4LA 1LEWA 2OJFE 3CPCA 5FP5A 2B9FA 4L8MA 3R8VA 3OOMA 4HVSA 3QQGA 4M68A 2O2UA 4O1OA 3IW6A 2RL5A 4ZTRA 3KEXA 4KRDA 1Q41A 4OTHA 4JLCA 3E88A 3NR9A 4G5JA 3M11A 4LFIA 4TPTA 2GS6A 4O96A 4E4XA 1G5SA 4ERWA 5CF6A 5GIOE 5BVDA 4C2VA 2Z8CA 4TRLA 3ZBFA 2PMOX 4H3PA 2YWVA 3A7HA 4DEGA 4LOOA 2OIDA 2XNOA 5HBEA 2JEDA 3BE9A 3JS2A 5TOZA 3C4WA 5DVRA 4FEQA 1DI9A 3W55A 2RG5A 3AC2A 3G9LX 5BVNA 2ZV9A 2CMWA 5LARA 4II5A 4Y5QA 3QCYA 3TV4A 2XH5A 3UNZA 4YTCA 3R2YA 1YXTA 4F64A 3QRIA 5M56A 4P4CA 3OG7A 3QA8A 4JR7A 3SRVA 3BL9A 3LFFA 5CI6A 2YLEA 2VO3A 4JI9A 1B38A 3DLZA 4V0GB 3COMA 4XP2A 1Z9XA 3IS5A 4AXCA 3UIBA 3R1SA 3TN8A 1J1BA 2X2MA 3ITZA 4CYIA 1RJBA 2GQGA 2C6EA 4XG7A 5BMMA 3ZSHA 3UG2A 2RF9A 3C4XA 5BVFA 4DLIA 3DKFA 3JR1A 3E64A 4YJQA 4AXEA 3TJDA 3EZRA 4O7NA 1YWNA 5B0XA 1YHSA 3DTWA 5M57A 2LGCA 2FH9A 2RGPA 4FTMA 3HRFA 2X8DA 1YI4A 3LQ3A 4CFFA 4DFUA 5AUYA 3GENA 4IBMA 2NRYA 4D1SA 2C0IA 4MNEA 4QT1A 4F0FA 3VRZA 5F95A 2CCIA 3TEIA 2QNJA 2UZTA 2VX3A 4AGUA 4C58A 4N6ZA 3O2MA 4ASEA 4AU8A 5EW9A 5ANGA 4RLLA 3H0ZA 2XMYA 4WHZA 2WOTA 1DAYA 1H1PA 3Q4ZA 4TXCA 4ZTNA 3WE8A 1RW8A 4I0RA 4E6DA 4AT3A 2B0QA 5L6WL 4D2RA 1UU7A 3KL8A 3KXNA 4CFWA 2GDOA 4FZFB 3RCDA 3PXZA 4HVGA 4EWHA 3OY3A 4BI1A 1Y57A 2CLXA 3R30A 4RWIA 4Z55A 5CXHA 4GUBA 5J95A 4BCIA 3Q52A 2PL0A 2R7IA 3GBZA 5HD4A 3TZ9A 4DFNA 4IMYA 1KOAA 4BCQA 4EYJA 4JAJA 1M17A 2JITA 3MTLA 3O7LD 5M4CA 4BVUA 3RHKA 4CQEA 5HOAA 2F4JA 3I6UA 5ETAA 4F09A 1QPJA 2PVJA 3FMEA 2UZNA 4TTHB 3OXZA 3VS4A 2QOKA 1PW2A 2R0UA 3IECA 2GS7A 2XJ0A 3BV3A 3W0SA 2WQBA 4EHEA 1H27A 1OIUA 4CFNA 3MIYA 5CZIA 4DGMA 1TFFA 2VWZA 4G31A 1S9JA 3F5XA 2XA4A 3RVGA 3I7BA 2C5XA 2RIOA 2A98A 3MVLA 4I1ZA 4RC4A 4WA9A 3U51A 3BGQA 4BHNA 4LMUA 2VX0A 4YHTA 4ZSLA 3UQCA 4DHZA 2HIWA 4ALUA 1IEPA 3PPZA 2ETRA 2QO9A 3O7LB 3LJ2A 2GCDA 4MXYA 3W8QA 2YERA 3VBQA 3D7TB 5HIBA 3UIMA 4FSQA 2WTJA 2J0MB 3DGKA 3LCTA 4JR3A 2X7FA 1XH9A 4E5WA 3UDZA 3W1FA 2WZJA 4H1JA 4TW9A 3WBLA 4XRLA 4PDSA 4MWIA 2W1GA 4AZFA 2XBAA 4E6AA 2W4OA 4PTCA 1SYKA 2XKCA 4TT7A 3MSSA 3AMAA 5LJJA 4QP7A 1J7IA 3P7CA 4WIHA 1ZYDA 3AXWA 5HNBA 2X6DA 4E5AX 3PSBA 4C37A 2CKOA 4BDEA 4L52A 4G3CA 4FTAA 2PVHA 2R3IA 5GZ9A 1YXUA 4X2NA 3LAUA 1M2PA 4MXZA 5E8SA 2QR7A 4U5JA 2WTCA 4XH6A 2NPQA 5AR2A 3PWYA 4IC7A 3THBA 4L6QA 4RFYA 4AN2A 4OAVB 4E6QA 2FO0A 4BDHA 2VWXA 3MJ1A 4PWNA 4QMVA 3TV7A 2C68A 2WOUA 4NW5A 4U9AA 4FSMA 1XMLA 3SW4A 2VWBA 4PL3A 4UZHA 4YC6A 2BTSA 4RA5A 2OIQA 3FHIA 4JXFA 4F7JA 4YR8A 3EQGA 4I41A 4O83A 3DJ6A 3TUDA 4L9IA 3QQJA 4O1PA 3T8OA 4BCOA 5LVOA 1XMMA 4ALWA 4CKJA 1VLRA 1YHWA 4JT3A 1UV5A 5HX8A 4QYHA 3U9CA 3G2FA 3VQHA 4ANMA 2W0JA 1Q8YA 4FV6A 4G6LA 2ITOA 4YO6A 5EOLA 4F99A 4IW0A 2GMXA 3QX2A 3SA0A 4ZY5A 3W33A 5J9ZA 3ATSA 3FXZA 4IZ7A 4F78A 1ZZ2A 3V6SA 3PTGA 3FZSA 2H8HA 4HGLA 5I9XA 4OTPA 5ANIA 4IACA 4XOZA 4D5KA 5HI2A 5E92A 1OBDA 4HOKA 2BAJA 4M69B 2W5AA 4F9BA 5IH4A 2VTRA 3NS9A 3QD0A 4UWYA 4UZDA 5HESA 2OG8A 5D1JA 3V8TA 5H8BA 3RCJA 2V62A 3W18A 2QOCA 4XX9A 5KE0A 2VTPA 3KK9A 4S30A 3UVQA 2XK3A 3EHAA 4G3FA 3IKAA 4FKGA 5A54A 5KMNA 4MNFA 2QOFA 3CTJA 3L9PA 4QMQA 3OROA 3PIXA 4FK3A 4LGDA 3BQCA 4E6CA 5L2SA 3ORIA 4PV0A 5FEEA 3R0TA 2CKQA 1YXVA 3LFAA 5E8WA 4WSYA 2UZLA 3PE2A 3FDNA 2UVZA 3IPHA 5JGAA 3KXHA 3PDTA 4GH2A 3RWPA 4R5SA 3C50A 4O81A 3W32A 1OGYA 4I21A 5L6PA 3FMMA 3PY3A 4FZAB 2VX1A 1H26A 4PQNA 2WTVA 1Q8TA 3MVHA 4ACMA 3EKNA 4BI2A 1TKIA 1CM8A 4DINA 3E5AA 3C4FA 3PZHA 3ZEPA 2C5VA 3LFCA 3MV5A 3FC1X 2WKMA 4IB0A 4J8NA 3HGKA 4YO4A 4ORKA 4GV1A 5HE1A 3K3IA 4FTUA 5LCKA 4MD9E 2YIQA 3WF8A 3UC3A 3D5XA 4PPCA 1OUYA 2GQSA 1LEZA 1IAJA 2I0VA 5KNJA 5IQDA 3PLAE 4FA2A 3D5VA 3AOXA 3V5JA 2X0OA 4FV5A 4GFGA 4X2GA 4BIBA 3R1QA 4APPA 4E8AA 5B2KA 4FF8A 5DFPA 4BI0A 3KA0A 3NYNA 1O6KA 4V01A 1GY3A 3GQLA 2GHLA 3TV6A 3HUCA 4JNWA 4R7BA 4FKVA 4F7NA 4V0GA 3U4WA 3O51A 2BZHB 3OWKA 4LYNA 4ZS0A 3VS7A 5EQPA 4DGOA 1WBVA 2ZDTA 4FBXA 3F5PA 4AZEA 4DFYA 4EQUA 1X8BA 4AT5A 4EC9A 3OCSA 3BBWA 5A46A 4I24A 3PJ8A 4FKJA 5HD7A 3OFMA 2H6DA 4D9TA 3VHEA 4X2KA 3KXXA 5K3YA 3FPQA 3EFJA 4LV7A 3EIDA 3BYMA 3ANRA 5DIAA 4Y85A 3SDJA 3ZUTA 1OM1A 2XJ2A 3UDTA 2ZV2A 4JX3A 1ZYSA 4QQCA 4KIOA 5TE0A 4K9YA 2JDTA 3D83A 1OL5A 1M52A 2WTWA 2XM9A 4M84A 1JVPP 3C13A 3R28A 4CRLA 4R77A 2W96B 4RFZA 4F63A 3RP9A 1GZNA 3Q96A 3V6RA 4EOKA 4AXDA 2I0EA 5IQGA 3I0OA 4CZYB 3P7AA 3ZRMA 2PZRA 1HCKA 4C4GA 4YU2A 2WTKB 3I1AA 3KRWA 3F61A 3NX8A 5IA2A 5AWMA 2B9HA 2Q0NA 5K0XA 1IA9A 5FTQA 3CY3A 4AGWA 4AFJA 1JAMA 4I23A 1NW1A 1W83A 1IAHA 2ITPA 4EYMA 2PUNA 4Q9SA 4D55A 5JFWA 4GU9A 4FT9A 4CQGA 3PP1A 3MH2A 3L1SA 2R3PA 5C4KA 5AP4A 3FLYA 2OBJA 3HV5A 3SOCA 4ZZNA 4PP7A 2OFUA 4CLJA 1OGUA 2I6LA 4FTQA 5CU2A 3IDPA 5EHOA 5EYDA 4F9YA 1BL7A 2EU9A 4EOOA 4DLJA 4MKCA 3W0PA 2OF4A 4TWCA 4JIAA 3OCTA 5ACKA 1OUKA 4QMOA 2VTMA 4FOCA 4IHPA 5FM2A 5C8NA 1YDSE 4RX9A 3W10A 3RJCA 4RX7A 2C3KA 4G9RA 2IVTA 4XG3A 5GJFA 3R9DA 4A07A 2YDKA 4EOSA 3R7UA 3TNPC 3M1SA 3TNHA 5C03A 2NRUA 1YI3A 5F20A 3Q2MA 2XK7A 3D7TA 3HMPA 3LLAA 3PJCA 4PY1A 3RNIA 4I22A 4FT7A 5KCVA 3ACJA 4A4XA 2AUHA 2UV2A 2VAGA 3HL7A 3VUKA 3ZFYA 5HBJA 4C57A 3OUKA 4YC8A 3ROCA 1PMEA 3HRBA 4FKWA 2A1AB 4NM7A 2G01A 4LUEA 3BYOA 3F3TA 3BYVA 3EN4A 3QYZA 4GMYA 2X0GA 4FL1A 4OR5A 4IM3A 4DH1A 1H01A 2ERZE 2R9SA 5DR2A 3VBWA 4R7IA 2G2FA 3TM0A 4YHJA 1OKZA 2VTLA 2WU6A 3QGWA 4OBQA 2C1BA 4MEDA 3DB8A 2WTKC 4U3ZA 4AOJA 3NUSA 4FX3A 3KRLA 4FV3A 4BCFA 4BIEA 2PVMA 1SVHA 4K33A 5EM6A 5KBRA 4BR3A 4FTKA 3GT8A 3K54A 4LRJA 4UXLA 2XRUA 4CNHA 3AC4A 4L46A 2VO6A 4FC0A 3ORXA 5EYCA 3QQUA 3ORZA 4LL0A 3GU4A 4TZRA 3Q2JA 5AFVA 5L3AA 2BZJA 4O0YA 5JQ8A 2J9MA 2YIYA 3EZVA 2VTTA 1T45A 4AP7A 3ZDIA 4E4MA 5KHXA 4O7ZA 3IK3A 4TN6A 4EOMA 3OUNB 4CG8A 2R3LA 4A9UA 2YHVA 2O64A 3TIYA 4FKTA 4AA5A 2RFNA 3I0QA 4BC6A 4CMUA 1OVEA 4DEBA 3LQ5A 1ST0A 5H9BA 5HTBA 2V5QA 2XP2A 2X0QA 4PRJA 4TYEA 3R7YA 4C8BA 4QYGA 5L8KA 3MYGA 5BQ0A 5KZ0A 4FIGA 3LPBA 2HZ4A 2O65A 5AAFA 3S95A 5LQFA 3EFLA 1I09A 4GRBA 4JRVA 3PY0A 3WZJA 5CASA 2O8YA 1JSVA 1UA2A 5T68A 2HY81 2VV9A 3MDYA 1PMVA 2IVVA 4ENYA 5JQ5A 4X2JA 2A27A 4BICA 4GK4A 3ZLYA 2PU8A 4FVPA 5ICPA 3EQCA 3VS2A 2QKWB 4M69A 2YISA 3PXKA 3QRUA 4ANNA 1YQJA 4GK3A 2GS2A 5IA1A 3QQHA 5HICA 2BDFA 2CHLA 3DAKA 3F2AA 3FZTA 3F3UA 3PA3A 5CVFA 4DEIA 5I9UA 2PVYA 3P5KA 2PSQA 4BIDA 4I6LA 3Q53A 3GC7A 3R7OA 3CPBA 3FSFA 3JXWA 3AT4A 2ZV7A 2J0LA 1KE9A 4IFGA 2XJ1A 4CD0A 4FMQA 2YZLA 4IH8A 4W8DA 4O82A 3DV3A 3HA8A 4FNYA 3QALE 1FINA 4ONAA 4BWXA 4EHVA 1ZMWA 3MH3A 1XH7A 3ORPA 3ULIA 3UZPA 4O86A 3LW0A 2XYUA 4ASDA 2PK9A 4C0TA 3HDNA 3EH9A 3PLSA 2QCSA 4I3ZA 4YP8A 2C5YA 3FLZA 2F2CB 3PVUA 2X7OA 3DXQA 2W17A 1K3AA 4AF3A 3FHRA 2ITXA 5I9VA 4ZSAA 3V5QA 4Z7HA 3QKMA 1TQMA 2PVNA 5M4IA 3F82A 2Z60A 3EQPA 4KINA 2HWPA 4W4YA 3UZTA 3AKKA 5AA8A 3SGCA 3FUPA 4WNKA 3HVCA 4RIXB 3RAKA 3W0RA 2O5KA 3NIZA 3RGFA 2B4SB 3DXPA 5EDPA 5CWZA 5I9YA 4W4VA 4R78A 3F5UA 5IA0A 4D1XA 4FE2A 3LM5A 4JVGA 1RQQA 4IX4A 5ANJA 5IZFA 1JKLA 2Z2WA 5CU3A 4D2PA 4USFA 3UO5A 4FEVA 2XB7A 1XH6A 2W5BA 2OXXA 1QMZA 4BRXA 1SNUA 2QHMA 2UZWE 4IANA 5C4LA 5BVWA 1XHAA 3DDQA 1WBOA 3ZUVA 4DH8A 1IG1A 2C0TA 2PMNX 2BAKA 3C4EA 3R02A 4BDBA 3ZC5A 3ZSGA 3UP2A 2B9JA 4L44A 3ID6C 5EI6A 4MXCA 2VWYA 4AE6A 2O0UA 1J1CA 2ACXA 3MFUA 2YAAA 5IA5A 3KK8A 2ONLC 3ACKA 3BIZA 3H9RA 2GFSA 2ZMDA 3BHHA 4ZLZA 3PFYA 3EL8A 3NFGB 2WGJA 4EOJA 4ZEGA 5HLPA 3HA6A 2E9VA 2C5NA 1WBPA 4WBBB 4ZSJA 2OZOA 4BYIA 2WAJA 3R7GA 1G8JA 4KIKB 4UWCA 4BYJA 2WELA 1FQ1B 4RVLA 4QYYA 2WU7A 5EDQA 3VUMA 2YN8A 4R6VA 3CP9A 5KHWA 5IUIA 3WF7A 3WZEA 3U55A 1CKPA 4RVTA 3E93A 5BNJA 5IMEA 4UYNA 3W0QA 4FVQA 4JAIA 1GZOA 4EOPA 4ARKA 2X0PA 4M8TA 4R8QA 5HO8A 1ZY4A 1KWPA 4O27B 3RAHA 3WIKA 4EZ3A 3FLWA 3AC1A 4M14A 4MH7A 4ZTSA 5CSPA 4A7CA 2HWOA 5H8EA 3FQEA 4HGSA 5D7VA 1P4FA 3PE1A 3CCNA 4ID7A 2W4KA 3VUDA 4FEXA 4L53A 4LOQA 3ML1A 4IB1A 2B9IA 2CDZA 4IM0A 2OJJA 4XP3A 4M13A 4YJVA 4ZIMA 2R3MA 2QQ7A 1GZKA 1L3RE 3QTSA 4OW8A 2IZTA 1VJYA 4PMMA 4YHFA 4O21A 2IVUA 4IX5A 1REJA 5FEDA 3LKMA 4I5HA 3HECA 4JDJA 4L7SA 4UBAA 2BZIB 4O7WA 3UJGA 2Y6MA 5EM8A 4L3JA 5CSVA 1XR1A 1H1WA 3HUBA 4O0XA 2WB8A 4Y8DA 4E1ZA 3F7ZA 2CKPA 4IZAA 3DK3A 3V04A 3AC8A 3ZLXA 4CRSA 4OLIA 3F2NA 2EB2A 2HW7A 4M7IA 5EKOA 3G0EA 2C47A 2XZSA 3WF5A 3IOPA 4BN1A 1Y91A 4GKIA 1J7LA 4GK2A 2C5OA 3VONA 3NNUA 4BWPA 4EUTA 5HNGA 2G2HA 2UW9A 2NYAA 2J7TA 3BGPA 4RPVA 4UB7A 4O6EA 4YZCA 5E8UA 5JH6A 2GHGA 1Z57A 2EXEA 3VVHA 3MPTA 2W1CA 3WARA 1ZY5A 2R3HA 3LHJA 4HPUE 5DYJA 3QTQA 4PUZA 2X1NA 2J50A 4MTAA 3D2IA 3I6WA 3W2PA 4TYGA 3TXOA 3ORNA 2QODA 3HP2A 3Q5ZA 3CGOA 3DBQA 3R2BA 3EQBA 3FKLA 2ZB0A 5E1EA 5KMJA 5J7HA 2ZJWA 4OT5A 4WG5A 3MW1A 1F0QA 4S31A 2XUUA 3ROYA 3GEQA 3VS1A 4DEAA 3I7CA 3KB7A 4FKOA 4IWPA 5GZAA 3OTVA 3EQFA 3FL5A 1YDTE 4HYIA 5J5SA 2ZVAA 4YZMA 2QONA 4H3BA 2A0CX 4FV1A 3HMMA 4WUAA 5IISA 5GNKA 3IW4A 4DITA 1U5RA 2YZAA 5J9LA 5CQWA 1W84A 3ZFXA 5A4LA 2GFCA 5DR6A 5AM6A 4IDTA 3G15A 3Q5IA 4FRFA 1Q61A 5LXMA 2VTOA 4C34A 1LUFA 3NWWA 4IVCA 5AIRA 4L7FA 2QO7A 4BFMA 5AP1A 1T46A 3NVMB 2PVFA 2YITA 3HMOA 5FGKA 3FI4A 5BVEA 1WMKA 4BZOA 5BX0A 5L8LA 4E4LA 4C61A 4F7SA 3KRXA 4YZDA 3QYWA 3WILA 1JKKA 2IN6A 3BEGA 4ANBA 5KKRB 4CMTA 1OKWA 1B6CB 4FICA 2X4FA 2XAOA 1WBTA 5TR6A 5CX9A 4ZTHA 3FLQA 3MBLA 3ALNA 5JKGA 2BPMA 5D9HA 5JK3A 2R7BA 4QEBA 1PXLA 3EN5A 4FSNA 4Z9LA 4XUFA 2OJ9A 4FTOA 2C6DA 4YJNA 2HZ0A 4G1WA 3QD2B 3FY0A 3VUHA 5KMIA 1H07A 2XIXA 5M55A 4ZZOA 3PIZA 1PXKA 4FKUA 3AGLA 3B8QA 5AX9A 4BDDA 5A6NA 3TMOA 3FZOA 3I5NA 4QP9A 3FMNA 2ONLA 3CR0A 4FSZA 4O91A 4RC3A 4ZJVA 4GFMA 5HTCA 3R9OA 3COIA 3NNXA 2PZIA 4ASZA 3KXGA 4F65A 4RZVA 4M97A 3DBDA 4X21A 3V5TA 2FSMX 1AD5A 3C4ZA 1L8TA 2I0YA 2XANA 5HX6A 4RX8A 2CCHA 5EQEA 3TZ7A 1WVXA 4IAAA 4U42A 5CAVA 5DEWA 3C5IA 3A62A 2FSOX 2OH0E 4QOXA 4ZMEA 3EFWA 4D4YA 3VBTA 2WTIA 3UP7A 2JAVA 4WNOA 3GC0A 1OIYA 4L01A 2IW6A 4MQ2A 5EM7A 3UZRA 4FNWA 4FIHA 3UNJA 2C0OA 2W1IA 1H00A 2VGPA 3O8TA 5K5XA 3MB7A 2I0HA 5DEYA 4FR4A 4QTCA 4AN3A 4RIXA 3CQUA 4KD1A 3GCPA 5CEQA 4B0GA 4Y95A 2HCKA 3DJ7A 3DCVA 4AS0A 5I3RA 4QP3A 3MVMA 4ANLA 4FUXA 2IO6A 4EH4A 2JIVA 3MJ2A 3LMIA 2NP8A 3WZDA 3R73A 4GJ3A 2Q83A 2VTQA 4MXAA 3ZONA 3ZO4A 4CFMA 2PY3A 1PYXA 1ZOEA 4O0VA 5GHVA 4BGHA 2A19B 3PG1A 4QDEA 1YWVA 3LXPA 1M7NA 2CLQA 3C0HA 3P78A 3FXWA 3QTZA 4BDIA 4DTKA 4CG9A 2R2PA 5KKRC 4FZ6A 5E9EA 2P0CA 4XCUA 3UQFA 2WMSA 1UU8A 4IX3A 4JQEA 4BTJA 2XK8A 3KVWA 2WMAA 4Z16A 3D5WA 2J0KA 3KMWA 5FEQA 5G1XA 3VC4A 4YSJA 3CKWA 3H4JA 5BPYA 4DFBA 3NIEA 4EUUA 1U46A 3QX4A 5DHJA 4EZ5A 2OKRA 2QOBA 5L2IA 5AIKA 1IA8A 5LVNA 1OL6A 4PDPA 1XH8A 3R63A 4FZ7A 3MY1A 4BTMA 1IASA 4QTAA 3QWJA 2BUJA 1GIHA 1CMKE 3Q9WA 3Q4TA 3QD3A 3REPA 4H05A 2JDVA 3PXYA 5ETFA 5FDPA 1KSWA 4ZS4A 5FG8A 3UNKA 1BX6A 3K3JA 2UW6A 4KBAA 4CLIA 1W0XC 4O7YA 3ZBXA 3GQIA 4YTFA 3FQSA 2F2UA 2R3RA 5LWNA 2BVAA 3QLGA 4RC2A 1TQPA 4ZXTA 2OFVA 3E8NA 3P9JA 4D5HA 3WYYA 3LFSA 1E9HA 4IZ5A 4KIKA 3DT1A 3FYJX 5LVMA 2B52A 3BHTA 4TYJA 4WKQA 3BLRA 4U97A 5HQ0A 2BDJA 4MBLA 4NJDA 3O71A 4ZTLA 3R8LA 3WZUA 5CNOA 4H36A 5TF9A 2XM8A 3V3VA 3F2RA 4DN5A 5J1VA 2GPHA 1PXIA 3V5PA 4CV8A 5BVOA 4R5YA 3ORMA 5DNRA 3DKOA 4Q2AA 2OXDA 2EXCX 2JIIA 3GCVA 3W2SA 2QC6A 2BZKB 3CSVA 3KMUA 4G3GA 3BQRA 3OW3A 3SV0A 3VWAA 4C3FA 1URWA 5EH0A 2VU3A 2IJMA 3A61A 5LMBA 5L2QA 3HV4A 4ERKA 2PE2A 3LQ8A 4UEUA 3RBWA 4C7TA 3DBCA 5CENA 5AUWA 4BF2A 2OICA 3FZPA 2XKDA 4PMTA 3UDBA 3VHKA 5LWMA 4EONA 4OTWA 2BILB 4I6HA 2FSLX 3BE2A 4NTTA 5CEIA 1URCA 2UZOA 4GCJA 3OEFX 3C51A 3FPMA 1TVOA 3EMGA 4RQKA 4YBJA 1PRYA 2XEZA 3IGOA 4BL1A 1G8SA 2ZYBA 3F3VA 1RDQE 4APCA 2ITZA 4B9DA 3E7OA 2FB8A 4HCVA 5HVYA 3VAPA 4J71A 2JAMA 4NWMA 3RPRA 4IEBA 3NUPA 3WI6A 3ALOA 1JKTA 2ZB1A 3Q60A 3UVPA 1BL6A