4O38A

Crystal structure of the human cyclin g associated kinase (gak)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
310
structure length
267
Chain Sequence
QSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPLYSNFPIGEKQDIWALGCILYLLCFRQHPFYSIPPHDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQEIAAARNVNPKSPITELLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Cyclin-G-associated kinase
publication title Crystal structure of the human cyclin G associated kinase (GAK)
rcsb
source organism Homo sapiens
total genus 71
structure length 267
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4o38A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o38A01
1GNGA 5B2MA 2BDJA 3CKWA 3OW4A 4GUBA 4CKIA 4FGRA 3MIAA 4U44A 3TUDA 3GFWA 5HTIA 3VUDA 2C6KA 3IONA 4IEBA 4K11A 5J5SA 5AUUA 5E8VA 1P4FA 3P7AA 5IZFA 3SC1A 4FTQA 5HX8A 1WMKA 2E9VA 4XLIA 3N4TA 2QR8A 2C6DA 4R7BA 4IE9A 4FL2A 4PMSA 5K4IA 4XRJA 2JITA 4ALWA 2QONA 4G3DA 4YJUA 1PKDA 3UG2A 4FKTA 5GHVA 2GS7A 4BDBA 3S2PA 2PVMA 4FZ7A 4I0RA 3NW7A 4QNAA 5A9UA 2C0OA 3PLAE 3B2WA 3NDMA 2NRYA 5AA8A 2JKOA 2QODA 4AW5A 4DT9A 1W82A 4KIOA 3TIZA 5EQYA 4I22A 3ORXA 2F7EE 3HL7A 1ND4A 3BU5A 3GGFA 5KMOA 3BI6A 4JNWA 4FOCA 2B9HA 5CEQA 1SZMA 4DTAA 4L3LA 4GFMA 2W05A 4CFXA 5JGBA 1H24A 4UALA 2XMYA 1JOWB 4EWQA 2QOBA 4HYSA 4QP8A 4E6CA 3WYYA 2X4FA 5BVWA 5L8KA 5T3QA 1M17A 3CLYA 3S0OA 4B6LA 5GIOE 4BGHA 2GS6A 4KINA 4MWIA 1ZWSA 4NCTC 4J8MA 4FKRA 4BZOA 3BHUA 4YJSA 4F0GA 4F7LA 1RQQA 4X3FB 3OUNB 4QP9A 4BL1A 4BTKA 5GINE 3UIMA 4L44A 4ZSJA 4IM2A 2XYNA 2B0QA 3TV4A 4OR5A 3EYHA 3BYOA 3PTGA 4BBMA 3LKMA 5CZHA 3ALNA 4C57A 3D5UA 4IC7A 4DEEA 4Y8DA 4U81A 5H3QA 5BVKA 3U87A 2F49A 1HOWA 2WMVA 3PVBA 4MNEA 1Q8ZA 3BEAA 3QZFA 5HD7A 4J97A 5AAEA 4U3YA 4O84A 5K0KA 1ZOHA 1PJKA 2WXVA 4K33A 2OKRA 2WMXA 3HDNA 4I6QA 2RFSA 3QCSA 4YGAA 4AOIA 4M97A 2CGUA 3HMNA 5CEPA 3LQ5A 5LARA 4TYIA 4F1TA 4C02A 3EQHA 3SXRA 5IU2A 2VUWA 4MD8E 4BGQA 4CEGA 4IC8A 4PL3A 3N9XA 3P9JA 4O7SA 1JSUA 1Z5MA 3JY9A 4JQ8A 3AGMA 2UVZA 3DBQA 4JDKA 3O0GA 3R8ZA 4A4LA 3DU8A 3R8UA 4JT3A 2NNWB 5IEVA 4KIKA 2X8EA 3G6GA 5AP7A 2E9UA 4XNEA 5DOSA 2OBJA 1QPEA 3NUUA 1CSNA 3SLSA 5HBHA 3D5XA 3IW6A 4JAJA 3BHHA 5BUEA 4W4WA 1XH8A 3AT3A 3VBVA 3DK6A 3H10A 3U6JA 3QL8A 4M3QA 4OBOA 3T3VA 2HK5A 5AJQA 2JFMA 4GJ2A 4X6QC 5JZNA 2FO0A 3ZRKA 3Q2JA 4Y83A 1LPUA 2WMWA 3WF5A 3OWJA 3QX4A 3LMIA 4AACA 1ZLTA 3MB7A 4RWLA 4U97A 2UZWE 4LUEA 4FEVA 2J51A 3LLTA 4HVGA 3HV3A 5C8NA 1J7UA 3TCPA 1WBWA 3R1YA 2F9GA 4XG4A 2CKPA 3ORKA 2ZM4A 4ZS4A 4Q5HA 4BDHA 3BCEA 3UO5A 1K9AA 3VIDA 3H4JA 3NLBA 4KBAA 4EK3A 2ZM1A 3Q5IA 5IMXA 4NU1A 4O6LA 5EKNA 4WNMA 3CQWA 3FXWA 3F5GA 1PXNA 3NYVA 2UW4A 5HNBA 2ERKA 1OBGA 4ZTNA 4BB4A 4K6ZA 3V5WA 3R2BA 3VUTA 3E63A 3VQHA 5AV1A 3FMKA 3LJ2A 2BRNA 3ORNA 3AT2A 3FPMA 3HA8A 4XG2A 3L8VA 2ITTA 5D41A 5CANA 5CF5A 2Z7SA 4FMQA 2F7XE 2OJJA 3L9MA 4FSZA 4O0YA 4RC2A 3DNDA 4V0GA 4C3PA 4USEA 3KN5A 5JQ8A 1YDTE 4QMXA 2HAKA 3NRMA 2GS2A 5HLPA 4C2WA 2QOQA 1PMNA 4FVRA 3Q4UA 2PZRA 5B7VA 3CY2A 1PXOA 4TWOA 5B0XA 4BR3A 2XEZA 4HGLA 3W8LA 4EORA 3U6HA 4BCJA 3TZMA 2YN8A 2G15A 5JGAA 2JGZA 4ITJA 5C8KA 2WTIA 2GQSA 5CSVA 4OT6A 4K1BA 3GCUA 4GH2A 3VS0A 1M52A 3PVWA 2RG5A 4EQCA 3HGKA 5EHOA 5K3YA 3KXHA 5BUIA 3LE6A 3EQIA 2W5BA 4KIQA 2W96B 5L6OA 3FLNC 3LXLA 4LMNA 3T3UA 1UV5A 3LFCA 2WO6A 3MSSA 4QTEA 4GCJA 4RIYB 2QO2A 3FZOA 5LOHA 4IWQA 3VULA 4NSTA 4RLLA 4AW0A 4CNHA 5I3OA 2GQRA 1OUKA 4QMPA 2X7OA 4DH7A 2R5TA 4LOPA 3R8PA 2HIWA 2ZMDA 4PMMA 1Q97A 5GJFA 3CCNA 4ID7A 4AN3A 4DH8A 5EQPA 4LFIA 1MUOA 1OIQA 3KCFA 4ZTSA 4EH7A 4FBXA 4FTAA 4EK4A 4LRJA 4IM0A 2YIWA 5IQEA 3IKAA 2OICA 3UP2A 3GEQA 4I20A 5A14A 2JDVA 2JIVA 2PVYA 3TKIA 3PIZA 2HWPA 5CSPA 5LCKA 2JDSA 4JIAA 3MESA 4F7JA 4MBLA 2O64A 2XM9A 4RT7A 5IF1A 1P2AA 4O1OA 1J7LA 3ZDUA 2YIXA 3DT1A 4F65A 2IJMA 1J7IA 5IA1A 3DXPA 4RA5A 4NCTA 3CPCA 4AT3A 5FP6A 4ASDA 4HGTA 2DUVA 2R3JA 1GIJA 3E8NA 3D83A 5GJDA 1OL2A 4ZS0A 5IDPA 3BZ3A 3QXPA 4HGSA 5M07A 4LRMA 4EOIA 4GKHA 5A3XA 1I09A 2R3RA 3V04A 1Y91A 1Q3DA 3KA0A 4CMOA 3EN5A 3KXNA 2QCSA 4IAIA 2WTJA 2VAGA 4EOQA 2WTWA 4I5MA 4H3BA 3C0GA 3R01A 3DLZA 3BYVA 1QMZA 4NFNA 2QOLA 4LI5A 4N4SA 2YDKA 4WHZA 4JXFA 4YZDA 5KKRB 1XH4A 4G9CA 5EDRA 3SX9A 1UU9A 4HNIA 3V5JA 3DBEA 3GC0A 4MBIA 4MNFA 3ERKA 5HVJA 4KS7A 4I94A 3D0EA 4UYAA 4IM3A 2QOOA 3NMUF 5IPJA 2J7TA 1K2PA 1ZYSA 3TWJA 2VU3A 3F5UA 4J1RA 5JFWA 3FE3A 3UVRA 4F1MA 4FIGA 5IUGA 1ZAOA 5FBOA 2PVLA 2BPMA 1XHAA 2XIZA 3NWWA 4GT4A 3SRVB 3N4UA 1YOMA 3SA0A 4QP2A 2YCSA 5CWZA 1ZYCA 4MF0A 3PXRA 3WE4A 4FT3A 1WBTA 1X8BA 2WFYA 4LOQA 4YHFA 2PVKA 3KY2A 2J0MB 4MD7E 3CEKA 2C6EA 3KL8A 4WT6A 4JQEA 1W83A 3PJ1A 5HX6A 1E1XA 3THBA 5CNOA 2BAQA 4FIFA 4IVAA 3UBDA 3IS5A 3Q52A 3KGAA 2FVDA 4YJVA 4XS2A 5JFXA 2OFVA 4QTBA 5EM7A 2VZ6A 4EZ5A 4YO4A 1YWVA 3L1SA 4FSUA 3ATSA 2XNMA 5HE1A 1YOLA 4G5JA 4DFLA 3C4EA 5HIEA 2EVAA 4C4HA 4D2SA 2NO3A 2R3GA 3CP9A 4HVDA 4UN0C 4EZ7A 3GNIB 1JAMA 4JDIA 3ZO1A 2XKCA 4XUFA 5CAQA 5AAFA 1KWPA 4G5PA 2PU8A 3H3CA 2C1BA 3RNIA 3SW4A 4JVGA 3IG7A 3ELJA 4FEWA 2WELA 1YDSE 3VBTA 4RVLA 5AV4A 4O27B 5HESA 3UIUA 2UZUE 4QQJA 4FTCA 5IISA 5KUPA 3MFUA 1G8AA 2P0CA 3Q4CA 3Q9WA 1I44A 3D2KA 3HZTA 1M14A 1QL6A 3QQKA 4W9XA 5L2QA 4UEUA 4TYHA 5FLFA 3VW6A 1LP4A 3AC1A 5AUTA 2YM8A 3DXNA 4YNEA 3I79A 5F94A 4A9YA 3C4WA 3RWPA 4DH3A 2R3MA 3CIKA 3DA6A 4IZ7A 3E8EA 2ETKA 2QU6A 3HKOA 2UZDA 4ASEA 2E9PA 3RBWA 5M4CA 2QR7A 4BKYA 4DCEA 2WQMA 1W7HA 4MXYA 3OW3A 3G9NA 3ZDIA 3RCDA 3OT8A 2ZDUA 2VRXA 3Q9YA 3RPSA 2ITUA 1UA2A 3B8RA 1Q41A 1Z57A 4USFA 4JJRA 4Q9SA 4P5QA 3BEGA 5AP0A 3CQUA 2YAAA 3DKOA 3FZRA 2XB7A 3MPTA 4A4OA 4UMPA 2UW0A 4UMUA 3BE2A 2GNJA 2Y9QA 3WZKA 4XCUA 4G34A 2X4ZA 4G16A 1AQ1A 3OHTA 3AC8A 5DT0A 5FTGA 2A19B 1QPDA 2ITYA 2WZJA 4PPCA 4QO9A 2XK7A 2R3HA 3DFCB 2J2IB 4V04A 5CAVA 4IDVA 3VC4A 3JR1A 4CRLA 4DEGA 4BTFA 2X8DA 2GU8A 3IGGA 4HNFA 4QTCA 5IH5A 2VGPA 2XM8A 4QQTA 4FICA 3VF8A 3QLGA 4MAOA 3DAJA 2QKRA 2JAVA 4RIOA 3HLLA 2WMQA 3LCKA 1Q61A 5TR6A 3HECA 4Q9ZA 5LVNA 3FEGA 4R6VA 5CU4A 4O81A 5A46A 4RJ6A 1YXXA 3ZBFA 4LV5A 5HIDA 3IDPA 4NJ3A 4YJOA 4QP1A 2W1FA 1PMUA 4N70A 3HDMA 2EXMA 4Z55A 4ZZNA 3UG1A 5EG3A 3MA6A 4ZMFA 3I6UA 3CY3A 3PP1A 1ZYLA 4JDHA 3R7EA 3MV5A 3CJGA 3ORZA 4NW6A 4MQ1A 2GCDA 1YI4A 2F57A 1R78A 3OS3A 4DEDA 4F6UA 5D7AA 4BIDA 4OBQA 2UUEA 4BHZA 4C62A 1O6YA 4L68A 4RG0A 3VBXA 3FJQE 3PVGA 3E3PA 5IQCA 4NM7A 3C51A 4UYNA 1YRPA 3G33A 3PXFA 5L6WL 3BHVA 4F1OA 3UZTA 1OL5A 2VWXA 5M53A 3QQGA 2C0IA 3G0EA 3NIZA 3ACKA 3ZEPA 4AN9A 4S31A 1BX6A 4XH6A 3F3UA 4M13A 5C9CA 4EOMA 3AD6A 3Q5ZA 3RWQA 3DJ6A 1JPAA 2W0JA 1PMEA 5DEWA 4ZEGA 2PSQA 2BCJA 2VWIA 3BQCA 3JVRA 4ZTLA 3A4PA 5HE0A 4ACCA 4BDGA 4UMRA 1MQBA 2X9FA 4D4RA 3COKA 1OKYA 3VRYA 5HQ0A 2W5HA 4KKHA 4GRBA 3ZLSA 4IWDA 5CENA 2X6DA 3PJCA 3BRBA 3LFAA 5JH6A 4DEHA 3PY1A 4C3RA 4NT4A 3MA3A 4CTCA 4C59A 3D5WA 4Y5QA 3HNGA 4CYIA 4YSMA 4EK5A 2CKEA 4KKGA 2X7FA 4BCQA 5IUHA 3KEXA 3T8OA 2PULA 4RQKA 4WO5A 4YHTA 4CYJA 1NVQA 3BKBA 3DK7A 2X6EA 4EOPA 5KZ0A 4FNYA 2ONLC 1OI9A 4PDYA 2FB8A 1VYWA 4IH8A 4DGNA 5HVKA 4IX6A 2UW5A 4JRVA 2PL0A 2J6MA 3IDCA 3TV7A 4CKRA 3AOXA 5H8GA 4APPA 4UWCA 2ZV7A 3RPOA 4P2KA 2B9FA 4IAFA 3AXWA 2OF4A 2HOGA 2UW8A 2BTSA 3MFSA 1SVEA 4IWPA 4RVKA 1SNXA 2HELA 4NM0A 5JSMA 4WA9A 2A2AA 1UWHA 5ITAA 3EZRA 2BVAA 5D7VA 4WBBB 1JKSA 3PWDA 4ARKA 3QTRA 4IBMA 5K0XA 4MEDA 3DJ7A 1JKKA 3I6WA 3O71A 4FZFB 5HCZA 4BN1A 5HE2A 5BPYA 5BVNA 4ACDA 5JFSA 3ZUTA 2DYLA 3PJ8A 2BAJA 4FKLA 4GT3A 3FSFA 3MH3A 5BUJA 2JIUA 4C0TA 4TWNA 1WBOA 3ZO4A 4AF3A 1T46A 4RRVA 1YXTA 1FMKA 3O50A 3VRZA 2W99B 4CGAA 1Z9XA 1KUTA 3O8UA 5E91A 2WHBA 1YHWA 3AMBA 1OPJA 5T68A 3KKVA 1DS5A 1XBAA 3KULA 5IA5A 3NW6A 3R02A 2BRMA 2OF2A 1Q99A 1WZYA 2CHLA 2YITA 5HBEA 4FUYA 2V55A 2WMRA 3DS6A 2R7BA 4EHEA 3RMFA 4OTDA 5TT7A 4CXAA 2XIKA 4JR3A 2HYYA 3SXFA 1L3RE 3SHEA 3MH1A 4KRCA 4WBOA 4L67A 2BROA 2C5OA 2GNIA 3JY0A 5E8UA 4YUQA 3PG1A 2LGCA 1U54A 5A6NA 4EHVA 4IX5A 1U4DA 3FI3A 2WGJA 5IA4A 2QU5A 3SXSA 4QQ5A 3QTIA 2EUFB 4I6BA 5M51A 3OUKA 2CCIA 5LWNA 3A60A 3PSDA 4UMQA 4DCAA 2UW9A 3OCBA 2PVHA 1B39A 4TYJA 4ALVA 2WIHA 3CPBA 3FMLA 4Y85A 5DRDA 4R1YA 5AP5A 4XRLA 3KRXA 2VNYA 3V5PA 3W16A 3POOA 3BELA 1FOTA 4D0XA 4D2RA 4E8AA 3F88A 3EWHA 2ZB1A 3FYJX 3G90X 3KREA 2Q0NA 2JDRA 2W1DA 4FK6A 4X3JA 3K3JA 3G15A 4L53A 1NXKA 3CS9A 5FEEA 2ETMA 3O96A 2W9ZB 3LFSA 4F0FA 4O0XA 5I9ZA 4FSRA 3S3IA 3UPZA 4ANNA 3GU4A 3LMGA 4QMTA 4MCVA 4BBEA 1BLXA 1JVPP 3NS9A 2YLFA 1XH7A 3CXWA 3IK3A 5AIRA 2R3KA 1QPCA 2WEIA 3II5A 3QLFA 4YJTA 4NM3A 3RI1A 3SV0A 1OECA 2RF9A 2QLUA 3IOKA 4R3PA 4X2JA 1F0QA 4BWXA 4HVSA 2CLQA 4ZK5A 2WQOA 1ZXEA 4DEIA 4BDDA 2YERA 3DTCA 5DEYA 4Z16A 4DBXA 2XIYA 3UPXA 4RZWA 5M4IA 3PSBA 4Y46A 3P79A 4FKOA 5ANEA 3QKKA 2JLDA 2BRHA 4ENYA 5EI8A 4O86A 4BC6A 1YXUA 3FWQA 4ENXA 3NCZA 1FMOE 2PZIA 4OTPA 3W55A 4OTIA 3VWAA 3O23A 4ACHA 5L6PA 5LJJA 3EOCA 2CN5A 3P78A 2J9MA 2PMIA 1APME 1OITA 2OGVA 4FV2A 2X2LA 3GC8A 3QQFA 4L42A 3QU0A 4MQ2A 3LFDA 3FLZA 4NW5A 4CV8A 2FH9A 4D2PA 5EDPA 4O7TA 2JD5A 3ZZEA 4DH1A 3HV4A 1MQ4A 1YI3A 3DLSA 4QQCA 2C30A 4QYGA 4AGWA 4XV9A 5M56A 4Y72A 2ZYBA 4BDAA 5E4HA 3F69A 2H6DA 3OFMA 2OH4A 4NIFB 4PDPA 4O6EA 4RBLA 3KC3A 4RJ4A 3NVKI 1FVRA 5CSXA 4DBNA 4G6OA 3LAUA 4GMYA 2BZKB 4D2VA 1LUFA 3FQEA 5I4NA 1K3AA 3EYGA 3OCGA 4GKIA 1Q8WA 1URCA 1V0BA 3JXWA 4DTBA 3W2OA 4U7ZA 3P1AA 4AE9A 3ZU7A 3LJ1A 3VJNA 5E8TA 3EQGA 5A4EA 4O96A 4EEVA 4BCGA 3PE1A 4BY9E 3MVHA 4FKVA 4MTAA 3QX2A 5EW8A 4EH3A 4K9YA 3FZPA 5LMKC 1Y6AA 4FOBA 5M09A 1IRKA 5C26A 1ZARA 4RIXB 2O65A 3F61A 1RW8A 4A06A 3R73A 4YP8A 2YJSA 4QTAA 3ZONA 3Q4ZA 3F6XA 1JNKA 3CD8A 4EL9A 4EK6A 2YFXA 4G17A 4EQUA 1Q4LA 2R2PA 3E64A 2YDJA 1GY3A 4DFZE 2X81A 4OTQA 2XNBA 2IO6A 5BMSA 1DM2A 5DVRA 3QRUA 4RQVA 4J53A 1U5QA 2OFUA 1NVSA 2BZIB 3ATTA 1OKZA 4D5KA 4FEUA 4FUXA 1BMKA 1WBNA 1SM2A 4AT4A 3Q04A 2WPAA 3LCTA 4E4MA 4KSPA 4FKUA 4FV7A 4CZUA 4AUAA 2YIQA 2HWOA 3VHEA 4FT0A 4BBFA 5E92A 3C0HA 2OU7A 1OL1A 3QD3A 4BDJA 3RZFA 3EQRA 4YTHA 3PY3A 3VS7A 3VUHA 1Y6BA 1BUHA 2QOHA 3GVUA 4G3EA 2E9OA 3VN9A 4D2TA 1WBVA 3D14A 3DV3A 3OG7A 2GHGA 4CRSA 3DTWA 2VV9A 3VNTA 5E8WA 2WOUA 3QRTA 4W4YA 5J8IA 3R63A 4DGLC 4USDA 5JT2A 1H08A 3GBZA 4WNPA 3SG9A 2ACXA 3V5QA 3VF9A 5C8MA 4B7TA 2BKKA 3UZRA 4QOXA 2YDIA 3FLWA 4FEXA 2C5YA 4IAKA 3R8LA 4QP3A 5D9HA 3OT3A 3MJ2A 4NKAA 5FG8A 1H4LA 4I6FA 1FGIA 4PRJA 5HZNA 5GIPE 5AR2A 4Z7HA 3LQ3A 3NUSA 4QRCA 4RVMA 3MDYA 4ZY6A 3V8TA 5IEYA 3K2LA 2PUPA 1GIIA 2GTNA 3IPHA 3ODZX 1XH5A 2O8YA 3B2TA 3UNZA 3T9IA 4QMQA 4YZNA 2B53A 3QQUA 4W4XA 2XUUA 4PPBA 4W8EA 4OLIA 4KS8A 4DG3E 5B2LA 3LQ8A 5CAOA 2XF0A 3W8QA 3WOWA 4L8MA 4DEAA 2BTRA 2YZLA 1TQIA 4E20A 3FPQA 3F3ZA 3PLSA 3PIXA 2XRWA 4G3GA 4BRXA 4JRNA 4FV0A 4D0WA 1R0PA 2ITNA 4DLIA 4XG7A 2YISA 3O7LB 3QHRA 4PF4A 5KBQA 2CCHA 2X39A 3DAEA 4IJ9A 4R8QA 3ZUVA 2P2IA 1ZMVA 5E1SA 3I0QA 3VS3A 3SW7A 3NIEA 2R3NA 2QO7A 2HW7A 3UNJA 3FBVA 3MI9A 1KE9A 4ZY4A 4R3RA 4UBAA 1JLUE 3HEGA 4RX5A 3W10A 3GUBA 1NW1A 1ZOGA 1RJBA 2IWIA 5CF4A 1IAHA 4NM5A 2FSMX 4C33A 1Q62A 3LHJA 5AADA 3HV6A 2NP8A 2IZTA 3C4FA 2Z7QA 1BI8A 4AZSA 4DN5A 3DOGA 5DPVA 2XKFA 3C9WA 3D7TB 3L9LA 3Q2MA 5FRIA 2QNJA 2WIPA 3EQCA 2IVVA 3UYTA 3WILA 5IQGA 4N6ZA 2JIIA 1JBPE 1CM8A 1H0WA 4JDJA 3HAVA 2CN8A 3IW8A 4C36A 5AR7A 5HU9A 4E6AA 4N6YA 4LMUA 2EXCX 3KRJA 3MTFA 4GFGA 5J9ZA 2IG7A 4CD0A 3WARA 1OMWA 4X2NA 3ZYAA 4EH4A 2CJMA 4F4PA 4O82A 3DQWA 1R39A 5AM6A 4NK9A 2IN6A 1G8SA 3VS5A 1GZ8A 3TZ8A 4E3CA 4MNEB 2C5XA 2HZIA 3FYKX 3UOJA 5KO1A 5AWMA 4AFJA 3GQLA 4O2ZA 1BL7A 5HIBA 3ETAA 3LXKA 2IZUA 3R83A 4W9WA 3ENHA 3VVHA 4F9CA 4QPMA 3RAHA 3EKKA 5CT0A 3KK9A 3HUCA 4RIWA 2XIXA 2B9IA 2R7IA 3D2IA 1J1CA 2A0CX 3PJ2A 1IEPA 2OZAA 4FNWA 4PTGA 4GYIA 2GTMA 4IADA 5EDQA 4EKLA 4KBCA 4FGBA 3PXYA 4KRDA 4PDSA 1PY5A 4LV8A 2BHEA 4I92A 4OTGA 5A4CA 1OZ1A 3R9OA 3HMPA 2W4JA 3EQBA 4YLJA 4C4FA 2VTRA 4NH1A 5IDNA 4EKKA 2W1HA 4C4EA 3F2AA 2X2MA 4FKJA 3VAPA 2CPKE 5LMKA 3DFAA 4KIKB 2Y4IB 5CVFA 4IZYA 3PUPA 3TNQB 3GP0A 4KUJA 5AR3A 2EU9A 3C4CA 4H58A 4IB3A 4DITA 4EJNA 3HV5A 2GNFA 1SNUA 3HVCA 2QKWB 4WKQA 4EHZA 4JBQA 4BCMA 4BI2A 2UZNA 2ZV2A 3QUPA 5TE0A 4O7RA 4R5YA 1ZYJA 1HCKA 3FI4A 4WUAA 3U4WA 5I9WA 3G0FA 4GL9A 3E8DA 2X0GA 3TM0A 3S4QA 5HTBA 3MYGA 4QP7A 4GUEA 4YZ9A 3ZOSA 3E8CA 4Z7GA 3R21A 2BKZA 5DBXA 2B4SB 5LQFA 2HW6A 3R0TA 4LGHA 4MH7A 3UOKA 4TZRA 3KB7A 4MX9A 5H8BA 3V51A 4HVIA 4H05A 1YHSA 3ZBXA 2QOCA 3OXIA 4XHKB 3R71A 1M2RA 4I41A 5AV3A 3D9VA 3UJGA 1O9UA 4YU2A 4LYNA 4C58A 3FZSA 2C6LA 4FSWA 5HO6A 3RKBA 5DR9A 3POZA 2BALA 4FTTA 4M66A 3LCOA 4MKCA 3VS4A 3OY3A 3EB0A 4PX6A 3QKMA 5KE0A 3RINA 3QD2B 4CLIA 4ORKA 2FSLX 2QD9A 4V0GB 3SQQA 4EH6A 5CALA 2BZJA 3IW7A 2WTKC 2BRGA 1H28A 2XP2A 3KCKA 4LL0A 4WSYA 4ZY5A 2I7QA 5IQDA 4E93A 3C5UA 4NWMA 3DAKA 3VS1A 5J9YA 3TI1A 4TY1A 4F9WA 4S34A 2OI4X 3MFRA 5L4QA 4CFUA 1W8CA 3DB6A 4I1ZA 3QUEA 4FKSA 3BYUA 3ITZA 5AP4A 1ERKA 1YXVA 3A8WA 3IQ7A 3VUIA 4MXXA 4B99A 2H96A 3OOGA 1FINA 3MPMA 3P7CA 3IDBA 4TW9A 4M15A 3G2FA 5CS6A 3CBLA 1FGKA 4FT9A 4B8MA 3ORPA 2GMXA 3R1QA 5JZJA 4KABA 3Q96A 4FODA 3RALA 4WUNA 4KA3A 3SD0A 3GCQA 5EFQA 3RK5A 1IG1A 5CI6A 1REJA 1KSWA 2OO8X 4YLKA 4PDOA 5CT7A 2J0LA 5FGKA 5FP5A 2C4GA 5GZ8A 1XBCA 1WBSA 3EKNA 5DIAA 4ZLYA 5JMSA 3QYZA 4FTJA 1VEBA 2C3IB 1ZRZA 1XH9A 3I4BA 3LZBA 1H1QA 2X2KA 4FKPA 3VBWA 3Q3BA 3ACJA 2XK8A 4OBPA 5J1WA 3DZQA 4C61A 3EHAA 1OM1A 4D55A 4H1JA 3TN8A 4H36A 3N4VA 4PQNA 4O91A 3RPRA 2GDOA 2VNWA 4RA4A 3U9NA 4EC8A 2ERZE 3MVJA 4YC6A 5JEBA 4FF8A 2C6IA 2PMNX 4FV3A 4ONAA 3PE2A 4ACMA 1XKKA 4HCUA 4UXLA 1PXIA 3ZCLA 4AW2A 4B9DA 4BGGA 4DF3A 3LVPA 4TTHB 4CG9A 3AD4A 1U59A 3FMEA 3OCSA 3DNEA 3QYWA 5CTPA 3SKCA 4QMSA 2A4LA 4ZLOA 4MYGA 3A8XA 4OW8A 4U9AA 2VN9A 1M7QA 4NTSA 2OSCA 5AR4A 3BGPA 3TNIA 4LL5A 2ITXA 3A62A 4OTFA 3E5AA 4FL1A 4WNKA 3UC4A 3LCDA 3HRCA 5C4LA 1KE7A 3MJ1A 3FXXA 5FM2A 5LVLA 3P86A 2IPXA 3A7GA 3DDPA 4KNBA 3K5VA 2UW6A 2GFCA 2E9NA 3QUDA 2WEVA 2CGXA 3CE3A 4KB8A 1CKJA 5IQAA 5C1QB 2QLQA 2I0EA 2VTHA 3NR9A 1WBPA 2OG8A 3COIA 1R3CA 5C03A 2QOKA 4M69A 4U79A 2R3LA 3PA3A 3ZFYA 2XZSA 3QALE 3QZHA 3QCXA 4F7NA 2OJGA 3DXQA 5DR6A 3AQVA 2RG6A 2SRCA 3WF8A 2Q0BA 4I4EA 5TF9A 2UW3A 1XWSA 2AC5A 4XV1A 4C35A 4EBWA 3GU8A 3UIBA 4F08A 5EH0A 5CAUA 2OLCA 5CEMA 1YQJA 1H01A 4PY1A 3PP0A 4QT1A 3ZUUA 3BLQA 3TG1A 2BR1A 3F3TA 3W2RA 5JN2A 4OT5A 5I9UA 3DPKA 4BDFA 5IKWA 3KU2A 1UU7A 2OXXA 4RGJA 3PZHA 5FTOA 4I24A 5E8SA 3VBQA 4CFMA 4EOKA 4BCPA 5IA2A 2CSNA 5E90A 2AC3A 2OWBA 4O0RA 3DQXA 5DA3A 4LGDA 2R0IA 2C6OA 2R0UA 1MRVA 3MY0A 3OY1A 5A6OA 4XMOA 3E92A 2WD1A 3FI8A 4FKWA 3TDVA 1KOBA 4YC8A 4FV8A 4RX9A 5CEKA 3PFQA 5ANKA 2VO6A 5KNJA 2FSTX 5BNJA 3NUAA 4UY9A 4TWPA 1UU8A 2VX0A 3ZH8A 3Q53A 1MRYA 2C47A 2G1TA 4OAUC 3BGQA 3MH2A 3A99A 2R4BA 3F82A 4FVQA 3I5NA 3JYAA 4J71A 2OXYA 3ROCA 3PXKA 2BDFA 3A7FA 4C8BA 4YURA 2J5EA 3GI3A 2Y6OA 4GT5A 4HZSA 5HBJA 5CSWA 4FSNA 2V7AA 2G01A 3QRJA 2OJFE 4TYEA 3ZO3A 4BDEA 3NPCA 3SGCA 3IGOA 4QMNA 4ZSGA 3ET7A 5BMMA 3RGFA 4YO6A 5CNNA 4Z9LA 4TYHB 1A48A 3CTQA 4O0UA 4YJRA 4FA2A 1SVGA 4W8DA 5EKOA 1WAKA 3MFTA 3P23A 3CQEA 3WIKA 4D9TA 3LFQA 4BVUA 3ZHPC 3E93A 2XNEA 4CCUA 3MVMA 4DA5A 4J8NA 1W84A 1V0PA 2G2FA 2WMSA 3BU3A 3EFLA 2VTNA 3GC7A 3I5ZA 1G3NA 3KVWA 4FTRA 2BRBA 4CFVA 3OBGA 3QRIA 5JRQA 1YXSA 4M7IA 3A4OX 2PE2A 1J3HA 2OJ9A 3QCYA 5FQDC 2W1IA 2RFNA 1PXMA 5HICA 4XV2A 5CLPA 4IAAA 4EWHA 1WVWA 3HYHA 5BYYA 5AAGA 1SVHA 2VWBA 4QMVA 3H30A 4AN2A 3EZVA 4DFYA 2UZVA 5FXSA 3TTJA 3F5XA 3OF0A 5FEQA 2PYWA 3Q60A 3K54A 3KRWA 4YPSA 2EB2A 3S1HA 2YACA 3KQ7A 3C7QA 1VYZA 1QCFA 4S32A 4G31A 4M12A 4ZJVA 4B4LA 4AXAA 4BWKA 2IW8A 2W5AA 4TKSA 3FXZA 4FC0A 1V0OA 4E6DA 4DFNA 3A7JA 2OZOA 3O51A 3ENMA 4IB0A 2QVSE 4BYIA 1J1BA 5DR2A 5HG9A 5L3AA 3EL7A 1ZMWA 4PL4A 5ANJA 4I5CA 4D1ZA 5HCYA 5F1ZA 3QF9A 4I23A 3GFEA 3ZMMA 3S95A 4FV9A 3L9NA 4AX8A 2BILB 3WF9A 3Q6UA 1YOJA 1LEWA 3JPVA 1FBNA 2WTKB 2CKQA 2Y6MA 4JBOA 4ZIMA 2VO3A 5J87A 4R77A 1YDRE 4V05A 3NEWA 3CR0A 4XOZA 3QC9A 5L8LA 3UQCA 3TNWA 4CG8A 4D2WA 1KV1A 4AW1A 3F3VA 2HXQA 1M2QA 2PVNA 4FV1A 3MGYA 5AV0A 3HUBA 5M57A 2ZB0A 1H1RA 3NZ0A 5AUXA 3WZUA 4F6SA 3T9TA 4CVAA 5LXMA 4FIEA 2GNHA 3FMJA 2C3KA 1EH4A 3PG3A 4X3FC 4WG3A 1OBDA 1XO2B 2V62A 3F9NA 3P08A 1H26A 5KCVA 4J98A 5KMKA 3U54A 1Q3WA 1R1WA 4FR4A 3KMUA 3BYMA 4WRSA 5HOAA 3REPA 5IA3A 4LUDA 3QQLA 2Q83A 3U51A 4BZDA 3U6IA 4NTTA 4O0WA 3MPAA 4NL0A 3NUXA 4GW8A 4BHNA 2XK3A 2YM5A 4IZAA 4BI0A 4DAWA 4DT8A 2HXLA 3TNHA 4RFYA 3FZ1A 4XX9A 5KMLA 2V5QA 4DLJA 4F63A 3CSVA 3BV2A 3D5VA 3UOHA 4FT7A 4E7WA 2QQ7A 2WMBA 5FXRA 3F66A 5DYJA 4JLCA 3ORMA 4ZTHA 2EWAA 4NZWB 5CU0A 3KRLA 5IQIA 1KE6A 2ZVAA 3OEZA 5HLWA 3COMA 2VTTA 4FNZA 5DT3A 5KMJA 3ZM4A 4V01A 4ASZA 4BCFA 4EOJA 5M44A 2BAKA 2KULA 1UWJA 3Q9ZA 5AUVA 3UMWA 3MS9A 2C1AA 4FG8A 4IMYA 2JBPA 3LMHA 4EZ3A 3B8QA 4IJPA 1JWHA 2J50A 5C01A 4NEUA 4Z3VA 2UW7A 3L8PA 4R78A 3BGZA 4L9IA 5HGIA 5CAPA 4C4GA 4C2VA 3FZTA 3SOAA 3F2NA 3ANQA 3KXXA 2XS0A 3PA4A 1KE8A 3QTSA 3VJOA 2B52A 3Q4TA 2GPHA 3WBLA 1HCLA 1H8FA 2PMLX 2CNVA 5DN3A 3GCPA 3COHA 3FAAA 4FKQA 4IIRA 4WIHA 1YWNA 3C1XA 5IEXA 4QMWA 3NVMB 5DMZA 3LJ0A 4F99A 3R2YA 1RDQE 1MP8A 2WTDA 4RJ7A 4AZTA 3MH0A 4G1WA 3AG9A 4G6NA 4N0SA 3R04A 2F2UA 2GHLA 2XJ2A 3GC9A 3NNWA 4ANLA 2VWWA 1ZOEA 3R9RA 1AD5A 3OWPA 2I6LA 4GK3A 2XRUA 4AOTA 4BWPA 4E4NA 2B7AA 3IW4A 4CSVA 5AUYA 1ZZLA 4YTFA 2VX3A 5AR8A 4O83A 3NNVA 4R3CA 4RFMA 3TUCA 4A9UA 3UQGA 3H9OA 4L01A 5I3RA 5AV2A 3HAMA 1TVOA 2X1NA 4D5HA 5IH6A 3KULB 3RNYA 4P4CA 3VBYA 2HY81 4QP6A 5CU2A 2YM3A 4EH2A 4YZBA 4IHPA 5BVOA 4R1VA 2Z60A 2XNOA 3CD3A 4U5JA 3R7UA 1T45A 3OD6X 4AU8A 2OIBA 4C3FA 3LFBA 3QTXA 3ZSHA 3EFJA 4HW7A 2XNNA 5TO8A 2X8IA 4R5SA 4H3PA 4Y73A 3H0YA 5M06A 4K18A 4BYJA 3VS2A 4EYJA 5HD4A 1S9JA 1RE8A 4H39A 1U54B 3NUPA 3WF7A 1ZY4A 3DKCA 3QC4A 3R9HA 1OL6A 3C13A 3KXMA 3EIDA 1FPUA 5HG8A 4TXCA 3UVQA 3H9RA 4BFMA 4JR7A 4PNKA 2RSVA 2F2CB 4XG8A 5KMIA 1Y57A 2PWLA 3PRFA 2HZ0A 5A4QA 4G9RA 4A07A 3ZM9A 3BHTA 2CKOA 3BU6A 3QGWA 2QHNA 2XK9A 2B1PA 4RJ8A 3BWFA 3FHRA 5EYCA 5EM6A 2O63A 4FV5A 4XLVA 5E7RA 4F9BA 5J5TA 3KMMA 3OWLA 3I60A 2WQEA 3RTPA 3GU5A 4M0ZA 3FY0A 4U8ZA 4RC3A 4RWJA 5E8YA 3CKXA 4P5ZA 4QMYA 3CTJA 4HCVA 1PF8A 4IX3A 2IZRA 3TNPC 3M42A 3R6XA 4BZNA 4EQMA 4PTEA 5AUZA 4QYYA 4WSQA 2Y7JA 2V7OA 3OZ6A 3PIYA 4P90A 4X2FA 3DY7A 2UV2A 3UYSA 1UNHA 5AA9A 3GB2A 2WB8A 2ZM3A 1S9IA 1UNGA 4O1PA 4X2GA 4YJPA 4AFEA 4HCTA 2CDZA 4JBPA 3R8MA 3GENA 3U55A 3PDTA 3QA8A 4FSTA 3OWKA 5T6KA 5CI7A 1OIUA 3DZOA 1IA9A 3UTOA 3HMMA 1OL7A 4DH5A 2BIYA 3OCTA 3HV7A 4EBVA 4TYGA 4XEYA 2VTMA 3QTWA 4ITIA 3A2CA 4RMZA 3MWUA 2O2UA 4TPTA 3ZLWA 5KMNA 4IWOA 5EK7A 5DWRA 4C4IA 4EUTA 4O7WA 4D1XA 3LFNA 4X3FA 4FSYA 3RP9A 3BPRA 2P55A 1LR4A 3NYXA 4X0MA 3ULZA 4ERWA 2YWPA 5HTCA 2BIKB 4FYOA 1PKGA 3PXZA 3VUMA 4L6QA 3V5TA 4BKJA 2WQNA 4FE2A 4A9RA 4E26A 3ZLYA 3MB6A 4AE6A 5EW3A 2QOFA 4U40A 3C5IA 1E9HA 2Z7LA 4YBKA 5DI1A 5KKRC 2W1EA 4D58A 3V6SA 4QMLA 3ZSGA 4OAVB 3RCJA 4IVCA 3UGCA 3CJFA 4R7IA 3DGKA 5LVPA 4RX7A 3HRBA 5CU6A 1UKIA 4ZZMA 5LMAA 4XP0A 3FLSA 2WNTA 5DRBA 4R7HA 2VO0A 1BL6A 5FUTA 4FTUA 2J90A 4MF1A 1YWRA 2GNGA 3SVVA 4RFZA 1M7NA 2PE1A 2I0VA 4J52A 3TEIA 4NJDA 2GHMA 5CVHA 4K77A 3BYSA 3RPYA 2YIYA 3W2SA 4D28A 3OOMA 5HI2A 5TOZA 4XP2A 2F7ZE 2REIA 5CF6A 3DB8A 4JG6A 2Y0AA 5LVOA 1FVVA 2FGIA 5CY3A 1Q5KA 4JAIA 5M08A 5AFVA 3ALOA 1SMHA 1H27A 4ZXTA 3R7IA 2IW9A 2IVSA 1CKPA 4ZTRA 4DHFA 1PRYA 2HZNA 3D7TA 2XBJA 3I81A 5KMMA 3PXQA 4AA0A 1REKA 2C5VA 2VTAA 3FI2A 3O7LD 4YJNA 3MBLA 3C4XA 2VGOA 4ANSA 2PPQA 2Z2WA 3I0OA 5ACKA 3GT8A 3NW5A 3QTQA 4AOJA 5EHYA 4JQ7A 3ZFXA 4PTCA 4YNOA 1GOLA 3ORTA 2XYUA 3PPKA 4A4XA 4O0SA 3CTHA 2JKQA 2ZJWA 4L00A 2QURA 2E2BA 4QP4A 1UVRA 2H9VA 1QPJA 3FDNA 3TXOA 3V8WA 4M67A 4ITHA 4ANBA 4ZSLA 4CT1A 3RAKA 3ROYA 3FMNA 5IQBA 3L8XA 4BTJA 2FUMA 3H9FA 3FY2A 4AGCA 3SAYA 2PUNA 4ZAUA 4YC3A 3FKNA 1OB3A 2YJRA 3ZTXA 4FIIA 4ACGA 1XH6A 5DLSA 1W0XC 4JI9A 3G6HA 5FTQA 3QFVA 4RPVA 4G3CA 3R00A 1IASA 5ANGA 5GNKA 4DGGA 4JL9A 4RJ3A 1Q8TA 4AWIA 2JC6A 3PPJA 1A9UA 5BQ0A 1JSTA 4CZTA 1YKRA 2A27A 1JQHA 3EN9A 2ITZA 3ORIA 4XP3A 5IQHA 2RFDA 2GFSA 4FKIA 4E1ZA 3NYNA 4GSBA 2LAVA 4AZWA 5AP6A 3WI6A 4BIBA 4FV4A 1KOAA 1ZYDA 4BF2A 4BDIA 1LEZA 2J0IA 5CU3A 5E9EA 3EQFA 3U8WA 1JSVA 3FUPA 4U41A 3GXLA 4OGRA 4GVJA 3E87A 1PXJA 3R9DA 5GZ9A 4IB1A 4RWKA 2JAMA 4F9AA 3LXNA 4C4JA 5L2TA 3PVUA 5ETFA 3NNUA 4II5A 4B0GA 2C0TA 4YR8A 3M11A 4ALUA 3LCSA 1PYXA 3QQHA 4M14A 2VTLA 3MY5A 4RIYA 2VTQA 1O6LA 4FTKA 2EXEA 4GFOA 3V5LA 4FIHA 4ANMA 2J0JA 1KE5A 4AS0A 5I5ZA 4G6LA 5AP3A 5BVDA 2YEXA 3F2RA 3OVVA 1OUYA 1XR1A 4FIJA 1OIYA 4IACA 2P33A 3TJCA 3I1AA 3P5KA 2J5FA 3N51A 3V3VA 4U3ZA 1JKTA 2IVTA 5H8EA 1CDKA 2ETRA 5DT4A 3QAME 4BIEA 3W2QA 2UZOA 4L3JA 4AAAA 4F6WA 3QBNA 4TRLA 4MXZA 2PVRA 1XJDA 4TN6A 2CLXA 4UXQA 4AGUA 2VTOA 2PHKA 3ZO2A 4NYEA 2B54A 3MTLA 4GK2A 4O7YA 3NNXA 3ODYX 4BTMA 2CGVA 2F4JA 1BKXA 2PTKA 2WAJA 3KF4A 5CX9A 4O7LA 2YHVA 4O7VA 2B55A 4HGEA 5M4UA 1U5RA 3LFEA 2I0YA 3HA6A 1IR3A 1GJOA 3E88A 4BCHA 3PYYA 2J0KA 3DBFA 1A06A 3EN6A 4H1MA 3O8TA 5EW9A 3IOPA 1XQZA 3FLQA 4OTRA 5CZIA 3WZEA 3QZIA 5AX9A 3FL4A 4FZAB 3AC4A 4O0VA 3EH9A 3ID6C 1AGWA 2ZAZA 4ANOA 3AC5A 1DI9A 4XOYA 4UZDA 4F70A 2IVUA 2VTJA 3W1FA 4GV1A 4IANA 3TUBA 2YIRA 1H0VA 4FYNA 5LMBA 3HP5A 3AT4A 1OPKA 4FVPA 2QG7A 3EN4A 3FKOA 3AC2A 5JKGA 2YABA 3FMHA 4KIPA 5HEZA 3OEFX 3C0IA 4HZRA 1FQ1B 4L3PA 3FMMA 3FMDA 4JOAA 4QD6A 2BFXA 5EHLA 4EH8A 5HU3A 3TACA 4XYFA 2WMTA 4Q2AA 5EI6A 2DQ7X 4RIWB 4C38A 4GYGA 4X7QA 4ZTQA 2BMCA 5L8JA 2B9JA 2OZAB 4U80A 3O2MA 5B2KA 4YTCA 4O7NA 3MY1A 4GG7A 1H1PA 4QPSA 5EYKA 5JQ5A 1CMKE 4WRGA 3SRVA 5L2SA 1PMVA 2WOTA 3DK3A 2W1ZA 1P14A 2AUHA 4KD1A 3K3IA 4ZMEA 4FSQA 3FL5A 4TL0A 3KFAA 3PZEA 2R9SA 1JKLA 4I3ZA 2PE0A 3OBJA 3UO4A 2XCHA 5L2WA 3HX4A 1GZNA 4FTNA 3LFFA 3QXOA 4JX7A 5EQEA 3VHKA 2WTCA 3KVXA 3MW1A 1SYKA 2XNPA 3F3WA 3QZGA 3AD5A 3Q32A 4RC4A 4RWIA 3A61A 5FM3A 4I6HA 4YJQA 5KZIA 4YTIA 4AZFA 2ITVA 2XJ0A 3FQHA 3RAWA 4CV9A 3FLYA 2UVYA 5EM5A 3ZC6A 3W2PA 3ZS5A 2XKDA 1MRUA 4UV0A 3BX5A 4C34A 3IW5A 4M8TA 2JDTA 2QC6A 2R3PA 3OTUA 5FDXA 2QOIA 4YLLA 4JG7A 3WYXA 3WIGA 5L2IA 2OJIA 3KXGA 4EJ7A 4I93A 3LIJA 4WG5A 5HCXA 3DJ5A 1YVJA 1NY3A 2QI8A 4U0IA 3KRRA 1VR2A 5F95A 5D10A 5BVFA 5EYMA 2PMOX 1UNLA 4BDKA 1G5SA 1U46A 3PRIA 3LM0A 2UZEA 1IA8A 4LOOA 3GU7A 3SDJA 1BYGA 2XIRA 3KK8A 4ZLZA 2QO9A 3F7WA 3D4QA 3Q9XA 3BLRA 5HO8A 1OKVA 3QKLA 3F5PA 4I0SA 2BZHB 1B38A 1CTPE 4LRKA 2ZOQA 4M84A 1M2PA 3AMYA 5D12A 4I21A 4ZOGA 5IG1A 3KMWA 3QRKA 4MWHA 4UMTA 5AM7A 3OP5A 5HG7A 3TTIA 1CKIA 5JK3A 3VS6A 4CQGA 4PWNA 3NAXA 2HCKA 3TDWA 4Y5HA 4Q5EA 4JX3A 4HYUA 5FXQA 3RK7A 2FA2A 3TZ7A 4J95A 4YZCA 4FNXA 2IW6A 3NCGA 5GJGA 5H2UA 3ZFMA 4EH5A 4D9UA 3V01A 4OTWA 4UB7A 3EQPA 5ICPA 4HJOA 4QYHA 4AZEA 2BUJA 2R3QA 4QMOA 4BKZA 3RM7A 3FV8A 4N57A 2J4ZA 2W17A 1TQPA 3QWJA 2R3IA 4FI1A 4GIIA 4UZHA 4E6QA 4EYMA 4GVAA 3UNKA 1P4OA 2H34A 3DKFA 2OK1A 2BDWA 3WZDA 3ZSIA 3DDQA 4UX9A 5AUWA 4FG7A 3UMXA 3TZ9A 3VO3A 2A1AB 4JS8A 4PL5A 2CMWA 5ACBC 1OPLA 4PV0A 4F0IA 2ITOA 3PPZA 4FL3A 3TKUA 3WF6A 3D15A 2WMAA 4JIKA 4K2RA 3BBWA 3R7GA 4YBJA 4ZJIA 1B6CB 1H1SA 2G9XA 1Q24A 3F7ZA 3OROA 3PSCA 4DYMA 3QWKA 5HNIX 4FSMA 5IQFA 1GAGA 2KTYA 2X9EA 4X21A 4DG0E 2WQBA 3A7HA 4J99A 4E5BA 1F3MC 4E73A 2EB3A 3NUYA 4Y95A 3BIZA 4IAYA 2JBOA 2OIDA 4MXOA 3ZLXA 1UKHA 2C3LA 2C5NA 2PZPA 2O0UA 2XK6A 2CNQA 2G2HA 2YZAA 5IH4A 2VTPA 2XEYA 4QMUA 2R3OA 3BHYA 2V22A 3L9PA 2QHMA 3M1SA 4L46A 4DG2E 2UVXA 5K4JA 4MXCA 1GZKA 3TV6A 4QMMA 2XVDA 4LG4A 4AA4A 4IX4A 4EI4A 4EOLA 2XJ1A 4E4XA 3UVPA 1NVRA 2HY0A 2W1CA 4K8AA 4C7TA 4MBJA 4EH9A 3UQFA 3RHXA 3RAIA 3BQRA 4CQEA 4I5HA 4XJ0A 5JRSA 3VW8A 4AZVA 3KXZA 4EHGA 2W9FB 4EK8A 4IW0A 5H9BA 5DNRA 1BI7A 2HZ4A 4DFBA 1OKWA 3UP7A 1H00A 1ZY5A 4YZMA 4LM5A 4QMZA 5BX0A 3K5UA 4KWPA 2C3JA 2W1GA 4G3FA 4I0TA 4U6RA 4AGDA 3BE9A 1GIHA 4WOVA 4AG8A 5E8XA 2O5KA 3R1NA 4CLJA 1PHKA 3ANRA 2AYPA 4JG8A 2NRUA 2ZMCA 3KF7A 4GJ3A 4CCBA 4GG5A 3O8PA 3R8VA 2P2HA 4FTIA 3FSKA 4PUZA 2PZYA 2XK4A 3QCQA 4FKGA 4IFGA 4MK0A 2BFYA 2Z8CA 5J7BA 2ESMA 2YCFA 4S33A 5EI2A 5I9YA 4C37A 1UU3A 3RVGA 2VX1A 2YA9A 4M69B 5ANDA 2WU6A 4HOKA 4HVHA 1OVEA 5CXZA 4QYFA 5G1XA 3ZRLA 4XG3A 2XH5A 2Z7RA 3W33A 3VUKA 5BVEA 2WU7A 2XA4A 4GK4A 2VWZA 4U42A 4FTLA 4D4VA 3DBDA 4J7BA 2OH0E 4FZ6A 2YWVA 2RFEA 5CEIA 3P4KA 4LQMA 3I7BA 3EFKA 2XBAA 3PY0A 4M68A 4F9YA 2C6MA 4KBKA 1PW2A 2ITPA 2HENA 3EMGA 3G5DA 3NAYA 4WD5A 4ERKA 2FYSA 4PP9A 2RL5A 4IXPA 4BCKA 2YCQA 1YHVA 4CMTA 5LWMA 2CNUA 3PJ3A 4TT7A 1R0EA 2P4IA 3G9LX 1H07A 2CGWA 2C68A 1Q8YA 3TKHA 3D94A 4I4FA 3HMOA 2BHHA 3CC6A 3EJ1A 5AIKA 5HG5A 2NPQA 4CFFA 4CTBA 5J95A 1YI6A 3PA5A 5BYLA 5K9IA 5CQWA 5D11A 3W18A 4UWBA 5GZAA 4EONA 3GU6A 4DINA 3WZJA 5ANOA 5AEPA 4ZJJA 1TKIA 3NGAA 4CMUA 4ZSAA 3ZRMA 3QHWA 2JKKA 4CT2A 4GU9A 3LLAA 1WCCA 3NYOA 4GU6A 4BCOA 4DTKA 5F9EA 4RLKA 5M55A 5JGDA 4I5PA 5LCJA 3OMVA 5AX3A 1VJYA 4DFXE 4PNIA 3UDBA 2W06A 1H1WA 1V1KA 5HKMA 4APCA 5AMNA 4HYIA 2X7GA 3OTVA 5HHWA 4NKSA 3VQUA 3ZC5A 3OXZA 3W2CA 4EC9A 4A7CA 2YLEA 4KKEA 1YW2A 2R64A 3RHKA 3RJCA 3ZXZA 2DWBA 4XBUA 5DH3A 4RVTA 5A4LA 2XKEA 5D1JA 5HLNA 5DGZA 1Y8YA 4M0YA 3GOPA 4L43A 1STCE 5KHXA 4IVDA 5DFPA 1NA7A 3G51A 2YM6A 3I7CA 5AP2A 1F5QA 4KSQA 3A7IA 5FBNC 1H25A 3QTUA 4IAZA 5FD2A 2JFLA 4WG4A 4XG6A 4FX3A 4RJ5A 5J1VA 3VUGA 1P5EA 3SOCA 4HPUE 3JS2A 2YCRA 4KAOA 4L45A 1URWA 3O17A 4TWCA 5HE3A 3WE8A 3H0ZA 5IA0A 4MHAA 4DGMA 2I0HA 4BCNA 4ZZOA 2PUUA 1Q8UA 2I40A 5CASA 2G2IA 4O21A 3LOKA 2RKUA 3E7VA 4S2ZA 3ULIA 4BI1A 2VWYA 2PVFA 3IECA 4XBRA 1ZMUA 5HVYA 5AR5A 3SG8A 2W4OA 4YMJA 2H8HA 2Y4PA 4FK3A 5KBRA 4MD9E 5I9XA 3ZEWA 2JKMA 3R7VA 2W7XA 4O38A 3PWYA 5KX8A 5CYIA 4U45A 5EOBA 4G2FA 3E62A 2ZDTA 2QG5A 3ORLA 1L8TA 3C4ZA 3M2WA 4QPAA 3BBTB 2IZSA 2WMUA 5IUIA 3R7YA 4E5WA 4GIHA 3L8SA 4O0TA 4E4LA 4D4SA 4MXAA 4QYEA 5DHJA 5C4KA 5J7HA 1VZOA 3R30A 4FTMA 3QD0A 5CF8A 4ZP5A 1W98A 5HORA 4LGGA 3EQDA 4S30A 4YHJA 4A9TA 2PZ5A 1PXPA 1ZZ2A 4MVFA 3GCVA 3UODA 5J9LA 3HP2A 1IAJA 3E3BX 2W4KA 4RX8A 1PXLA 3V6RA 3GQIA 4AT5A 3MIYA 3FQSA 5CVGA 5F20A 3QQJA 3KN6A 3LW0A 2VTSA 3W32A 4F09A 5HO7A 4PMTA 4NUSA 4CFNA 3FHIA 2GNLA 2WTVA 1OGUA 1GZOA 4DEBA 4K0YA 2C69A 2OXDA 3RM6A 1PXKA 4XV3A 4FEQA 4CZYB 3EL8A 3TJDA 4PMPA 4YSJA 5E1EA 3R1SA 2PVJA 2JEDA 2RGPA 4PP7A 1TQMA 3RPVA 2ZV8A 4NFMA 3DBCA 5K5XA 4RSSA 1J91A 3E7OA 3UO6A 3TL8A 2FSOX 4OTHA 1FVTA 5ANIA 4NIFA 4W4VA 5KHWA 1WVXA 3V8SA 4O2PA 2GSFA 4P7EA 3QGYA 3DKGA 3QTZA 2ZV9A 4QTDA 5EM8A 3ZZWA 5J79A 3AC3A 3EN7A 2VO7A 3OC1A 5K5NA 3NUNA 4IB5A 3FC2A 4WNOA 2YM4A 4GEOA 4X2KA 4PPAA 3TIYA 5EYDA 2Z02A 4FZDB 3JUHA 3ZXTA 4AA5A 5BYZA 5DG5A 4D4YA 3BWJA 2RIOA 5I9VA 4ZTMA 4O7ZA 2PK9A 2XNGA 3GOKA 1KV2A 4OUCA 1DAYA 4HPTE 5FWKK 4J96A 4DGOA 4TNDA 5F4NA 4XG9A 5ETIA 4BICA 4GS6A 4EOOA 2I1MA 1DI8A 2ITWA 2VWUA 3GCSA 4ANQA 3FKLA 3MN3A 3HRFA 3P0MA 4DFUA 1WFCA 4RZVA 3UC3A 2Y4IC 3C50A 2VTIA 3D7ZA 5FEDA 4CFWA 4JBVA 3EFWA 3LM5A 1O6KA 3HMIA 4RIXA 4ASXA 2GQGA 3QA0A 5DE2A 2Y8OA 4IZ5A 4B8LA 5A4TA 5I0BA 3S00A 3QD4A 4FTOA 4DC2A 2VWVA 3RK9A 1DAWA 4AP7A 4BDCA 2O3PA 3R9NA 3AMAA 2WKMA 4U43A 5EOLA 4FV6A 5HNGA 2R3FA 2VD5A 3UIXA 3CGOA 5M4FA 3CGFA 2DS1A 3LPBA 3BV3A 3UE4A 5CXHA 4BCIA 5ETAA 4F7SA 3IO7A 5CQUA 5JFVA 5LVMA 4O22A 1WVYA 3DCVA 3U9CA 3R28A 2YAKA 1ATPE 4YPDA 4IQ6A 3UZPA 4E5AX 3Q6WA 2YM7A 4ZSEA 2ITQA 3NSZA 4FG9A 4AQCA 2OIQA 4FT5A 5A54A 5C27A 4X6RA 3OXTA 4IFCA 4EUUA 3R22A 4H3QA 3U4UA 5IMEA 3AGLA 4TNBA 4A9SA 4L7FA 3RZBA 1XBBA 4F64A 2P3GX 1NT2A 3BLHA 4IVBA 5TKDA 5AP1A 3NX8A 1PYEA 2PY3A 2OW3A 3LXPA 3P7BA 4HYHA 4L52A 4UWYA 5CSHA 2JDOA 3MVLA 5E8ZA 1OIRA 2V0DA 4DE4A 3TT0A 3UOLA 4L7SA 5ETCA 1Y8GA 2UZTA 5CEOA 5G6VA 4IDTA 4QNYA 3R7OA 2XCKA 2PUIA 2UZBA 5FDPA 2UZLA 3FC1X 4D1SA 2ONLA 4EOSA 4CKJA 1E1VA 3JVSA 2C6TA
chains in the Genus database with same CATH superfamily
1GNGA 5B2MA 2BDJA 3CKWA 3OW4A 4GUBA 4CKIA 4FGRA 3MIAA 4U44A 3TUDA 3GFWA 5HTIA 3VUDA 2C6KA 3IONA 4IEBA 4K11A 5J5SA 5AUUA 5E8VA 1P4FA 3P7AA 5IZFA 3SC1A 4FTQA 5HX8A 3W0RA 1WMKA 2E9VA 4XLIA 3N4TA 2QR8A 2C6DA 4R7BA 4IE9A 4FL2A 4PMSA 5K4IA 4XRJA 2JITA 4ALWA 2QONA 4G3DA 4YJUA 1PKDA 3UG2A 4FKTA 5GHVA 2GS7A 4BDBA 3S2PA 2PVMA 4FZ7A 4I0RA 3NW7A 4QNAA 5A9UA 2C0OA 3PLAE 3B2WA 3NDMA 2NRYA 5AA8A 2JKOA 2QODA 4AW5A 4DT9A 1W82A 4KIOA 3TIZA 5EQYA 4I22A 3ORXA 2F7EE 3HL7A 1ND4A 3BU5A 3GGFA 5KMOA 3BI6A 4JNWA 4FOCA 2B9HA 5CEQA 1SZMA 4DTAA 4L3LA 4GFMA 2W05A 4CFXA 5JGBA 1H24A 4UALA 2XMYA 1JOWB 4EWQA 2QOBA 4HYSA 4QP8A 4E6CA 3WYYA 2X4FA 5BVWA 5L8KA 5T3QA 1M17A 3CLYA 3S0OA 4B6LA 5GIOE 2AEGA 4BGHA 2GS6A 4KINA 4MWIA 1ZWSA 4NCTC 4J8MA 4FKRA 4BZOA 3BHUA 4YJSA 4F0GA 4F7LA 1RQQA 4X3FB 3OUNB 4QP9A 4BL1A 4BTKA 5GINE 3UIMA 4L44A 4ZSJA 4IM2A 2XYNA 2B0QA 3TV4A 4OR5A 3EYHA 3BYOA 3PTGA 4BBMA 3LKMA 5CZHA 3ALNA 4C57A 3D5UA 4IC7A 4DEEA 4Y8DA 4U81A 5H3QA 5BVKA 3U87A 2F49A 1HOWA 2WMVA 3PVBA 4MNEA 1Q8ZA 3BEAA 3QZFA 5HD7A 4J97A 5AAEA 2IEWA 4U3YA 5K0KA 1ZOHA 1PJKA 2WXVA 4K33A 4O84A 2OKRA 2WMXA 3HDNA 4I6QA 2RFSA 3QCSA 4YGAA 4AOIA 4M97A 2CGUA 3HMNA 5CEPA 3LQ5A 5LARA 4TYIA 1XMMA 4F1TA 4C02A 3EQHA 3SXRA 5IU2A 2VUWA 4MD8E 4BGQA 4CEGA 4IC8A 4PL3A 3N9XA 3P9JA 4O7SA 1JSUA 1Z5MA 3JY9A 2XARA 4JQ8A 3AGMA 2UVZA 3DBQA 4JDKA 3O0GA 3R8ZA 4A4LA 3DU8A 3R8UA 4JT3A 2NNWB 5IEVA 4KIKA 2X8EA 3G6GA 5AP7A 2E9UA 4XNEA 5DOSA 2OBJA 1QPEA 3NUUA 1CSNA 3SLSA 5HBHA 3D5XA 3IW6A 4JAJA 3BHHA 5BUEA 4W4WA 1XH8A 3AT3A 3VBVA 3DK6A 3H10A 3U6JA 3QL8A 4M3QA 4OBOA 3T3VA 2HK5A 5AJQA 2JFMA 4GJ2A 4X6QC 5JZNA 2FO0A 3ZRKA 3Q2JA 4Y83A 1LPUA 2WMWA 3WF5A 3OWJA 3QX4A 3LMIA 4AACA 1ZLTA 3MB7A 4RWLA 4U97A 2UZWE 4LUEA 4FEVA 2J51A 3LLTA 4HVGA 3HV3A 5C8NA 1J7UA 3TCPA 1WBWA 3R1YA 2F9GA 4XG4A 2CKPA 3ORKA 2ZM4A 4ZS4A 4Q5HA 4BDHA 3BCEA 3UO5A 1K9AA 3VIDA 3P5JC 3H4JA 3NLBA 4KBAA 4EK3A 2ZM1A 3Q5IA 5IMXA 4NU1A 4O6LA 5EKNA 4WNMA 3CQWA 3FXWA 3F5GA 1PXNA 3NYVA 2UW4A 5HNBA 2ERKA 1OBGA 4ZTNA 4BB4A 4K6ZA 3V5WA 3R2BA 3VUTA 3E63A 3VQHA 5AV1A 3FMKA 3LJ2A 2BRNA 3ORNA 3AT2A 3FPMA 3HA8A 4XG2A 3L8VA 2ITTA 5D41A 5CANA 5CF5A 2Z7SA 4FMQA 2F7XE 2OJJA 3L9MA 4FSZA 4O0YA 4RC2A 3DNDA 4V0GA 4C3PA 4USEA 3KN5A 5JQ8A 1YDTE 4QMXA 2HAKA 3NRMA 2GS2A 5HLPA 4C2WA 2QOQA 1PMNA 4FVRA 3Q4UA 2PZRA 5B7VA 3CY2A 1PXOA 4TWOA 5B0XA 4BR3A 2XEZA 4HGLA 3W8LA 4EORA 3U6HA 4BCJA 3TZMA 2YN8A 2G15A 5JGAA 2JGZA 4ITJA 5C8KA 2WTIA 2GQSA 5CSVA 4OT6A 4K1BA 3GCUA 4GH2A 3VS0A 1M52A 3PVWA 2RG5A 4EQCA 3HGKA 5EHOA 5K3YA 3KXHA 5BUIA 4BJJB 3LE6A 3EQIA 2W5BA 4KIQA 2W96B 5L6OA 3FLNC 3LXLA 3W0MA 4LMNA 3T3UA 1UV5A 3LFCA 2WO6A 3MSSA 4QTEA 4GCJA 4RIYB 2QO2A 3FZOA 5LOHA 4IWQA 3VULA 4NSTA 4RLLA 4AW0A 4CNHA 5I3OA 2GQRA 1OUKA 4QMPA 2X7OA 4DH7A 2R5TA 4LOPA 3R8PA 2HIWA 2ZMDA 4PMMA 1Q97A 5GJFA 3CCNA 4ID7A 4AN3A 4DH8A 5EQPA 4LFIA 1MUOA 1OIQA 3KCFA 4ZTSA 4EH7A 4FBXA 4FTAA 4EK4A 4LRJA 4IM0A 2YIWA 5IQEA 3IKAA 2OICA 3UP2A 3GEQA 4I20A 5A14A 2JDVA 2JIVA 2PVYA 3TKIA 3PIZA 2HWPA 5CSPA 5LCKA 2JDSA 4JIAA 3MESA 4F7JA 4MBLA 2O64A 2XM9A 4RT7A 5IF1A 1P2AA 4O1OA 1J7LA 3ZDUA 2YIXA 3DT1A 4F65A 2IJMA 3W0NA 1J7IA 5IA1A 3DXPA 4RA5A 4NCTA 3CPCA 4AT3A 5FP6A 4ASDA 4HGTA 2DUVA 2R3JA 1GIJA 3E8NA 3D83A 5GJDA 1OL2A 4ZS0A 5IDPA 3BZ3A 3QXPA 4HGSA 5M07A 4LRMA 4EOIA 4GKHA 5A3XA 1I09A 2R3RA 3V04A 1Y91A 1Q3DA 3KA0A 4CMOA 3EN5A 3KXNA 2QCSA 4IAIA 2WTJA 2VAGA 4EOQA 3BL7A 2WTWA 4I5MA 4H3BA 3C0GA 3R01A 3DLZA 3BYVA 1QMZA 4NFNA 2QOLA 4LI5A 4N4SA 2YDKA 4WHZA 4JXFA 4YZDA 5KKRB 1XH4A 4G9CA 5EDRA 3SX9A 1UU9A 4HNIA 3V5JA 3DBEA 3GC0A 4MBIA 4MNFA 3ERKA 5HVJA 4KS7A 4I94A 3D0EA 4UYAA 4IM3A 2QOOA 3NMUF 5IPJA 2J7TA 1K2PA 1ZYSA 3TWJA 2VU3A 3F5UA 4J1RA 5JFWA 3FE3A 3UVRA 4F1MA 4FIGA 5IUGA 1ZAOA 5FBOA 2PVLA 2BPMA 1XHAA 2XIZA 3NWWA 4GT4A 3SRVB 3N4UA 1YOMA 3SA0A 4QP2A 2YCSA 5CWZA 1ZYCA 4MF0A 3PXRA 3WE4A 4FT3A 1WBTA 1X8BA 2WFYA 4LOQA 4YHFA 2PVKA 3KY2A 2J0MB 4MD7E 3CEKA 2C6EA 3KL8A 4WT6A 4JQEA 1W83A 3PJ1A 5HX6A 1E1XA 3THBA 5CNOA 2BAQA 4FIFA 4IVAA 3UBDA 3IS5A 3ML1A 3Q52A 3PUFC 3KGAA 2FVDA 4YJVA 4XS2A 5JFXA 2OFVA 4QTBA 4O4EA 5EM7A 2VZ6A 4EZ5A 4YO4A 1YWVA 3L1SA 4FSUA 3ATSA 2XNMA 5HE1A 1YOLA 4G5JA 4QDVA 4DFLA 3C4EA 5HIEA 2EVAA 4C4HA 4D2SA 2NO3A 2R3GA 3CP9A 4HVDA 4UN0C 4EZ7A 3GNIB 1JAMA 4JDIA 3ZO1A 3W0PA 2XKCA 4XUFA 5CAQA 5AAFA 1KWPA 5BV3A 4G5PA 2PU8A 3H3CA 2C1BA 3RNIA 3SW4A 4JVGA 3IG7A 3ELJA 4FEWA 2WELA 1YDSE 3VBTA 4RVLA 5AV4A 4O27B 5HESA 3UIUA 2XAMA 2UZUE 4QQJA 4FTCA 5IISA 5KUPA 3MFUA 1G8AA 2P0CA 3Q4CA 3Q9WA 1I44A 3D2KA 3HZTA 1M14A 1QL6A 3QQKA 4W9XA 5L2QA 4UEUA 4TYHA 5FLFA 3VW6A 1LP4A 3AC1A 5AUTA 2YM8A 3DXNA 4YNEA 3I79A 5F94A 4A9YA 3C4WA 3RWPA 4DH3A 2R3MA 3CIKA 3DA6A 4IZ7A 3E8EA 2ETKA 2QU6A 3HKOA 2UZDA 4ASEA 4LV7A 2E9PA 3RBWA 5M4CA 2QR7A 4BKYA 4DCEA 2WQMA 1W7HA 4MXYA 3OW3A 3G9NA 3ZDIA 3RCDA 3OT8A 2ZDUA 2VRXA 3Q9YA 3RPSA 2ITUA 1UA2A 3B8RA 1Q41A 1Z57A 4USFA 4JJRA 4Q9SA 4P5QA 3BEGA 5AP0A 3CQUA 2YAAA 3DKOA 3FZRA 2XB7A 3MPTA 4A4OA 4UMPA 2UW0A 4UMUA 3BE2A 2GNJA 2Y9QA 3WZKA 4XCUA 4G34A 2X4ZA 4G16A 1AQ1A 3OHTA 3AC8A 5DT0A 5FTGA 2A19B 1QPDA 2ITYA 2WZJA 4PPCA 4QO9A 2XK7A 2R3HA 3DFCB 2J2IB 4V04A 5CAVA 4IDVA 3VC4A 3JR1A 4CRLA 4DEGA 4BTFA 1G8JA 2X8DA 2GU8A 3IGGA 4HNFA 4QTCA 5IH5A 2VGPA 2XM8A 4QQTA 4FICA 3VF8A 3QLGA 4MAOA 3DAJA 2QKRA 2JAVA 4RIOA 3HLLA 2WMQA 3LCKA 1Q61A 5TR6A 3HECA 4Q9ZA 5LVNA 3FEGA 4R6VA 5CU4A 4O81A 5A46A 4RJ6A 1YXXA 3ZBFA 4LV5A 5HIDA 3IDPA 4NJ3A 4YJOA 4QP1A 2W1FA 1PMUA 4N70A 3HDMA 2EXMA 4Z55A 4ZZNA 3UG1A 5EG3A 3MA6A 4ZMFA 3I6UA 3CY3A 3PP1A 1ZYLA 4JDHA 3R7EA 3MV5A 3CJGA 3ORZA 4NW6A 4MQ1A 2GCDA 1YI4A 2F57A 1R78A 3OS3A 4DEDA 4F6UA 5D7AA 4BIDA 4OBQA 2UUEA 4BHZA 4C62A 1O6YA 4L68A 4RG0A 3VBXA 3FJQE 3PVGA 3E3PA 5IQCA 4NM7A 3C51A 4UYNA 1YRPA 3G33A 3PXFA 5L6WL 3BHVA 4F1OA 3UZTA 1OL5A 2VWXA 5M53A 3QQGA 2C0IA 3G0EA 3NIZA 3ACKA 3ZEPA 4AN9A 4S31A 1BX6A 4XH6A 3F3UA 4M13A 5C9CA 4EOMA 3AD6A 3Q5ZA 3RWQA 3DJ6A 1JPAA 2W0JA 1PMEA 5DEWA 4ZEGA 2PSQA 2BCJA 2VWIA 3BQCA 3JVRA 4ZTLA 3A4PA 5HE0A 4ACCA 4BDGA 4UMRA 1MQBA 2X9FA 4D4RA 3COKA 1OKYA 3VRYA 5HQ0A 2W5HA 4KKHA 4GRBA 3ZLSA 4IWDA 5CENA 2X6DA 3PJCA 3BRBA 3LFAA 5JH6A 4DEHA 3PY1A 4C3RA 4NT4A 3MA3A 4CTCA 4C59A 3D5WA 4Y5QA 3HNGA 4CYIA 4YSMA 4EK5A 2CKEA 4KKGA 2X7FA 4BCQA 5IUHA 3KEXA 3T8OA 2PULA 4RQKA 4WO5A 4YHTA 4CYJA 1NVQA 3BKBA 3DK7A 2X6EA 4EOPA 5KZ0A 4FNYA 2ONLC 1OI9A 4PDYA 2FB8A 1VYWA 4IH8A 4DGNA 5HVKA 4IX6A 2UW5A 4JRVA 2PL0A 2J6MA 3IDCA 3TV7A 4CKRA 3AOXA 5H8GA 4APPA 4UWCA 2ZV7A 3RPOA 4P2KA 2B9FA 4IAFA 3AXWA 2OF4A 2HOGA 2UW8A 2BTSA 3MFSA 1SVEA 4IWPA 4RVKA 1SNXA 2HELA 4NM0A 5JSMA 4WA9A 2A2AA 1UWHA 5ITAA 3EZRA 2BVAA 5D7VA 4WBBB 1JKSA 3PWDA 4ARKA 3QTRA 4IBMA 5K0XA 4MEDA 3DJ7A 1JKKA 3I6WA 3O71A 4FZFB 5HCZA 4BN1A 5HE2A 5BPYA 5BVNA 4ACDA 5JFSA 3ZUTA 2DYLA 3PJ8A 2BAJA 4FKLA 4GT3A 3FSFA 3MH3A 5BUJA 2JIUA 4C0TA 4TWNA 1WBOA 3ZO4A 4AF3A 1T46A 3W0OA 4RRVA 1YXTA 1FMKA 3O50A 3VRZA 2W99B 4O4FA 4CGAA 1Z9XA 1KUTA 3O8UA 5E91A 2WHBA 1YHWA 3AMBA 1OPJA 5T68A 3KKVA 1DS5A 1XBAA 3KULA 5IA5A 3NW6A 3R02A 2BRMA 2OF2A 1Q99A 1WZYA 2CHLA 2YITA 5HBEA 4FUYA 2V55A 2WMRA 3DS6A 2R7BA 4EHEA 3RMFA 4OTDA 5TT7A 4CXAA 2XIKA 4JR3A 2HYYA 3SXFA 1L3RE 3SHEA 3MH1A 4KRCA 4WBOA 4L67A 2BROA 2C5OA 2GNIA 3JY0A 5E8UA 4YUQA 3PG1A 2LGCA 1U54A 5A6NA 4EHVA 4IX5A 1U4DA 3FI3A 2WGJA 5IA4A 2QU5A 3SXSA 4QQ5A 3QTIA 2EUFB 4I6BA 5M51A 3OUKA 2CCIA 5LWNA 3A60A 3PSDA 4UMQA 4DCAA 2UW9A 3OCBA 2PVHA 1B39A 4TYJA 4ALVA 2WIHA 3CPBA 3FMLA 4Y85A 5DRDA 4R1YA 5AP5A 4XRLA 3KRXA 2VNYA 3V5PA 3W16A 3POOA 3BELA 1FOTA 4D0XA 4D2RA 4E8AA 3F88A 3EWHA 2ZB1A 3FYJX 3G90X 3KREA 2Q0NA 2JDRA 2W1DA 4FK6A 4X3JA 3K3JA 3G15A 4L53A 1NXKA 3CS9A 5FEEA 2ETMA 3O96A 2W9ZB 3LFSA 4F0FA 4O0XA 5I9ZA 4FSRA 3S3IA 3UPZA 4ANNA 3GU4A 3LMGA 4QMTA 4MCVA 4BBEA 1BLXA 1JVPP 3NS9A 2YLFA 1XH7A 3CXWA 3IK3A 5AIRA 2R3KA 1QPCA 2WEIA 3II5A 3QLFA 4YJTA 4NM3A 3RI1A 3SV0A 1OECA 2RF9A 2QLUA 3IOKA 4R3PA 4X2JA 1F0QA 4BWXA 4HVSA 2CLQA 4ZK5A 2WQOA 1ZXEA 4DEIA 4BDDA 2YERA 3DTCA 5DEYA 4Z16A 4DBXA 2XIYA 3UPXA 4RZWA 5M4IA 3PSBA 4Y46A 3P79A 4FKOA 5ANEA 3QKKA 2JLDA 2BRHA 4ENYA 5EI8A 4O86A 4BC6A 1YXUA 3FWQA 4ENXA 3NCZA 1FMOE 2PZIA 4OTPA 3W55A 4OTIA 3VWAA 3O23A 4ACHA 5L6PA 5LJJA 3EOCA 2CN5A 3P78A 2J9MA 2PMIA 1APME 1OITA 2OGVA 4FV2A 2X2LA 3GC8A 3QQFA 4L42A 3QU0A 4MQ2A 3LFDA 3FLZA 4NW5A 4CV8A 2FH9A 4D2PA 5EDPA 4O7TA 2JD5A 3ZZEA 4DH1A 3HV4A 1MQ4A 1YI3A 3DLSA 4QQCA 2C30A 4QYGA 4AGWA 4XV9A 5M56A 4Y72A 2ZYBA 4BDAA 5E4HA 3F69A 2H6DA 1G8KA 3OFMA 2OH4A 4NIFB 4PDPA 4O6EA 4RBLA 3KC3A 4RJ4A 3NVKI 1FVRA 5CSXA 4DBNA 4G6OA 3LAUA 4GMYA 2BZKB 4D2VA 1LUFA 3FQEA 5I4NA 3UDTA 1K3AA 3EYGA 3OCGA 4GKIA 1Q8WA 1URCA 1V0BA 3JXWA 4DTBA 3W2OA 4U7ZA 3P1AA 4AE9A 3ZU7A 3LJ1A 3VJNA 5E8TA 3EQGA 5A4EA 4O96A 4EEVA 4BCGA 3PE1A 4BY9E 3MVHA 4FKVA 4MTAA 3QX2A 5EW8A 4EH3A 4K9YA 3FZPA 5LMKC 1Y6AA 4FOBA 5M09A 1IRKA 5C26A 1ZARA 4RIXB 2O65A 3F61A 1RW8A 4A06A 3R73A 4YP8A 2YJSA 4QTAA 2A98A 3ZONA 1W2DA 3Q4ZA 3F6XA 1JNKA 3CD8A 4EL9A 4EK6A 2YFXA 4G17A 4EQUA 1Q4LA 2R2PA 3E64A 2YDJA 1GY3A 4DFZE 2X81A 4OTQA 2XNBA 2IO6A 5BMSA 1DM2A 5DVRA 3QRUA 4RQVA 4J53A 1U5QA 2OFUA 1NVSA 2BZIB 3ATTA 1OKZA 1ST4A 4D5KA 4FEUA 4FUXA 1BMKA 1WBNA 1SM2A 4AT4A 3Q04A 2WPAA 3LCTA 4E4MA 4KSPA 4FKUA 4FV7A 4CZUA 4AUAA 2YIQA 2HWOA 3VHEA 4FT0A 4BBFA 5E92A 3C0HA 2OU7A 1OL1A 3QD3A 4BDJA 3RZFA 3EQRA 4YTHA 3PY3A 3VS7A 3VUHA 1Y6BA 1BUHA 2QOHA 3GVUA 4G3EA 2E9OA 3VN9A 4D2TA 1WBVA 3D14A 3DV3A 3OG7A 2GHGA 4CRSA 3DTWA 2VV9A 3VNTA 5E8WA 2WOUA 3QRTA 4W4YA 5J8IA 3R63A 4DGLC 4USDA 5JT2A 1H08A 3GBZA 4WNPA 3SG9A 2ACXA 3V5QA 3VF9A 5C8MA 4B7TA 2BKKA 3UZRA 4QOXA 2YDIA 3FLWA 4FEXA 2C5YA 4IAKA 3R8LA 4QP3A 5D9HA 3OT3A 3MJ2A 4NKAA 5FG8A 1H4LA 4I6FA 1FGIA 4PRJA 5HZNA 5GIPE 5AR2A 4Z7HA 3LQ3A 3NUSA 4QRCA 4RVMA 3MDYA 4ZY6A 3V8TA 5IEYA 3K2LA 2PUPA 1GIIA 2GTNA 3IPHA 3ODZX 1XH5A 2O8YA 3B2TA 3UNZA 3T9IA 4QMQA 4YZNA 2B53A 3QQUA 4W4XA 2XUUA 4PPBA 1OGYA 4W8EA 4OLIA 4KS8A 4DG3E 5B2LA 3LQ8A 5CAOA 2XF0A 3W8QA 3WOWA 4L8MA 4DEAA 2BTRA 2YZLA 1TQIA 4E20A 3FPQA 3F3ZA 3PLSA 3PIXA 2XRWA 4G3GA 4BRXA 4JRNA 4FV0A 3NFFB 4D0WA 1R0PA 2ITNA 4DLIA 4XG7A 2YISA 3O7LB 3QHRA 4PF4A 5KBQA 2CCHA 2X39A 3DAEA 4IJ9A 4R8QA 3ZUVA 2P2IA 1ZMVA 5E1SA 3I0QA 3VS3A 3SW7A 3NIEA 2R3NA 2QO7A 2HW7A 3UNJA 3FBVA 3MI9A 1KE9A 4ZY4A 4R3RA 4UBAA 1JLUE 3HEGA 4RX5A 3W10A 3GUBA 1NW1A 1ZOGA 1RJBA 2IWIA 5CF4A 1IAHA 4NM5A 2FSMX 4C33A 1Q62A 3LHJA 5AADA 3HV6A 2NP8A 2IZTA 3C4FA 2Z7QA 1BI8A 4AZSA 4DN5A 3DOGA 5DPVA 2XKFA 3C9WA 3D7TB 3L9LA 3Q2MA 5FRIA 2QNJA 2WIPA 3EQCA 2IVVA 3UYTA 3WILA 5IQGA 4N6ZA 2JIIA 1JBPE 1CM8A 1H0WA 4JDJA 3HAVA 2CN8A 3IW8A 4C36A 5AR7A 5HU9A 4E6AA 4N6YA 4LMUA 2EXCX 3KRJA 3MTFA 4GFGA 5J9ZA 2IG7A 4CD0A 2XAOA 3WARA 1OMWA 4X2NA 3ZYAA 4EH4A 2CJMA 4F4PA 4O82A 3DQWA 1R39A 5AM6A 4NK9A 2IN6A 1G8SA 3VS5A 1GZ8A 3TZ8A 4E3CA 4MNEB 2C5XA 2HZIA 3FYKX 3UOJA 5KO1A 5AWMA 4AFJA 3GQLA 4O2ZA 1BL7A 5HIBA 3ETAA 3LXKA 2IZUA 3R83A 4W9WA 3ENHA 3VVHA 4F9CA 4QPMA 3RAHA 3EKKA 5CT0A 3KK9A 3HUCA 4RIWA 2XIXA 2B9IA 2R7IA 3D2IA 1J1CA 2A0CX 3PJ2A 1IEPA 2OZAA 4FNWA 4PTGA 4GYIA 2GTMA 4IADA 5EDQA 4EKLA 4KBCA 1TFFA 4FGBA 3PXYA 4KRDA 4PDSA 1PY5A 4LV8A 2BHEA 4I92A 4OTGA 5A4CA 1OZ1A 3R9OA 3HMPA 2W4JA 3EQBA 4YLJA 4C4FA 2VTRA 4NH1A 5IDNA 4EKKA 2W1HA 4C4EA 3F2AA 2X2MA 4FKJA 3VAPA 2CPKE 5LMKA 3DFAA 4KIKB 2Y4IB 5CVFA 4IZYA 3PUPA 3TNQB 3GP0A 4KUJA 5AR3A 2EU9A 3C4CA 4H58A 4IB3A 4DITA 4EJNA 3HV5A 2GNFA 1SNUA 3HVCA 2QKWB 4WKQA 4EHZA 4JBQA 4BCMA 4BI2A 2UZNA 2ZV2A 3QUPA 5TE0A 4O7RA 4R5YA 1ZYJA 1HCKA 3FI4A 4WUAA 3U4WA 5I9WA 3G0FA 4GL9A 3E8DA 2X0GA 3TM0A 3S4QA 5HTBA 3MYGA 4QP7A 4GUEA 4YZ9A 3ZOSA 3E8CA 4Z7GA 3R21A 2BKZA 5DBXA 2B4SB 5LQFA 2HW6A 3R0TA 2AQXA 4LGHA 4MH7A 3UOKA 4TZRA 3KB7A 4MX9A 5H8BA 3V51A 4HVIA 4H05A 1YHSA 3ZBXA 2QOCA 3OXIA 4XHKB 3R71A 1M2RA 4I41A 5AV3A 3D9VA 3UJGA 1O9UA 4YU2A 4LYNA 4C58A 3FZSA 2C6LA 4FSWA 5HO6A 3RKBA 5DR9A 3POZA 2BALA 4FTTA 4M66A 3LCOA 4MKCA 3VS4A 3OY3A 3EB0A 4PX6A 3QKMA 5KE0A 3RINA 3QD2B 4CLIA 4ORKA 2FSLX 2QD9A 4V0GB 3SQQA 4EH6A 5CALA 2BZJA 3IW7A 2WTKC 2BRGA 1H28A 2XP2A 3KCKA 4LL0A 4WSYA 4ZY5A 2I7QA 5IQDA 4E93A 3C5UA 4NWMA 3DAKA 3VS1A 5J9YA 3TI1A 4TY1A 4F9WA 4S34A 2OI4X 3MFRA 5L4QA 4CFUA 1W8CA 3DB6A 4I1ZA 3QUEA 4FKSA 3BYUA 3ITZA 5AP4A 1ERKA 1YXVA 3A8WA 3IQ7A 3VUIA 4MXXA 4B99A 2H96A 3OOGA 1FINA 3MPMA 4AXCA 3P7CA 3IDBA 4TW9A 4M15A 3G2FA 5CS6A 3CBLA 1FGKA 4FT9A 4B8MA 3W0QA 3ORPA 2GMXA 3R1QA 5JZJA 4KABA 3Q96A 4FODA 3RALA 4WUNA 4KA3A 3SD0A 3GCQA 5EFQA 3RK5A 1IG1A 5CI6A 1REJA 1KSWA 2OO8X 4YLKA 4PDOA 5CT7A 2J0LA 5FGKA 5FP5A 2C4GA 3W0SA 5GZ8A 1XBCA 1WBSA 3EKNA 5DIAA 4ZLYA 5JMSA 3QYZA 4FTJA 1VEBA 2C3IB 1ZRZA 1XH9A 3I4BA 3LZBA 1H1QA 2X2KA 4FKPA 3VBWA 3Q3BA 3ACJA 2XK8A 4OBPA 5J1WA 3DZQA 4C61A 3EHAA 1OM1A 4D55A 4H1JA 3TN8A 4H36A 3N4VA 4PQNA 4O91A 3RPRA 2GDOA 2VNWA 4RA4A 3U9NA 4EC8A 2ERZE 3MVJA 4YC6A 5JEBA 4FF8A 2C6IA 2PMNX 4FV3A 4ONAA 3PE2A 4ACMA 1XKKA 4HCUA 4UXLA 1PXIA 3ZCLA 4AW2A 4B9DA 4BGGA 4DF3A 3LVPA 4TTHB 4CG9A 3AD4A 1U59A 3FMEA 3OCSA 3DNEA 3QYWA 5CTPA 3SKCA 3TMOA 4QMSA 2A4LA 4ZLOA 4MYGA 3A8XA 4OW8A 4U9AA 2VN9A 3PFYA 1M7QA 4NTSA 2OSCA 5AR4A 3BGPA 3TNIA 4LL5A 2ITXA 3A62A 4OTFA 3E5AA 4FL1A 4WNKA 3UC4A 3LCDA 3HRCA 5C4LA 1KE7A 3MJ1A 3FXXA 5FM2A 5LVLA 3P86A 2IPXA 3A7GA 3DDPA 4KNBA 3K5VA 2UW6A 2GFCA 2E9NA 3QUDA 2WEVA 2CGXA 3CE3A 4KB8A 1CKJA 5IQAA 5C1QB 2QLQA 2I0EA 2VTHA 3NR9A 1WBPA 2OG8A 3COIA 1R3CA 5C03A 2QOKA 4M69A 4U79A 2R3LA 3PA3A 3ZFYA 2XZSA 3QALE 3QZHA 3QCXA 4F7NA 2OJGA 3DXQA 5DR6A 3AQVA 2RG6A 2SRCA 3WF8A 2Q0BA 4I4EA 5TF9A 2UW3A 1XWSA 2AC5A 4XV1A 4C35A 4EBWA 3GU8A 3UIBA 4F08A 5EH0A 5CAUA 2OLCA 5CEMA 1YQJA 1H01A 4PY1A 3PP0A 4QT1A 3ZUUA 3BLQA 3TG1A 2BR1A 3F3TA 3W2RA 5JN2A 4OT5A 5I9UA 3DPKA 4BDFA 5IKWA 3KU2A 1UU7A 2OXXA 4RGJA 3PZHA 5FTOA 4I24A 5E8SA 3VBQA 4CFMA 4EOKA 4BCPA 5IA2A 2CSNA 5E90A 2AC3A 2OWBA 4O0RA 3DQXA 5DA3A 4LGDA 2R0IA 2C6OA 2R0UA