4O38A

Crystal structure of the human cyclin g associated kinase (gak)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
310
structure length
267
Chain Sequence
QSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPLYSNFPIGEKQDIWALGCILYLLCFRQHPFYSIPPHDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQEIAAARNVNPKSPITELLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human cyclin G associated kinase (GAK)
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Cyclin-G-associated kinase
total genus 71
structure length 267
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4o38A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o38A01
4NW6A 2CKPA 4K0YA 4ZK5A 5AA9A 5HTIA 2BHHA 3R7YA 3CGFA 4I4FA 3VBWA 4G6LA 4MVFA 3ZONA 3WBLA 4JXFA 2CKQA 4RFZA 2EVAA 4RX9A 5BQ0A 3KN6A 4LM5A 5EM8A 5HIDA 4AE6A 4DTKA 2BAJA 5E8UA 3FLQA 3FLWA 5B7VA 2YABA 4PTEA 3MN3A 3QC9A 4UZDA 3QD0A 2W1HA 4DH1A 4U3YA 4PPCA 5IUHA 2Z7LA 2VO6A 4DEEA 1WBOA 5FEDA 4Y83A 3NYOA 4R1VA 3PLSA 1H1WA 2YM4A 5ANOA 4FV5A 4B6LA 1XHAA 4HPUE 2ZV8A 1RW8A 2ZB0A 3LCSA 3MH1A 3PVUA 3LVPA 2WZJA 2VWUA 4X2GA 3SDJA 4U44A 4X2KA 3PSCA 5E9EA 5BVNA 3TV6A 2O8YA 4PDOA 5FM2A 4PX6A 2YZAA 4NM7A 2JEDA 3OCBA 1GZNA 3POOA 4E6CA 3I79A 4BCKA 3QHRA 2V55A 3JY0A 4WNKA 4RZWA 4N6YA 4TWNA 5CQUA 1PXIA 3Q5IA 4FTQA 3BGPA 5F20A 3EB0A 4NIFB 4Y85A 1Q61A 4EHEA 5AV1A 2VV9A 3AD5A 2WMBA 4C38A 3P0MA 4UYNA 3TKIA 3AD6A 3MPTA 4U40A 4ZTSA 2B9IA 3GU6A 3H9OA 3L8XA 2VD5A 5ANKA 4QYGA 4XV2A 4ZSAA 5CF8A 4CKJA 2Z7SA 3LXLA 1OPKA 4IIRA 4RJ4A 1O6LA 3HMPA 3ATSA 3P78A 1I09A 3A60A 4U9AA 2IW6A 2C69A 1ZAOA 2RFSA 2UW5A 3LAUA 1FGIA 2XNBA 4YZMA 4GJ2A 5LVMA 4ACMA 4I94A 3U9NA 4EHVA 2HCKA 4RLLA 4FE2A 3FI3A 5CSHA 5EFQA 5HGIA 5IF1A 3QD2B 3GU5A 2HY0A 4BVUA 2LGCA 4BCOA 1DAYA 2J2IB 3BU5A 4PMMA 5EYDA 3DTCA 2JDVA 1QPEA 2VTQA 1WVYA 2W7XA 3KMUA 3W2PA 1OGUA 4ZTNA 3FZTA 4HZRA 4N0SA 3PJCA 2PE0A 2RFEA 3GFEA 3ZYAA 1OPJA 3PXRA 3P23A 2P33A 3VRZA 3KRJA 1W0XC 5ANDA 5IQDA 3TDVA 1ZOEA 1Z9XA 3UBDA 3ZTXA 4DEHA 4ITJA 3VBVA 3QF9A 3MJ1A 2B9HA 3QTSA 4U7ZA 4YUQA 2VRXA 1UU3A 2R3MA 2WU6A 4EK8A 3ETAA 3F66A 3ALOA 2XM8A 3UO6A 4L44A 4RZVA 4D0XA 3KN5A 2UW4A 5C01A 3KF7A 4IX5A 3GU8A 2QODA 1FOTA 1GAGA 1LUFA 4UWYA 3CS9A 3QQLA 3K3IA 4J71A 4G3EA 3EN7A 1JBPE 3Q96A 4BGHA 4F7NA 4TYGA 3PE2A 3QU0A 1YDSE 1R0EA 2C0OA 4F6UA 4ZTHA 3HV6A 3QWJA 2DS1A 4Y5HA 3UIXA 4OAVB 3KXHA 3CP9A 1OL6A 5BYZA 4FGBA 4FV7A 4U45A 1RE8A 3WF5A 4USEA 5LCJA 2W17A 3REPA 4ALUA 3SV0A 1B39A 2RIOA 2OG8A 2GNLA 4EQMA 3Q2MA 1MRUA 4RIYB 2XK4A 3E8CA 3HL7A 5IUIA 1ZYDA 2SRCA 4TW9A 2B54A 1YI4A 3OBGA 3AC3A 4L00A 4GU6A 3Q52A 3DDQA 3R63A 1U5RA 4AAAA 4AA0A 4O0YA 5IQCA 3RZBA 4CRSA 5IH4A 1FVTA 4O0UA 4O21A 4W4XA 4HW7A 1APME 1S9IA 4C37A 1JLUE 1PXMA 5CSPA 4X2NA 3QZGA 3FQEA 3CKXA 3TI1A 5HTBA 1H01A 2J6MA 1H24A 4XMOA 3PJ8A 3ZC6A 1WBSA 5AX3A 4BGGA 3VUIA 4ZSLA 4DH7A 4K77A 4KRDA 5KMKA 1Q8TA 4YPDA 3IW5A 1OBGA 4FK3A 4I23A 3MIAA 4MXZA 2I0HA 4K8AA 4EOIA 2H96A 4OW8A 1NW1A 1GJOA 2YCQA 3WYYA 1P2AA 4FNXA 5IZFA 5EHYA 4AW0A 2VUWA 4FIJA 1YDTE 4KS8A 4YJNA 2DYLA 4BIDA 5HCXA 1A06A 3ORLA 2XK8A 4FOBA 3HYHA 3C9WA 3OMVA 2QONA 4GMYA 5H9BA 5L2TA 4GFMA 4NWMA 3ODZX 5J9YA 2YM3A 4FSNA 3AC5A 4A4LA 4GVAA 1FPUA 3VQHA 1CMKE 4F9CA 4FVRA 1FBNA 1SYKA 3SD0A 4NFMA 2PVMA 4KBCA 5H3QA 2HOGA 2OGVA 4XV9A 1IEPA 2ETRA 1OECA 2XMYA 4WBOA 3U87A 3SLSA 4P5QA 1JOWB 1ZMWA 3EQRA 2G15A 1XH5A 2WTCA 3NNXA 4MQ1A 4OR5A 4PP9A 4QMXA 2OO8X 4NYEA 1T46A 1TKIA 2R4BA 5ANIA 5E7RA 3LFAA 3Q9YA 5E8ZA 2UW7A 3KXGA 2WAJA 4DFLA 4R3CA 5FG8A 4B8MA 1K2PA 3VJOA 4BYIA 2J0JA 4IAIA 3TV4A 3NIEA 4GG5A 3COKA 3VF8A 5FUTA 3PVGA 4YZBA 3CGOA 1KE8A 1F5QA 2W1CA 3A8WA 2CKEA 3FC1X 3RK9A 3HKOA 3VF9A 5AP3A 4AT3A 4D4RA 3UIMA 3WF6A 2Y7JA 3MFTA 1FGKA 4RIXA 2VTAA 4W8EA 4DLIA 4TY1A 3WI6A 3GFWA 4V05A 2IG7A 3BPRA 4EBWA 4OTHA 3BI6A 1BL6A 2O65A 3COIA 3R71A 4LG4A 4H3BA 4PY1A 5B0XA 3WIKA 5AEPA 3Q32A 2YM7A 4J97A 4KIQA 4QMMA 3QGYA 4QMLA 1RQQA 4RWLA 5CSXA 5CZIA 3D7ZA 2W0JA 2F2CB 2QO7A 4KUJA 4IHPA 4FX3A 3GCUA 1JWHA 1U54B 3SQQA 5DR9A 4FA2A 4F99A 4V01A 3BWJA 5A14A 4ARKA 3PRIA 4F6WA 2UVXA 3H4JA 4I6QA 2QLUA 4XG4A 5AUWA 3QYZA 4EC9A 3A4PA 3BBTB 5G1XA 2Y6MA 1H0VA 3SVVA 5CT0A 4NCTC 2CKOA 3FXXA 5I9WA 1PMUA 4BKZA 2WD1A 4O0SA 3UOLA 4E73A 5M51A 4MNFA 2YIWA 5C8NA 3RALA 2WOUA 5DG5A 1YRPA 4GW8A 3FI2A 3FBVA 4FEQA 5EHLA 1GZ8A 3DS6A 5JN2A 4G31A 4YZ9A 3WZDA 3SAYA 1JSUA 4JL9A 3LJ0A 3DKCA 5CZHA 3VWAA 2PHKA 2GHMA 1NVRA 4GK3A 3V3VA 3GNIB 3IS5A 4M0YA 4JBPA 2XRUA 3WZUA 3BBWA 3F5XA 1Y57A 3M2WA 4C7TA 5AV2A 3HMIA 4IM3A 3K5VA 3FWQA 2QQ7A 3PPKA 4YGAA 2PPQA 2C3LA 3PY1A 3PIZA 1H07A 3TTIA 4FV1A 4FZ7A 5HLPA 5DR2A 1WVWA 4QP8A 3MI9A 4E4LA 5A6NA 5J95A 4F1MA 2XKFA 1GIJA 4YPSA 3K5UA 3T3UA 4NJ3A 1P4OA 3FYJX 3FZOA 4Z7GA 4ZP5A 1HCKA 1KE6A 2W1EA 2R3IA 3RCJA 1YOMA 3OY3A 2QOQA 3EQDA 3R21A 3O7LB 4W4YA 3UPZA 1YI6A 4YC6A 3HGKA 5I3OA 4F0GA 1BX6A 2VTTA 4WNOA 5H2UA 5JH6A 3EIDA 4D1ZA 1VJYA 3MH3A 5ANEA 4Y46A 2GNHA 4Y95A 4BCIA 4D1SA 1YHWA 4RFMA 4BBEA 2Z8CA 3C5UA 2WHBA 5HHWA 4C58A 5AUUA 3AC1A 4IM0A 4PMTA 3MY5A 5KBQA 4D2PA 2ITVA 4APCA 3DLSA 1OKWA 1STCE 3OP5A 2GNIA 5FXSA 5C03A 2CGVA 4AACA 2F7ZE 4CCBA 4TPTA 4WG3A 3COHA 4MBIA 2WPAA 3CCNA 5GZ8A 1XR1A 2VNYA 4XP2A 3FLYA 3RGFA 5KMOA 5LJJA 2OF4A 3MH0A 4QMWA 3ZSGA 5JFSA 4K2RA 3AT3A 2W1GA 4OLIA 2JFMA 5CNOA 4DH5A 5ACKA 4FKQA 3OWLA 4BC6A 4F7LA 3QTXA 3CD3A 3RAKA 3IOKA 3LFBA 5J5TA 1LEZA 2C30A 1P5EA 3NCZA 4JR7A 4O0WA 2FUMA 4M66A 3WZEA 2G1TA 4LRKA 3R9OA 3C5IA 4DTAA 4ZTQA 3ORTA 4WOVA 3ANQA 1M14A 3FY0A 4A06A 3TACA 4ITHA 4M69B 5HO6A 4FSUA 3NUXA 4C33A 3PVBA 2GDOA 5IA0A 4TNBA 2YFXA 3U4UA 3QUPA 3DJ7A 4IX3A 2WQNA 3D5XA 5BVFA 2F2UA 4K18A 4LFIA 4CEGA 1OUYA 2ITWA 4B8LA 1AQ1A 3LFNA 3LQ8A 3MA6A 2HWOA 4FTOA 4AZVA 2HY81 1YVJA 3MY1A 4O7RA 3L9LA 1M52A 1OZ1A 3MBLA 3R1NA 4U5JA 2GHLA 5HG7A 5TF9A 4R5YA 4GVJA 4HZSA 5HOAA 4IZAA 3LCDA 4ALWA 5AAEA 3P9JA 3QFVA 2OIBA 3SX9A 2GFCA 4IACA 5AR7A 5B2KA 4AP7A 4YMJA 4TYHB 5HICA 3ZRMA 5M57A 2F49A 2PY3A 3TUDA 1OUKA 1PYXA 3HP5A 1R0PA 2IW8A 1L8TA 4JI9A 3V5TA 3GOPA 2FSMX 3EL8A 4NK9A 1JAMA 1ZWSA 5A6OA 3W16A 3BYSA 1M17A 3R0TA 3W2QA 3FMKA 3W8LA 4BDJA 4MCVA 1DM2A 3MWUA 3DBFA 4GT4A 5B2MA 5GIOE 4WG5A 5LMAA 2B9FA 3QCQA 3F6XA 4KD1A 1Q99A 2Q0NA 3FI4A 2GSFA 4OTRA 4RLKA 1WBTA 3ORKA 2JAVA 3PPJA 4RX8A 3NRMA 4FKVA 4PL5A 4CXAA 2IVSA 4ASEA 5L2WA 4AT5A 3TJCA 3KF4A 3PE1A 4F09A 3PYYA 2OWBA 4QTAA 5CANA 4LV5A 4HCTA 2UW9A 3DNEA 5BPYA 4HOKA 4LOQA 4MH7A 2BIKB 4HNFA 5ETFA 4BDKA 3LLAA 3MFUA 3QRUA 4YO4A 3M42A 4R7HA 2BZKB 3NIZA 1F3MC 3BQRA 4USDA 4FSZA 4JQ8A 1NVSA 4IB0A 5D12A 4BDAA 4ZJVA 5KNJA 3UQFA 4NL0A 4QMSA 4GEOA 4QNAA 3ZLXA 5EI2A 3F3UA 4H39A 4NKSA 5AIKA 4DA5A 5IA2A 4K9YA 2F7XE 4ZTRA 4IVBA 3T9TA 1YXVA 2QOOA 3F3WA 4KAOA 4GS6A 3ENMA 4QP3A 2O63A 4FIFA 4TT7A 5AP6A 2C47A 3QTRA 3TNQB 2C6MA 3HX4A 3HRCA 3R02A 4RWIA 3RTPA 3VBXA 2BILB 2EUFB 2ETKA 3D2KA 2XKDA 1J7LA 2BRGA 3DKGA 4BCHA 4QMTA 4BDCA 3QKKA 4N6ZA 4D2RA 5CALA 5FWKK 1IASA 1WBNA 2R64A 4HVGA 4USFA 3DY7A 3MDYA 5JGDA 5CAOA 4KKGA 2R3OA 4TYJA 5CY3A 1PMEA 5IA4A 3DFCB 3QCXA 3CTHA 4CMUA 4O0TA 4FNYA 4BWXA 3RWQA 4ZLYA 2XNEA 4IDTA 3B2WA 1J1CA 4HPTE 4MWHA 3QX2A 5CENA 2QG5A 4AOJA 5HNGA 4CV8A 4R3PA 4D5HA 2ITNA 1W84A 3AXWA 4F9AA 1VR2A 3OXIA 3MSSA 4FV9A 1H28A 4IWDA 1OL5A 4ALVA 3MPMA 3TKUA 3N9XA 3ZEWA 2P4IA 2ZJWA 3JVSA 4PDSA 4I6BA 4XYFA 1ZXEA 4A9TA 2XIRA 2YN8A 4GL9A 5M09A 4ACDA 5BVOA 2VWZA 2Z7RA 3UNJA 2Z7QA 3OY1A 5EOLA 5AMNA 1BYGA 2CHLA 2OKRA 3IECA 4I24A 2UUEA 3F5PA 2C6LA 4MAOA 4O7WA 3Q9ZA 3EQGA 3V5WA 3FAAA 5L2SA 2IZRA 5DN3A 2GNGA 4L52A 2CLXA 4JDJA 2PMIA 1SNXA 5FD2A 4QMUA 4AFJA 4AX8A 1YKRA 4PMSA 4WIHA 3FMMA 3U55A 3KVWA 2KULA 1KOBA 2IZSA 2V0DA 3AC8A 4F9WA 2ONLA 3VHEA 4ZS4A 4CFWA 3P7AA 2PMOX 4HVDA 3NSZA 2QR7A 2X81A 4RPVA 4AGCA 1TQPA 3A99A 4BBFA 1PMNA 3E87A 3U54A 2WMRA 2C6KA 5L8KA 3G9LX 1E9HA 2UZLA 4FBXA 4QMVA 5F1ZA 3KA0A 5CEIA 3NLBA 2WELA 4NW5A 4BBMA 4PNKA 2Q83A 2A27A 1T45A 3FL5A 3OF0A 3HNGA 3F3VA 4J99A 4I6FA 4YU2A 3BHTA 4FV6A 2Y4PA 3AQVA 4DG3E 4UMUA 4CG8A 1W7HA 4KBAA 3D7TB 2R3GA 3CIKA 3EQPA 3D83A 3S00A 5B2LA 4UWCA 4XJ0A 2HENA 4KSPA 4MYGA 3UG2A 4EOLA 5IDPA 2FA2A 3RK7A 4ZZMA 4JOAA 4BCMA 1NXKA 2A19B 4MK0A 3ZXZA 1UU8A 5AUXA 3KCFA 3MJ2A 4BTKA 2F57A 2C5VA 2X39A 2Z60A 1PKDA 3GC9A 3EZRA 3K2LA 3U6HA 1OPLA 2YISA 3R7EA 3A7FA 4FZFB 1PXNA 2NRUA 1XBBA 4I22A 5ANGA 3SXFA 4B99A 3ZC5A 2XYUA 2V7AA 4F65A 2XEZA 3QBNA 4E93A 4D2TA 4FV8A 4GRBA 3PIXA 2XIXA 4O96A 5EYCA 5DOSA 1OM1A 4AZEA 1NT2A 3P7CA 1R39A 2PTKA 2YHVA 4JRVA 3TJDA 2CGXA 3F7ZA 4J52A 2WMXA 4IAAA 4M68A 4V0GA 3ZO1A 5DRBA 5ETAA 4JDKA 1GY3A 5IPJA 5M44A 5IU2A 4XOZA 5KHXA 4DF3A 2ZV2A 2VX3A 3BHYA 3KXNA 4WD5A 3S2PA 3TNPC 5L6OA 4AZSA 5DT3A 4AN2A 4O27B 3IOPA 1FMOE 2R0IA 3RHXA 2OZAA 3A62A 4DHFA 4TNDA 5AAFA 1Y91A 2QC6A 2ETMA 3P5KA 3R00A 2ITUA 3EWHA 4ZY5A 4L8MA 1SVHA 2NNWB 3EYHA 4BDFA 4ENYA 4QMNA 3G5DA 5CNNA 4M97A 3QWKA 2YJRA 4P7EA 4E5AX 4RJ7A 3UOJA 2P3GX 3GU7A 3T8OA 3UNZA 3MVHA 3U4WA 3QAME 3EN4A 4QQTA 5CU2A 5F94A 4C0TA 3S95A 5K0XA 1LP4A 3LCKA 3BKBA 4XNEA 3W1FA 3ZRKA 3Q4UA 3LM5A 5FXRA 3KU2A 3F82A 5JFVA 5J1WA 4BIEA 3KMMA 4BCFA 4BI0A 5AR4A 3EFLA 4FKWA 4PNIA 5HG5A 5KBRA 4BICA 4BYJA 3L9MA 2PZ5A 4JAJA 3NVKI 4BZDA 5HBHA 2PSQA 3G90X 1XH6A 1OIUA 3GVUA 4YSMA 3ZO4A 3CY2A 2BHEA 4JG6A 4LMNA 3DOGA 2F9GA 1UKHA 3F5GA 4AN9A 5CAQA 4HYHA 3IDBA 3MY0A 4KIKB 3OZ6A 3C4CA 3HUBA 4O7TA 4XG9A 4JLCA 4AZFA 3UMXA 3S3IA 2W1FA 3HAMA 4HGLA 1ZYSA 2X2LA 2YCRA 2QO2A 1Q5KA 4FIIA 4BHZA 4EK6A 1ZRZA 4IJ9A 1YW2A 1OKZA 2HK5A 2H34A 5KZIA 1U59A 4J7BA 3BYOA 3FMDA 2E9OA 4G6NA 1B6CB 1GOLA 5EI8A 4XHKB 5HZNA 3ZFXA 1SNUA 1KE7A 3D5UA 3OXTA 3ZLSA 3WZKA 1H0WA 3RM6A 5BUIA 2QOHA 2XBAA 4ZLOA 3OW4A 3C0IA 4EH8A 3OXZA 2PUIA 4KRCA 2WMWA 5CX9A 3JUHA 4F1TA 5HVJA 3MVMA 3G33A 2HIWA 4IVDA 3G6GA 3ZSHA 2Y0AA 5CAPA 4AG8A 4NCTA 2XJ1A 3BYUA 2UZNA 3NGAA 4R78A 4C61A 4TXCA 5L2IA 3PA4A 1UA2A 5FLFA 5H8BA 3OD6X 3F9NA 4C4EA 2X6DA 4JBQA 5CU3A 3ZBFA 3V5LA 2GFSA 5JQ8A 1H1PA 4L7SA 2GMXA 1WBWA 3PSBA 4HJOA 4CKRA 5FM3A 2P2HA 3FPQA 4RWJA 3BGQA 3F2RA 4BWKA 4D1XA 3IK3A 4GV1A 2X4ZA 5BUJA 4OAUC 3MS9A 1XQZA 4G5JA 2JIVA 3ZZWA 5IA1A 2XF0A 3FSKA 2F4JA 2XK6A 4I93A 4PMPA 5ANJA 3OHTA 2BFXA 2I0YA 3U6IA 1PY5A 2PYWA 3TXOA 3QQHA 2Y6OA 1UWHA 3IPHA 4YTIA 2PZPA 1J7UA 5GIPE 3A8XA 4JBVA 3FZPA 1Q8WA 2ZM1A 1KWPA 2JC6A 2WGJA 2AUHA 3QD3A 4J53A 5K4IA 2XNOA 2ITQA 5JT2A 4GIHA 3VBQA 3ZOSA 4I0RA 4MXYA 2XKCA 1B38A 2PVHA 1Q8ZA 4W9WA 1H08A 5AP5A 2OJFE 3G0EA 4U80A 4WKQA 3V04A 4YURA 5FTQA 5DHJA 5C26A 5AUTA 3C0HA 4EH5A 3CE3A 2XCKA 3FQSA 3QA8A 4FI1A 4Q5HA 3TZMA 4AWIA 4RIWB 3DKOA 4D55A 3QX4A 1OL2A 5KO1A 5BYYA 2R3RA 3BZ3A 4A9SA 4TYIA 4FTKA 5IQGA 1ZYLA 2VTHA 3LFEA 4C2WA 2GHGA 2EXEA 4EZ7A 1SM2A 3DAKA 4GYGA 3V5PA 3CTJA 5CASA 1JVPP 2YCFA 2FSTX 3NUSA 3P79A 4M0ZA 4BL1A 4DEDA 3PG3A 2BROA 5KUPA 4WNMA 2JDTA 3NNVA 3EKKA 4ACCA 3RCDA 4YR8A 2VTIA 4GUEA 2R3FA 4WO5A 4NT4A 2OI4X 2FYSA 1IG1A 5DH3A 4E5BA 2BTRA 3OCSA 4GFGA 4E5WA 3T9IA 3BHUA 2R3JA 5T3QA 3LIJA 3N4VA 5FBNC 4Z16A 2OH0E 2PL0A 3PWYA 3PDTA 3IKAA 3FY2A 4ASXA 5EOBA 4OT5A 4XP3A 2PVJA 3H10A 2YITA 3UNKA 4XRLA 5HLWA 2C5NA 2HAKA 3QYWA 2VNWA 5BX0A 2XIZA 4BDGA 4E6AA 1M2PA 3Q04A 2PU8A 2W5BA 3ZMMA 1U5QA 4DT9A 1CM8A 1E1XA 3QQKA 1OI9A 2V7OA 3ZO3A 4EOMA 2XCHA 4KA3A 1O6KA 4ASZA 4BTJA 4F7SA 2OJJA 4J95A 4D0WA 4CCUA 4RGJA 3ZZEA 3ZUVA 5KHWA 3EFWA 2YLFA 4KWPA 4CFMA 3BLQA 4YC8A 3VO3A 2VO3A 4BI1A 3NUNA 5E8VA 4E6QA 2O0UA 4FSWA 3CXWA 4QP2A 4QTBA 2VTPA 5I9UA 3VS0A 2R5TA 4BCQA 1Z57A 2W9ZB 4ZAUA 5CF4A 4EJ7A 2QOBA 4II5A 4YTCA 3R73A 2BKZA 3QKMA 5AR3A 2YCSA 2Y9QA 3LMGA 3O7LD 3PP0A 4FIEA 2HW7A 4GK4A 4OBPA 4H3PA 4RMZA 4IAFA 1NVQA 2YDIA 4LYNA 4AQCA 4GIIA 4BTFA 2YM8A 1IA8A 4NM0A 3BE2A 3FC2A 4FZ6A 4QYFA 4RWKA 3FEGA 2GS6A 3T3VA 3PPZA 3PJ2A 4EH4A 5FGKA 4FNWA 4TRLA 4XG7A 4BFMA 3RPVA 4EUUA 3I81A 3FE3A 2WXVA 4EK4A 3CQEA 2R2PA 2RKUA 3LZBA 3VUKA 4O7VA 2GTNA 3U8WA 2QOKA 4PV0A 2OBJA 2WQBA 5BMSA 3NX8A 3GCQA 4FR4A 2OSCA 3LJ2A 4AE9A 2R3LA 3KXZA 4ANLA 3RPRA 3DU8A 3GC8A 2BFYA 2J0KA 3LW0A 4AZTA 2WTIA 4C35A 4D9UA 4E6DA 3U6JA 5J9LA 3WIGA 3UIUA 1JKKA 2O3PA 3O71A 4B7TA 3K3JA 1H26A 4PTCA 3FMNA 3KRRA 2ITOA 3W2CA 4AA5A 1XJDA 3ULZA 3TWJA 4EUTA 2FSLX 3DB8A 1JSVA 5CXZA 4XP0A 2YZLA 4BY9E 5JSMA 2ERZE 3W55A 3SGCA 3R8ZA 4Q9ZA 5FBOA 4YLJA 3QLGA 4E26A 4F1OA 3UJGA 3UOHA 4WRGA 3DXQA 1A9UA 3BRBA 3COMA 5K0KA 4DEIA 4Z7HA 5C8KA 5JGBA 4UY9A 3FHIA 4XH6A 4IZYA 4S30A 2HYYA 1R1WA 3HP2A 1ZZLA 3EN5A 3QRIA 4FL3A 5DNRA 4YP8A 4AW5A 3PLAE 2XA4A 1XH9A 4Q2AA 5LVPA 3DXNA 3PFQA 4XUFA 3NPCA 4O91A 1ZYCA 2BPMA 2C4GA 3WYXA 5AA8A 5M07A 4RJ5A 4FT5A 2H9VA 3OT8A 2BAQA 3R30A 3NW7A 2PZRA 2QR8A 4XG8A 4ZXTA 3C7QA 3VHKA 4L7FA 2QOLA 4MNEB 4BN1A 4CQGA 5ACBC 4QMQA 5HD4A 3BELA 3D4QA 5M55A 4U81A 2IVVA 2CDZA 3MB7A 4X6RA 3SA0A 4YJRA 2H6DA 3TZ9A 3TZ8A 1XWSA 3BIZA 4C4GA 3KREA 2VWVA 5GJFA 2ACXA 3FKOA 3OOMA 2ZVAA 3ORZA 4YJUA 5D41A 4UXQA 5DVRA 4E3CA 1FINA 3QQFA 4QMPA 3UGCA 1TQIA 3CR0A 3V01A 3NYNA 3BHHA 4BCPA 3QQGA 1KE9A 4IQ6A 4LUDA 3R8LA 3WZJA 3QTZA 2X2MA 3PXKA 2JFLA 4HNIA 3TT0A 3QL8A 4WRSA 4CSVA 3DCVA 4EOQA 2HW6A 3UE4A 4DGOA 3POZA 3SG9A 2X1NA 4O2ZA 5E8YA 3VS2A 4CG9A 1ND4A 1FMKA 4XG3A 5CI7A 2OW3A 4IAKA 4ITIA 2ONLC 5ETCA 3R8MA 3OEZA 3AT4A 3E64A 4FTUA 2W4KA 4YO6A 5DLSA 3OWKA 4DFBA 4U79A 2W1DA 2CGUA 3QCYA 1H27A 1PKGA 2J50A 2ITZA 3HA8A 1UNHA 3FMJA 4H05A 3GOKA 1UKIA 3RWPA 2V22A 3S4QA 5CEPA 3KEXA 5HCYA 4ZSEA 4FSRA 4WSQA 3EQFA 3RVGA 3UYTA 4ASDA 4W4WA 4J8NA 1ZARA 4QO9A 5A46A 4A9UA 5JK3A 4OTPA 3GT8A 5I5ZA 3R7VA 2GQRA 2VO0A 4RT7A 2ZDTA 5IUGA 3HEGA 3RKBA 3DB6A 1OVEA 2C5XA 3MTLA 4QQ5A 4MXAA 3G0FA 3PVWA 3W33A 3HAVA 4FT7A 2GCDA 5A3XA 1LEWA 3DQXA 3UP2A 3OROA 2G2IA 4DITA 2W1IA 2RFNA 4NSTA 1UNLA 4ACHA 1JSTA 4L9IA 4XV1A 1U46A 2WQOA 3BEGA 2QNJA 4FICA 4EHZA 4RRVA 1H1SA 2IZTA 3MH2A 2X9EA 5CF6A 2BVAA 4EH3A 4A4XA 2RGPA 5DT4A 3FQHA 1Q41A 2QOFA 4IFGA 4U0IA 5GJGA 4ERWA 5LMBA 4FTMA 2B0QA 4JRNA 1H1RA 4FVQA 5CU6A 4Q9SA 4EZ3A 3QQUA 4FSTA 4QYEA 2CN5A 3MESA 1KUTA 2QOIA 4NM3A 3FLNC 4DFNA 2JGZA 2QLQA 2I6LA 3VVHA 1QCFA 4O86A 4DG2E 4ZOGA 2Z2WA 3UG1A 2BDJA 4RX5A 3TUBA 3KK9A 4FTJA 5L3AA 3LMIA 3EZVA 5LWNA 2QCSA 4V0GB 3FDNA 3EL7A 4TWCA 2VTLA 5E90A 3ANRA 3JYAA 3VIDA 4A9RA 2ESMA 4I0SA 2W4JA 3V5QA 2PE1A 1OITA 2CNQA 2W96B 3ZSIA 4RBLA 2OXXA 4FK6A 4L43A 3VN9A 5HG8A 2BALA 2G9XA 3L9NA 3F5UA 1YXXA 4JQEA 4OBQA 3NUPA 1YOJA 4DBNA 4F6SA 3N4TA 3HRBA 5DIAA 1W82A 1TVOA 1G5SA 3D15A 3HMNA 4IE9A 3OC1A 3DA6A 5KX8A 4OTGA 3R7IA 3DKFA 2UVZA 4RVTA 5EQPA 3PY0A 3OCGA 5LARA 4DEAA 5E1SA 3BCEA 3FZ1A 4FYOA 3RPYA 3C51A 3W8QA 4KINA 4YLKA 4YJPA 1VYZA 1LR4A 5HTCA 2NRYA 3PXFA 2X2KA 4ZSJA 2HXLA 3W2OA 4TKSA 3ZM9A 2Y4IC 4NM5A 3SXRA 3EJ1A 5LVLA 3EQHA 1XBCA 5AUYA 2WTDA 3OUNB 1PRYA 2BZIB 3E8EA 4WUNA 5DR6A 4IM2A 1PXPA 4FYNA 3MVJA 5HX6A 3SW4A 5HE0A 2WOTA 4IVCA 2CJMA 3P86A 2VX0A 4MEDA 4FUYA 2QKWB 2UZWE 5T6KA 5KCVA 2B55A 3FYKX 3PZEA 4W8DA 4XG2A 4L67A 1V1KA 2BZHB 4O22A 5HNBA 3H0ZA 4L68A 4AU8A 2CPKE 2DQ7X 4AUAA 2XNNA 2A1AB 2VZ6A 4QP1A 3VS6A 5LVNA 1MUOA 3QLFA 4MTAA 5AP2A 1OIRA 2R9SA 2VU3A 3Q5ZA 5E8WA 3TNWA 3GEQA 4O6EA 3SXSA 3QUEA 4UALA 3ZXTA 4XCUA 4UZHA 3ZS5A 2YM6A 3GC7A 4CZYB 2W06A 4O82A 1WAKA 2DWBA 4FSQA 2XK9A 4FTIA 5EHOA 2WIPA 4LGHA 5TOZA 1RDQE 4WUAA 3R8VA 1K3AA 4XEYA 2XM9A 1Q62A 3KCKA 4P4CA 4QTCA 4EH9A 3BWFA 5CSVA 2BRBA 5EQYA 3FXZA 1M7NA 2JDSA 2WEVA 3LHJA 4RVLA 1OL1A 5T68A 3TZ7A 4YBKA 4YTHA 3UIBA 4EBVA 5JGAA 3VJNA 4IBMA 2B9JA 2PK9A 3QGWA 5E8SA 2W99B 3RBWA 4A07A 5BVDA 4O81A 4MF0A 3D2IA 2C5OA 4FUXA 4AS0A 4W9XA 4D28A 4UX9A 4O1PA 1LPUA 3F69A 4CNHA 4RG0A 5IA3A 2PZYA 5IMEA 3PY3A 3GCPA 3QZIA 3FL4A 3S1HA 4K33A 4J98A 2ITXA 2RSVA 4O0XA 4RVMA 4RA5A 4L3JA 3FUPA 3AD4A 1W98A 3GC0A 4UMTA 3DQWA 4FL1A 5FRIA 4LL5A 2XZSA 4ZJIA 2OZOA 2I0EA 3Q4TA 4NKAA 5F95A 3FHRA 4FV3A 4IWOA 5EM5A 3N4UA 3NEWA 3BU6A 1URWA 3HMMA 2IVUA 5IQEA 1E1VA 2XBJA 2YERA 1BL7A 2J9MA 3NWWA 3FMLA 2PUNA 3FMHA 3AC4A 4D4SA 3PXQA 3LOKA 4WG4A 3LE6A 3RINA 3V5JA 1XBAA 2V62A 4O7YA 4ONAA 5LVOA 4U41A 1PF8A 5EW3A 3SOCA 3EQCA 5AR2A 4IZ5A 3TL8A 4H58A 4FKSA 3QRTA 4ANMA 4EH6A 3GGFA 3R6XA 4ANOA 2RL5A 4UMPA 1CDKA 5J1VA 3F3TA 4MXCA 4TWOA 4ZJJA 1UU9A 3WF7A 5LWMA 4K11A 2WMTA 3ENHA 4IAZA 3UDBA 1WBVA 3OUKA 3RK5A 4FEVA 4XOYA 4FF8A 2WMAA 1MQBA 3HUCA 1KV1A 3I4BA 3LPBA 4JVGA 4ZLZA 1Q8UA 2FB8A 4DG0E 1ZMVA 4LRMA 4O7NA 4ANSA 4ZTMA 3V51A 4AOTA 3DNDA 3MIYA 2YAAA 4K6ZA 2PVFA 4IAYA 4CYIA 2IN6A 3MGYA 4EH2A 5GINE 4DLJA 3HA6A 4NEUA 5FP6A 3TIYA 1FVRA 3R22A 3ELJA 4MXXA 2X7GA 3O2MA 5KMMA 3D7TA 4FV4A 1PYEA 3IGGA 5M4FA 3R1YA 1O9UA 5I9XA 3PG1A 5AV0A 2W5AA 3RHKA 3R9NA 5CF5A 4R3RA 4F64A 3EFKA 2BIYA 3A7JA 3TIZA 4DEGA 2VGPA 1DS5A 1MRYA 1OKYA 5HO8A 2GNFA 2OK1A 1ZY4A 4JNWA 5BYLA 3R9RA 3LFCA 4CTCA 5CEKA 5LQFA 2X0GA 2BMCA 4G9CA 4HYSA 5DMZA 5JZJA 4C4FA 2VWXA 4QYYA 4GKIA 4E4MA 1K9AA 3DTWA 1I44A 3HVCA 1QL6A 4QOXA 1J7IA 5KMIA 4F4PA 3KY2A 1H4LA 4U97A 4XBUA 5EG3A 4I3ZA 1MRVA 2OXYA 4YZNA 5HBEA 4GT5A 4TZRA 3RMFA 4IB3A 3VBYA 4EORA 4NZWB 4FTLA 4I4EA 1YXUA 4WA9A 4RX7A 2UW6A 4AW1A 3UVQA 2YAKA 2J5EA 4QPMA 1PXLA 3DJ5A 3NNUA 4BCGA 2UZTA 3Q53A 3ZEPA 5I9VA 3WF9A 1U4DA 4GUBA 2EB2A 3LCTA 5C27A 1R3CA 5D7AA 4FG7A 4JAIA 4L46A 4QPAA 2QOCA 2YIYA 4C3RA 2QD9A 4GG7A 1WFCA 3P1AA 3V8TA 2NP8A 3QQJA 5CVFA 3NS9A 3HZTA 2BDWA 4CFXA 3ZCLA 5HNIX 1ERKA 1XH8A 4DGGA 4KIKA 1YWVA 1P4FA 3PXZA 4F0IA 5EYKA 3LXPA 5EI6A 5DGZA 3Q60A 3UODA 2XP2A 4ANNA 4D58A 4FKTA 1G3NA 5HORA 1IA9A 4U6RA 3DDPA 1YHSA 4BB4A 4LV8A 3I7BA 4RC4A 4FEXA 2UZUE 1A48A 2CNVA 3BV2A 3D5VA 3CJFA 4Z3VA 4HVIA 4PPAA 3F3ZA 1IAJA 3GU4A 2P55A 4U3ZA 3KQ7A 4ERKA 4O7ZA 1YHVA 1CKJA 3LXNA 3RP9A 3E8NA 3E92A 3F61A 4DINA 5AIRA 5L8LA 1Y6BA 2XS0A 3PTGA 4ACGA 3HV4A 3QA0A 5IQBA 1SMHA 2ZAZA 3CPCA 4JG8A 4TN6A 3V6RA 4EZ5A 5A4QA 3AG9A 2JD5A 4YNOA 4G1WA 1TQMA 4EQUA 4BCNA 1JPAA 2WQMA 4FKOA 1UWJA 4I5MA 5D1JA 3LFDA 2PVRA 5DE2A 3E5AA 3LQ5A 4P2KA 3NUAA 5JKGA 2JBPA 2W1ZA 4IMYA 1WVXA 2BRNA 3BYVA 3UQCA 4FEWA 4IXPA 5KKRB 3GCSA 3GCVA 4YHFA 3SG8A 5HIBA 5CYIA 2FVDA 5IISA 2H8HA 3LM0A 2OFUA 3BEAA 3VW6A 2YWPA 1M2QA 3DBQA 1VEBA 2X9FA 3VS4A 3IW4A 4R8QA 4A9YA 5C4LA 4C36A 5AX9A 1CTPE 4BCJA 2C3IB 5CT7A 5I9ZA 2BKKA 3GXLA 3H0YA 3WILA 4CMTA 2WMVA 5FTOA 3KRXA 1URCA 2C68A 3C4WA 4GFOA 3ZU7A 4ZMFA 4LGDA 4G9RA 3QCSA 2GS2A 2XVDA 3NR9A 4QD6A 4R7IA 2ERKA 3DJ6A 1S9JA 2BCJA 5CU4A 2C6DA 4ZSGA 3OTVA 5K3YA 2WMSA 4JDIA 2REIA 3ZFYA 4AA4A 1WBPA 1U54A 4RJ8A 3S0OA 4EONA 4DGLC 3CC6A 5F9EA 2VTOA 3RM7A 3BE9A 5EKNA 5IMXA 4MX9A 1BLXA 4M84A 3RZFA 5J7BA 3RPSA 3HV5A 4X2JA 4JX3A 5DWRA 1JNKA 5FQDC 2IO6A 4DH3A 4EI4A 3R83A 3NZ0A 4FKRA 3BLRA 2QVSE 4FTAA 2J5FA 5A4TA 3HMOA 3O8TA 4X2FA 3CY3A 2J7TA 5DPVA 4DGNA 4F7JA 3LXKA 4FEUA 4U8ZA 3PUPA 2UW8A 3UZTA 3PIYA 4MD9E 3UC4A 5FEEA 4JS8A 3P08A 2X7OA 5C4KA 4CD0A 5KKRC 5FXQA 3DPKA 3QC4A 4FNZA 4G34A 5K4JA 1ZOGA 4F0FA 3W2SA 4R7BA 1FVVA 2O2UA 1XH7A 3DK7A 5BNJA 2IZUA 4HGSA 3BQCA 2R3NA 4IWQA 3SW7A 2YIRA 3PA3A 3VBTA 4BTMA 2C3JA 4FT3A 4UEUA 4Z55A 3H30A 2W4OA 4O38A 4OTFA 5CS6A 4C3FA 4M7IA 3GENA 4BKYA 2HZNA 3JR1A 3OWPA 5A54A 1ZYJA 2I0VA 3AMBA 1OKVA 3CLYA 1PW2A 4MBLA 3ROCA 3DLZA 4DT8A 2OIQA 4NTTA 2YJSA 3QZFA 4TL0A 4E4NA 4K1BA 2UW3A 5CVHA 4GH2A 4U42A 1H25A 3EQIA 3FPMA 4ANQA 2GU8A 4QT1A 5CSWA 3IW6A 4E20A 5HLNA 2R7BA 2O64A 3VS7A 5I9YA 4CGAA 2XEYA 4YHTA 4QYHA 4QP9A 1YWRA 2JBOA 4UMQA 1OBDA 2R7IA 3U9CA 3G6HA 4NTSA 4FKIA 3BX5A 5D11A 1G8SA 2PVNA 1WMKA 3ZDIA 5CQWA 5BMMA 3HDMA 3R01A 1BKXA 4CFNA 4RIWA 1F0QA 1QMZA 3HDNA 4CLIA 2ZMCA 3QRJA 4YJVA 2GTMA 4H3QA 2XNGA 3LLTA 2JKQA 4W4VA 3G51A 2A4LA 2B1PA 3VUMA 5J8IA 4M14A 1JKSA 2OZAB 3VUTA 4F70A 4R77A 5JEBA 3KL8A 1YQJA 5J9ZA 4LOOA 4RQVA 4NUSA 2OU7A 4WHZA 3VUDA 2PMNX 3IDCA 1MP8A 1YOLA 2J0IA 3R8PA 3WE4A 1CKIA 4P90A 2OJ9A 5EYMA 4LMUA 2PUUA 3NYVA 4MNEA 4D4YA 2YDKA 1H1QA 3VUHA 4CV9A 3W2RA 4BDHA 2OIDA 5EKOA 4DGMA 2WKMA 4XG6A 4O0RA 4FIGA 2E9PA 1OIQA 2X8IA 4Q5EA 4X3JA 5LMKC 4KBKA 3UOKA 4ZY4A 2PWLA 3RPOA 2WTVA 1IRKA 3OCTA 1HOWA 4KKHA 4QMZA 3LFSA 4S31A 4YTFA 5HD7A 2IVTA 4J96A 3I0QA 2XIYA 3OT3A 2A2AA 3R9HA 3SOAA 3R7GA 2IWIA 5FDPA 4I20A 3JPVA 1JKLA 3Q3BA 4RSSA 3O8UA 5HG9A 5LXMA 1VYWA 5L4QA 3DT1A 4IJPA 4PDYA 4AN3A 1CKPA 4M13A 1XH4A 5AWMA 3MV5A 5KMJA 4G5PA 3O23A 3JVRA 5EDRA 3Q6WA 5HCZA 1Q8YA 3O96A 3MVLA 4JIAA 3PZHA 4YJTA 4D4VA 4PP7A 3BHVA 5EQEA 4N4SA 5H8EA 3R9DA 4FV0A 2YM5A 3N51A 3QXPA 2VTSA 3QXOA 1REKA 5C1QB 3DBCA 3I6WA 3DK6A 4J8MA 3LMHA 4AXAA 3FZRA 5TO8A 4CYJA 3BLHA 4C57A 5AV3A 1P14A 4ENXA 2YACA 4KKEA 4ZIMA 3V6SA 2X4FA 3EKNA 2XK3A 3RI1A 3ZFMA 3AOXA 2I40A 1YWNA 4MHAA 3IO7A 2UZEA 5DEYA 2WNTA 3O8PA 5LMKA 4WT6A 2Q0BA 4LUEA 3FMEA 2VX1A 4DFZE 3UO5A 2VWWA 2JITA 4ZS0A 3F7WA 3A7HA 4HCVA 5BUEA 4MQ2A 4XBRA 4Y8DA 3L8PA 4CT2A 3HLLA 4IB1A 3TG1A 4ZZOA 5JRSA 4AF3A 3V8WA 5IH5A 4FTNA 4PL3A 5A9UA 3WF8A 4O6LA 4C2VA 3RAWA 4F9YA 1Q3WA 2Y8OA 2JDOA 1Y6AA 4JQ7A 4GCJA 1H8FA 3PSDA 4L3PA 4O2PA 3W10A 4EYMA 4IANA 1JQHA 3IGOA 3ULIA 2NO3A 2AYPA 4YSJA 3FKNA 5LOHA 3PXYA 4X0MA 2WU7A 5IEYA 3NYXA 3RJCA 1ZY5A 5E4HA 3W18A 4C62A 3ROYA 3KK8A 4J1RA 4YHJA 4AOIA 3FV8A 1ATPE 2HZ0A 3ORPA 3TUCA 2BRMA 4CLJA 5CEMA 5IQAA 5L8JA 1UVRA 3D14A 5E8TA 3VC4A 5DT0A 1X8BA 4HVSA 4ZZNA 5K5NA 2E9NA 4L53A 2FO0A 4PDPA 2HXQA 2KTYA 3TTJA 3GQIA 4EOOA 1ZZ2A 1AD5A 3E63A 2ZB1A 4YNEA 5AP7A 3WARA 2B4SB 2CSNA 3ITZA 2YLEA 2ZMDA 4IWPA 1GZOA 3O50A 2XJ0A 3ACJA 4FKUA 4RC2A 3R2YA 2VTRA 2AC5A 1AGWA 3ZRLA 5AP0A 5E92A 2UZBA 2EXMA 4UXLA 4S2ZA 4PWNA 1W83A 2J0MB 5TKDA 3SRVB 3SRVA 5DI1A 2VGOA 4S34A 4NU1A 2CNUA 3C0GA 4DYMA 4M12A 3CBLA 5FEQA 3QTWA 4G6OA 4FSYA 3C4XA 3EHAA 3KMWA 3BV3A 3CQUA 4FKLA 4X7QA 4Y73A 2C0TA 4QP4A 3H9FA 5HEZA 2W9FB 2G2HA 5HX8A 4YJSA 2ZM4A 5I0BA 4UV0A 2BR1A 3R7UA 5FP5A 3C4FA 3ZH8A 3L8VA 2CGWA 4RQKA 4UB7A 5JZNA 4ZY6A 4DN5A 4IX6A 3A4OX 3FXWA 5JQ5A 3R2BA 2PMLX 4BDDA 5A4LA 5FTGA 4XLIA 1PXJA 3IW7A 5BVWA 3Q2JA 3ZUUA 5HU3A 2WFYA 5IKWA 3JS2A 1UNGA 3Q9WA 4QTEA 5ICPA 4TTHB 5AUZA 2JKKA 2PUPA 4MXOA 3HV3A 2RF9A 2I7QA 1FQ1B 4BZOA 2PVYA 3P7BA 4FG8A 1KOAA 2CMWA 2G01A 2JAMA 3TEIA 4HVHA 5IDNA 3OTUA 3E8DA 1W8CA 1J3HA 2Z02A 2YDJA 4MWIA 3I5NA 5M56A 4MD7E 4BF2A 3E62A 3ATTA 4DBXA 2X7FA 2R3KA 3PRFA 2RG5A 4FTTA 5IQHA 1Y8YA 5IA5A 2X8DA 3NNWA 2BDFA 4I21A 4RIYA 4GU9A 3FLZA 3ZLWA 4EOKA 3DBEA 3FI8A 2B53A 2C3KA 2WEIA 4BDEA 4EQCA 4NFNA 4EK3A 1Q4LA 3OW3A 4JBOA 3VRYA 4FTCA 3PA5A 4WBBB 3I6UA 2CCHA 3MW1A 3QTUA 4CT1A 4YJOA 5DFPA 5C9CA 3FKLA 3IW8A 1DAWA 4BDBA 2W5HA 2W05A 2C6IA 4EH7A 5AUVA 2VWYA 1M2RA 2E9VA 4O7LA 4FOCA 4WNPA 5GZAA 4E7WA 4OBOA 4CZUA 3DXPA 5CVGA 5AP1A 2BRHA 2HELA 2IW9A 2UZOA 2R0UA 2X8EA 3LFQA 4IX4A 4OUCA 4QQCA 4EEVA 2EXCX 1V0PA 3MFRA 2C5YA 1H00A 2OXDA 5IG1A 5AADA 4D5KA 5HO7A 4DAWA 4LGGA 4FT0A 4PL4A 4CRLA 3VQUA 1V0BA 5DA3A 1JKTA 2VWIA 4LI5A 3TKHA 3UQGA 3CKWA 3KB7A 3ZBXA 4IW0A 5DEWA 4MF1A 1IR3A 5HU9A 3OG7A 2F7EE 1GZKA 3MYGA 3R04A 4NJDA 3ID6C 1KSWA 2OLCA 3DFAA 4I5CA 2YWVA 5AR5A 5HE3A 4Y72A 3CTQA 4YBJA 4H1JA 2FGIA 1GIHA 2ZM3A 4AW2A 2E2BA 4EOPA 4UN0C 5C8MA 2QHMA 2Y4IB 3KRWA 4EWQA 4EC8A 4OTIA 2YIXA 5K5XA 4B0GA 5L6PA 3TNIA 2R3PA 3R28A 3SHEA 2C6TA 3PWDA 3IG7A 3VUGA 2HZ4A 5J79A 4QMYA 5AP4A 5J7HA 1GNGA 4GYIA 4AGWA 4CQEA 2PVLA 4KIPA 5IEXA 5M4IA 5M53A 3Q4CA 4B9DA 4FT9A 5EW9A 4C34A 4DFUA 3HV7A 4G3CA 4RIXB 4IEBA 1OIYA 5TE0A 2HZIA 1IAHA 3UVRA 5HBJA 3B2TA 5E1EA 1J1BA 3VW8A 4D9TA 4XLVA 3ORXA 2C0IA 4DH8A 3B8RA 4KIOA 3DZQA 4G3FA 5TT7A 2BAKA 3GBZA 4QNYA 2XJ2A 3V8SA 2OF2A 4JIKA 4L3LA 4L6QA 3UMWA 4I41A 4AGDA 4BKJA 1WZYA 4DEBA 2R3HA 4QPSA 3SKCA 1Z5MA 3E88A 4HYIA 3TV7A 3F88A 3I7CA 4XRJA 5G6VA 5AAGA 1MQ4A 4IH8A 2XIKA 3D5WA 5CI6A 2QURA 3L8SA 5AJQA 3UVPA 3FLSA 2PVKA 4OTQA 4M15A 5A4EA 4RIOA 4X6QC 5E8XA 4DFXE 4O83A 3SC1A 4GJ3A 5CU0A 4FV2A 4LRJA 1QPDA 3O0GA 4I5HA 5H8GA 4FG9A 4IDVA 3DAJA 3R1QA 4FC0A 4PQNA 2QU5A 2ZDUA 4M67A 4YJQA 4O84A 2X6EA 2CLQA 3MTFA 1YXSA 3NUYA 4EJNA 4R5SA 4QMOA 4CMOA 3W32A 2VTJA 3UPXA 4UWBA 4B4LA 4KB8A 3L9PA 4QRCA 5EDQA 1PXKA 4DFYA 3UO4A 3EQBA 3ZHPC 2UW0A 2CN8A 3UYSA 4UYAA 3D0EA 3UTOA 4G3DA 2C6EA 4APPA 4H36A 3WE8A 2WMUA 4IVAA 3NVMB 4O7SA 1DI8A 3FJQE 5GNKA 4BZNA 5KE0A 2A0CX 1M7QA 5CEQA 4FVPA 4YZCA 4C4JA 3KXMA 2JIIA 4LQMA 3WOWA 5GZ9A 4G16A 2OFVA 5HVYA 5HI2A 2GQSA 3ODYX 3LFFA 2XH5A 1Y8GA 4R6VA 3EMGA 4QP6A 2PZIA 4L45A 3H3CA 4O1OA 4GT3A 4X3FC 2ZOQA 4IFCA 5GHVA 4EOSA 1EH4A 3QHWA 3GUBA 2C1BA 3A7GA 3L1SA 3PP1A 3NUUA 4BIBA 5DBXA 2PULA 5J5SA 5J87A 5M4UA 5IQIA 4N70A 4BRXA 4TYHA 3NW6A 4C8BA 2FSOX 2G2FA 2J0LA 3KVXA 4MD8E 4RJ3A 5I4NA 4AZWA 1BMKA 3H9RA 3BYMA 1R78A 2ITYA 2XK7A 3ORMA 3GI3A 3Q6UA 4I0TA 4CVAA 5KMLA 4D2WA 2GS7A 3KULA 4IC7A 3NAYA 5CAVA 2JKMA 3AGMA 4KSQA 4FZDB 3VS1A 5HE2A 4QTDA 3C1XA 5CTPA 3I0OA 5ETIA 3DV3A 1YI3A 4HGEA 4BGQA 4P5ZA 3D94A 4DE4A 4RJ6A 4C3PA 3IDPA 3F2NA 3NMUF 2VO7A 5L6WL 3QALE 1BI7A 4A7CA 3EOCA 5LCKA 3G2FA 3CJGA 3IONA 2VTNA 3KULB 4OGRA 5DRDA 4IZ7A 4Z9LA 3QTIA 4FIHA 4I1ZA 4JDHA 4JR3A 4JX7A 5HKMA 5CXHA 3ZUTA 3NDMA 4FKGA 3OBJA 5CAUA 2B7AA 2WB8A 1HCLA 2QO9A 3E7OA 1SZMA 3OOGA 3AGLA 2RFDA 4C02A 4A4OA 3E93A 2VAGA 4ZMEA 5CLPA 5FDXA 2IPXA 3C50A 5M08A 4OT6A 5KMNA 3U51A 3Q9XA 2QG7A 1UV5A 4I92A 4S32A 2VTMA 3ORNA 5EW8A 4D2SA 3II5A 2P0CA 4IADA 3D9VA 5EK7A 3DK3A 3OEFX 4BI2A 3K54A 4EKKA 4DCAA 3ZLYA 3ALNA 4EK5A 5D10A 4OTWA 1DI9A 3UP7A 4CFFA 2EB3A 4QQJA 2OJGA 5EH0A 5IQFA 4C4HA 4BDIA 3CSVA 3QKLA 1VZOA 4MBJA 2OICA 3Q4ZA 4XS2A 4EHGA 1WCCA 1J91A 2WTKC 3IQ7A 4ANBA 2ZV9A 3GB2A 4FMQA 4ID7A 2QHNA 4RFYA 1PXOA 4YZDA 3MPAA 5AV4A 3NW5A 5L2QA 4L01A 3B8QA 4G3GA 2LAVA 2JKOA 4GSBA 5M4CA 1NA7A 3THBA 2HWPA 2J51A 5BVKA 5K9IA 1QPJA 4D2VA 1GIIA 1UU7A 4KS7A 3FZSA 3HRFA 3PJ3A 3CEKA 4PPBA 4M69A 4KNBA 1YDRE 2UZVA 3GQLA 3DBDA 4UBAA 2JDRA 5JFWA 2GNJA 2O5KA 1QPCA 4V04A 4YC3A 4MKCA 3P4KA 1SVEA 2IJMA 4U43A 5AM7A 1O6YA 1ZLTA 3GP0A 3TCPA 5HE1A 4F9BA 4FODA 4CZTA 3QD4A 4G2FA 2OH4A 4O0VA 4CKIA 5HVKA 3RNYA 2BTSA 5GJDA 4EKLA 3DZOA 4L42A 1OMWA 2E9UA 3C4ZA 4QP7A 4X3FB 3HECA 4X3FA 5EM6A 5HQ0A 2ITTA 4FZAB 2WMQA 4RC3A 5JRQA 2AC3A 4FSMA 4ZTLA 5M06A 2BZJA 2C6OA 1XKKA 3A7IA 2JLDA 1NY3A 5HESA 3KGAA 4E4XA 4EL9A 3NAXA 3ORIA 3M1SA 4EYJA 3C13A 3KKVA 4XV3A 1REJA 2WTJA 4NH1A 4X21A 2RG6A 1PMVA 4FKJA 4TYEA 2P2IA 3EH9A 4FGRA 1CSNA 4M8TA 3MA3A 5CWZA 3C4EA 3OWJA 4DCEA 2YA9A 3E7VA 4LOPA 4RA4A 5I3RA 3R7OA 3TM0A 4F63A 3OVVA 4JJRA 3O17A 2J4ZA 4OTDA 1SVGA 4HCUA 2GQGA 1Q24A 5AR8A 1L3RE 1OB3A 4AT4A 4PRJA 5A4CA 2WO6A 4EWHA 3G15A 1KV2A 4LL0A 4E8AA 2WTKB 3A2CA 3I1AA 5JMSA 3RNIA 3E3PA 5D7VA 3CQWA 4BWPA 3LJ1A 4C4IA 4M3QA 4TWPA 5EM7A 4FKPA 2GPHA 2B52A 2V5QA 3PJ1A 3R8UA 3TNHA 3DAEA 1Q3DA 3VULA 2ZV7A 3DGKA 3EYGA 4C59A 2QKRA 1YXTA 5CEOA 1XO2B 4KABA 5TR6A 3ZDUA 3A61A 2UV2A 3OFMA 4CFUA 2WIHA 3KRLA 4DC2A 3LQ3A 1ZOHA 2VWBA 1BI8A 4IC8A 3EFJA 3QTQA 4JT3A 2FH9A 3AT2A 5F4NA 3ACKA 2J90A 4GK2A 4HYUA 2YEXA 3G9NA 3BU3A 4PUZA 3TN8A 2XB7A 3MFSA 3QZHA 3CD8A 3TDWA 3LCOA 3UZPA 5DYJA 2VN9A 3KXXA 2ZYBA 4IB5A 2R3QA 3R1SA 1G8AA 1ZMUA 1PHKA 3VS3A 5HIEA 3EN9A 2I1MA 4H1MA 2XYNA 2WTWA 5E91A 4WSYA 2DUVA 3M11A 4YLLA 3ERKA 3FSFA 4GKHA 2XRWA 2YIQA 4HGTA 3I60A 2PE2A 4G17A 4AFEA 4N57A 4E1ZA 3RAHA 2JIUA 2BUJA 4ORKA 2OJIA 3JXWA 4I6HA 5AM6A 1BUHA 3VAPA 3E3BX 1V0OA 4UMRA 2NPQA 2XNMA 4R1YA 4FL2A 4PF4A 4Y5QA 4PTGA 1OL7A 3O51A 3OS3A 4BR3A 1Q97A 4CFVA 3ZO2A 4NIFA 4S33A 2C1AA 3UC3A 2EU9A 3QUDA 4ZEGA 4BHNA 3LKMA 3KFAA 3CPBA 3VS5A 1PJKA 2XUUA 1KE5A 4I5PA 4F08A 3AMYA 2UVYA 3EN6A 3UZRA 3RAIA 2CCIA 5KZ0A 4AGUA 3AC2A 4DTBA 4EOJA 5JFXA 2XKEA 5EDPA 2ITPA 3MB6A 4RVKA 3BGZA 3VNTA 5AFVA 2UZDA 3NCGA 2XNPA 2QU6A 3AMAA 3QRKA 3ET7A 5IEVA 4XX9A 2EWAA 2WQEA 4CTBA 5IH6A 3KC3A 5BVEA 4JG7A 3I5ZA 5D9HA 5ITAA 3F2AA 3ZM4A 2QI8A 4FTRA 3JY9A 1RJBA
chains in the Genus database with same CATH superfamily
3BLAA 4NW6A 2CKPA 4K0YA 4ZK5A 5AA9A 5HTIA 2BHHA 3R7YA 3CGFA 4I4FA 3VBWA 4G6LA 4MVFA 3ZONA 3WBLA 4JXFA 2CKQA 4RFZA 2EVAA 4RX9A 5BQ0A 3KN6A 4LM5A 5EM8A 5HIDA 4AE6A 4DTKA 2BAJA 5E8UA 3FLQA 3FLWA 5B7VA 2YABA 4PTEA 3MN3A 3QC9A 4UZDA 3QD0A 2W1HA 4DH1A 4U3YA 4PPCA 5IUHA 2Z7LA 2VO6A 4DEEA 1WBOA 5FEDA 4Y83A 3NYOA 4LDTA 4R1VA 3PLSA 1H1WA 2YM4A 5ANOA 4FV5A 4B6LA 1XHAA 4HPUE 2ZV8A 1RW8A 2ZB0A 3LCSA 3MH1A 3PVUA 3LVPA 2WZJA 2VWUA 4X2GA 3SDJA 4AXEA 4U44A 4X2KA 3PSCA 5E9EA 5BVNA 3TV6A 2O8YA 4PDOA 5FM2A 4PX6A 2YZAA 4NM7A 2JEDA 3OCBA 1GZNA 3POOA 4E6CA 3I79A 4BCKA 3QHRA 2V55A 3JY0A 4WNKA 4RZWA 4N6YA 4TWNA 5CQUA 1PXIA 3Q5IA 4FTQA 3BGPA 5F20A 3EB0A 4NIFB 4Y85A 1Q61A 4EHEA 5AV1A 2VV9A 3AD5A 2WMBA 4C38A 3P0MA 4UYNA 3TKIA 3AD6A 3MPTA 4U40A 4ZTSA 2B9IA 3GU6A 3H9OA 3L8XA 2VD5A 5ANKA 4QYGA 4XV2A 4ZSAA 5CF8A 4CKJA 2Z7SA 3LXLA 1OPKA 4IIRA 4RJ4A 1O6LA 3HMPA 3ATSA 3P78A 1I09A 3A60A 4U9AA 2IW6A 2C69A 1ZAOA 2RFSA 2UW5A 3LAUA 1FGIA 2XNBA 4YZMA 4GJ2A 5LVMA 4ACMA 4I94A 3U9NA 4EHVA 2HCKA 4RLLA 4FE2A 3FI3A 5CSHA 5EFQA 5HGIA 5IF1A 3QD2B 3GU5A 2HY0A 4BVUA 2LGCA 4BCOA 1DAYA 2J2IB 3BU5A 4PMMA 5EYDA 3DTCA 2JDVA 1QPEA 2VTQA 1WVYA 2W7XA 3KMUA 3W2PA 1OGUA 4ZTNA 3FZTA 4HZRA 4N0SA 3PJCA 2PE0A 2RFEA 3GFEA 3ZYAA 1OPJA 3PXRA 3P23A 2P33A 3VRZA 3KRJA 1W0XC 5ANDA 5IQDA 3TDVA 1ZOEA 1Z9XA 3UBDA 3ZTXA 4DEHA 4ITJA 3VBVA 3QF9A 3MJ1A 2B9HA 3QTSA 4U7ZA 4YUQA 2VRXA 1UU3A 2R3MA 2WU6A 4EK8A 3ETAA 3F66A 3ALOA 2XM8A 3UO6A 4L44A 4RZVA 4D0XA 3KN5A 2UW4A 5C01A 3KF7A 4IX5A 3GU8A 4AAYA 2QODA 1FOTA 1GAGA 1LUFA 4UWYA 3CS9A 3QQLA 3K3IA 4J71A 4G3EA 3EN7A 1JBPE 3Q96A 4BGHA 3W0OA 4F7NA 4TYGA 3PE2A 3QU0A 1YDSE 1R0EA 2C0OA 4F6UA 4ZTHA 3HV6A 3QWJA 1TZDA 3UDTA 2DS1A 4Y5HA 3UIXA 4OAVB 3KXHA 3CP9A 1OL6A 5BYZA 4FGBA 4FV7A 4U45A 1RE8A 3WF5A 4USEA 5LCJA 2W17A 3REPA 4ALUA 3SV0A 1B39A 2RIOA 2OG8A 2GNLA 4EQMA 3Q2MA 1MRUA 4RIYB 3NFFB 2XK4A 3E8CA 3HL7A 5IUIA 1ZYDA 2SRCA 4TW9A 2B54A 1YI4A 3OBGA 3AC3A 4L00A 4GU6A 3Q52A 3DDQA 3R63A 1U5RA 4AAAA 4AA0A 4O0YA 5IQCA 3RZBA 4CRSA 4O4FA 5IH4A 1FVTA 4O0UA 4O21A 4W4XA 4HW7A 1APME 1S9IA 4C37A 1JLUE 1PXMA 5CSPA 4X2NA 3QZGA 3FQEA 3CKXA 3TI1A 5HTBA 1H01A 2J6MA 1H24A 4XMOA 3PJ8A 3ZC6A 1WBSA 5AX3A 4BGGA 3VUIA 4ZSLA 4DH7A 4K77A 4KRDA 5KMKA 1Q8TA 4YPDA 3IW5A 1OBGA 4FK3A 4I23A 3MIAA 4MXZA 2I0HA 4K8AA 4EOIA 2H96A 4OW8A 1NW1A 1GJOA 2YCQA 3WYYA 1P2AA 4FNXA 5IZFA 5EHYA 4AW0A 2VUWA 2XARA 4FIJA 1YDTE 4KS8A 4YJNA 2DYLA 4BIDA 5HCXA 1A06A 3ORLA 2XK8A 4FOBA 3HYHA 3C9WA 3OMVA 2QONA 4GMYA 5H9BA 5L2TA 4GFMA 4NWMA 3ODZX 5J9YA 2YM3A 4FSNA 3AC5A 4A4LA 4GVAA 1FPUA 3VQHA 1CMKE 4F9CA 4FVRA 1FBNA 1SYKA 3SD0A 4NFMA 2PVMA 4KBCA 5H3QA 2HOGA 2OGVA 4XV9A 1IEPA 2ETRA 1OECA 2XMYA 4WBOA 3U87A 3SLSA 2IEWA 4P5QA 1JOWB 1ZMWA 3EQRA 2G15A 1XH5A 2WTCA 3NNXA 4MQ1A 4OR5A 4PP9A 4QMXA 2OO8X 4NYEA 1T46A 1TKIA 2R4BA 5ANIA 5E7RA 1G8KA 3LFAA 3Q9YA 5E8ZA 2UW7A 3KXGA 2WAJA 4DFLA 4R3CA 5FG8A 4B8MA 1K2PA 3VJOA 4BYIA 2J0JA 4IAIA 3TV4A 3NIEA 4GG5A 3COKA 3VF8A 5FUTA 3PVGA 4YZBA 3CGOA 1KE8A 1F5QA 2W1CA 3A8WA 2CKEA 3FC1X 3RK9A 3HKOA 4MUQA 3VF9A 5AP3A 4AT3A 4D4RA 3UIMA 3WF6A 2Y7JA 3MFTA 1FGKA 4RIXA 2VTAA 4W8EA 4DLIA 4TY1A 3WI6A 3GFWA 4V05A 2IG7A 3BPRA 4EBWA 1G8JA 4OTHA 3BI6A 1BL6A 2O65A 3COIA 3R71A 4LG4A 4H3BA 4PY1A 5B0XA 3WIKA 5AEPA 3Q32A 2YM7A 4J97A 4KIQA 4QMMA 3QGYA 4QMLA 3BL9A 1RQQA 4RWLA 5CSXA 5CZIA 3D7ZA 2W0JA 2F2CB 2QO7A 4KUJA 4IHPA 4FX3A 3GCUA 1JWHA 1U54B 3ML1A 3SQQA 5DR9A 4FA2A 4F99A 4V01A 3BWJA 5A14A 4ARKA 3PRIA 4F6WA 2UVXA 3H4JA 4I6QA 2QLUA 4XG4A 5AUWA 3QYZA 4EC9A 3A4PA 3BBTB 5G1XA 2Y6MA 1H0VA 3SVVA 5CT0A 4NCTC 2CKOA 3FXXA 5I9WA 1PMUA 4BKZA 2WD1A 4O0SA 3UOLA 4E73A 5M51A 4MNFA 2YIWA 5C8NA 3RALA 2WOUA 5DG5A 1YRPA 4GW8A 3FI2A 3FBVA 4FEQA 5EHLA 1GZ8A 3DS6A 5JN2A 4G31A 4YZ9A 3WZDA 3SAYA 1JSUA 4JL9A 3LJ0A 3DKCA 5CZHA 3VWAA 2PHKA 2GHMA 1NVRA 4GK3A 3V3VA 3GNIB 3IS5A 4M0YA 4JBPA 2XRUA 3WZUA 3BBWA 3F5XA 1Y57A 3M2WA 4C7TA 5AV2A 3HMIA 4IM3A 3K5VA 3FWQA 2QQ7A 3PPKA 4YGAA 2PPQA 2C3LA 3PY1A 3PIZA 1H07A 3TTIA 4FV1A 4FZ7A 5HLPA 5DR2A 1WVWA 4QP8A 2NYAA 3MI9A 4E4LA 5A6NA 5J95A 4F1MA 2XKFA 1GIJA 4YPSA 3K5UA 3T3UA 4NJ3A 1P4OA 3FYJX 3FZOA 4Z7GA 4ZP5A 1HCKA 1KE6A 2W1EA 2R3IA 3RCJA 1YOMA 3OY3A 2QOQA 3EQDA 3R21A 3O7LB 4W4YA 3UPZA 1YI6A 4YC6A 3HGKA 5I3OA 4F0GA 1BX6A 2VTTA 4WNOA 5H2UA 5JH6A 3EIDA 4D1ZA 1VJYA 3MH3A 5ANEA 4Y46A 2GNHA 4Y95A 4BCIA 4D1SA 4I6LA 1YHWA 4RFMA 4BBEA 2Z8CA 3C5UA 2WHBA 5HHWA 4C58A 5AUUA 3AC1A 4IM0A 4PMTA 4DDGA 3MY5A 5KBQA 4D2PA 2ITVA 4APCA 2XAOA 3DLSA 1OKWA 1STCE 3OP5A 2GNIA 5FXSA 5C03A 2CGVA 4AACA 2F7ZE 4CCBA 4TPTA 4WG3A 3COHA 4MBIA 2WPAA 3CCNA 5GZ8A 1XR1A 2VNYA 4XP2A 3FLYA 3RGFA 5KMOA 5LJJA 2OF4A 3MH0A 4QMWA 3ZSGA 5JFSA 4K2RA 3AT3A 2W1GA 4OLIA 2JFMA 5CNOA 4DH5A 5ACKA 4FKQA 3OWLA 4BC6A 4F7LA 3QTXA 3CD3A 3RAKA 3IOKA 3LFBA 5J5TA 1LEZA 2C30A 1P5EA 3NCZA 1ST4A 4JR7A 4O0WA 2FUMA 4M66A 3WZEA 2G1TA 4LRKA 3R9OA 3C5IA 4DTAA 4ZTQA 3ORTA 4WOVA 3ANQA 1M14A 3FY0A 4A06A 3TACA 4ITHA 4M69B 5HO6A 4FSUA 3NUXA 4C33A 3PVBA 2GDOA 5IA0A 4TNBA 2YFXA 3U4UA 3QUPA 3DJ7A 4IX3A 2WQNA 3D5XA 5BVFA 2F2UA 4K18A 4LFIA 4CEGA 1OUYA 2ITWA 4B8LA 1AQ1A 3LFNA 3LQ8A 3MA6A 2HWOA 4FTOA 4AZVA 2HY81 1YVJA 3MY1A 4O7RA 3L9LA 1M52A 1OZ1A 3MBLA 3R1NA 4U5JA 2GHLA 5HG7A 5TF9A 4R5YA 4GVJA 4HZSA 5HOAA 4IZAA 3LCDA 4ALWA 5AAEA 3P9JA 3QFVA 2OIBA 3SX9A 3W0NA 2GFCA 4IACA 5AR7A 5B2KA 4AP7A 4YMJA 4TYHB 5HICA 3ZRMA 5M57A 2F49A 2PY3A 3TUDA 1OUKA 1PYXA 3HP5A 1R0PA 2IW8A 1L8TA 4JI9A 3V5TA 3GOPA 2FSMX 3EL8A 4NK9A 1JAMA 1ZWSA 5A6OA 3W16A 3BYSA 1M17A 3R0TA 3W2QA 3FMKA 3W8LA 4BDJA 4MCVA 1DM2A 3MWUA 3DBFA 4GT4A 5B2MA 5GIOE 4WG5A 5LMAA 2B9FA 3QCQA 3F6XA 4KD1A 1Q99A 2Q0NA 3FI4A 2GSFA 4OTRA 4RLKA 1WBTA 3ORKA 2JAVA 3PPJA 4RX8A 3NRMA 4FKVA 4PL5A 4CXAA 2IVSA 4ASEA 5L2WA 4AT5A 3TJCA 3KF4A 3PE1A 4F09A 3PYYA 2OWBA 4QTAA 5CANA 4LV5A 4HCTA 2UW9A 3DNEA 5BPYA 4HOKA 4LOQA 4MH7A 2BIKB 4HNFA 5ETFA 4BDKA 3LLAA 3MFUA 3QRUA 4YO4A 3M42A 4R7HA 2BZKB 3NIZA 1F3MC 3BQRA 4USDA 4FSZA 4JQ8A 1NVSA 4IB0A 5D12A 4BDAA 4ZJVA 5KNJA 3UQFA 4NL0A 4QMSA 1W2FA 4GEOA 4QNAA 3ZLXA 5EI2A 3F3UA 4H39A 4NKSA 5AIKA 4DA5A 5IA2A 4K9YA 2F7XE 4ZTRA 4IVBA 3T9TA 1YXVA 2QOOA 3F3WA 4KAOA 4GS6A 3ENMA 4QP3A 2O63A 4FIFA 4TT7A 5AP6A 2C47A 3QTRA 3TNQB 2C6MA 3HX4A 3HRCA 3R02A 4RWIA 3RTPA 3VBXA 2BILB 2EUFB 2ETKA 3D2KA 2XKDA 1J7LA 2BRGA 3DKGA 4BCHA 4QMTA 4BDCA 3QKKA 4N6ZA 4D2RA 5CALA 5FWKK 1IASA 1WBNA 2R64A 4HVGA 4USFA 3DY7A 3MDYA 5JGDA 5CAOA 4KKGA 2R3OA 4TYJA 5CY3A 1PMEA 4DDIA 5IA4A 3DFCB 3QCXA 3CTHA 4CMUA 4O0TA 4FNYA 4BWXA 3RWQA 4ZLYA 2XNEA 4IDTA 3B2WA 1J1CA 4HPTE 4MWHA 3QX2A 5CENA 2QG5A 4AOJA 5HNGA 4CV8A 4R3PA 4D5HA 2ITNA 1W84A 3AXWA 4F9AA 1VR2A 3OXIA 3MSSA 4FV9A 1H28A 4IWDA 1OL5A 4ALVA 3MPMA 3TKUA 3N9XA 3ZEWA 2P4IA 2ZJWA 3JVSA 4PDSA 4I6BA 4XYFA 1ZXEA 4A9TA 2XIRA 2YN8A 4GL9A 5M09A 4O4DA 4ACDA 5BVOA 2VWZA 2Z7RA 3UNJA 2Z7QA 3OY1A 5EOLA 5AMNA 1BYGA 2CHLA 2OKRA 3IECA 4I24A 2UUEA 3F5PA 2C6LA 4MAOA 4O7WA 3Q9ZA 3EQGA 3V5WA 3FAAA 5L2SA 2IZRA 5DN3A 2GNGA 4L52A 2CLXA 4JDJA 2PMIA 1SNXA 2AQXA 4QMUA 5FD2A 4AFJA 1YKRA 4PMSA 4WIHA 3FMMA 4AX8A 3KVWA 3U55A 2KULA 1KOBA 2IZSA 2V0DA 3AC8A 4F9WA 2ONLA 3VHEA 4ZS4A 4CFWA 3P7AA 2PMOX 4HVDA 3NSZA 2QR7A 2X81A 4RPVA 4AGCA 1TQPA 3A99A 4BBFA 1PMNA 3E87A 4AXDA 3U54A 2WMRA 2C6KA 5L8KA 3G9LX 1E9HA 2UZLA 4FBXA 4QMVA 5F1ZA 3KA0A 5CEIA 3NLBA 2WELA 4NW5A 4BBMA 4PNKA 2Q83A 2A27A 1T45A 3FL5A 3OF0A 3HNGA 3F3VA 4J99A 4I6FA 4YU2A 3BHTA 4FV6A 2Y4PA 3AQVA 4DG3E 4UMUA 4CG8A 1W7HA 4KBAA 3D7TB 2R3GA 3CIKA 3EQPA 3D83A 3S00A 1VLRA 5B2LA 4UWCA 4XJ0A 2HENA 4KSPA 4MYGA 3UG2A 4EOLA 5IDPA 2FA2A 3RK7A 4ZZMA 4JOAA 4BCMA 1NXKA 2A19B 4MK0A 3ZXZA 1UU8A 5AUXA 3KCFA 3MJ2A 4BTKA 2F57A 2C5VA 2X39A 2Z60A 1PKDA 3GC9A 3EZRA 3K2LA 3U6HA 1OPLA 2YISA 3R7EA 3A7FA 4FZFB 1PXNA 2NRUA 1XBBA 4I22A 5ANGA 3SXFA 4B99A 3ZC5A 2XYUA 2V7AA 4F65A 2XEZA 3QBNA 4E93A 4D2TA 4FV8A 4GRBA 3PIXA 2XIXA 4O96A 5EYCA 5DOSA 1OM1A 4AZEA 1NT2A 3P7CA 1R39A 2PTKA 2YHVA 4JRVA 3TJDA 2CGXA 3F7ZA 4J52A 2WMXA 4IAAA 4M68A 4V0GA 3ZO1A 5DRBA 5ETAA 4JDKA 1GY3A 5IPJA 5M44A 5IU2A 4XOZA 5KHXA 4DF3A 2ZV2A 2VX3A 3BHYA 3KXNA 4WD5A 3S2PA 3TNPC 5L6OA 3PUFC 4AZSA 5DT3A 4AN2A 4O27B 3IOPA 1FMOE 2R0IA 3RHXA 2OZAA 3AKLA 3A62A 4DHFA 4TNDA 5AAFA 1Y91A 2QC6A 2ETMA 3P5KA 3R00A 2ITUA 3EWHA 4ZY5A 4L8MA 1SVHA 2NNWB 3EYHA 4BDFA 4ENYA 4QMNA 3G5DA 5CNNA 4M97A 3QWKA 2YJRA 4P7EA 4E5AX 4RJ7A 3UOJA 2P3GX 3GU7A 3T8OA 3UNZA 3MVHA 3U4WA 3QAME 3EN4A 4QQTA 5CU2A 5F94A 4C0TA 3S95A 5K0XA 1LP4A 3LCKA 3BKBA 4XNEA 3W1FA 3ZRKA 3Q4UA 3LM5A 5FXRA 3KU2A 3F82A 1W2CA 5JFVA 5J1WA 4BIEA 3KMMA 4BCFA 4BI0A 5AR4A 2XALA 3EFLA 4FKWA 4PNIA 5HG5A 5KBRA 4BICA 4BYJA 3L9MA 2PZ5A 4JAJA 3NVKI 4BZDA 3W0QA 5HBHA 2PSQA 3G90X 1XH6A 1OIUA 3GVUA 4YSMA 3ZO4A 3CY2A 2BHEA 4JG6A 4LMNA 3DOGA 2F9GA 1UKHA 3F5GA 4AN9A 5CAQA 4HYHA 3IDBA 1OGYA 3MY0A 4KIKB 3OZ6A 3C4CA 3HUBA 4O7TA 4XG9A 4JLCA 4AZFA 3UMXA 3S3IA 2W1FA 3HAMA 4HGLA 1ZYSA 3W0SA 2X2LA 2YCRA 2QO2A 1Q5KA 4FIIA 4BHZA 4EK6A 1ZRZA 4IJ9A 1YW2A 1OKZA 2HK5A 2H34A 5KZIA 1U59A 4J7BA 3BYOA 3FMDA 2E9OA 4G6NA 1B6CB 1GOLA 5EI8A 4XHKB 5HZNA 3ZFXA 1SNUA 1KE7A 3D5UA 3OXTA 3ZLSA 3WZKA 1H0WA 3RM6A 5BUIA 2QOHA 2XBAA 4ZLOA 3OW4A 3C0IA 4EH8A 3OXZA 2PUIA 4KRCA 2WMWA 5CX9A 3JUHA 4F1TA 5HVJA 3MVMA 3G33A 2HIWA 4IVDA 3G6GA 3ZSHA 2Y0AA 5CAPA 4AG8A 4NCTA 2XJ1A 3BYUA 2UZNA 3NGAA 4R78A 4C61A 4TXCA 5L2IA 3PA4A 1UA2A 5FLFA 5H8BA 3OD6X 3F9NA 4C4EA 2X6DA 4JBQA 5CU3A 3ZBFA 3V5LA 2GFSA 5JQ8A 1H1PA 4L7SA 2GMXA 1WBWA 3PSBA 4HJOA 4CKRA 5FM3A 2P2HA 3FPQA 4RWJA 3BGQA 3F2RA 4BWKA 4D1XA 3IK3A 4GV1A 2X4ZA 5BUJA 4OAUC 3MS9A 1XQZA 4G5JA 2JIVA 3ZZWA 5IA1A 2XF0A 3FSKA 2F4JA 2XK6A 4I93A 4PMPA 3W0RA 5ANJA 3OHTA 2BFXA 2I0YA 3U6IA 1PY5A 2PYWA 3TXOA 3QQHA 2Y6OA 1UWHA 3IPHA 4YTIA 2PZPA 1J7UA 5GIPE 3A8XA 4JBVA 3FZPA 1Q8WA 2ZM1A 1KWPA 2JC6A 2WGJA 2AUHA 3QD3A 4J53A 5K4IA 2XNOA 2ITQA 5JT2A 4GIHA 3VBQA 3ZOSA 4I0RA 4MXYA 2XKCA 1B38A 2PVHA 1Q8ZA 4W9WA 1H08A 5AP5A 2OJFE 3G0EA 4U80A 4WKQA 3V04A 4YURA 5FTQA 5DHJA 5C26A 5AUTA 3C0HA 4EH5A 3CE3A 2XCKA 3FQSA 3QA8A 4FI1A 4Q5HA 3TZMA 4AWIA 4RIWB 3DKOA 4D55A 3QX4A 1OL2A 5KO1A 5BYYA 2R3RA 3BZ3A 4A9SA 4TYIA 4FTKA 5IQGA 1ZYLA 2VTHA 3LFEA 4C2WA 2GHGA 2EXEA 4EZ7A 1SM2A 3DAKA 4GYGA 3V5PA 3CTJA 5CASA 1JVPP 2YCFA 2FSTX 3NUSA 3P79A 4M0ZA 4BL1A 4DEDA 3PG3A 2BROA 5KUPA 4WNMA 2JDTA 3NNVA 3EKKA 4ACCA 3RCDA 4YR8A 2VTIA 4GUEA 2R3FA 4WO5A 4NT4A 2OI4X 2FYSA 1IG1A 5DH3A 4E5BA 2BTRA 3OCSA 4GFGA 4E5WA 3T9IA 3BHUA 2R3JA 5T3QA 3LIJA 3N4VA 5FBNC 4Z16A 2OH0E 2PL0A 3PWYA 3PDTA 3IKAA 3FY2A 4ASXA 5EOBA 4OT5A 4XP3A 4AXCA 2PVJA 3H10A 2YITA 3UNKA 4XRLA 5HLWA 2C5NA 2HAKA 3QYWA 2VNWA 5BX0A 2XIZA 4BDGA 4E6AA 1M2PA 3Q04A 2PU8A 2W5BA 3ZMMA 1U5QA 4DT9A 1CM8A 1E1XA 3QQKA 1OI9A 2V7OA 3ZO3A 4EOMA 2XCHA 4KA3A 1O6KA 4ASZA 4BTJA 4F7SA 2OJJA 4J95A 4D0WA 4CCUA 4RGJA 3ZZEA 3ZUVA 5KHWA 3EFWA 2YLFA 4KWPA 4CFMA 3BLQA 4YC8A 3VO3A 2VO3A 4BI1A 3NUNA 5E8VA 4E6QA 2O0UA 4FSWA 3CXWA 4QP2A 4QTBA 2VTPA 5I9UA 3VS0A 2R5TA 4BCQA 1Z57A 2W9ZB 4ZAUA 5CF4A 4EJ7A 2QOBA 4II5A 4YTCA 3R73A 2BKZA 3QKMA 5AR3A 2YCSA 2Y9QA 3LMGA 3O7LD 3PP0A 4FIEA 2HW7A 4GK4A 4OBPA 4H3PA 4RMZA 4IAFA 1NVQA 2YDIA 4LYNA 4AQCA 4GIIA 4BTFA 2YM8A 1IA8A 4NM0A 3BE2A 3FC2A 4FZ6A 4QYFA 4RWKA 3FEGA 2GS6A 3T3VA 3PPZA 3PJ2A 4EH4A 5FGKA 4FNWA 4TRLA 4XG7A 4BFMA 3RPVA 4EUUA 3I81A 3FE3A 2WXVA 4EK4A 3CQEA 2R2PA 2RKUA 3LZBA 3VUKA 4O7VA 2GTNA 3U8WA 2QOKA 4PV0A 2OBJA 2WQBA 5BMSA 3NX8A 3GCQA 4FR4A 2OSCA 3LJ2A 4AE9A 2R3LA 3KXZA 4ANLA 3RPRA 4F78A 3DU8A 3GC8A 2BFYA 2J0KA 3LW0A 4AZTA 2WTIA 4C35A 4D9UA 4E6DA 3U6JA 5J9LA 3WIGA 3UIUA 1JKKA 2O3PA 3O71A 4B7TA 3K3JA 1H26A 4PTCA 3FMNA 3KRRA 2ITOA 3W2CA 4AA5A 1XJDA 3ULZA 3TWJA 4EUTA 2FSLX 3DB8A 1JSVA 5CXZA 4XP0A 2YZLA 4BY9E 5JSMA 2ERZE 3W55A 3SGCA 3R8ZA 4Q9ZA 5FBOA 4YLJA 3QLGA 4E26A 4F1OA 3UJGA 3UOHA 4WRGA 3DXQA 1A9UA 3BRBA 3COMA 5K0KA 4DEIA 4Z7HA 5C8KA 5JGBA 4UY9A 3FHIA 4XH6A 4IZYA 4S30A 2HYYA 4DHZA 1R1WA 3HP2A 1ZZLA 3EN5A 3QRIA 4FL3A 5DNRA 4YP8A 4AW5A 3PLAE 2XA4A 1XH9A 4Q2AA 5LVPA 3DXNA 3PFQA 4XUFA 3NPCA 4O91A 1ZYCA 2BPMA 2C4GA 3WYXA 5AA8A 5M07A 4RJ5A 4FT5A 2H9VA 3OT8A 2BAQA 3R30A 3NW7A 2PZRA 2QR8A 4XG8A 4ZXTA 3C7QA 3VHKA 4L7FA 2QOLA 4MNEB 4BN1A 4CQGA 5ACBC 4QMQA 5HD4A 3BELA 3D4QA 5M55A 4U81A 2IVVA 2CDZA 3MB7A 4X6RA 3SA0A 4YJRA 2H6DA 3TZ9A 3TZ8A 1XWSA 3BIZA 4C4GA 3KREA 2VWVA 5GJFA 2ACXA 3FKOA 3OOMA 2ZVAA 3ORZA 4YJUA 5D41A 4UXQA 5DVRA 4E3CA 1FINA 3QQFA 4QEBA 4QMPA 3UGCA 1TQIA 3CR0A 3V01A 3NYNA 3BHHA 4BCPA 3QQGA 1KE9A 4IQ6A 4LUDA 3R8LA 3WZJA 3QTZA 2X2MA 3PXKA 2JFLA 4HNIA 3TT0A 3QL8A 4WRSA 4CSVA 3DCVA 4EOQA 2HW6A 3UE4A 4DGOA 3POZA 3SG9A 2X1NA 4O2ZA 5E8YA 3VS2A 4CG9A 1ND4A 1FMKA 4XG3A 5CI7A 2OW3A 4IAKA 4ITIA 2ONLC 5ETCA 3R8MA 3OEZA 3AT4A 3E64A 4FTUA 2W4KA 4YO6A 5DLSA 3OWKA 4DFBA 4U79A 2W1DA 2CGUA 3QCYA 1H27A 1PKGA 2J50A 2ITZA 3HA8A 1UNHA 3FMJA 4H05A 3GOKA 1UKIA 3RWPA 2V22A 3S4QA 5CEPA 3KEXA 5HCYA 4ZSEA 4FSRA 4WSQA 3EQFA 3RVGA 3UYTA 4ASDA 4W4WA 4J8NA 1ZARA 4QO9A 5A46A 4A9UA 5JK3A 4OTPA 2X0QA 3GT8A 5I5ZA 3R7VA 2GQRA 2VO0A 4RT7A 2ZDTA 5IUGA 3HEGA 3RKBA 3DB6A 1OVEA 2C5XA 3MTLA 4QQ5A 4MXAA 3G0FA 3PVWA 3W33A 3HAVA 4FT7A 2GCDA 5A3XA 1LEWA 3DQXA 3UP2A 3OROA 2G2IA 4DITA 2W1IA 2RFNA 4NSTA 1UNLA 4ACHA 1JSTA 4L9IA 4XV1A 1U46A 2WQOA 3BEGA 2QNJA 4FICA 4FRFA 4EHZA 4RRVA 1H1SA 2IZTA 1ST0A 3MH2A 2X9EA 5CF6A 2BVAA 4O4CA 4A4XA 2RGPA 4EH3A 5DT4A 3FQHA 1Q41A 2QOFA 4IFGA 4U0IA 5GJGA 4ERWA 5LMBA 4FTMA 2B0QA 4JRNA 1H1RA 4FVQA 5CU6A 4Q9SA 4EZ3A 3QQUA 4FSTA 4QYEA 2CN5A 3MESA 1KUTA 2QOIA 4NM3A 3FLNC 4DFNA 2JGZA 2QLQA 2I6LA 3VVHA 1QCFA 4O86A 4DG2E 4ZOGA 2Z2WA 5BV3A 3UG1A 2BDJA 4RX5A 3TUBA 3KK9A 4FTJA 5L3AA 3LMIA 3EZVA 5LWNA 2QCSA 4V0GB 3FDNA 3EL7A 4TWCA 2VTLA 5E90A 3ANRA 3JYAA 3VIDA 4A9RA 2ESMA 4I0SA 2W4JA 3V5QA 2PE1A 1OITA 2CNQA 2W96B 3ZSIA 4RBLA 2OXXA 4FK6A 4L43A 3VN9A 5HG8A 2BALA 2G9XA 3L9NA 3F5UA 1YXXA 4JQEA 4OBQA 3NUPA 1YOJA