4O38A

Crystal structure of the human cyclin g associated kinase (gak)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
310
structure length
267
Chain Sequence
b'QSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPLYSNFPIGEKQDIWALGCILYLLCFRQHPFYSIPPHDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQEIAAARNVNPKSPITELLEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-G-associated kinase
publication title Crystal structure of the human cyclin G associated kinase (GAK)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 71
structure length 267
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4o38A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o38A01
3TXOA 4M84A 3QD4A 4Z7GA 2OJ9A 4O83A 2YACA 2ZAZA 3E92A 2ZM1A 1SM2A 3BE9A 1M2QA 3GCQA 4A9SA 4DFLA 3ZOSA 2VUWA 3MIAA 4ZY5A 4ARKA 3F3WA 5IEVA 2PVRA 2BHHA 3VBVA 4PTGA 3NX8A 4EZ5A 3GP0A 5KMJA 4FT9A 5K9IA 1VEBA 2BMCA 1MQ4A 2R4BA 4FV8A 3WYXA 1TKIA 2CDZA 2NRUA 1LR4A 2B54A 3QZIA 3FZPA 4YPSA 3OCTA 3DXQA 4M14A 4GV1A 4BZNA 3L1SA 4HGEA 4J95A 3KCFA 3BI6A 3SOAA 4U9AA 3PXZA 3R7IA 2YHVA 2FYSA 3CY3A 3KK9A 2YM4A 3N51A 4QMUA 3PE1A 3SKCA 2WOUA 2C0IA 4HVDA 2F4JA 2CGUA 3C51A 4O27B 4JX7A 4YJTA 2UVZA 2GS7A 5LMKC 5D7VA 3UNJA 3TUBA 5CAPA 2YCFA 1X8BA 3TT0A 2JAVA 5I9XA 1R0PA 5CT0A 3FHRA 3KC3A 4ZSGA 4EC9A 1Y91A 1PY5A 3MPAA 1MRUA 3WF9A 4M7IA 4W4XA 3DBDA 1JBPE 2KTYA 3SC1A 5AFVA 3ULZA 4D28A 2XKEA 4F7SA 4JQEA 2C5VA 5DHJA 2E9PA 3LJ2A 5TT7A 4AGCA 4MYGA 4FX3A 4A9YA 2YM5A 5HBJA 2YJRA 3VJNA 2VTAA 4B7TA 2JAMA 3HECA 5CYIA 5EYDA 4BDIA 4I0RA 5CWZA 1KE6A 4EOPA 2GS2A 2V22A 3G5DA 4C4GA 4DEBA 3U4WA 2XNPA 2RG5A 4PX6A 4P5ZA 2BALA 3SAYA 3ITZA 2XNBA 3NYNA 4F7LA 1GNGA 2A19B 2CLQA 3GC9A 4LOOA 1H1RA 1OL7A 5CX9A 4EH6A 2V62A 5TR6A 4XRLA 3DT1A 1GZNA 3BHYA 4X3FB 5I4NA 1LUFA 4QP8A 4TYJA 2R2PA 1FMOE 4WD5A 2OIQA 1OECA 3K3IA 3PTGA 4ANBA 3O17A 4WRSA 3FSFA 1YWRA 3BU6A 2X8DA 2G2FA 3MI9A 4BKZA 4G3GA 4PF4A 4AAAA 3C4CA 3U4UA 5TO8A 3NNUA 2X6DA 3R28A 5IH4A 1KOBA 5EHYA 3W10A 3VBWA 2WMWA 3DV3A 5EM5A 5L6OA 4U3YA 2QODA 1OIQA 5K0XA 3WI6A 1H25A 5ANOA 4UX9A 3VS3A 3BHTA 4L43A 3LQ3A 3DY7A 4N57A 4E5WA 4J71A 5DRBA 5CF4A 3IOPA 3C1XA 4QQJA 5IEXA 4CEGA 2V55A 2YFXA 4RPVA 3FMNA 1MP8A 1PXMA 1UNGA 1ZY5A 2IW6A 3A2CA 3ENHA 3OXZA 4GYIA 1H08A 2WTWA 4XMOA 4RZWA 4XS2A 5ANIA 4ACMA 4XV2A 4CFMA 3I60A 4HCTA 1H4LA 3KK8A 4BKYA 3ORXA 5H8GA 1UWHA 2G01A 1WVYA 4G9CA 2ZMDA 4OTQA 2X9FA 5ETIA 4N6YA 5TOZA 2B53A 4FICA 4O2ZA 4IM0A 2GNIA 2SRCA 4YZBA 2PULA 3SW7A 3ATTA 3UIUA 5KMIA 1Q4LA 2W96B 2PVMA 3ORZA 4PL3A 5EDQA 4XP2A 2R0IA 1SNXA 3KMUA 5J7BA 4JR3A 3C5UA 1CMKE 3MH1A 4WSQA 3WZDA 4O96A 3HA6A 4AF3A 5GZ8A 1Q8UA 4FG8A 2CKEA 3FV8A 3PXRA 3GC8A 4FA2A 3FYJX 4FZAB 4J1RA 5FXQA 4G17A 2NRYA 4BDKA 1PYEA 3UDBA 1KE8A 3QZFA 4ANQA 3ODYX 4FKGA 1OPLA 3FUPA 3RHXA 2NPQA 4MXOA 4XEYA 3F5PA 3BPRA 3CTJA 3EFLA 3A7FA 2IJMA 3GU5A 1XH9A 3ZS5A 1R78A 2JKKA 3ZMMA 4FTMA 4DG3E 1XH7A 3F82A 3PRIA 4IB1A 4IW0A 2WMBA 3DBQA 4DH1A 5IA1A 1FQ1B 1PF8A 3Q6WA 3F3UA 5CU6A 3TI1A 5EW3A 3CSVA 3ROYA 3W33A 4OAVB 2YLEA 1ZOGA 4XG6A 1KSWA 2CGWA 1H8FA 2XJ1A 2YWPA 3I6UA 2XBJA 4ZZMA 4HYSA 3ZSGA 4HVSA 3OG7A 5HEZA 3ZO1A 4CT2A 3NAYA 3GQIA 3WARA 1BKXA 4Y83A 5D10A 2I6LA 3GVUA 4NJDA 3TWJA 4TWPA 3VF8A 4GG7A 4EYJA 2QOLA 4IZ7A 3D2KA 5IH5A 4CXAA 2GU8A 1XHAA 4O7WA 3PSDA 3H10A 3RMFA 3MN3A 4ZOGA 4ZLOA 2ITTA 3EQCA 3FQSA 1SZMA 3Q2MA 4O7YA 3HRFA 1U46A 3MGYA 4HVHA 1E1VA 3BQRA 3FKNA 2YWVA 3TV7A 5EK7A 3FLQA 4LUEA 2JBOA 5E8UA 3AD6A 5KHXA 1L8TA 3N4VA 2O8YA 4E1ZA 5AX9A 5J87A 2X8IA 1JSVA 4HW7A 3H9FA 3QFVA 4F9CA 5AEPA 4UMQA 4C57A 5J5TA 2JITA 3BCEA 5DR6A 1DS5A 2C3LA 4NK9A 3LXLA 3O0GA 3D2IA 3QX2A 4RX5A 5EI6A 4FT5A 3V8SA 2O0UA 3MSSA 4F65A 1FBNA 3V5PA 3LE6A 3FE3A 3R7EA 3UTOA 3LFFA 4GUEA 2XUUA 3SOCA 4A4OA 3LAUA 4BR3A 4WOVA 4OBPA 4R8QA 3R7YA 4D2PA 4K18A 5JT2A 2A27A 2UVYA 4BKJA 3DQXA 4L67A 3CIKA 1CKIA 2YABA 3UPXA 3FZSA 3E63A 3FI2A 2BPMA 4RJ7A 3W8LA 5CXZA 5C4LA 4WUAA 5HZNA 4USEA 5FWKK 4RC2A 1UV5A 2BTSA 3I0OA 4O0WA 1UU7A 5FRIA 1IAHA 1OI9A 3AD4A 3PXKA 2DQ7X 4OTHA 2W0JA 4QP6A 4RWIA 4YJVA 5CSXA 5CEQA 4YBKA 2VRXA 4B6LA 1TVOA 4PY1A 3GCSA 2CPKE 4KKHA 4YR8A 4FZ7A 2J0LA 1ND4A 2VTHA 3PUPA 5BVFA 4U3ZA 3C0HA 1R3CA 2CGXA 3S1HA 4UY9A 1URCA 1V0OA 3DOGA 3A8WA 2WB8A 5DGZA 3V5JA 3D94A 3MJ1A 3DAKA 1UKIA 4FGBA 5FM3A 4ZXTA 5JQ5A 3DS6A 1UNHA 2LGCA 1ZYDA 1YXSA 3Q9XA 4XG7A 1ZLTA 2FSMX 4FTQA 4O6EA 5EQYA 5ICPA 1DI8A 4LG4A 2R3LA 4TWNA 1ZZ2A 3HA8A 4JQ7A 4K1BA 4R5SA 4C33A 4CZTA 1SYKA 3R9OA 2W9ZB 4O2PA 4O7NA 3QQLA 4FKWA 3FMLA 1XQZA 4QMVA 5AR8A 5IMEA 2J90A 4HJOA 3F7ZA 3JXWA 4L00A 1BUHA 3D15A 5JFVA 2YZAA 3Q4ZA 3Q4UA 4D5HA 2PE2A 3RJCA 4PDPA 3GOPA 2R5TA 3NW6A 5JGBA 3POZA 1W0XC 2IPXA 3P5KA 5D11A 4BDDA 4C4EA 3KXZA 4AZTA 5IQHA 5F4NA 4RA5A 4C38A 3F6XA 3R22A 4PV0A 3LCSA 4C59A 4BCNA 5AAEA 3NWWA 5F9EA 4IDTA 2C6EA 2Z8CA 4AT3A 4F6UA 5CTPA 1WMKA 3TZ9A 3LKMA 3LFDA 4PRJA 3I79A 5AP5A 2P2IA 4LUDA 2IO6A 4TXCA 3ZC6A 3RP9A 2HZ0A 3BYMA 2JIVA 4I5CA 1ZMUA 3E3PA 4ASEA 3ORTA 4J52A 4N0SA 1AQ1A 4AFEA 3G9LX 3ZRKA 3VNTA 4BTKA 5ANJA 1XKKA 4FKRA 4WBBB 3NUPA 4TKSA 3QCSA 4QYGA 5IUIA 3VUTA 4EQCA 2R0UA 2VTMA 4ZSLA 4MF1A 3MIYA 3OW4A 4PDOA 3Q6UA 2AC3A 3D0EA 3S00A 2PY3A 3OCSA 4IVBA 4R6VA 2Z7QA 4RX9A 3ZUVA 4APCA 4EQUA 4IVCA 3Q5IA 4GK4A 2WZJA 3CJFA 1P5EA 2JFMA 3F7WA 4RIWB 1FVTA 1I44A 3V8WA 4YU2A 4JDHA 3H3CA 2HW7A 3TKIA 3ZM4A 4DFXE 4DYMA 3R9HA 3PA4A 4OTPA 3UBDA 2ITWA 4C3PA 2X8EA 5K0KA 4XG3A 5BVWA 5B7VA 4FTKA 5HIBA 3C5IA 1UU3A 3DNDA 3GT8A 4MH7A 3W2PA 3DXNA 5IU2A 3F66A 3IONA 1YDSE 5FQDC 4UYNA 4EOSA 4MXAA 3JR1A 4OTIA 3LM0A 4FSNA 4L3JA 4APPA 2OLCA 4YMJA 2ZB0A 3HYHA 1RW8A 2RF9A 4FVRA 3UIMA 2A2AA 2UZOA 3QTUA 5EOBA 2C6KA 4R5YA 2PK9A 4LOQA 1WCCA 5J9LA 3WILA 3C4EA 2QO2A 5M07A 1JLUE 2OFUA 4U44A 3U51A 3MFTA 1ZYJA 4WKQA 3T8OA 3TEIA 4BFMA 4XBRA 4Z9LA 5C1QB 2Q0BA 2XCKA 3PG3A 3R0TA 3RPVA 2BRBA 2EU9A 2VGPA 4HGLA 4G6OA 3CQUA 4RLKA 3G6GA 3C4FA 3VIDA 5LVMA 2ITZA 3QYWA 3CC6A 4X3JA 2YISA 1DAWA 4X2JA 4RFMA 1ZOHA 5C9CA 3UQFA 4GW8A 2YEXA 4ZIMA 4DT9A 4E6DA 3SDJA 1W7HA 4NSTA 4XG4A 4Y72A 5CALA 3D4QA 2XK8A 5KBQA 2PE0A 3MH0A 4U8ZA 4AW0A 3P7CA 4IJ9A 3AD5A 3WBLA 1YOMA 4ZLZA 2XBAA 1LP4A 2OG8A 2BIKB 4AG8A 3KRRA 4BZDA 4YZDA 4AA5A 4M68A 4RVKA 3U6JA 4MD9E 3BU3A 3V5TA 3Q3BA 4YJNA 3GFEA 3ODZX 4ALUA 4PDYA 2B4SB 4YURA 3PPJA 4IB5A 4RVMA 4UALA 4FEWA 2GDOA 1U5RA 2ESMA 3ENMA 3RAKA 2QONA 3KREA 3FKOA 4FSZA 2E9NA 2VWVA 5KO1A 2DYLA 2WU6A 1BYGA 3PP1A 4Q5HA 4MQ2A 2RFNA 4FOCA 2NO3A 3MYGA 2C6MA 3COHA 1YI3A 1ZARA 1H27A 3HV6A 4KIPA 3REPA 4CMUA 3BGPA 1K3AA 5DLSA 5LMAA 3IG7A 3AG9A 4G5JA 4YZ9A 2BZJA 5E91A 3U87A 4OLIA 4D2TA 2QO7A 2R3PA 3QRTA 3H9RA 4NEUA 1EH4A 5DT4A 4EK6A 1PXLA 2CN8A 3ZSHA 3OC1A 4FV2A 2O63A 4CLIA 4DCEA 4BHNA 2G2HA 3U6HA 2BDJA 3KULB 1VZOA 2IG7A 4NW6A 5CVGA 5HTIA 5AAFA 4CCUA 3KXMA 4OGRA 3C0IA 3HKOA 4EJNA 3ZBFA 4EK8A 3ANRA 3RK5A 3R8VA 3DXPA 4IWDA 5H8BA 2R3JA 4RZVA 4S33A 4F09A 3MH2A 1WAKA 3HL7A 3UE4A 4F1TA 3NNXA 3FXWA 2F7ZE 3OY3A 5HI2A 3GCUA 3V6RA 4O7VA 3ATSA 2W17A 2X2LA 5DN3A 3QKMA 5CLPA 2YCSA 3DBCA 4H1MA 3F5XA 3FSKA 3G9NA 2VWUA 2UZVA 3MB7A 3CQWA 3QRJA 4BIBA 2Y8OA 3ORNA 4GJ3A 1WZYA 4J96A 4HVIA 3CS9A 5LXMA 1U54A 3OT8A 2ITYA 4IAKA 2BKKA 3FMHA 4BTMA 2PYWA 5HORA 3SRVB 4BL1A 2BILB 3RPRA 2J51A 5AV0A 3G90X 5J9YA 2VO0A 2F7EE 4L53A 3F2RA 2PVJA 3DLZA 4O0RA 4YNOA 4PTEA 1J7LA 4BCGA 3CQEA 3DFAA 5EI8A 4AW2A 4U40A 2GS6A 3IPHA 5BVEA 4CG9A 4YTHA 3VBYA 4F0FA 4KKGA 2XEZA 4MQ1A 3RPOA 2QG5A 3WZKA 2Z02A 3PJCA 3EKKA 2IVVA 4XCUA 5HX8A 1H07A 2XKFA 4IWQA 3GU7A 1REKA 4KRCA 5EKNA 2WEIA 4WNPA 4QMXA 4JS8A 4O0VA 4A9UA 4F1MA 3VJOA 5BVNA 5CANA 2OJIA 3VBXA 4DC2A 5K4IA 2XIKA 3E8CA 3IDCA 4FKLA 1YQJA 4FK6A 4U43A 3R8PA 5LVPA 4DFYA 2W1CA 2P4IA 3FLSA 4EH2A 2IVTA 2I0EA 2P0CA 3L8XA 3NNVA 5E8SA 3LW0A 3F3ZA 4EHEA 2C5NA 4PTCA 2R3GA 3FY2A 4FK3A 1FVRA 1PJKA 2UV2A 3VO3A 3QKLA 4TPTA 2QI8A 3AGLA 4AN3A 2X81A 2C0OA 3TZMA 3RZFA 3SG9A 4C35A 3N4TA 2QHNA 3CLYA 3CGOA 3CD8A 4I5PA 2BZKB 2PZPA 3RI1A 3ZLXA 2PSQA 5L8KA 2JLDA 4GVJA 1XR1A 4HPUE 2IZRA 5EHOA 4FNWA 3VS2A 4XG9A 1YXXA 2WQBA 3KRXA 4PL5A 5IQDA 2I40A 4USDA 2W05A 1V0BA 2VD5A 4U6RA 3AC1A 4NL0A 2ZM3A 4WUNA 2QOIA 4E6QA 4UZHA 5HO7A 3WF7A 4U80A 2W4OA 2OICA 1UU9A 3RAWA 4E20A 4XYFA 3A8XA 3P1AA 4IANA 4QMSA 4F9WA 5K5XA 5ANGA 5K3YA 1BLXA 4PPAA 2VTPA 3TKUA 2HY0A 4AOTA 3DDQA 2WTKC 5I3RA 1OIRA 4RX8A 4RC3A 4V0GB 1PXOA 2Y4IB 3BU5A 4ALVA 3E64A 3CD3A 3QKKA 5EM6A 3HUCA 4P7EA 3E93A 4YJQA 4O1PA 1R0EA 4KUJA 4AA4A 4EOJA 2C1AA 4R3PA 2RL5A 2UZUE 3AMBA 1P2AA 4FSUA 4EQMA 3OOGA 4Y5QA 2VNYA 4FSYA 4BIEA 2PVYA 4IAAA 4KIOA 4QYFA 3QQUA 3LHJA 3RK9A 4IC8A 4FNYA 4FKSA 4MK0A 4NJ3A 1BL6A 3UZRA 3LFNA 1S9JA 1QPCA 4JRNA 4BCPA 5FTQA 5IISA 3FLYA 3TJDA 4K11A 2QOFA 3IW5A 3MBLA 4TNDA 3ZFXA 2B9JA 2ETKA 4ITHA 4L8MA 4RIYB 2EXCX 4XUFA 4F4PA 2R3RA 4DGLC 3I0QA 2J0JA 4O38A 2I0VA 4JQ8A 1QPDA 3ROCA 2VO7A 3ZHPC 5I3OA 3K5UA 4YLJA 2ACXA 2PZRA 4C61A 2EXEA 3RNIA 4F1OA 2YCRA 1A06A 4FG7A 5CVFA 4QP4A 3F5UA 1DI9A 3FQEA 3DBEA 3Q5ZA 1J91A 2I0HA 3FBVA 3V5WA 1J7IA 5KUPA 2BDWA 4O0SA 1WVXA 3ULIA 3GUBA 4K9YA 5JH6A 4C4JA 2R7IA 5A4LA 5CAOA 5D7AA 5AP4A 2P2HA 4EEVA 4AT5A 5L2SA 4XOYA 4LV8A 5CI6A 3QRUA 5HU3A 5E4HA 1JOWB 4YJUA 2R3NA 1Q41A 4IC7A 2DS1A 3TV6A 3COIA 4IEBA 5HNGA 3W18A 3EL8A 3SVVA 3D7TA 3Q2JA 4UV0A 3RKBA 5DVRA 3VC4A 2BHEA 4PNIA 2J4ZA 3PY1A 2UW6A 2W1EA 3E7OA 3GU6A 2XF0A 2BROA 3Q4TA 4QP1A 4IACA 4ANNA 3ET7A 4IMYA 3O7LB 1XBAA 4NFMA 4TY1A 4FGRA 4F7NA 4KSPA 2R9SA 4L52A 1OBDA 1YKRA 3FPMA 5KMLA 3JY0A 4G3CA 1A48A 1IRKA 4MAOA 4JXFA 3Q32A 4XX9A 1PW2A 2GTNA 3BV2A 5M4CA 1ATPE 3EQFA 2Y7JA 4P4CA 5IQEA 3IECA 3CR0A 2R3HA 5M06A 2QURA 3LOKA 2HZ4A 2YCQA 3KB7A 2WD1A 3S3IA 2R3IA 4CCBA 3UC3A 3DQWA 1OZ1A 3WE4A 3R9DA 1UU8A 3OWKA 5IH6A 4BBEA 2WQOA 3L9MA 5AV2A 5E8YA 4G1WA 3ZO3A 3ZZWA 2ITNA 2GQSA 3AC5A 5E8TA 4KBKA 2VX0A 4CFFA 3R7OA 2BFYA 3HP5A 4F6WA 5BMSA 3UVPA 1WBSA 1OPJA 2C6IA 5ETCA 4FYNA 4BDGA 2PUNA 1F0QA 3VUMA 4DEAA 4DGNA 2BIYA 2XYNA 3DDPA 3DGKA 4FV0A 3LMGA 4AZSA 5FM2A 4HNFA 1MRVA 3HRBA 5G1XA 3SLSA 4AFJA 2VTTA 4CFNA 5E8WA 1A9UA 4CTCA 3AGMA 5DMZA 4FG9A 2QKRA 2G9XA 1OBGA 4XV3A 4EL9A 3QXPA 4XRJA 5J95A 4H39A 3DKCA 3F2NA 3UOJA 4FTRA 3GI3A 3QL8A 4MNEA 4ZJIA 4D1SA 2CKOA 5L4QA 4TL0A 2B7AA 4WG4A 5DEYA 4A7CA 4BGHA 4E6AA 2XJ2A 2W5HA 3EN5A 2WELA 2WXVA 3D5VA 4RIXA 4BDBA 4ACDA 4EUUA 1PXKA 1OL6A 4FTAA 1STCE 2JIIA 2W1DA 4RJ8A 3IGOA 5GIOE 3KKVA 3ZU7A 2QHMA 3QZGA 4C3RA 3ETAA 3BHUA 5KMNA 5I9WA 4WNMA 4FEUA 2WMAA 3LFSA 4NCTA 5F95A 3VBQA 5KKRC 5IQFA 5EDPA 2W5AA 4F64A 3BWJA 4QP7A 4YO6A 5AA9A 4R1VA 5D1JA 3ZDIA 3IW4A 1H1PA 2WQMA 3NSZA 1PYXA 1UVRA 3VRZA 5CAVA 2GHLA 3R00A 2C30A 4PP7A 5C26A 2BRGA 3RPSA 2F2UA 2GNHA 2GMXA 3KY2A 2XCHA 4GIHA 4QYYA 4XBUA 3R8UA 4C37A 4CD0A 4I23A 5L2WA 4WA9A 4KRDA 3EN7A 5E7RA 4BCJA 5M09A 3DJ7A 1KOAA 3RWPA 5J7HA 5IA0A 3E5AA 4NKSA 3BGQA 3L8VA 4F7JA 2OJGA 1ZWSA 2C5OA 3FJQE 3T3UA 4DTAA 4AX8A 3OXIA 2WMXA 4DTKA 4F70A 4FT7A 2HZIA 3LFEA 2R3MA 2ZJWA 4BBMA 4BZOA 4U97A 3NUUA 2PVFA 4B4LA 2WTKB 1G5SA 4B0GA 4M66A 4YHJA 4G3EA 2HIWA 4KINA 1T45A 1ZOEA 4OW8A 2JDRA 3NIEA 2EVAA 3G2FA 4IX6A 1IEPA 3FC1X 4MWHA 3UO6A 1ZY4A 1J7UA 3GGFA 5ETFA 3PXYA 3E8EA 2C69A 3OVVA 5LVOA 4LOPA 5L6PA 1OL1A 1H0VA 4RJ4A 3DU8A 3H30A 3TUCA 2ONLA 3HMIA 4RVLA 5H9BA 4C3FA 2C4GA 3OP5A 4KAOA 3RK7A 4DH8A 3BEGA 3A7IA 3EOCA 5CT7A 2G15A 5IA2A 3R01A 5TF9A 4IZ5A 4GKHA 5A4TA 2J2IB 5CF8A 1OKWA 2QCSA 4D5KA 3N4UA 5EDRA 4ZLYA 3FQHA 4NH1A 2QU6A 1YDTE 3W2CA 3O50A 4IDVA 1OM1A 4E26A 5CSHA 1CKPA 2VTRA 1FINA 1BI7A 4QO9A 5TKDA 3Q52A 1JWHA 4GT4A 3P79A 2BAJA 4A4LA 1GJOA 4DN5A 3WF5A 2JKQA 2XNNA 4X2FA 2J6MA 4E6CA 4FTNA 4R7BA 2R64A 4L9IA 2CNUA 4O7RA 3QA0A 2W1FA 3IW6A 3PP0A 3V6SA 5IZFA 3VVHA 4II5A 3HV5A 2I0YA 3A7JA 2XIZA 4B9DA 3ACJA 4JVGA 3KFAA 5CQUA 3SA0A 4GG5A 1H00A 4XLVA 4PPCA 4QYHA 2WTDA 4QP3A 1OIYA 1YWVA 4QMNA 3W1FA 5L3AA 2X2KA 3GENA 3NIZA 3QD2B 4RA4A 4JR7A 3BKBA 3NGAA 5AP2A 2VWXA 3EHAA 3O8UA 1XH6A 4RVTA 4X2NA 4HPTE 2F7XE 4HYUA 4CFWA 2VGOA 3EL7A 5I9YA 3F2AA 4DH7A 1TQIA 3FYKX 3QGWA 1IR3A 2X0GA 4MXYA 3ZTXA 3DB8A 3SXSA 2OZOA 4ZAUA 3UZTA 4YSJA 4C4HA 2XK3A 5CEOA 2AYPA 3MA3A 2Z2WA 3D7ZA 3FZ1A 3LCDA 3QC9A 4JJRA 4XLIA 5C27A 3WYYA 2HYYA 2OZAB 4NM0A 3ZEWA 5A4EA 2Y6OA 2P55A 1APME 2WHBA 4ERWA 5ANEA 4E93A 2A0CX 2W7XA 3AC4A 3U6IA 1Q3DA 2XRWA 1SVEA 2JDVA 4O7ZA 3AQVA 1M17A 5CU3A 4PNKA 3E7VA 4G6LA 3U8WA 1W84A 5HG9A 3KEXA 4I0SA 2Z7LA 4RIOA 5E1EA 4JI9A 3GCPA 1OL2A 4C02A 5EYKA 4XP0A 4DEHA 3PXQA 4K2RA 3R02A 4YBJA 2OO8X 2RKUA 3ZSIA 5KBRA 3T9IA 4FUYA 2OIBA 4QNAA 5KMMA 1PXPA 2XKCA 1W83A 2OK1A 4E8AA 3QTSA 4M15A 3K5VA 3AC2A 2IN6A 3HDNA 3KXNA 4DH3A 2W1ZA 4CV8A 4C7TA 1K2PA 1PMEA 3NUSA 4ORKA 3ACKA 4I93A 2JC6A 5CENA 4BDCA 2VU3A 1JKLA 4RQKA 4FV9A 3NNWA 3ZXZA 2PVHA 4J98A 5ETAA 3QCXA 1J1BA 3C4WA 4L6QA 2KULA 4MD7E 2QVSE 2VV9A 3D5XA 5GIPE 3TZ8A 1G3NA 4AE6A 3LFAA 3ZRMA 1XWSA 4EHZA 3KXXA 2QO9A 3KMWA 2BAQA 3CKXA 4QNYA 3ZO4A 2YDKA 3HX4A 3L8PA 3PRFA 4M97A 5FBOA 4YJSA 5DIAA 2FGIA 2C68A 3FZOA 4YHFA 1J3HA 3PDTA 4KKEA 3D9VA 2YAKA 3BWFA 1GIJA 2WIPA 5KZ0A 4CRSA 5GNKA 4DF3A 1RJBA 4FTCA 3BX5A 5DE2A 2GNGA 5EHLA 3UP2A 2WO6A 2IZSA 4C8BA 3H4JA 4JBOA 3FHIA 2LAVA 3FC2A 4D58A 2X4ZA 4YTCA 2CNQA 3TN8A 4OTRA 1O6KA 2B52A 4J8MA 5AP1A 3GCVA 5HICA 3SW4A 3NVMB 3KF4A 5JGAA 3KN6A 4FT3A 1WBPA 3VS1A 1JKTA 3UOKA 4BGQA 4CQEA 4RWLA 2Q83A 1U5QA 2DUVA 3QTIA 5DT3A 4H3QA 4I1ZA 1O6LA 4BDHA 3F3VA 3E88A 2R3FA 2V0DA 5A46A 3UP7A 1ZYCA 3KRJA 3D5WA 4QQCA 1B6CB 1PMNA 3DJ5A 4CKIA 2DWBA 4OAUC 2CKQA 3ORLA 1VYWA 4L3PA 4QMTA 4XH6A 5HNBA 3SV0A 4FE2A 3FPQA 3R8ZA 4W4VA 1KV1A 3UODA 4IX5A 3R83A 3PJ8A 5CZHA 4EOIA 5IDNA 3QHRA 4RWKA 4FBXA 4UWCA 5DR2A 1ZXEA 3BIZA 3MTLA 2ITOA 2XS0A 4PDSA 2WTVA 4AGWA 3CCNA 5AV3A 5KMOA 5M57A 4ZZNA 2CGVA 2ZMCA 4FTJA 4M69B 2PUPA 2O5KA 3D83A 3QLFA 3IS5A 5AR4A 3A4PA 2PMNX 3EIDA 3QAME 5A6NA 3EYHA 3HMOA 2OJFE 1W8CA 4U42A 2VO3A 4R7HA 4U5JA 3ZH8A 4AN9A 3LLTA 3OEFX 4HZRA 4F0GA 4I22A 2FUMA 3DAEA 3RHKA 4FYOA 4HCUA 1YOLA 3QQKA 3WZEA 4B8LA 2HOGA 2UVXA 4FC0A 4QT1A 2ITUA 5FEDA 3R7VA 4CYIA 2WOTA 5DRDA 2YIXA 4GIIA 3A62A 4FNZA 3DPKA 3GEQA 4O21A 4FKOA 5BMMA 4Z3VA 4Y5HA 3U9CA 4GEOA 4ASDA 4EOOA 1IAJA 4QTEA 1RE8A 5FP5A 2WNTA 2F9GA 4IFCA 4BCHA 1NA7A 2R7BA 5AWMA 4NYEA 1OPKA 5IQAA 5CAQA 3GNIB 2C6OA 3UMXA 4Y46A 2YDJA 5FUTA 3O71A 5CSVA 3BQCA 4EWQA 1NT2A 4IWOA 2UW4A 3FXXA 5H3QA 3I7CA 4EKKA 5BYLA 4KWPA 2FB8A 3GFWA 3TACA 5JN2A 2VN9A 3DZOA 4DEGA 5BUJA 3HNGA 3PJ3A 4WG5A 3P9JA 4ANMA 4UMTA 3TCPA 2OU7A 4K0YA 4MNFA 1Q97A 3QWJA 4FKQA 4N6ZA 3FWQA 1PMUA 4Y8DA 3VUHA 3UO4A 4Z55A 4BWPA 5M51A 4R3CA 4GFGA 4FUXA 2Q0NA 2CSNA 4EH5A 4KA3A 3T3VA 1FVVA 5IA4A 4HVGA 5E1SA 2XM8A 5HG5A 2A4LA 3FY0A 5EFQA 4KIKA 4GK2A 2E2BA 5HD7A 3PIZA 4WRGA 4RIWA 5HESA 2J0KA 2REIA 4IAYA 4EK3A 3BYOA 2YIQA 5LJJA 3KVWA 4O0XA 4XG2A 4QPSA 3BBWA 3UYSA 3PIXA 3OOMA 4ZSAA 1W82A 5AIRA 4J8NA 4C4FA 3ZM9A 1GAGA 3K3JA 3P08A 1Q24A 2O2UA 2RFDA 5M55A 2ETMA 2Y9QA 3MS9A 4PMTA 1PKDA 3TDVA 4IAFA 4W9WA 3LZBA 1OKVA 3KCKA 3R71A 4ZEGA 4LM5A 5JZNA 4BDAA 4E5BA 1OUKA 2E9OA 4GFMA 4TWCA 2WMTA 2BFXA 3MFRA 5C8KA 3OS3A 3PVBA 4C34A 3UJGA 1YXUA 3OEZA 4QRCA 3HAVA 2J5FA 2W4JA 2QG7A 2C47A 4MBIA 2FSTX 2YIWA 4K77A 4MXXA 4ZP5A 2CKPA 2C0TA 4QQTA 3DK6A 5M44A 2HK5A 5CS6A 5HGIA 1Q62A 4MCVA 3HRCA 3G0FA 3BZ3A 3R1NA 5FGKA 3FEGA 3BHVA 5DH3A 4D9TA 4TW9A 5AR3A 1XBBA 5AR5A 2QR8A 5EH0A 3ZFYA 3KXGA 2WQEA 2PMLX 4MTAA 4OTGA 4BTJA 5BPYA 2B9HA 4FV5A 2G2IA 5EM8A 1U54B 2OXXA 3HMPA 4I20A 4AW1A 5LOHA 4Q9ZA 4F08A 3B8QA 3CEKA 4GJ2A 2QOOA 2BZIB 5JRQA 2OKRA 4X0MA 2BCJA 5CSPA 3KGAA 5FEQA 5HG7A 3KL8A 4QYEA 1RDQE 4I24A 3KA0A 1OITA 3JUHA 3ZYAA 4AN2A 2B0QA 5HIEA 4U81A 3HDMA 2YDIA 5FD2A 3TNWA 4IQ6A 5GJGA 4F99A 1U59A 3LCOA 3MW1A 4NKAA 1BI8A 4S34A 3LIJA 4HYIA 1WFCA 1YRPA 4KD1A 2IWIA 3DB6A 2ETRA 3M42A 4XNEA 4FKJA 4NU1A 5L2QA 3TKHA 4EHGA 3JYAA 3POOA 4FEQA 4F6SA 4FIEA 2WTCA 4M67A 4ZY4A 3UNKA 1HOWA 2CCIA 4QMWA 4GL9A 3K2LA 5BX0A 3GU8A 3MA6A 2B9FA 4XOZA 3TDWA 4I3ZA 5DWRA 3N9XA 1JVPP 3S0OA 4CMTA 4J53A 2VO6A 4FMQA 3B8RA 5HCYA 2BUJA 4D2WA 5AADA 4IFGA 4J99A 4N70A 5CI7A 3CY2A 4JIKA 5ANKA 2X39A 4JBQA 4KBAA 5B2LA 3L8SA 5IPJA 4YNEA 4FV3A 3Q96A 1Y8YA 2PMIA 3DFCB 3JVSA 2HW6A 3R63A 4CTBA 2X6EA 4F9AA 2BZHB 4NCTC 1YXVA 3KULA 5AM7A 4TYHA 1NVQA 4CYJA 3MY1A 5HLWA 2W1GA 3KVXA 1WBVA 3QQJA 2QOBA 3AT4A 3RNYA 4Z7HA 4U79A 4HNIA 3RAIA 3UG1A 3VHEA 2YM3A 4BDEA 4QMMA 4CNHA 4DBNA 3PY3A 4FNXA 1O6YA 3QQHA 4RLLA 5J9ZA 2C3JA 5C03A 4ZS0A 3ZUTA 3G51A 4DFNA 2YN8A 3EB0A 5FDXA 2X1NA 2WMVA 3CBLA 3OWLA 5HCZA 4EZ7A 5AUZA 2PPQA 1GOLA 4OBQA 4D4RA 5AIKA 5IMXA 1P4OA 2HXQA 3M11A 4GT3A 4OTDA 3EZRA 2J9MA 3ORPA 4IAIA 5DFPA 5HBEA 5CNNA 4TZRA 2WMUA 4HGSA 5A3XA 5CEKA 5BUEA 1SNUA 4I6QA 1OMWA 2ITQA 1GIIA 4L45A 3OY1A 3PVGA 3DAJA 3SRVA 2J0IA 3Q9YA 4DEEA 1KE7A 3R1SA 5GINE 2GNFA 3VBTA 4QTCA 4GK3A 3ZONA 4E7WA 3OROA 4CVAA 4M3QA 4NTSA 5AUYA 2BRHA 4M12A 4I21A 5DR9A 4JIAA 4ZMFA 5GJDA 5HLPA 4O81A 3BLHA 3W55A 2CNVA 2YM6A 3NUNA 2EB2A 3ZXTA 3H9OA 3QU0A 5J1WA 3NUYA 4KNBA 1URWA 2IZTA 4FVPA 5HBHA 5HIDA 3I6WA 4X7QA 4AT4A 2VWIA 3R8MA 3EYGA 4JBVA 4G3FA 2B9IA 3WZUA 2ONLC 4OTFA 2WTIA 4BHZA 5BVDA 3DA6A 5A6OA 4X21A 4ANOA 2XK9A 3PPZA 4FIJA 2C6DA 2XVDA 4W8DA 1H01A 2IVUA 5BNJA 3C13A 3O51A 4WG3A 3T9TA 3C50A 1ZYSA 4FV6A 4D2SA 4CFUA 5DG5A 5AR7A 5JZJA 3AMYA 5EQPA 3O96A 2Y6MA 1XO2B 3VS4A 3CP9A 5CEIA 5KHWA 2QQ7A 3G33A 5T6KA 3P0MA 4IAZA 2YM7A 3FZTA 4FIFA 2RIOA 3I1AA 4USFA 2PWLA 5CU4A 4YJPA 3QD3A 1B39A 4FZ6A 4LMUA 5I9UA 5JGDA 4D1ZA 5HO6A 3UPZA 4R7IA 4FOBA 3VW8A 2UUEA 4FKVA 3AT2A 3IKAA 2VWZA 2VTIA 3RINA 3Q9ZA 4DGGA 4UXLA 4JAJA 4XHKB 4ASXA 5LMBA 3EJ1A 4DTBA 3OUKA 1P4FA 4ZJJA 4H1JA 4ZK5A 1QL6A 4V01A 1WBNA 4H3PA 3G6HA 3A7HA 2C3IB 4JRVA 3D14A 5GJFA 1MUOA 3IDPA 2QOKA 1Q8YA 3B2TA 4MEDA 4YO4A 1Q5KA 1H0WA 3PJ1A 4FIGA 1YDRE 3D7TB 1GZOA 1CKJA 4FV1A 4ZSEA 4ANSA 1FMKA 4U7ZA 4ACGA 1MRYA 5HNIX 5M4UA 1QPJA 2C6LA 2OH4A 3QQFA 4ENXA 2J50A 2HZNA 4YJOA 3V04A 2ZOQA 5GHVA 4JG7A 5HOAA 4BIDA 2XIYA 3HEGA 5AX3A 3WOWA 4DINA 1ZAOA 4BI0A 4OBOA 3TG1A 3UG2A 1GY3A 3GBZA 4RFYA 1JQHA 4IB3A 4H58A 4LRMA 4NIFA 4WSYA 2WTJA 3NZ0A 3MDYA 2PE1A 2Y4PA 2X7GA 3ZEPA 2J5EA 4PWNA 3PSBA 5D12A 5DEWA 2X7FA 4ZY6A 3PA3A 5I5ZA 4AOJA 3MY5A 3R21A 5DOSA 2GFCA 4ZTSA 4NM5A 4EZ3A 3DZQA 3PWYA 2VZ6A 3WF8A 3PPKA 3S95A 2VTJA 5CQWA 1JSUA 2ZV8A 4I4EA 2IW8A 3ZFMA 4F0IA 5A14A 1QMZA 2ZVAA 4EKLA 1ERKA 3OCBA 4IIRA 2PVLA 3QRIA 4L46A 2WFYA 5AUXA 5J8IA 4RFZA 3S4QA 3LMIA 1I09A 5HCXA 4AWIA 4QPMA 1V0PA 2ZV2A 5CVHA 4GVAA 5ITAA 4O86A 3AMAA 5EYCA 2VAGA 3BBTB 3ZO2A 4EOMA 4ZTRA 4OT5A 4P90A 4X2KA 4XP3A 5IA5A 4FKPA 4FTTA 1YOJA 4RIYA 4TTHB 3WE8A 1M2PA 4E5AX 3RGFA 2BDFA 3VWAA 4LGDA 3UOHA 4YZMA 4ASZA 5JKGA 3ORMA 2XRUA 1P14A 4HOKA 4QTBA 5EI2A 4BC6A 4K6ZA 1O9UA 2FH9A 4JDJA 1R39A 3PLSA 4CKRA 1OUYA 4J7BA 2X2MA 2ZDUA 5AV4A 5CU0A 2WKMA 4PP9A 5DYJA 4J97A 2W1IA 3NPCA 4PPBA 4R1YA 3QHWA 2OW3A 3FMKA 3QUDA 5HD4A 4DFZE 3LMHA 4MNEB 2B1PA 1PXJA 2XNEA 5FG8A 4AQCA 3GC0A 1NVRA 1XH5A 5HE2A 4BICA 5HTBA 5M4IA 4RIXB 3QUEA 3QCQA 2HELA 3H0YA 5FEEA 4W8EA 3TUDA 3W2OA 3A7GA 3LFBA 3BYSA 3ORIA 3UMWA 3ZBXA 1PXNA 4M8TA 2UW5A 4E73A 4KS8A 4I0TA 1YWNA 2ITXA 3V51A 1YI4A 3MB6A 3PVUA 4C2WA 5E92A 4ZTMA 3CPBA 5IKWA 2YZLA 5ACBC 4FR4A 1M7NA 4UMUA 1F3MC 3ANQA 4NT4A 3L9PA 3PA5A 3PG1A 5ACKA 3TIYA 3ZRLA 4D2RA 4QMOA 4G3DA 1Q8WA 3OBJA 2EXMA 3MVMA 5FP6A 2QD9A 3VQUA 3COKA 4BWKA 2WIHA 1BMKA 3C0GA 1H28A 2BRMA 1YI6A 3ZZEA 2PVKA 4V05A 2YAAA 5AP6A 4C2VA 3GB2A 3QX4A 1PMVA 4O0TA 2XB7A 3CJGA 3F3TA 2G1TA 2W5BA 2CHLA 2CN5A 4IWPA 1TQMA 5FLFA 3RAHA 4JL9A 4RMZA 3RZBA 3V3VA 4EH8A 3WF6A 4ZTNA 1JKKA 4UMRA 3SXRA 3ZLWA 3MVJA 5T68A 5LWMA 3IQ7A 3L9LA 4ZZOA 3NVKI 2W9FB 5EW8A 4TRLA 1Q99A 1Q8TA 4ZTHA 4CV9A 3UIBA 4E4MA 2PL0A 1YXTA 4JDIA 4CSVA 5HTCA 4ACCA 4LRJA 2XEYA 1FGKA 4AGUA 2JBPA 5I0BA 2PTKA 3D5UA 1L3RE 3KMMA 4FKUA 5J1VA 2H6DA 3FI3A 4IM3A 1GZKA 3LQ5A 1RQQA 3R2BA 4DGOA 2YIRA 4ITIA 1GZ8A 4LV5A 3LLAA 2O3PA 1H26A 3DTWA 3MH3A 2JDSA 1M52A 3ELJA 4QMZA 3HVCA 4I6HA 5LVLA 3VN9A 2UW0A 4BCFA 3FLWA 3TNHA 4TWOA 4B8MA 2X7OA 3P23A 4L3LA 3VQHA 3FMDA 4IX3A 2UZDA 4NFNA 3IDBA 4IADA 2C6TA 2W06A 3SGCA 2C1BA 2GPHA 3PZHA 2PVNA 4KABA 4WIHA 3R73A 2VX3A 5HHWA 3DKGA 3MV5A 5I9VA 3NR9A 1TQPA 4ANLA 3DKOA 5L8JA 2C5YA 3LPBA 3OBGA 4KIQA 3RM6A 4F9YA 2V7AA 4CQGA 3II5A 3KF7A 4K8AA 4LMNA 3FMJA 1JNKA 2UZWE 2YA9A 3QTZA 1FGIA 4CGAA 3A60A 4AP7A 5IQBA 4FVQA 1CTPE 2OXYA 4BN1A 5HVYA 3R6XA 3NMUF 4EOLA 1PKGA 5EKOA 1UNLA 2R3KA 3V5QA 4X3FA 3EQPA 3B2WA 3IO7A 1JAMA 4FL3A 4FTIA 4AZEA 4EK5A 4QOXA 3NS9A 5M56A 5J79A 1LEZA 2RSVA 3COMA 5HU9A 4H3BA 1NVSA 3PE2A 5AP0A 3I5NA 2OJJA 2Y0AA 3RCDA 5A54A 3P7AA 2VTLA 3NRMA 3VW6A 3FI8A 4IX4A 3BRBA 5CAUA 4UZDA 2OXDA 3QALE 2F57A 3I81A 2XYUA 4EUTA 2P33A 4FL2A 4UXQA 3HMNA 2PMOX 5BVKA 3SD0A 4YGAA 4PMPA 4EYMA 4DEIA 1F5QA 3C9WA 4O7LA 4FSQA 3LJ1A 4HZSA 2XA4A 2BVAA 2ERKA 4DLJA 4EC8A 4TNBA 3DLSA 4QP9A 5DPVA 3BLRA 3QTRA 3EFKA 4RX7A 5ANDA 2J7TA 1XJDA 3EMGA 3L9NA 4CMOA 4EHVA 2UW9A 3NCZA 2VNWA 4UWBA 3MFUA 4QMQA 3BV3A 3SX9A 1Y6BA 3TJCA 2C3KA 3OT3A 2RG6A 2E9UA 4I4FA 4RJ6A 1BX6A 1YW2A 2GFSA 3FL4A 3EKNA 4C4IA 4I92A 1E9HA 1V1KA 4XV1A 4PQNA 4FZFB 2OF2A 4G16A 3OXTA 1ZRZA 4DGMA 3QBNA 5AMNA 3NCGA 4NZWB 3LM5A 4MBJA 1M7QA 1Y6AA 1DM2A 5E90A 1YHWA 4BB4A 1KWPA 2W1HA 3P7BA 4BDFA 5FTGA 1E1XA 3VULA 5FXRA 5LWNA 4IZYA 2VX1A 2ZDTA 3TNIA 3CTQA 4GMYA 4QD6A 4YC8A 4L68A 4RC4A 5HVJA 1UKHA 3R7GA 4JLCA 5HKMA 1OIUA 2W4KA 1VR2A 4GUBA 4Q5EA 5HE0A 3V8TA 4DA5A 4CZUA 1ZMWA 3DK7A 5JQ8A 3O8TA 4AGDA 2VWYA 3BLQA 3G0EA 5AM6A 3P78A 4FTLA 3TV4A 3UVRA 4TYIA 2FA2A 1YHSA 2O65A 3LFCA 5K4JA 5JK3A 5AUWA 3BYUA 3LFQA 3UQGA 3TNPC 5CEPA 3FZRA 3BHHA 3OD6X 4BDJA 3VF9A 2VTQA 2OIDA 3LXNA 3QTXA 4YC3A 1IG1A 1KUTA 2W99B 3EN4A 2XKDA 2Z7SA 4IJPA 3LCKA 2PZ5A 4QTAA 2UZNA 4JNWA 2Z60A 1H1WA 2BKZA 3P4KA 4G9RA 3VS6A 2OFVA 2OGVA 2JEDA 3R30A 3CKWA 2QNJA 4M0YA 4WNKA 3MVHA 4YTFA 4FTOA 4LRKA 2FSLX 5D41A 3Q60A 2QC6A 1PHKA 3E62A 5E8VA 2QKWB 5B2KA 4ZS4A 4M0ZA 2IVSA 4FV4A 5F94A 2OZAA 4P2KA 1Z5MA 4FT0A 2VWBA 3LQ8A 4S30A 4OUCA 3RALA 2GCDA 1SMHA 1OB3A 2ZYBA 2R3OA 1OGUA 2ZV7A 4JG6A 4ONAA 5CNOA 3W16A 4D4SA 3UNZA 4BWXA 4C36A 4PMMA 1XH4A 2XK4A 4IHPA 4LL5A 3PY0A 1J1CA 3PZEA 4GH2A 4YLLA 4DFBA 3LXKA 4O0YA 4EI4A 5EOLA 4EOKA 5JSMA 5KKRB 3PIYA 5A9UA 1HCKA 2ITPA 2NP8A 2UZTA 3EH9A 3Q04A 4GFOA 2ITVA 4QP2A 4MVFA 4S2ZA 4W4WA 3NAXA 4ACHA 2JFLA 5LQFA 1REJA 5KNJA 4M13A 2QU5A 2HXLA 4A4XA 2UZEA 3E8DA 3GOKA 4NWMA 3R9NA 3HZTA 5JMSA 4OTWA 4MX9A 2H9VA 5HO8A 3QF9A 5CY3A 4AE9A 4BGGA 1XH8A 3TIZA 2PU8A 4AU8A 1Q3WA 3CTHA 1ZMVA 4AZVA 2QLQA 5L2TA 3A61A 4W9XA 5LMKA 1ZZLA 4Y95A 4RBLA 3FLNC 3F9NA 3KRLA 3HV7A 4PUZA 4L7FA 3DNEA 2EWAA 3F69A 2XK6A 4X2GA 3RTPA 2JIUA 4ENYA 4GT5A 1VYZA 2CJMA 3QTWA 1H24A 2VTNA 2XJ0A 2UZLA 4ITJA 4MF0A 3R8LA 2XNOA 3O2MA 4BVUA 1WBOA 4BF2A 3VS0A 4GS6A 4YLKA 2F2CB 4JG8A 4KB8A 3VHKA 4FV7A 4LL0A 5KX8A 2OI4X 2R3QA 3HV4A 3NW5A 3OCGA 4OT6A 4QQ5A 3NYVA 4GYGA 1OL5A 2GHGA 4EK4A 2UW3A 4O7TA 5JFSA 2CMWA 4I5HA 4DLIA 5IUGA 2XZSA 2VWWA 3QRKA 5KCVA 1Z57A 5AP3A 2JKMA 5IUHA 4YTIA 4GKIA 1Y8GA 3QYZA 5AUVA 2ERZE 3JS2A 4LGHA 3MPMA 1Z9XA 3FMEA 1GIHA 1OVEA 4EWHA 2BAKA 4AOIA 3OWJA 5B2MA 4CG8A 1AD5A 4X6QC 2Z7RA 3MVLA 1BL7A 4CRLA 3QTQA 4WO5A 4U41A 4WT6A 4KIKB 3M1SA 1IA8A 1H1QA 2XM9A 4JT3A 3VAPA 4R78A 3HLLA 4I5MA 1OKYA 4BBFA 3F61A 3EQGA 4GU6A 3I4BA 3KU2A 4DG2E 3UQCA 2UW7A 2JKOA 3CE3A 4M69A 1KV2A 2ZM4A 2FSOX 4FKTA 4I6BA 4NTTA 4U0IA 3ZC5A 3R9RA 4O0UA 3IW7A 3U55A 4O7SA 1WBTA 5DA3A 3DJ6A 3O8PA 3PWDA 5D9HA 3ZDUA 1IASA 2HWPA 2XNMA 4TYGA 2BR1A 4RGJA 4A06A 4DT8A 4IM2A 1DAYA 3DK3A 4PMSA 3NLBA 4O84A 4XG8A 3RPYA 5IDPA 1UWJA 4LYNA 4C62A 3C4ZA 3GU4A 3EWHA 4BCOA 3WIKA 3EQIA 4QTDA 1Q61A 4Q9SA 3ZLYA 3ERKA 2XK7A 1K9AA 4FEVA 4AUAA 4A9RA 2Y4IC 4DAWA 4EONA 4Y85A 3FMMA 3BYVA 3DBFA 1CDKA 5HE3A 5HX6A 1KE9A 3CPCA 3WZJA 5E8XA 2J0MB 3ALOA 4G6NA 3EN6A 3HMMA 4UEUA 4JBPA 3HUBA 3U9NA 5GZAA 1JPAA 3RBWA 4MXZA 5HQ0A 1NXKA 5FDPA 4DCAA 3NUAA 2V5QA 5CU2A 3OTVA 2OF4A 4EH3A 5AA8A 4E4NA 4UYAA 5AV1A 4BI1A 4BYJA 1R1WA 5K5NA 3QQGA 4N4SA 1HCLA 5FBNC 4E4XA 2FVDA 4ZTLA 1PXIA 2I7QA 3E8NA 4FSWA 4RT7A 3FXZA 2QOHA 4MD8E 2GNJA 4Z16A 1YVJA 5EW9A 5C01A 4GU9A 4HYHA 1NW1A 3AC8A 3DKFA 3JPVA 4DITA 4EH9A 5IG1A 4CLJA 5JEBA 2WMRA 5H2UA 3VRYA 2PUUA 5G6VA 5KMKA 3CGFA 5LCJA 3OWPA 4TN6A 3C4XA 2OWBA 2AUHA 3NW7A 5KZIA 3C7QA 3O23A 2V7OA 2XIXA 2XNGA 2UZBA 3QC4A 3OW3A 4D4VA 5AUTA 2YIYA 5CSWA 5HG8A 3DTCA 4H36A 3K54A 4FEXA 3PLAE 2RFEA 2RFSA 4FSMA 3NEWA 3HGKA 3A99A 2H96A 4S31A 3UVQA 4O1OA 4CFVA 5E8ZA 3GQLA 3O7LD 5L6WL 4EBWA 3SHEA 3DCVA 3AT3A 5AJQA 5DT0A 1JKSA 4RQVA 3RCJA 4O22A 4MXCA 3GXLA 4TYEA 4UN0C 3A4OX 4YZNA 4AA0A 1QCFA 2WPAA 3W2QA 4EJ7A 4G34A 4XJ0A 5C8MA 4TYHB 3MESA 4R77A 5CF5A 4BCQA 3R1QA 4L01A 4MBLA 4EOQA 4YUQA 2QOQA 5HLNA 3LVPA 3UYTA 3AXWA 4P5QA 4G2FA 4DG0E 1UA2A 2HAKA 4BCMA 3R2YA 4L44A 4AXAA 5M4FA 2GHMA 5F20A 5AUUA 4EH4A 3FLZA 3WIGA 4HCVA 3NYOA 4BTFA 3FDNA 4DFUA 2QOCA 3RWQA 3RM7A 4LFIA 3QXOA 2PZIA 4YC6A 4CZYB 1NY3A 3PXFA 1KE5A 4K33A 3W2RA 2YJSA 4EH7A 4ALWA 5E9EA 2PZYA 2QR7A 3PJ2A 5B0XA 5C4KA 2A1AB 3OF0A 4RJ5A 3EN9A 1CM8A 1SVHA 3FAAA 3FI4A 3QCYA 4LI5A 4NM7A 4NW5A 3VS5A 3LXPA 3EFJA 4O6LA 4AACA 3W32A 5J5SA 3ALNA 4DH5A 4B99A 1CSNA 3EFWA 4W4YA 4TT7A 4YP8A 1B38A 2FO0A 5M53A 4D0WA 5EM7A 4GRBA 2JDTA 4BRXA 1XBCA 5BUIA 1LPUA 2UW8A 2JGZA 1ZYLA 3QUPA 3CXWA 4U45A 3SQQA 4BY9E 4I94A 5AP7A 4YPDA 4C58A 5BYYA 3HV3A 2HENA 2H8HA 1IA9A 4EORA 4MKCA 5CEMA 3R7UA 4CT1A 2XH5A 3ORKA 4XV9A 3OUNB 3VUIA 3QGYA 4E4LA 2NNWB 3VUKA 3TZ7A 3HAMA 4L7SA 4FODA 4WBOA 2C5XA 5JFWA 1FPUA 4QMYA 3R1YA 5BQ0A 3BEAA 2H34A 4RJ3A 3M2WA 3Q53A 4IVDA 1LEWA 4D55A 4ZMEA 3SG8A 1M2RA 5IQGA 4RG0A 3GC7A 5IEYA 2HY81 2B55A 4MWIA 5IF1A 1SVGA 5KE0A 4JAIA 5DI1A 3MJ2A 2CLXA 3R04A 4UB7A 4UBAA 2BTRA 5JRSA 4R3RA 3VUDA 4LQMA 5HVKA 4G31A 4YHTA 2GTMA 5CXHA 3H0ZA 3E87A 4QMPA 5LCKA 3OTUA 4AS0A 3JVRA 5EG3A 3SXFA 3OFMA 3I5ZA 3IW8A 4YZCA 4DHFA 4FIHA 1S9IA 4NUSA 3QLGA 4KS7A 2ZV9A 4AZWA 5FXSA 4IZAA 1Y57A 3KN5A 3TNQB 3EQHA 1W98A 3W2SA 3AC3A 3IOKA 4IE9A 4X3FC 3V01A 3F5GA 3EQRA 2BRNA 4FSTA 3LCTA 4F9BA 5L2IA 4WNOA 5EQEA 4MHAA 1VJYA 1QPEA 3EQDA 3Q4CA 5IQIA 4H05A 2VTOA 2P3GX 2YLFA 2HCKA 3TTJA 4WHZA 2YERA 5CASA 5I9ZA 3FKLA 4LGGA 3UIXA 2WGJA 3BGZA 5GZ9A 3EZVA 4GSBA 1G8SA 2GQRA 2CCHA 4FI1A 3Q9WA 2RGPA 2WAJA 3MTFA 4HGTA 1T46A 4YSMA 5LARA 3VUGA 2WMSA 4D0XA 4D4YA 3PYYA 5A4CA 2YM8A 4ZSJA 4AZFA 5H8EA 2ZB1A 1WVWA 4GCJA 4IXPA 3VS7A 4FTUA 5IA3A 5IQCA 4I6FA 2WEVA 4NIFB 4FIIA 5L8LA 4BI2A 5A4QA 3UOLA 5CF6A 3PVWA 3MWUA 3KXHA 4E3CA 2WQNA 1G8AA 5DNRA 3PSCA 4I41A 5F1ZA 4ZTQA 3U54A 3V5LA 4S32A 2E9VA 4ID7A 5BYZA 5FTOA 5TE0A 3TTIA 3UGCA 3S2PA 2OH0E 2GSFA 3NYXA 4Y73A 2WU7A 4QMLA 4G5PA 4O82A 2EB3A 3MFSA 4PL4A 2IZUA 2O64A 4V04A 4D9UA 3UO5A 3LJ0A 3BE2A 3QWKA 2IW9A 3IGGA 5HE1A 4DE4A 5CZIA 2XIRA 4OR5A 4CFXA 3ZUUA 1WBWA 4X6RA 2GNLA 4RSSA 4UMPA 4KSQA 4BCIA 4RRVA 4O91A 4C0TA 2X4FA 4IB0A 2F49A 4QPAA 3JY9A 4RWJA 4V0GA 4D1XA 1YHVA 4BYIA 3EQBA 4JDKA 3ZCLA 5AAGA 4DBXA 1H1SA 3NUXA 1AGWA 4BCKA 4A9TA 4ZJVA 3UC4A 4AW5A 4D2VA 2HWOA 3OZ6A 4IH8A 4EBVA 5C8NA 2WMQA 4FSRA 3MY0A 2PHKA 4IBMA 3QZHA 4FL1A 4JX3A 4CKJA 3ID6C 3BELA 4KBCA 4JOAA 3TM0A 1FOTA 5DBXA 3QA8A 4ERKA 5T3QA 5BVOA 1JSTA 1MQBA 2OSCA 1M14A 4IVAA 4DEDA 2JDOA 3I7BA 2OBJA 3NDMA 3QD0A 3F88A 2X9EA 3FL5A 3TL8A 3W8QA 2I1MA 3AOXA 4Q2AA 5LVNA 3PFQA 3HP2A 3E3BX 3G15A 5M08A 4FF8A 2EUFB 4F63A 1Q8ZA 2XMYA 2YITA 3KRWA 1U4DA 1PRYA 2VTSA 2PUIA 2GQGA 3RVGA 5AR2A 3ZLSA 5JFXA 2AC5A 3KQ7A 5EYMA 4A07A 3MPTA 4L42A 4UWYA 1OKZA 3THBA 3UZPA 2XP2A 3P86A 4FKIA 4YJRA 4NM3A 2QLUA 2JD5A 3OHTA 4FZDB 3OMVA 3IK3A
chains in the Genus database with same CATH superfamily
1W2DA 3TXOA 4M84A 3QD4A 4Z7GA 2OJ9A 4O83A 2YACA 2ZAZA 3E92A 2ZM1A 1SM2A 3BE9A 1M2QA 3GCQA 4A9SA 4DFLA 3ZOSA 2VUWA 3MIAA 4ZY5A 4ARKA 3F3WA 5IEVA 2PVRA 2BHHA 3VBVA 4PTGA 3NX8A 4EZ5A 3GP0A 5KMJA 4FT9A 5K9IA 1VEBA 2BMCA 1MQ4A 2R4BA 4FV8A 3WYXA 1TKIA 2CDZA 2NRUA 1LR4A 2B54A 3QZIA 3FZPA 4YPSA 3OCTA 3DXQA 4M14A 4GV1A 4BZNA 3L1SA 4HGEA 4J95A 3KCFA 3BI6A 3SOAA 4U9AA 3PXZA 3R7IA 2YHVA 2FYSA 3CY3A 3KK9A 2YM4A 3N51A 4QMUA 3PE1A 3SKCA 2WOUA 2C0IA 4HVDA 3VONA 2F4JA 2CGUA 3C51A 4O27B 4JX7A 4YJTA 2UVZA 2GS7A 5LMKC 5D7VA 3UNJA 3TUBA 5CAPA 2YCFA 1X8BA 3TT0A 2JAVA 5I9XA 1R0PA 5CT0A 3FHRA 3KC3A 4ZSGA 4EC9A 1Y91A 1PY5A 3MPAA 1MRUA 3WF9A 4M7IA 4W4XA 3DBDA 1JBPE 2KTYA 3SC1A 5AFVA 3ULZA 4D28A 2XKEA 4F7SA 4JQEA 2C5VA 5DHJA 2E9PA 3LJ2A 5TT7A 4AGCA 4MYGA 4FX3A 4A9YA 2YM5A 5HBJA 2YJRA 3VJNA 2VTAA 4B7TA 2JAMA 3HECA 5CYIA 5EYDA 4BDIA 4I0RA 5CWZA 1KE6A 4EOPA 2GS2A 2V22A 3G5DA 4C4GA 4DEBA 3U4WA 2XNPA 2RG5A 4PX6A 4P5ZA 2BALA 3SAYA 3ITZA 2XNBA 3NYNA 4F7LA 1GNGA 2A19B 2CLQA 3GC9A 4LOOA 1H1RA 1OL7A 5CX9A 4EH6A 2V62A 5TR6A 4XRLA 3DT1A 1GZNA 3BHYA 4X3FB 5I4NA 1LUFA 4QP8A 4TYJA 2R2PA 1FMOE 4WD5A 4AAYA 2OIQA 1OECA 3K3IA 3PTGA 4ANBA 3O17A 4WRSA 3FSFA 1YWRA 3BU6A 2X8DA 2G2FA 3MI9A 4BKZA 4G3GA 4PF4A 4AAAA 3C4CA 3U4UA 5TO8A 3NNUA 2X6DA 3R28A 5IH4A 1KOBA 5EHYA 3W10A 3VBWA 2WMWA 3DV3A 5EM5A 5L6OA 4U3YA 2QODA 1OIQA 5K0XA 3WI6A 1H25A 4O4CA 5ANOA 4UX9A 3VS3A 3BHTA 4L43A 3LQ3A 3DY7A 4N57A 4E5WA 4J71A 5DRBA 5CF4A 3IOPA 3C1XA 4QQJA 5IEXA 4CEGA 2V55A 2YFXA 4RPVA 3FMNA 1MP8A 1PXMA 1UNGA 1ZY5A 2IW6A 3A2CA 3ENHA 3OXZA 4GYIA 1H08A 2WTWA 4XMOA 4RZWA 4XS2A 5ANIA 4ACMA 4XV2A 4CFMA 3I60A 4HCTA 1H4LA 3KK8A 4BKYA 3ORXA 5H8GA 1UWHA 2G01A 1WVYA 4G9CA 2ZMDA 4OTQA 2X9FA 5ETIA 4N6YA 5TOZA 2B53A 4FICA 4O2ZA 4IM0A 2GNIA 2SRCA 4YZBA 2PULA 3SW7A 3ATTA 3UIUA 5KMIA 1Q4LA 2W96B 2PVMA 3ORZA 4PL3A 5EDQA 4XP2A 2R0IA 1SNXA 3PFYA 3KMUA 5J7BA 4JR3A 3C5UA 1CMKE 3MH1A 4WSQA 3WZDA 4O96A 3HA6A 4AF3A 5GZ8A 1Q8UA 4FG8A 2CKEA 3FV8A 3PXRA 3GC8A 4FA2A 3FYJX 4FZAB 4J1RA 5FXQA 4G17A 2NRYA 4BDKA 1PYEA 3UDBA 1KE8A 3QZFA 4ANQA 3ODYX 4FKGA 1OPLA 3FUPA 3RHXA 2NPQA 4MXOA 4XEYA 3F5PA 3BPRA 3CTJA 3EFLA 3A7FA 2IJMA 3GU5A 1XH9A 3ZS5A 1R78A 2JKKA 3ZMMA 4FTMA 4DG3E 1XH7A 3F82A 3PRIA 4IB1A 4IW0A 2WMBA 3DBQA 4DH1A 5IA1A 1FQ1B 1PF8A 3Q6WA 3F3UA 5CU6A 3TI1A 5EW3A 3CSVA 3ROYA 3W33A 4OAVB 2YLEA 1ZOGA 4XG6A 1KSWA 2CGWA 1H8FA 2XJ1A 2YWPA 3I6UA 2XBJA 4ZZMA 4HYSA 3ZSGA 4HVSA 3OG7A 5HEZA 3ZO1A 4CT2A 3NAYA 3GQIA 4LV7A 3WARA 1BKXA 4Y83A 5D10A 2I6LA 3GVUA 4NJDA 3TWJA 4TWPA 3VF8A 4GG7A 4EYJA 2QOLA 4IZ7A 3D2KA 5IH5A 4CXAA 2GU8A 1XHAA 4O7WA 3PSDA 3H10A 3RMFA 3MN3A 4ZOGA 4ZLOA 2ITTA 3EQCA 3FQSA 1SZMA 3Q2MA 4O7YA 3HRFA 1U46A 3MGYA 4HVHA 1E1VA 3BQRA 3FKNA 2YWVA 3TV7A 3TMOA 5EK7A 3FLQA 4LUEA 2JBOA 5E8UA 3AD6A 5KHXA 1L8TA 3N4VA 2O8YA 4E1ZA 5AX9A 5J87A 2X8IA 1JSVA 4HW7A 3H9FA 3QFVA 4F9CA 5AEPA 4UMQA 4C57A 5J5TA 2JITA 3BCEA 5DR6A 1DS5A 2C3LA 4NK9A 3LXLA 3O0GA 3D2IA 3QX2A 4RX5A 5EI6A 4FT5A 3V8SA 2O0UA 3MSSA 4F65A 1FBNA 3V5PA 3LE6A 3FE3A 3R7EA 3UTOA 3LFFA 4GUEA 2XUUA 3SOCA 4A4OA 3LAUA 4BR3A 4WOVA 4OBPA 4R8QA 3R7YA 4D2PA 4K18A 5JT2A 2A27A 2UVYA 4BKJA 3DQXA 4L67A 3CIKA 1CKIA 2YABA 3UPXA 3FZSA 3E63A 3FI2A 2BPMA 4RJ7A 3W8LA 5CXZA 5C4LA 4WUAA 5HZNA 4USEA 5FWKK 4RC2A 1UV5A 2BTSA 3I0OA 4O0WA 1UU7A 5FRIA 1IAHA 1OI9A 3AD4A 3PXKA 2DQ7X 4OTHA 2W0JA 4QP6A 4RWIA 4YJVA 5CSXA 5CEQA 4YBKA 2VRXA 4B6LA 1TVOA 4PY1A 3GCSA 2CPKE 4KKHA 4YR8A 4FZ7A 2J0LA 1ND4A 2VTHA 3PUPA 5BVFA 4U3ZA 3C0HA 1R3CA 2CGXA 3S1HA 4UY9A 1URCA 1V0OA 3DOGA 3A8WA 2WB8A 5DGZA 3V5JA 3D94A 3MJ1A 3DAKA 1UKIA 4FGBA 5FM3A 4ZXTA 5JQ5A 3DS6A 1UNHA 2LGCA 1ZYDA 1YXSA 3Q9XA 4XG7A 1ZLTA 2FSMX 4FTQA 4O6EA 5EQYA 5ICPA 1DI8A 4LG4A 2R3LA 4TWNA 1ZZ2A 3HA8A 4JQ7A 4K1BA 4R5SA 4C33A 4CZTA 1SYKA 3R9OA 2W9ZB 4O2PA 4O7NA 3QQLA 4FKWA 3FMLA 1XQZA 4QMVA 5AR8A 5IMEA 2J90A 4HJOA 4O4DA 3F7ZA 3JXWA 4L00A 1BUHA 3D15A 5JFVA 2YZAA 3Q4ZA 3Q4UA 4D5HA 2PE2A 3RJCA 4PDPA 3GOPA 2R5TA 3NW6A 5JGBA 3POZA 1W0XC 2IPXA 3P5KA 5D11A 4BDDA 4C4EA 3KXZA 4AZTA 5IQHA 5F4NA 4RA5A 4C38A 3F6XA 3R22A 4PV0A 3LCSA 4C59A 4BCNA 5AAEA 3NWWA 5F9EA 4IDTA 2C6EA 2Z8CA 4AT3A 4F6UA 5CTPA 1WMKA 3TZ9A 3LKMA 3LFDA 4PRJA 3I79A 5AP5A 2P2IA 1XMMA 4LUDA 2IO6A 4TXCA 3ZC6A 3RP9A 2HZ0A 3BYMA 2JIVA 4I5CA 1ZMUA 3E3PA 4ASEA 3ORTA 4J52A 4N0SA 1AQ1A 4O4BB 4AFEA 3G9LX 3ZRKA 3VNTA 4BTKA 5ANJA 1XKKA 4FKRA 4WBBB 3NUPA 4TKSA 3QCSA 4QYGA 5IUIA 3VUTA 4EQCA 2R0UA 2VTMA 4ZSLA 4MF1A 3MIYA 3OW4A 4PDOA 3Q6UA 2AC3A 3D0EA 3S00A 2PY3A 3OCSA 4IVBA 4R6VA 2Z7QA 4RX9A 3ZUVA 4APCA 4EQUA 4IVCA 3Q5IA 4GK4A 2WZJA 3CJFA 1P5EA 2JFMA 3F7WA 4RIWB 1FVTA 1I44A 3V8WA 4YU2A 4JDHA 3H3CA 2HW7A 3TKIA 3ZM4A 4DFXE 4DYMA 3R9HA 3PA4A 4OTPA 3UBDA 2ITWA 4C3PA 2X8EA 5K0KA 4XG3A 5BVWA 5B7VA 4FTKA 5HIBA 3C5IA 1UU3A 3DNDA 3GT8A 4MH7A 3W2PA 3DXNA 5IU2A 3F66A 3IONA 1YDSE 5FQDC 4UYNA 4EOSA 4MXAA 3JR1A 4OTIA 3LM0A 4FSNA 4L3JA 4APPA 2OLCA 4YMJA 2ZB0A 3HYHA 1RW8A 2RF9A 4FVRA 3UIMA 2A2AA 2UZOA 3QTUA 5EOBA 2C6KA 4R5YA 2PK9A 4LOQA 1WCCA 5J9LA 3WILA 3C4EA 2QO2A 5M07A 1JLUE 2OFUA 4U44A 3U51A 3MFTA 1ZYJA 4WKQA 3T8OA 3TEIA 4BFMA 4XBRA 4Z9LA 5C1QB 2Q0BA 2XCKA 3PG3A 3R0TA 3RPVA 2BRBA 2EU9A 2VGPA 4HGLA 4G6OA 3CQUA 4RLKA 3G6GA 3C4FA 3VIDA 5LVMA 2ITZA 3QYWA 3CC6A 4X3JA 2YISA 1DAWA 4X2JA 4RFMA 1ZOHA 5C9CA 3UQFA 4GW8A 2YEXA 4ZIMA 4DT9A 4E6DA 3SDJA 1W7HA 4NSTA 4XG4A 4Y72A 5CALA 3D4QA 2XK8A 5KBQA 2PE0A 3MH0A 4U8ZA 2ZFYA 4AW0A 3P7CA 4IJ9A 3AD5A 3WBLA 1YOMA 4ZLZA 2XBAA 1LP4A 2OG8A 2BIKB 4AG8A 3KRRA 4BZDA 4YZDA 4AA5A 4M68A 4RVKA 3U6JA 4MD9E 3BU3A 3V5TA 3Q3BA 4YJNA 3GFEA 3ODZX 4ALUA 3W0NA 3UDTA 4PDYA 2B4SB 4YURA 3PPJA 4IB5A 4RVMA 4UALA 4FEWA 2GDOA 1U5RA 2ESMA 3ENMA 3RAKA 2QONA 3KREA 3FKOA 4FSZA 2E9NA 2VWVA 5KO1A 2DYLA 2WU6A 1BYGA 3PP1A 4Q5HA 4MQ2A 2RFNA 4FOCA 2NO3A 3MYGA 2C6MA 3COHA 1YI3A 1ZARA 1H27A 3HV6A 4KIPA 3REPA 4CMUA 3BGPA 1K3AA 5DLSA 5LMAA 3IG7A 3AG9A 4G5JA 4YZ9A 2BZJA 5E91A 3U87A 4OLIA 4D2TA 2QO7A 1XMLA 2R3PA 3QRTA 3H9RA 4NEUA 1EH4A 5DT4A 4EK6A 1PXLA 2CN8A 3ZSHA 3OC1A 4FV2A 2O63A 4CLIA 4DCEA 2NYAA 4BHNA 2G2HA 3U6HA 2BDJA 3KULB 1VZOA 2IG7A 4NW6A 5CVGA 5HTIA 3ML1A 5AAFA 4CCUA 3KXMA 4OGRA 3C0IA 3HKOA 4EJNA 3ZBFA 4EK8A 3ANRA 2AEGA 3RK5A 3R8VA 3DXPA 4IWDA 5H8BA 2R3JA 4RZVA 4S33A 4F09A 3MH2A 1WAKA 3HL7A 3UE4A 4F1TA 3NNXA 3FXWA 2F7ZE 3OY3A 5HI2A 3GCUA 3V6RA 4O7VA 3ATSA 2W17A 2X2LA 5DN3A 3QKMA 5CLPA 2YCSA 3DBCA 4H1MA 3F5XA 3FSKA 3G9NA 2VWUA 2UZVA 3MB7A 3CQWA 3QRJA 4BIBA 2Y8OA 3ORNA 4GJ3A 1WZYA 4J96A 4HVIA 3CS9A 5LXMA 1U54A 3OT8A 2ITYA 4IAKA 2BKKA 3FMHA 4BTMA 2PYWA 5HORA 3SRVB 4BL1A 2BILB 3RPRA 2J51A 5AV0A 3G90X 5J9YA 2VO0A 2F7EE 4L53A 3F2RA 2PVJA 3DLZA 4O0RA 4YNOA 4PTEA 1J7LA 4BCGA 3CQEA 3DFAA 5EI8A 4AW2A 4U40A 2GS6A 3IPHA 5BVEA 4CG9A 4YTHA 3VBYA 4F0FA 4KKGA 3BL9A 2XEZA 3AKKA 3W0MA 4MQ1A 3RPOA 2QG5A 3WZKA 2Z02A 3PJCA 3EKKA 2IVVA 4XCUA 5HX8A 1H07A 2XKFA 4IWQA 3GU7A 1REKA 4KRCA 5EKNA 2WEIA 4WNPA 4QMXA 4BJJA 4JS8A 4O0VA 4A9UA 4F1MA 3VJOA 5BVNA 5CANA 2OJIA 3VBXA 4DC2A 5K4IA 2XIKA 3E8CA 3IDCA 4FKLA 1YQJA 4FK6A 4U43A 3R8PA 5LVPA 4DFYA 2W1CA 2P4IA 3FLSA 4EH2A 2IVTA 2I0EA 2P0CA 3L8XA 3NNVA 5E8SA 3LW0A 3F3ZA 4EHEA 2C5NA 4PTCA 2R3GA 3FY2A 4FK3A 1FVRA 1PJKA 2UV2A 3VO3A 3QKLA 4TPTA 2QI8A 3AGLA 4AN3A 2X81A 2C0OA 3TZMA 3RZFA 3SG9A 4C35A 3N4TA 2QHNA 3CLYA 3CGOA 3CD8A 4I5PA 2BZKB 2PZPA 3RI1A 3ZLXA 2PSQA 5L8KA 2JLDA 4GVJA 1XR1A 4HPUE 2IZRA 5EHOA 4FNWA 3VS2A 4XG9A 1YXXA 2WQBA 3KRXA 4PL5A 5IQDA 2I40A 4USDA 2W05A 1V0BA 2VD5A 4U6RA 3AC1A 4NL0A 2ZM3A 4WUNA 2QOIA 4E6QA 4UZHA 5HO7A 3WF7A 4U80A 2W4OA 2OICA 1UU9A 3RAWA 4E20A 4XYFA 3A8XA 3P1AA 4IANA 4QMSA 4F9WA 5K5XA 5ANGA 5K3YA 1BLXA 4PPAA 2VTPA 3TKUA 2HY0A 4AOTA 3DDQA 2WTKC 5I3RA 1OIRA 4RX8A 4RC3A 4V0GB 1PXOA 2Y4IB 3BU5A 4ALVA 3E64A 3CD3A 3QKKA 5EM6A 3HUCA 4P7EA 3E93A 4YJQA 4O1PA 1R0EA 4KUJA 4AA4A 4EOJA 2C1AA 4R3PA 2RL5A 2UZUE 3AMBA 1P2AA 4FSUA 4EQMA 3OOGA 4Y5QA 2VNYA 4DDGA 4FSYA 4BIEA 2PVYA 4IAAA 4KIOA 4QYFA 3QQUA 3LHJA 3RK9A 4IC8A 4FNYA 4FKSA 4MK0A 4NJ3A 1BL6A 3UZRA 3LFNA 1S9JA 1QPCA 4JRNA 4BCPA 5FTQA 5IISA 3FLYA 3TJDA 4K11A 2QOFA 3IW5A 3MBLA 4TNDA 3ZFXA 2B9JA 2ETKA 4ITHA 4L8MA 4RIYB 2EXCX 4XUFA 4F4PA 2R3RA 4DGLC 3I0QA 2J0JA 4O38A 2I0VA 4JQ8A 1QPDA 3ROCA 2VO7A 3ZHPC 5I3OA 3K5UA 4YLJA 2ACXA 2PZRA 4C61A 2EXEA 3RNIA 4F1OA 2YCRA 1A06A 4FG7A 5CVFA 4QP4A 3F5UA 1DI9A 3FQEA 3DBEA 3Q5ZA 1J91A 2I0HA 3FBVA 3V5WA 1J7IA 5KUPA 2BDWA 4O0SA 1WVXA 3ULIA 3GUBA 4K9YA 5JH6A 4C4JA 2R7IA 5A4LA 5CAOA 5D7AA 5AP4A 2P2HA 4EEVA 4AT5A 5L2SA 4XOYA 4LV8A 5CI6A 3QRUA 5HU3A 5E4HA 1JOWB 4YJUA 2R3NA 1Q41A 4IC7A 2DS1A 3TV6A 3COIA 4IEBA 5HNGA 3W18A 3EL8A 3SVVA 3D7TA 3Q2JA 4UV0A 3RKBA 5DVRA 3VC4A 2BHEA 4PNIA 2J4ZA 3PY1A 2UW6A 2W1EA 3E7OA 3GU6A 2XF0A 2BROA 3Q4TA 4QP1A 4IACA 4DT8A 4ANNA 3ET7A 4IMYA 3O7LB 1XBAA 4NFMA 4TY1A 4FGRA 4F7NA 4KSPA 2R9SA 4L52A 1OBDA 1YKRA 3FPMA 5KMLA 3JY0A 4G3CA 1A48A 1IRKA 4MAOA 4JXFA 3Q32A 4XX9A 1PW2A 2GTNA 3BV2A 5M4CA 1ATPE 3EQFA 2Y7JA 4P4CA 5IQEA 3IECA 3CR0A 2R3HA 5M06A 2QURA 3LOKA 2HZ4A 2YCQA 3KB7A 2WD1A 3S3IA 2R3IA 4CCBA 3UC3A 3DQWA 1OZ1A 3WE4A 3W0QA 3R9DA 1UU8A 3OWKA 5IH6A 4BBEA 1VLRA 2WQOA 3L9MA 5AV2A 5E8YA 4G1WA 3ZO3A 3ZZWA 2ITNA 2GQSA 3AC5A 5E8TA 3AKJA 4KBKA 2VX0A 4CFFA 3R7OA 2BFYA 3HP5A 4F6WA 5BMSA 3UVPA 1WBSA 1OPJA 2C6IA 5ETCA 4FYNA 4BDGA 2PUNA 1F0QA 3VUMA 4DEAA 4DGNA 2BIYA 2XYNA 3DDPA 3DGKA 4FV0A 1G8KA 3LMGA 4AZSA 5FM2A 4HNFA 1MRVA 3HRBA 5G1XA 3SLSA 4AFJA 2VTTA 4CFNA 5E8WA 1A9UA 4CTCA 3AGMA 5DMZA 4FG9A 2QKRA 2G9XA 1OBGA 4XV3A 4EL9A 3QXPA 4XRJA 5J95A 4H39A 3DKCA 3F2NA 3UOJA 4FTRA 3GI3A 3QL8A 4MNEA 4ZJIA 4D1SA 2CKOA 5L4QA 4TL0A 2B7AA 4WG4A 5DEYA 4A7CA 4BGHA 4E6AA 2XJ2A 2W5HA 3EN5A 2WELA 2WXVA 3D5VA 4RIXA 4BDBA 4ACDA 4EUUA 1PXKA 1OL6A 4FTAA 1STCE 2JIIA 2W1DA 4RJ8A 3IGOA 5GIOE 3KKVA 3ZU7A 2QHMA 3QZGA 4C3RA 3ETAA 3BHUA 5KMNA 5I9WA 4WNMA 4FEUA 2WMAA 3LFSA 4NCTA 5F95A 3VBQA 5KKRC 5IQFA 5EDPA 2W5AA 4F64A 3BWJA 4QP7A 4YO6A 5AA9A 4R1VA 5D1JA 3ZDIA 3IW4A 1H1PA 2WQMA 3NSZA 1PYXA 1UVRA 3VRZA 5CAVA 2GHLA 3R00A 2C30A 4PP7A 2IEWA 5C26A 2BRGA 3RPSA 2F2UA 2GNHA 2GMXA 3KY2A 2XCHA 4GIHA 4QYYA 4XBUA 3R8UA 4C37A 4CD0A 4I23A 5L2WA 4WA9A 4KRDA 3EN7A 5E7RA 4BCJA 5M09A 3DJ7A 1KOAA 3RWPA 5J7HA 5IA0A 3E5AA 4NKSA 3BGQA 3L8VA 4F7JA 2OJGA 1ZWSA 2C5OA 3FJQE 3T3UA 4DTAA 4AX8A 3OXIA 2WMXA 4DTKA 4F70A 4FT7A 2HZIA 3LFEA 1ST4A 2R3MA 2ZJWA 4BBMA 4BZOA 4U97A 3NUUA 2PVFA 4B4LA 2WTKB 1G5SA 4B0GA 4M66A 4YHJA 4G3EA 2HIWA 4KINA 1T45A 1ZOEA 4OW8A 2JDRA 3NIEA 2EVAA 3G2FA 4IX6A 1IEPA 3FC1X 4MWHA 3UO6A 1ZY4A 1J7UA 3GGFA 5ETFA 3PXYA 3E8EA 2C69A 3OVVA 5LVOA 4LOPA 5L6PA 1OL1A 1H0VA 4RJ4A 3DU8A 3H30A 3TUCA 2ONLA 3HMIA 4RVLA 5H9BA 4C3FA 2C4GA 3OP5A 4KAOA 3RK7A 4DH8A 3BEGA 3A7IA 3EOCA 5CT7A 2G15A 5IA2A 3R01A 5TF9A 4IZ5A 4GKHA 5A4TA 2J2IB 5CF8A 1OKWA 2QCSA 4D5KA 3N4UA 5EDRA 4ZLYA 3FQHA 4NH1A 2QU6A 1YDTE 3W2CA 3O50A 4IDVA 1OM1A 4E26A 5CSHA 1CKPA 2VTRA 1FINA 1BI7A 3UDSA 4QO9A 5TKDA 3Q52A 1JWHA 4GT4A 3P79A 2BAJA 4A4LA 1GJOA 4DN5A 3WF5A 2XANA 2JKQA 2XNNA 4X2FA 2J6MA 4E6CA 4FTNA 4R7BA 2R64A 4L9IA 2CNUA 4O7RA 3QA0A 2W1FA 3IW6A 3PP0A 3V6SA 5IZFA 3VVHA 4II5A 3HV5A 2I0YA 3A7JA 2XIZA 4B9DA 3ACJA 4JVGA 3KFAA 5CQUA 3SA0A 4GG5A 1H00A 4XLVA 4PPCA 4QYHA 2WTDA 4QP3A 1OIYA 1YWVA 4QMNA 3W1FA 5L3AA 2X2KA 3GENA 3NIZA 3QD2B 4RA4A 4JR7A 3BKBA 3NGAA 5AP2A 2VWXA 3EHAA 3O8UA 1XH6A 4RVTA 4X2NA 4HPTE 2F7XE 4HYUA 4CFWA 2VGOA 3EL7A 5I9YA 3F2AA 4DH7A 1TQIA 3FYKX 3QGWA 1IR3A 2X0GA 4MXYA 3ZTXA 3DB8A 4DHJA 3SXSA 2OZOA 4ZAUA 3UZTA 4YSJA 4C4HA 2XK3A 5CEOA 2AYPA 3MA3A 2Z2WA 3D7ZA 3FZ1A 3LCDA 3QC9A 4JJRA 4XLIA 5C27A 3WYYA 2HYYA 2OZAB 4FRFA 4NM0A 3ZEWA 5A4EA 2Y6OA 2P55A 1APME 2WHBA 4ERWA 5ANEA 4E93A 2A0CX 2W7XA 3AC4A 3U6IA 1Q3DA 2XRWA 1SVEA 2JDVA 4O7ZA 3AQVA 1M17A 5CU3A 4PNKA 3E7VA 4G6LA 3U8WA 1W84A 5HG9A 3KEXA 4I0SA 2Z7LA 4RIOA 5E1EA 4JI9A 3GCPA 1OL2A 4C02A 5EYKA 4XP0A 4DEHA 3PXQA 4K2RA 3R02A 4YBJA 2OO8X 2RKUA 3ZSIA 5KBRA 3T9IA 4FUYA 2OIBA 4QNAA 5KMMA 1PXPA 2XKCA 1W83A 3TYKA 2OK1A 4E8AA 3QTSA 4M15A 3K5VA 3AC2A 2IN6A 3HDNA 3KXNA 4DH3A 2W1ZA 4CV8A 4C7TA 1K2PA 1PMEA 3NUSA 4ORKA 3ACKA 4I93A 2JC6A 5CENA 4BDCA 2VU3A 1JKLA 4RQKA 4FV9A 3NNWA 3ZXZA 2PVHA 4J98A 5ETAA 3QCXA 1J1BA 3C4WA 4L6QA 2KULA 4MD7E 2QVSE 2VV9A 3D5XA 5GIPE 3TZ8A 1G3NA 4AE6A 3LFAA 3ZRMA 1XWSA 4EHZA 4FJVA 3KXXA 2QO9A 3KMWA 2BAQA 3CKXA 4QNYA 3ZO4A 2YDKA 3HX4A 3L8PA 3PRFA 4M97A 5FBOA 4YJSA 5DIAA 2FGIA 2C68A 3FZOA 4YHFA 1J3HA 3PDTA 4KKEA 3D9VA 2YAKA 3BWFA 1GIJA 2WIPA 5KZ0A 4CRSA 5GNKA 4DF3A 1RJBA 4FTCA 3BX5A 5DE2A 2GNGA 5EHLA 3UP2A 2WO6A 2IZSA 4C8BA 3H4JA 4JBOA 3FHIA 2LAVA 3FC2A 4D58A 2X4ZA 4YTCA 2CNQA 3TN8A 4OTRA 1O6KA 2B52A 4J8MA 5AP1A 3GCVA 5HICA 3SW4A 3NVMB 3KF4A 5JGAA 3KN6A 1W2FA 4FT3A 1WBPA 3VS1A 1JKTA 3UOKA 4BGQA 4CQEA 4RWLA 2Q83A 1U5QA 2DUVA 3QTIA 5DT3A 4H3QA 4I1ZA 1O6LA 4BDHA 3F3VA 3E88A 2R3FA 2V0DA 5A46A 3UP7A 1ZYCA 3KRJA 3D5WA 4QQCA 1B6CB 1PMNA 3DJ5A 4CKIA 2DWBA 4OAUC 2CKQA 3ORLA 1VYWA 4L3PA 4QMTA 4XH6A 5HNBA 3SV0A 4FE2A 3FPQA 3R8ZA 4W4VA 1KV1A 3UODA 4IX5A 3R83A 3PJ8A 5CZHA 4EOIA 5IDNA 3QHRA 4RWKA 4FBXA 4UWCA 5DR2A 4DDIA 1ZXEA 3BIZA 3MTLA 2ITOA 2XS0A 4PDSA 2WTVA 4AGWA 3CCNA 5AV3A 5KMOA 5M57A 4ZZNA 2CGVA 2ZMCA 4FTJA 4M69B 2PUPA 2O5KA 3D83A 3QLFA 3IS5A 5AR4A 3A4PA 2PMNX 3EIDA 3QAME 5A6NA 3EYHA 3HMOA 2OJFE 1W8CA 4U42A 2VO3A 4R7HA 4U5JA 3ZH8A 4AN9A 3LLTA 3OEFX 4HZRA 4F0GA 4I22A 2FUMA 3DAEA 3RHKA 4FYOA 4HCUA 1YOLA 3QQKA 3WZEA 4B8LA 2HOGA 2UVXA 4FC0A 4QT1A 2ITUA 5FEDA 3R7VA 4CYIA 2WOTA 5DRDA 2YIXA 4O4EA 4GIIA 3A62A 4FNZA 3DPKA 3GEQA 4O21A 4FKOA 5BMMA 4Z3VA 4Y5HA 3U9CA 4GEOA 4ASDA 4EOOA 1IAJA 4QTEA 1RE8A 5FP5A 2WNTA 2F9GA 4IFCA 4BCHA 1NA7A 2R7BA 5AWMA 4NYEA 1OPKA 5IQAA 5CAQA 3GNIB 2C6OA 3UMXA 4Y46A 2YDJA 5FUTA 3O71A 5CSVA 3BQCA 4EWQA 1NT2A 4IWOA 2UW4A 3FXXA 5H3QA 3I7CA 4EKKA 5BYLA 4KWPA 2FB8A 3GFWA 3TACA 5JN2A 2VN9A 3DZOA 4DEGA 5BUJA 3HNGA <