4O38A

Crystal structure of the human cyclin g associated kinase (gak)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
310
structure length
267
Chain Sequence
QSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPLYSNFPIGEKQDIWALGCILYLLCFRQHPFYSIPPHDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQEIAAARNVNPKSPITELLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-G-associated kinase
publication title Crystal structure of the human cyclin G associated kinase (GAK)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 71
structure length 267
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4o38A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o38A01
1JBPE 2G9XA 4H3QA 3QD3A 5DH3A 1O6LA 2O8YA 3MFRA 3RM6A 1KSWA 5IKWA 4AW0A 4EHEA 2WMUA 4JAJA 3BEAA 3BBWA 4XUFA 2OFVA 2JDSA 4RC2A 3OOMA 3TZ9A 4APCA 4Y46A 3JY9A 4M69A 2G2IA 3WARA 5G1XA 1UNLA 4O83A 3DAJA 4JBPA 4E73A 2GNGA 3QALE 3TDVA 4RJ3A 4LOPA 2XK4A 4PUZA 4FG7A 4U3YA 4X2NA 5CQUA 2AUHA 3D94A 3GCSA 4IBMA 5A6NA 4I0RA 4MD7E 1U59A 1HCLA 2WOTA 4JNWA 1NXKA 4C7TA 3QCYA 5EQYA 3K3JA 4I5CA 4PTGA 5EG3A 3WE8A 5DEWA 1UKIA 4BDBA 2H96A 4LFIA 2Y8OA 4FODA 3R7OA 4A4XA 4GL9A 3KC3A 3B2WA 4LM5A 4J71A 3VRYA 3UQGA 3ZLSA 4MBJA 4E26A 4CMOA 1IG1A 2R3HA 3LLTA 2WQMA 4KBKA 4YTHA 2VTPA 3JXWA 4L45A 4DFYA 5J5TA 2WTIA 3QTWA 3W2RA 5CAPA 5KMLA 5C9CA 2I7QA 5A4CA 3U6HA 3H9RA 4LYNA 2WPAA 3FBVA 5HOAA 5HO6A 2VUWA 5I9WA 4GFMA 4WUAA 4KRDA 4ZTQA 2OZAA 2BIKB 3H10A 1W84A 3C4XA 2I6LA 5AP0A 4AN9A 4BF2A 2X4ZA 4RIYA 5JRQA 5IUHA 2ETKA 4QMMA 3TG1A 3ZTXA 4XJ0A 4BWXA 4HGEA 2B0QA 3NZ0A 5IISA 1BYGA 1V0OA 4EBWA 5KUPA 1GZNA 2VO7A 3SAYA 3ACKA 3HL7A 3E63A 2NRUA 1P5EA 2V7AA 2P55A 3GXLA 3Q6UA 4BCMA 4KAOA 4ACMA 3A60A 4ANBA 3MFTA 5EKNA 4IW0A 2YITA 3NUAA 4OW8A 4BDIA 3ALNA 3CD3A 3GQIA 5EW3A 4IH8A 4D1XA 5AAGA 4D0XA 4PP7A 5K4JA 3PIXA 1Q4LA 3RINA 4FGBA 1CKJA 2HZNA 3QKLA 3FI3A 1AGWA 3O23A 3ZZEA 1OKYA 3VW6A 4BDHA 2PVKA 4RVTA 1YXSA 3FZRA 1Q3DA 4MXXA 4RX9A 3TXOA 4BTKA 2JAVA 3ZLYA 2YDIA 3MV5A 3QQLA 4ERKA 5FUTA 4XHKB 4BI1A 3EN7A 2O5KA 5JFXA 1ZWSA 5CU3A 4EEVA 4RFMA 3TIYA 1OBGA 3HA6A 4L46A 2PUPA 1Q24A 3ZEWA 4NKAA 4D4SA 5DIAA 4JJRA 2OF2A 3NYVA 2C6MA 3BEGA 3BU3A 3AG9A 4BDFA 4WIHA 5FP5A 3R1YA 5AIRA 3ZRKA 2FB8A 3KCFA 3UIMA 1FOTA 4A4LA 2PPQA 1W82A 2BTSA 1YXXA 4QD6A 3FPQA 5HI2A 3QRIA 4G3EA 1WBNA 2PSQA 2Y7JA 5KE0A 3VRZA 5JEBA 4ANMA 3WYXA 4HVDA 2P4IA 5J5SA 3FEGA 4QYHA 3MJ2A 4IADA 3MH3A 4QPMA 1GOLA 1PXMA 5HG9A 3UDBA 4F64A 4U97A 2WO6A 2OSCA 4QMXA 5DT3A 5EFQA 4R8QA 4J96A 3QKMA 2GTMA 4WD5A 4FEWA 5M57A 4TWPA 4AZSA 3ATTA 4GK2A 3PZHA 4FR4A 5FG8A 4OTHA 1A48A 4GUBA 4FTNA 1WVXA 3ACJA 4A9RA 4EI4A 3KRLA 2VTMA 5AV1A 4FKVA 3B8RA 4BDDA 4O0UA 4O7YA 3FZPA 2VTHA 3LFDA 4F7JA 1A06A 5D11A 4G6LA 3QTRA 3NUYA 3OP5A 4TYHA 4BCJA 1W83A 3HEGA 4GYGA 5CSXA 4BZDA 4TNDA 3W2SA 5HE2A 1ZYDA 2C1AA 2JGZA 4DA5A 1WFCA 3ZYAA 3LCDA 4CRSA 5EDPA 2DYLA 2VTIA 4PDYA 4H3PA 4WA9A 3SG9A 2YDJA 2BZKB 3FJQE 4PDSA 3C50A 3RI1A 4C4IA 5BUJA 2XK9A 3DLSA 4USEA 5KMOA 3KRXA 3KVXA 2PY3A 4IAZA 4M8TA 3P23A 4ENXA 3NVKI 2XYNA 4BCGA 4O27B 3CP9A 5L2WA 4GV1A 4DFLA 1XHAA 2X2LA 3QHRA 5ETAA 3EQHA 3F61A 4IB0A 2X4FA 4AX8A 5CSPA 1F5QA 2GS6A 2GQSA 2ZV7A 3LM5A 4TKSA 3KMWA 4CV9A 1CKIA 4FK3A 3DKFA 1W98A 3E92A 4FICA 4PNIA 1FPUA 1Y6AA 2OH0E 4MWHA 5H3QA 3VUIA 3QU0A 2WU7A 3EN4A 1J91A 2QODA 4F0IA 2VTTA 4RWIA 1FQ1B 4UMUA 5D7AA 4EJ7A 2QURA 5A3XA 3BE2A 3QXOA 2J0JA 3PY0A 5HKMA 5LXMA 4QMNA 5LWMA 3WZDA 2GS2A 3KEXA 3S1HA 4GKIA 4R78A 3Q32A 2ZV9A 3UOHA 4GG7A 1ZY4A 4JVGA 2W4KA 4ZTNA 1Q8UA 2ZOQA 3IW8A 3CSVA 3VW8A 5M53A 3QTSA 5DWRA 2ITNA 4IZ5A 3GU6A 4E6QA 4X3JA 2DWBA 5DRDA 4AOIA 1SVGA 4LQMA 5AR7A 3EZVA 2YEXA 4HYUA 4L8MA 3V5LA 3R00A 5AUVA 1P2AA 3QZIA 3F2NA 3MJ1A 5M51A 3Q4UA 2F7EE 3GCUA 2BPMA 4KBCA 1OZ1A 3MY1A 1ZMWA 3LZBA 2B9FA 1I44A 2WOUA 4FNZA 4FZ6A 4KINA 4FSWA 4V0GB 1K9AA 4BVUA 4ZOGA 5DI1A 2Z7QA 4F9BA 2PL0A 3HRFA 2GCDA 4HCVA 3DXQA 4O86A 4O7SA 2C5NA 4EZ7A 2VNYA 5JKGA 2YM7A 5LCJA 3AC5A 1FGKA 5HD4A 2YLFA 3O7LD 3U87A 4I22A 5J79A 4O2PA 4O7RA 3NNXA 2E9OA 4JLCA 4K6ZA 4FTCA 3BWJA 4JX7A 3UO6A 1ZYLA 1LEZA 3GI3A 4UWBA 1OL1A 2OKRA 4FT3A 5J1VA 3I4BA 3LQ8A 4BI0A 1FMOE 5IA3A 2C0IA 4ZLOA 1M14A 1NVQA 5AV3A 3SXRA 5IH6A 1KUTA 3ZSGA 2VX0A 3MFUA 2PZRA 4QP9A 4EOJA 2CPKE 3MPMA 2XS0A 4Q5HA 3BKBA 3NUSA 3RAKA 1JLUE 5AAEA 2QOQA 4GFOA 4BIBA 1OPJA 3NS9A 1ZXEA 3ORXA 4PV0A 2WELA 4FX3A 4C33A 2CKQA 2CHLA 4BTJA 3R1QA 4O96A 3CJFA 3G9LX 3HP2A 4FTMA 2BHEA 1XR1A 2WMSA 4IEBA 4M3QA 5EI2A 3TKHA 3ZM4A 4IWDA 3O50A 4J52A 5IEVA 1OGUA 3MW1A 3ULZA 3D14A 1T45A 2B9JA 3DT1A 4U45A 2BROA 4FIIA 1PXKA 4K77A 4R1VA 5KZ0A 5KNJA 5AR5A 2NP8A 3QAME 5IDNA 3QUEA 5C27A 2YFXA 5FDPA 2ITYA 2C6TA 4MNEB 4BWKA 5HNIX 5E8YA 1Y8YA 3OWKA 1OB3A 2X8IA 3QTXA 2W7XA 2HZIA 4DGLC 3QRKA 5CU6A 3RNYA 5JMSA 3RNIA 3CR0A 1PXPA 4MF1A 3LFCA 3PVBA 5EM5A 1ZOGA 5IQEA 3EL7A 3PJCA 4IANA 4NFMA 4E4NA 3OXTA 4M0YA 2VRXA 1PYEA 3PVUA 3UJGA 4HNFA 2QOIA 4FV3A 4TWNA 1UWJA 3Q6WA 4XOZA 4ZSEA 4FV6A 4GCJA 4FZFB 3GCQA 5DVRA 2XK8A 3NUUA 4O6EA 1E1VA 2PVJA 3RGFA 2F4JA 2W9FB 3D7TA 4OAUC 4OT5A 3BU5A 5DFPA 3U54A 5DPVA 3ZONA 4DH5A 2UW8A 2BALA 3RKBA 4MXAA 1LPUA 4FOCA 3V04A 3JUHA 2A0CX 4NKSA 2QI8A 4JDIA 2CCHA 1WVYA 1Q5KA 2Q0BA 4Y8DA 4P4CA 3RMFA 4CXAA 4CQEA 3F3ZA 3ZSIA 4L3LA 4OTIA 4LRMA 2ITZA 2DS1A 3CGFA 4O7TA 3DZOA 2GMXA 3COHA 5EM6A 2WEVA 2REIA 4HYSA 4NL0A 3VWAA 3ZFMA 3S0OA 4FTOA 2QCSA 4LGHA 5JZNA 2P0CA 3TTJA 1OM1A 4RZWA 3VQHA 3D2KA 1TQPA 2NRYA 4ZS4A 1LEWA 4I6BA 3BLRA 2FSMX 1OPKA 4TY1A 1OKVA 2RG5A 3VQUA 3FMHA 1LUFA 3RK7A 2XM9A 2WHBA 3UNKA 2X8DA 3FKOA 4LUEA 3E62A 2BFXA 3D0EA 1KOAA 2UZEA 3OZ6A 4DFUA 2X7OA 3HECA 3D2IA 4A9YA 1NVRA 3MY5A 3R2BA 3TI1A 4FV7A 2XCHA 4AW2A 5BYYA 2FO0A 4IZYA 2AYPA 3BCEA 2DUVA 4PPAA 4YC3A 1DI8A 4D0WA 4RA4A 4D4RA 4DFNA 4CFMA 4ZTRA 4ZY4A 5A9UA 2C6KA 1PXJA 3PPKA 4FVPA 1OBDA 1XQZA 3NYXA 2BMCA 4JAIA 4U9AA 3C9WA 3R7IA 2WFYA 4YNOA 5FD2A 5M08A 1H25A 4JRVA 4XNEA 4D5KA 4EJNA 4YZNA 4GT4A 3MVJA 5AUXA 4RA5A 2GFCA 4U43A 5B2LA 3GCPA 3N9XA 5I9VA 2GNLA 2OU7A 5M09A 3FMDA 1UNHA 3QXPA 4JQ7A 3IG7A 5I3RA 3GFWA 4G31A 5KMJA 2BRBA 3D4QA 5KX8A 4IJ9A 1OIQA 2CMWA 2UZWE 1R0EA 1FINA 3WZUA 5BVOA 4X6QC 4YHTA 3ORPA 4Q5EA 2V22A 3LM0A 4LMNA 4AA4A 2F7XE 4I4EA 4KUJA 4W4XA 2VTSA 3POOA 2OK1A 2FUMA 2R9SA 4GRBA 4L68A 2IW9A 1H1WA 2IN6A 3TKIA 4BL1A 3HV3A 4LOOA 3L1SA 4NM7A 4TNBA 3ZFXA 3S4QA 3Q9XA 5LMKC 5HBEA 4IDVA 4W9WA 3UIUA 3KMUA 3Q5ZA 2Q0NA 1MRUA 3FKNA 3PSCA 4IVCA 4R6VA 4WUNA 3SRVA 5DR2A 5L8LA 4HZSA 2OWBA 3QFVA 3DXNA 5EOLA 3JVSA 3PTGA 3O51A 2JITA 4DFZE 2WTDA 2WZJA 3R6XA 4AT3A 3HV4A 1WAKA 3HV5A 4J98A 5AP6A 3VBWA 2IZUA 3BYOA 2VZ6A 5LOHA 2EXMA 3Q2MA 1MRYA 4YLJA 4YZMA 3DS6A 4OTRA 3KXNA 3R04A 3PP0A 2X1NA 4EWHA 1JWHA 3NLBA 1JNKA 4FOBA 5LMKA 2OJGA 4FTAA 4I5HA 5FXSA 2XA4A 3VUGA 5CU0A 2JIIA 2PMOX 5M56A 4O7VA 5EOBA 1U54A 2UUEA 2VWIA 5E8WA 5FM2A 5F9EA 1FVRA 5AEPA 2WNTA 3NNWA 4O1PA 5C26A 4RIXB 3Q3BA 3A8WA 4F9WA 4FKWA 4IX3A 1U5QA 3A7IA 5JQ5A 4N0SA 5EM8A 5HG7A 3DBEA 1DAYA 3IW5A 4D2PA 2OBJA 2X7GA 2GSFA 2OJJA 3PYYA 4U42A 3SGCA 4EHVA 5M4FA 2YWPA 3EFKA 4K8AA 4UMRA 3N4VA 5CANA 4BKZA 1TQMA 3MPTA 4MQ2A 2VWBA 4TT7A 5ITAA 2O65A 5EI6A 4MXOA 1XKKA 3V3VA 1QMZA 4ZTHA 5HESA 2OIDA 3NGAA 5BUIA 5HIEA 5HZNA 5C4KA 2IZTA 4JX3A 4XLIA 4TW9A 1T46A 4CFFA 4FZDB 2G01A 2BFYA 4CD0A 1PJKA 4DGMA 4EYJA 5FXQA 5IA5A 3FXXA 5EDRA 1V0BA 2YM5A 5BVDA 2ITPA 3N51A 3W2PA 5TR6A 2J2IB 4RJ7A 5CAQA 5KKRC 4U0IA 5IA0A 2XK6A 3QQHA 4QMLA 2VNWA 5J8IA 3F66A 5I9XA 4OBPA 3IK3A 4NJ3A 4QP2A 5DRBA 3R30A 4ZZMA 2RSVA 3OWPA 4EL9A 5ANDA 5CF4A 4Z7HA 3IECA 1QL6A 3MVMA 3TACA 4F7SA 1A9UA 1NT2A 4NW5A 2IVTA 5CT0A 3NUNA 3TUDA 3H0YA 1Q8YA 3FLWA 3LE6A 5HE1A 4EQUA 4TYEA 3PA3A 3FQEA 1Z5MA 4E7WA 2GPHA 3FKLA 1OUKA 3E64A 4YMJA 2ZB1A 1UA2A 4EH6A 1H00A 3BLQA 5HIBA 4B99A 3R7EA 1YRPA 2ZAZA 3L9LA 4LG4A 3WILA 4FEVA 1KE6A 5LVMA 3MH0A 3A61A 5L4QA 4RSSA 4O81A 2OIBA 2HXQA 4YSJA 2RFSA 5HD7A 1O9UA 2VN9A 4ACCA 4J99A 5A46A 5CF5A 3FLYA 3DFAA 2PZIA 5ANJA 1KE5A 4CTCA 3BYMA 4D1ZA 5C01A 3R8PA 3VC4A 2R3LA 4EH3A 4NH1A 2QR7A 3KB7A 3LHJA 4TYGA 4RQVA 4F7LA 2QHMA 2OICA 4ZZNA 4DG2E 3HMMA 3AC2A 4FL3A 4KA3A 3I81A 3PWDA 3NYNA 3BYSA 4XV2A 5E1SA 3MFSA 4O0VA 2PE0A 3LFSA 4JS8A 5HO8A 3G33A 4EK6A 1CDKA 4XS2A 3TM0A 1B39A 3OWJA 1Q62A 3Q9YA 3FXWA 5GHVA 2CNVA 5EQPA 5I3OA 4FSTA 5L6OA 3EKKA 1H8FA 2F49A 4FV1A 3VS5A 1NY3A 4AWIA 2VWZA 5K0KA 5M07A 3KXHA 3NW6A 2B4SB 2J0LA 3NIZA 4GT3A 5CU4A 4D9UA 2BR1A 4Q2AA 4WHZA 5E8XA 4K18A 5CX9A 2XRUA 3WZJA 2VGOA 3QTIA 3AC1A 4AUAA 3IKAA 4CZUA 1R0PA 1RQQA 2IO6A 5I5ZA 1FVTA 3MBLA 2P3GX 4P5ZA 4R77A 4RT7A 4DEIA 5CWZA 2XBJA 4RIWB 4PL5A 4IVAA 3NUXA 4FKQA 3WF5A 3P86A 4IAAA 3TV7A 3OBGA 5CZIA 4ONAA 3THBA 4BIEA 2BRHA 3RHKA 3D9VA 5D9HA 3U9NA 2VD5A 1F3MC 1L8TA 3CTJA 4L9IA 5J95A 3R8UA 3W16A 2CNUA 1R39A 4FL1A 5TKDA 3M2WA 3MY0A 1WZYA 4FSUA 3UNJA 4D9TA 5FWKK 3A7GA 5AA8A 3KF4A 4O22A 1W0XC 3OY3A 4QYEA 4U79A 3JS2A 4W4YA 5AM7A 5KHWA 4KD1A 1BMKA 4AP7A 4XX9A 2XF0A 4D2VA 3LCTA 4IFCA 5AV4A 5EI8A 4ANSA 4IX4A 4EYMA 4FGRA 1OMWA 1REKA 4RVMA 3WF8A 4CG9A 3HKOA 4BDCA 3RBWA 3OBJA 3FDNA 3GVUA 3OXZA 4EUTA 2OLCA 2HWOA 4XMOA 5EYMA 4WT6A 2QQ7A 2XNGA 3G2FA 3WYYA 4E1ZA 2GDOA 5DLSA 1G5SA 5A14A 5CQWA 1STCE 4F70A 1PKDA 4LUDA 2IW8A 2W5AA 1OL6A 2BAQA 5FXRA 2VV9A 3RPSA 4AE6A 4NJDA 2R3JA 2WQNA 3JR1A 2W1CA 4IM3A 3EQRA 3F3TA 3OWLA 1WMKA 1GJOA 4PL3A 3T9IA 4DEDA 2CLQA 3MSSA 3OW4A 2Q83A 1BKXA 2Y0AA 2BUJA 2GHGA 3FLSA 4DC2A 4G1WA 2PVLA 3AC8A 4QP4A 4M7IA 2QOLA 3V8TA 2PUNA 2W5BA 3BYUA 4HZRA 4CVAA 2ONLC 4ID7A 1Q8WA 3UMWA 4OGRA 1PY5A 1MQBA 4JQEA 3Q60A 5HE3A 3WZEA 3ALOA 2HENA 4O0XA 4DT8A 2KTYA 3BQCA 5BX0A 4FT9A 3R1NA 4FF8A 4PX6A 5HG5A 3V5PA 1M17A 5AIKA 4CEGA 3U55A 4UYAA 4QTAA 1UV5A 4YGAA 2WMTA 2YJRA 3H9FA 4GVAA 4PPBA 5IA1A 4FV0A 4H58A 2C69A 5AUTA 4ANNA 3E87A 3PIZA 3VS2A 3LLAA 2WD1A 3MA6A 5E8UA 4DITA 3OCGA 2X81A 2J0KA 3OUKA 1VYZA 2C1BA 2R3KA 2ONLA 4YTIA 3TZ8A 5ETIA 4AGUA 4BCIA 4BGQA 1GIIA 4CT1A 3VVHA 2BILB 4FKPA 1UU3A 3SXSA 4UX9A 3OW3A 3DV3A 3RTPA 4DH3A 2OGVA 2F57A 2J9MA 4FKOA 4USFA 3ZC6A 4NW6A 4BDKA 3DBQA 2RF9A 2BTRA 3T3VA 4AN2A 2C0TA 4YJSA 4YHFA 2RFNA 2WTWA 2B9IA 3EWHA 5E91A 4EOPA 5HU9A 3KRJA 1IAJA 1CMKE 2CKEA 5GIOE 2RFDA 3PG3A 4QRCA 4BIDA 2BAJA 3U8WA 4CFNA 2W99B 4C2VA 3QC9A 3DZQA 4EKKA 3LFQA 5KCVA 4QPSA 4NEUA 5HX8A 5HTCA 2FSOX 2O63A 1KWPA 2I40A 3FSKA 5E4HA 1H1RA 3L9NA 4X3FB 5IQHA 2QG5A 1OIYA 2FGIA 2YISA 3EZRA 3MWUA 3PVWA 2YM3A 1NVSA 5D10A 3EQGA 3TDWA 4UXLA 2QU5A 5E7RA 2ZM4A 3I6UA 4OTWA 1XH8A 4J8MA 4PMTA 4RX7A 4QNAA 2E9UA 3KGAA 4WKQA 5DMZA 3HZTA 1OVEA 1YDRE 3E3BX 3EHAA 2ITWA 3VULA 3R9NA 4EORA 3SOCA 3FLQA 2CKPA 4KSPA 4C62A 3Q04A 3UQCA 1Y6BA 4AF3A 3FQHA 3LCOA 2ZV8A 5ANEA 4GSBA 4OTQA 4ZAUA 4U41A 3H3CA 1YI3A 3EYHA 3GOPA 4IM0A 3WIGA 2UZNA 5IH4A 5IQCA 5ANOA 2IZRA 3O7LB 4BBMA 4ASZA 5KMIA 3S00A 5LCKA 4TYIA 5DHJA 4BWPA 3N4UA 3ZUUA 4C4GA 4QO9A 2R0UA 3V8SA 5HE0A 2W1IA 1M52A 2ITQA 4XOYA 4YJVA 2B54A 4HYIA 2EXEA 4RMZA 5CNNA 3UOJA 1QPJA 4O21A 3AGLA 4XH6A 5EHOA 3SA0A 4FSQA 3ZO2A 3CTQA 4G17A 4BBEA 1RJBA 3QKKA 3E8EA 4RC4A 3C0GA 4QYYA 4B4LA 4C38A 4C34A 1JVPP 1L3RE 2W1FA 4ZMEA 2CGUA 3QUDA 2YM8A 5ACBC 3HMPA 3LW0A 3W55A 3C0HA 3FMLA 1BL7A 3DKOA 3F69A 3SVVA 2YCRA 3QYWA 4KNBA 2A2AA 3ODYX 3Q96A 5GJDA 3P7CA 3QZHA 4MKCA 4YBKA 1YKRA 3WF6A 3QA0A 4IB5A 4MK0A 4EOLA 3PJ8A 3ANRA 2UW9A 2OJ9A 4B8LA 4XV1A 2PHKA 4NIFB 5AUUA 3UVRA 2OH4A 4WBBB 4WNKA 4H39A 4CKRA 3SX9A 3UPZA 3I0OA 1JSTA 3BHUA 2XNMA 2XKFA 5IMXA 3O8TA 1QPEA 3F3WA 4KSQA 4BTMA 4M68A 4PMMA 3A2CA 4I5PA 3OTVA 5FM3A 3FL5A 3EFLA 4OBQA 3FC2A 2NPQA 4P90A 4QPAA 3DKGA 2WAJA 5IDPA 3FYJX 4G5PA 3VAPA 4ZSLA 3JVRA 4V05A 4DBXA 3D83A 3C5IA 2QKRA 3K5VA 4FTUA 5JRSA 4KS8A 5DN3A 4BCFA 4I4FA 4DBNA 4C59A 3JPVA 3OUNB 3PPJA 1GNGA 2J5FA 3B8QA 3C1XA 4GIHA 3WZKA 4F4PA 2PZ5A 2W96B 5LARA 2ZDUA 4TL0A 4C4EA 4XG4A 4L7FA 3O8UA 2JDTA 4RVLA 2PVNA 3P78A 3NDMA 4HVGA 1KE9A 5L2QA 3PFQA 2GS7A 4KABA 5AFVA 2ERZE 4FG9A 4WNOA 4V04A 3SQQA 2XCKA 5HVJA 2IWIA 1H1SA 3GT8A 5ANKA 4CMTA 4QYFA 3ZSHA 2Z7LA 2JD5A 3CQUA 5GJFA 3ZRMA 3P7AA 3EOCA 4CV8A 4XV3A 4R7IA 2PMNX 3I6WA 3NUPA 3VS3A 4DINA 5FTOA 4GFGA 4ZY6A 1R78A 3COIA 5A6OA 4ASEA 2PMLX 4CFWA 4RC3A 2HW6A 2WTVA 3NYOA 5FEQA 1UNGA 4G3CA 5BVKA 4HGTA 2XKCA 1HCKA 4QTCA 2HCKA 2W1DA 5FLFA 3RP9A 3W2QA 4DTKA 4RX5A 4R7BA 3MB6A 4YP8A 2C6EA 3O71A 3EN6A 3T9TA 4YO4A 1BLXA 2W5HA 3ORIA 5HCZA 2R3OA 4AA0A 4D1SA 4J53A 3R83A 3TJCA 3IQ7A 3HV7A 4DCEA 3CCNA 1E1XA 4YSMA 4BYJA 2B1PA 2CLXA 3NRMA 4Y85A 3BU6A 2PU8A 1SYKA 2QLUA 3B2TA 3OF0A 2VTLA 4FEQA 2WTKB 4QP1A 4JL9A 2Z60A 1ZY5A 4NYEA 4F1MA 3DB8A 3VNTA 5EK7A 2R2PA 1RDQE 4FSRA 2CDZA 4FTTA 1GZ8A 4L3JA 4IE9A 4O82A 1PXNA 4DH1A 3I1AA 4ZJVA 5IQAA 2R3PA 2OXXA 1EH4A 5IA2A 4EHGA 5A4QA 3A4PA 1JOWB 2A4LA 3KXMA 4QMSA 3F3VA 1LR4A 2ACXA 4AACA 2IVSA 4KIKB 3NNUA 1XH5A 4O7WA 2GTNA 3BHYA 3DQWA 4Y83A 2C5OA 4DG3E 2PMIA 3RK9A 4FC0A 2X9EA 3H0ZA 3UE4A 4AFEA 1R3CA 3LXNA 2WQEA 1PMVA 3HUBA 4W4WA 1YXTA 2H34A 3E88A 4G5JA 4X2KA 5LWNA 4I23A 4W8DA 3NAYA 3U4UA 3OMVA 4GJ3A 4UY9A 5J87A 1ZYSA 4YO6A 4ACHA 5IUGA 2XM8A 2YERA 3HV6A 3EN9A 3W1FA 1J3HA 4HGSA 3CKXA 4MAOA 4FKUA 3ZS5A 2P2HA 4AGDA 1XH4A 4O7LA 4YJQA 3NW5A 3U6JA 3ZEPA 3V5TA 4K1BA 2LAVA 4UN0C 5FP6A 2W06A 4GK4A 5CAOA 5FTQA 4C36A 4YZBA 4I92A 4FTQA 3HLLA 4YTFA 3OROA 1Q41A 3IW4A 4F6UA 4ITHA 3MPAA 3ORZA 2JAMA 5CEKA 3SKCA 3H4JA 2WTKC 4O84A 2XEYA 4PDOA 3H30A 4DEEA 2WXVA 3E8CA 3QCXA 4FKSA 4WRGA 4K33A 3RJCA 3VUHA 3WBLA 2YAKA 4H3BA 4QMWA 4BGHA 2QVSE 5K9IA 3HDNA 1SMHA 4GKHA 4II5A 1FMKA 2F2UA 4V0GA 2YIRA 3OVVA 5HIDA 1VJYA 5CYIA 3ZXZA 1PW2A 5CT7A 4RVKA 3W18A 2I0YA 4GYIA 4EK5A 5CNOA 4GH2A 5DNRA 5C8KA 1U5RA 4BCOA 1YW2A 4EBVA 5HLNA 4JG7A 2X2MA 5A4LA 2W05A 3V01A 2QO9A 3DAKA 3EMGA 3PSBA 5EQEA 5IQIA 1K3AA 2GU8A 2O64A 4FTKA 5AP7A 3RPRA 4KIQA 1OL2A 3KXXA 5HHWA 5CEQA 3W8LA 2R3QA 3HX4A 4AN3A 2JLDA 3QGWA 3AOXA 2CCIA 3P0MA 4DG0E 2OIQA 2UW3A 1QPCA 2R7IA 2VWVA 4YHJA 5BVEA 3ZBXA 4FSNA 4OBOA 4R3PA 1B38A 3PE1A 3PRFA 3CQWA 3FQSA 3TEIA 3LMHA 1ZLTA 5GZ9A 2V55A 4ENYA 4ITIA 3RZBA 2C5VA 2XIZA 2PVMA 4E4XA 3L8VA 3LFBA 4PNKA 5T3QA 4FIHA 4JDKA 5IPJA 5JZJA 1PYXA 1PXIA 3GUBA 4HOKA 3OXIA 4PF4A 3W2CA 3BV2A 3PY3A 4EOMA 1G8SA 2AC5A 4FTIA 2Y9QA 1PKGA 3ANQA 2JFLA 2JKKA 3Q52A 4FKLA 4XG6A 4S34A 4F1TA 5L2TA 3D5UA 2FH9A 3TT0A 5E1EA 3P4KA 1XBBA 2PZYA 2HW7A 1APME 4XG2A 1UVRA 2C30A 3KN6A 4FT0A 5HICA 1OIRA 4TZRA 2UZLA 4A07A 3LOKA 3CKWA 3HMIA 2HZ0A 1ND4A 3GBZA 3G51A 2C6DA 4WBOA 3KK8A 4FYNA 5EYKA 3EQPA 2JKQA 5CSVA 3MH2A 5E9EA 3DDPA 4NK9A 2YIWA 4W9XA 4XG7A 3A4OX 5CI6A 1H08A 2W1GA 2YAAA 3QTQA 2QO7A 2XMYA 3SRVB 3VJNA 1ZOEA 4JR7A 4UYNA 4D58A 2R3MA 1JQHA 3RZFA 3ZRLA 1Q97A 2CSNA 3QF9A 4CG8A 3PIYA 4ALWA 4AT5A 4MNEA 5AMNA 2BDWA 4M67A 3SHEA 4KS7A 3C5UA 5DYJA 4K0YA 1CM8A 4LV5A 2C5XA 3A8XA 3KMMA 3PE2A 3OG7A 3DPKA 5DR6A 4E4LA 3MVLA 5EM7A 4IWOA 3OTUA 2BDFA 3PPZA 3DK7A 4JBOA 4GS6A 1TQIA 4JIKA 2BVAA 4I24A 1H0VA 3W10A 2XZSA 1FBNA 5FTGA 5EH0A 4M12A 4QP6A 3DJ5A 4EOQA 2YIQA 3GC9A 1J1CA 1GIHA 5M44A 3C4WA 3TKUA 3BPRA 3KKVA 3MB7A 2G2HA 3GFEA 4YJOA 4PRJA 2EUFB 4EZ3A 3CIKA 3UZPA 3U51A 5A4TA 4R1YA 4BZNA 3F7WA 3DCVA 2C3JA 4Y72A 3UZRA 4E5WA 2VO0A 2B53A 4DLJA 4R5SA 4AZTA 2X6DA 2IG7A 4J97A 3QD2B 3VBYA 4N57A 2W0JA 1H26A 3NCGA 3D5VA 1Q99A 5H8EA 3ULIA 1YHWA 4CZYB 2PVRA 3AD5A 4FE2A 2PWLA 5AX9A 3R8LA 4Y95A 3ZUTA 1WVWA 5LJJA 3JY0A 4MTAA 5CLPA 4DEHA 2WKMA 3EB0A 4CCBA 1V0PA 5IA4A 5L8JA 5C03A 4XEYA 2IPXA 1V1KA 5CVFA 3MESA 2C68A 3O96A 2G2FA 3DAEA 2DQ7X 1YWRA 3NNVA 3SW4A 5E8TA 4EUUA 4X21A 3E93A 3FYKX 4BC6A 4QQTA 5HO7A 4G34A 3FZSA 4JG6A 1YXUA 4L01A 3U9CA 3CC6A 1J7LA 3R7GA 2JIVA 3CTHA 1MQ4A 2JDRA 3MYGA 3DB6A 4J7BA 4WSQA 3MIYA 5AR2A 3ZZWA 3DQXA 4IIRA 5L2IA 2QG7A 1PHKA 1Z57A 2YZAA 3C4ZA 4BDJA 4MNFA 3HRCA 4FNYA 3LCKA 4OTFA 3TCPA 5L2SA 3GOKA 4Z9LA 2HWPA 2FVDA 2XIRA 3MGYA 4FA2A 4CTBA 2IZSA 2YM6A 4IB3A 4ACDA 4KKHA 3UPXA 3PJ3A 5FQDC 3OY1A 4FZAB 4BDGA 3F5XA 1H1PA 1O6KA 4YLLA 5BVFA 3BV3A 3OEZA 4QMYA 4TWOA 3ZCLA 3QLFA 5K0XA 1O6YA 3LJ1A 5FGKA 3F5GA 2VO6A 3A62A 3PG1A 3EQIA 3PRIA 5IQBA 2QR8A 5GJGA 5A4EA 3R9HA 2EB3A 3OT3A 2V62A 5K4IA 4PL4A 1OL7A 4HPUE 1CKPA 3PVGA 4O7NA 3BGZA 4JRNA 3M42A 2XNOA 3EJ1A 5M4IA 3BI6A 5JSMA 3PWYA 3C13A 1PMEA 4LGGA 2QOHA 3A7HA 3JYAA 4FKGA 4QTDA 4GMYA 2JBOA 4PY1A 4EOKA 4CFXA 1DI9A 2W9ZB 2W17A 1JSVA 4TPTA 3I79A 2JKMA 3OCSA 5LQFA 3ZU7A 2J0IA 3V5JA 5IEXA 4CYIA 4USDA 4O91A 4L6QA 5BYZA 4NUSA 1GAGA 1XWSA 1YQJA 2B7AA 3FMJA 4JQ8A 4MXYA 1DM2A 1YWVA 2PVFA 4FMQA 1JKTA 3FMEA 4PMPA 3ZH8A 2OFUA 3P7BA 1OPLA 4NSTA 5DGZA 4AZEA 2CKOA 3P9JA 2QOBA 4HNIA 1VZOA 5TE0A 4EONA 3QZFA 4H1JA 3CGOA 3KREA 4QOXA 5A54A 3W33A 3ODZX 3TJDA 1XH6A 4L42A 4MVFA 4TN6A 4ZK5A 2Y4IB 1G8AA 1SM2A 4D2SA 4AFJA 4FIGA 1REJA 2CN5A 1I09A 1TKIA 3OHTA 3Q4TA 3S95A 5BMMA 4KIOA 3UO4A 4BFMA 1URWA 3E5AA 3QQUA 4S31A 4RIXA 5IQDA 4I0TA 3AT2A 1QPDA 4D28A 4N70A 4PDPA 4HVSA 2JFMA 4CSVA 5EYDA 3TN8A 5LVOA 3PA5A 3NW7A 2RKUA 3O2MA 1ZARA 3UODA 2HY81 2VTRA 1M7NA 2I0EA 4WNPA 4AG8A 5I9ZA 2WMWA 2EXCX 5LMBA 2GHLA 5I9UA 1NW1A 4IWPA 1P4FA 4WNMA 3AT3A 2QONA 5AR8A 3AGMA 4IAIA 1E9HA 3CLYA 3D5XA 3F3UA 2CGVA 5GNKA 4KRCA 4DH7A 4O0WA 4ANQA 3MH1A 2WMRA 2OJIA 3I0QA 3IS5A 5ETCA 3TL8A 2J6MA 3IGOA 4JR3A 2ITOA 4W4VA 5D41A 1B6CB 3SXFA 3RAWA 1XJDA 4WO5A 3TTIA 5EHYA 4E93A 2OXDA 3E8DA 4D4VA 4BHNA 3VS4A 4AZVA 4UWYA 2VWYA 3PP1A 3S3IA 3WI6A 2R3RA 4S2ZA 3LXKA 4F6SA 4Q9SA 5EKOA 2C5YA 5BPYA 2WMBA 1KE8A 4IMYA 3CY2A 5E90A 4EC8A 4G9CA 2V7OA 4IACA 4FYOA 3BHTA 4LV8A 4RBLA 4BCHA 3QQGA 2HK5A 5IZFA 4CFUA 4RJ8A 1RE8A 3ROCA 4ALVA 3FAAA 3F7ZA 4F9CA 1WBVA 2PUUA 2XJ0A 4ZS0A 5D1JA 2ITTA 3EIDA 4CCUA 3FC1X 3FY0A 3VS6A 5KZIA 4AXAA 1YXVA 2ITUA 2UVZA 4C3RA 5JH6A 4DEBA 4U5JA 4NCTC 4D2RA 2JC6A 4HVIA 3NIEA 4M69B 4C4FA 3R01A 4RJ5A 3TNPC 5KBRA 3VBQA 4CGAA 4QMTA 3UG1A 3R21A 2UVYA 3PSDA 3LMGA 3CJGA 4HVHA 3GU5A 1XH7A 4JT3A 5CSHA 2UV2A 4DH8A 4ZLYA 3DXPA 4RLLA 3V8WA 2VAGA 3GEQA 3KRWA 4FBXA 5AWMA 4EWQA 2UZOA 4UV0A 3TNQB 5HBJA 4XRJA 4GEOA 5JFVA 2UVXA 2BZIB 4FL2A 4I94A 4H1MA 5C4LA 4NCTA 3RCDA 3KULA 4E20A 3Q5IA 1MRVA 2XYUA 4U7ZA 4GK3A 1H01A 4I5MA 2XK7A 4FV2A 4TRLA 3HAVA 4LI5A 3BIZA 4M13A 3RCJA 5AP4A 3NCZA 4FIEA 4FKRA 4G3GA 4TYJA 5AP2A 4BB4A 3IDBA 3PXKA 4O0RA 1XH9A 1ZYJA 1BX6A 3DBDA 2QNJA 3MTLA 2XRWA 3E7VA 5L8KA 2KULA 4K9YA 4E8AA 4YPSA 3OS3A 4F6WA 1JKKA 2W1EA 2CNQA 4YZDA 2RFEA 1G3NA 3ZLWA 2OZAB 5CALA 5HCXA 3NX8A 4J8NA 4RIYB 4FNXA 4IQ6A 4K2RA 3TNWA 4QQCA 3TZMA 2J0MB 1X8BA 1YWNA 3F2AA 3PXQA 4U6RA 5F95A 2VTQA 1AQ1A 3UTOA 3VHEA 5C8MA 4XP2A 2XNPA 2UZTA 5L6PA 1IR3A 2BHHA 3L8SA 5K5XA 1ERKA 4GJ2A 4OTDA 4C2WA 4YU2A 4U81A 4RRVA 3AXWA 4EK3A 4CLJA 2R7BA 1M2PA 4RFYA 2F7ZE 4RIWA 4EH8A 3BHVA 4RLKA 2W1HA 3KF7A 5BVWA 4EKLA 4E6CA 2ETMA 4UEUA 4FUYA 2WQOA 1IEPA 2X8EA 3GNIB 2UZUE 3BLHA 4AW1A 2C3IB 3LJ0A 3PY1A 4K11A 1VEBA 4G16A 3GU4A 5ICPA 4IX6A 3NR9A 2GNHA 4ZZOA 2WMVA 1KV2A 5CVGA 5BUEA 1OITA 1YI4A 4F08A 3KXGA 3VF9A 5I4NA 3QLGA 2ZJWA 2YJSA 4FTLA 5HBHA 3ORLA 4YZ9A 5H9BA 4LL0A 5DE2A 3R7VA 4CKJA 3LFNA 3I7BA 3ZFYA 3ZC5A 4EQMA 1OKWA 3LMIA 4U44A 1FGIA 3EKNA 2GQRA 2ZM3A 4P7EA 4QYGA 5LMAA 4LRJA 5JT2A 2P2IA 5HVKA 5FRIA 4Z7GA 2PVYA 4Y5HA 4WG4A 4I93A 3CPBA 3FMNA 3FUPA 2W4OA 4E6AA 3R9DA 2I1MA 2WMAA 2NNWB 4O7ZA 2R0IA 3V5QA 3NMUF 4A9SA 3K2LA 2HXLA 5CTPA 2QKWB 2WB8A 3LFAA 3IOKA 1IRKA 4F9YA 1ZYCA 4FSYA 2OF4A 1GIJA 5H8GA 3ORKA 2NO3A 3E7OA 1Y8GA 4BKJA 4RX8A 3P08A 4UALA 3A7FA 2HIWA 4F1OA 3L9PA 4U3ZA 5IMEA 3E3PA 3HGKA 1J7UA 4HCUA 4IZ7A 4ARKA 4BBFA 2PYWA 4QP3A 5LVPA 5AJQA 5E8VA 4YR8A 2PUIA 5DT4A 4ZEGA 4JBQA 2GQGA 4DAWA 5I9YA 4PTEA 4IZAA 3MN3A 3ORMA 5EDQA 2YLEA 3DOGA 5B0XA 4QMPA 2VGPA 3EL8A 3Q4CA 4E4MA 4EOSA 3DLZA 4G2FA 4TYHB 3BELA 4AW5A 4B8MA 2HAKA 3QYZA 3VS0A 3HMNA 5CEIA 3ZOSA 3KFAA 4UWCA 2J4ZA 3IDCA 4XBRA 4GU6A 5DT0A 4ANLA 2VX1A 2SRCA 4DLIA 5AADA 1KOBA 5JN2A 1OL5A 4L7SA 3AC3A 3NEWA 2QOFA 4GW8A 4J95A 3FLZA 3PXYA 4ANOA 2BRMA 4NM5A 4C4JA 4EHZA 1YOLA 3R63A 1Q3WA 5J9YA 4EH7A 2BZHB 3EFJA 3MA3A 3ZO3A 4A7CA 4R3CA 3I5ZA 4Z55A 5EW8A 1SZMA 1M7QA 2UW0A 5G6VA 4FT5A 3FZ1A 3LJ2A 3QX4A 4GVJA 4L52A 3I60A 3DA6A 4U40A 5HU3A 2UW5A 2FYSA 3F6XA 5D7VA 4DGOA 1Z9XA 1J7IA 4MBLA 4XBUA 3S2PA 2R3IA 4X3FC 3GC7A 1K2PA 2ERKA 4IXPA 4QQ5A 1MP8A 2OZOA 3FZOA 4L43A 3BWFA 4OR5A 4D2TA 3GC8A 4MX9A 3Q53A 2GNIA 4IDTA 5GIPE 4B0GA 2X7FA 2BKKA 4YBJA 5D12A 1ZRZA 4EK8A 3BBTB 3FXZA 5HEZA 4C4HA 4NM3A 4FIJA 4RIOA 5J1WA 4LL5A 3G90X 4UMQA 4F09A 2ZM1A 2UZVA 5LVNA 4X3FA 4RWJA 3V6SA 1KE7A 2BIYA 3VIDA 3BYVA 4Z3VA 3UZTA 4RQKA 2WEIA 1WBPA 3TNIA 4ZY5A 4B9DA 2OG8A 3RHXA 4AU8A 2H9VA 4JI9A 3RAHA 5CEOA 4JG8A 3LCSA 2C0OA 2PK9A 4MYGA 3AMBA 4O38A 5FEEA 4P2KA 4BZOA 4F7NA 3RWQA 3DK6A 2OO8X 3LFEA 3PJ2A 3RWPA 3V6RA 1IASA 1GZKA 3W2OA 3UC4A 3D5WA 1ZMVA 5BVNA 4UZHA 3T3UA 2J7TA 4G6NA 4BCKA 3COKA 5GZAA 3C4EA 3HVCA 4ZSGA 1CSNA 5CF8A 4UBAA 1WCCA 4D55A 5IH5A 2RG6A 5CU2A 3KRRA 2YIXA 4NWMA 3ZHPC 2YCFA 1XBCA 4L44A 4XCUA 4DF3A 3U4WA 3IPHA 3COMA 3OCBA 2JEDA 3F9NA 4UXQA 3AD6A 2ESMA 2VTJA 3EQBA 3QWKA 5L3AA 2XJ2A 3SV0A 3M1SA 5IEYA 2A1AB 4JBVA 4XLVA 2YN8A 1XBAA 3R8MA 3HNGA 2PZPA 3UP2A 2WTJA 3SDJA 2V0DA 5EYCA 4F65A 4HW7A 5M4CA 3MTFA 2CN8A 3PZEA 3QX2A 3RALA 3IOPA 5AP5A 3L9MA 4AAAA 4WOVA 4A4OA 4C3PA 2BRGA 4ZTLA 1BI7A 3QBNA 3G9NA 4FKTA 4L53A 5B2MA 2XNBA 3WF7A 3R0TA 5HVYA 3ROYA 2X2KA 5CI7A 2XP2A 4F0FA 3PDTA 2JDVA 3FI8A 3PLAE 3R28A 4UMTA 3R9RA 3ENMA 3AC4A 2H6DA 4Y73A 1SVHA 4JDHA 3V51A 4TTHB 2R64A 1H4LA 4BR3A 3UC3A 2FSLX 4PTCA 2A27A 3QL8A 3F82A 1PXOA 2H8HA 3G5DA 3RK5A 4RWKA 5JGDA 5FEDA 4HPTE 3ZM9A 4HCTA 4FK6A 3FV8A 4NIFA 2WGJA 3M11A 4UZDA 3SD0A 3W8QA 1WBWA 2BDJA 2RL5A 2C6IA 3P1AA 4MF0A 3PJ1A 4FSZA 3QGYA 4QMZA 2XKDA 2UZBA 1BI8A 2ZMCA 2X39A 4R3RA 5CSWA 4XP3A 2BCJA 3ZUVA 4ZSJA 1CTPE 4NZWB 2R5TA 3QQFA 3QC4A 4DFXE 5BYLA 3R7UA 3LAUA 4YPDA 2VX3A 2ETRA 3UOKA 3FI2A 4FKJA 4MEDA 3SW7A 3HA8A 3F5PA 5CS6A 3AT4A 2CGXA 4C37A 4E5AX 3ETAA 4PQNA 2VWWA 2JDOA 3BX5A 2ZB0A 4C0TA 3IO7A 3F2RA 4AGWA 5BQ0A 5CXZA 3QA8A 3FE3A 3T8OA 4RFZA 3BE9A 4Z16A 2ZYBA 4O0YA 1ZMUA 5C8NA 3K3IA 5HLPA 3D7TB 2OW3A 3DGKA 4EH9A 3CY3A 1ZZ2A 4DTBA 2G15A 4OLIA 1XO2B 5AP3A 1IAHA 4FV4A 4IHPA 2VWUA 1QCFA 3CS9A 2Z2WA 3QRUA 4IJPA 4Y5QA 4BICA 5J7BA 3FHRA 1SVEA 4QQJA 2XNEA 3LQ3A 1PXLA 3DTWA 4RGJA 4NFNA 4BTFA 3IW6A 1W7HA 2BRNA 4EK4A 2UW7A 4FTRA 4JOAA 2QHNA 4GIIA 1DAWA 1ZZLA 2WMQA 3ELJA 3BQRA 3HDMA 4IVBA 2O0UA 4KKGA 3QRTA 5CY3A 4ZP5A 4F99A 4HJOA 3WOWA 3DBCA 1YOJA 4ZXTA 3ZLXA 4FV9A 4E3CA 3BZ3A 4I21A 3SOAA 3MI9A 3HUCA 2CJMA 2WIHA 2RGPA 3IDPA 1R1WA 3QUPA 5AUYA 4XYFA 5LVLA 2R3NA 2XJ1A 4PPCA 4B6LA 3DNEA 1J1BA 4I6HA 2EVAA 5B7VA 3FZTA 3L8XA 4UB7A 4QMOA 3W32A 3ZXTA 4AE9A 2O2UA 5HORA 2YZLA 3FLNC 2IW6A 2W1ZA 4FEXA 3R22A 4LRKA 5H8BA 2VU3A 3FMKA 3OCTA 5IQFA 3SG8A 1NA7A 5HLWA 1UWHA 1P14A 2GNFA 5HNBA 3VBXA 1OKZA 4YNEA 3VUTA 4DN5A 4MQ1A 3AMYA 1JAMA 4YC8A 5T6KA 1PRYA 3A99A 3O0GA 4C61A 3POZA 5M4UA 2QLQA 1U4DA 5CENA 3RM7A 5HTBA 4N6YA 4KB8A 1IA9A 1MUOA 1URCA 4Q9ZA 2BAKA 4X7QA 4YJUA 5DBXA 4M0ZA 4CFVA 2IVVA 3UNZA 2Z02A 2R4BA 4JIAA 3O8PA 3CD8A 3R71A 4YJTA 3GU7A 2FA2A 4N4SA 2P33A 2C47A 4J1RA 4GUEA 5IG1A 4I6QA 4C8BA 5F4NA 4BRXA 4JXFA 4L00A 3BGPA 1S9IA 4KIKA 4XG9A 4AZFA 3UQFA 3ZMMA 3LVPA 3BGQA 1JPAA 3R8VA 3VHKA 2Y6OA 5F20A 3G0FA 4H05A 2XIYA 5KO1A 3TNHA 3IGGA 2WMXA 4A9UA 4S30A 4CYJA 3C4FA 4DHFA 1OIUA 3NWWA 3SLSA 2QO2A 2QOOA 3QTZA 3SC1A 3VUKA 5CXHA 3DFCB 2YCQA 3UYTA 4FVRA 4QP8A 4KKEA 4YTCA 3VJOA 4IVDA 3TWJA 2Z7SA 2ZDTA 3R2YA 5FDXA 3HMOA 4NTSA 3NSZA 3D7ZA 3TV4A 1LP4A 4G3DA 4IC8A 1Q8ZA 3ORTA 4NM0A 4U80A 5EHLA 3VS1A 5HX6A 3MDYA 3II5A 4F63A 4CKIA 4I1ZA 4CT2A 5ANGA 4GU9A 3KU2A 4LMUA 3BHHA 3UBDA 2R3GA 3IONA 2XIXA 3KQ7A 3KVWA 4IAKA 4MBIA 4M97A 2CGWA 4QNYA 4YJPA 4DGGA 4KBAA 5T68A 2XNNA 4CQGA 2QC6A 4CNHA 3KXZA 4RPVA 3RAIA 1H24A 3QCQA 4CMUA 4YURA 1SNXA 4DGNA 2HELA 2YA9A 1BUHA 5CAVA 4CLIA 3GCVA 3QRJA 4WSYA 1YOMA 4RZVA 3IW7A 2HYYA 4FUXA 4AGCA 1WBTA 4D2WA 5GZ8A 3R73A 2BZJA 3VN9A 2PE2A 4QP7A 4ASXA 2QOKA 2X9FA 4FKIA 3FI4A 3QD0A 1U54B 4GT5A 4NTTA 4JDJA 4W8EA 2J5EA 3L8PA 4ZTSA 3VS7A 3OEFX 4MHAA 3VUMA 4O2ZA 3DY7A 1JKSA 5JGAA 5KBQA 4BCNA 4BY9E 1SNUA 2PTKA 3DBFA 1U46A 4P5QA 4PMSA 3AD4A 4FV5A 1DS5A 4ZIMA 3ERKA 4RG0A 2YABA 1YHSA 5KMNA 2PULA 4BYIA 4C58A 5AR3A 2C6OA 2ZVAA 2VTNA 3QD4A 2J51A 4EOOA 5E92A 5E8ZA 4QT1A 3F88A 5TT7A 4ALUA 4DEGA 4FT7A 5AP1A 2WTCA 3LFFA 3UP7A 5IF1A 5ANIA 2F2CB 2B55A 1KV1A 4I20A 5AV0A 3TV6A 4IC7A 2X0GA 4MD8E 5DG5A 3R02A 4NU1A 5JFWA 5AX3A 5GINE 4C3FA 3QQKA 4FG8A 3RPOA 4O6LA 1M2RA 3FHIA 4S32A 4YZCA 3GB2A 3GC0A 4X2FA 4EH2A 2YIYA 4EOIA 4N6ZA 3VBVA 2WIPA 4A9TA 3EN5A 3DKCA 2F9GA 1Y91A 3KCKA 4L3PA 4NT4A 5BMSA 2Y4PA 3PXFA 3UOLA 2RIOA 4KIPA 3HYHA 5ETFA 3VF8A 2A19B 4QMUA 4TXCA 1Y57A 4WRSA 4G9RA 1H28A 4GG5A 3KL8A 4IAFA 4FTJA 2YWVA 3RPYA 2XIKA 3GU8A 3ITZA 3QHWA 2VWXA 3PA4A 1OECA 1OI9A 2OJFE 4I0SA 2J50A 3CPCA 4IX5A 4U8ZA 5M55A 2Z8CA 3DK3A 2E9VA 4ACGA 3CQEA 2VO3A 3OC1A 5J7HA 3TUBA 3V5WA 2GNJA 3HRBA 3PXZA 4AT4A 1PMNA 2AC3A 5DOSA 3EH9A 3OT8A 4LOQA 3ENHA 5KKRB 4RWLA 3FSFA 3C7QA 3DNDA 3R9OA 3UO5A 4ERWA 3EYGA 2ZV2A 2YM4A 2E9NA 2YHVA 4FIFA 2WQBA 3GQLA 4FNWA 2UW6A 4I3ZA 4ZMFA 2XVDA 1Q61A 3G6HA 4A06A 4V01A 3FPMA 4C57A 3AQVA 2W4JA 3C51A 2HOGA 4XG8A 5IU2A 4APPA 4TWCA 4BI2A 3C4CA 4YLKA 4ZJIA 4IM2A 5AV2A 3LXLA 5CEPA 3MVHA 5F1ZA 5TOZA 3FL4A 3FY2A 4YUQA 1ATPE 3MIAA 4R5YA 5AA9A 3K54A 4MCVA 5H2UA 4DT9A 3OFMA 4HGLA 4I41A 1Q8TA 1RW8A 1WBOA 2EWAA 2C4GA 2YDKA 4QTBA 2ZMDA 4QMVA 4O1OA 5C1QB 3C0IA 3D15A 2GFSA 1ZOHA 1H0WA 4X2GA 4PWNA 3Q2JA 5CVHA 2ITVA 2XEZA 3O17A 3ZBFA 3GGFA 3VO3A 5HQ0A 1JSUA 3KA0A 1HOWA 2XK3A 2XBAA 1YVJA 4HYHA 4DYMA 3HAMA 3Q9ZA 3PLSA 4ORKA 5AUWA 4IWQA 2VTOA 1TVOA 4IFGA 5J9ZA 2B9HA 3BRBA 4DFBA 3A7JA 3CBLA 4AS0A 3KK9A 4XV9A 3ID6C 3RVGA 1M2QA 3QWJA 2B52A 4I6FA 4X6RA 4XP0A 3EFWA 1P4OA 4MD9E 3ET7A 4C35A 3VBTA 4KWPA 2JIUA 3G6GA 3LXPA 3WIKA 2C3KA 3G0EA 4FI1A 5TF9A 3DJ6A 4WG5A 4OTGA 5DA3A 3ATSA 3K5UA 4BDAA 3F5UA 3REPA 3FWQA 2FSTX 2QU6A 1YDSE 3TIZA 1GY3A 2X6EA 4BCQA 3LQ5A 5IUIA 4BCPA 2Y6MA 4CRLA 3WF9A 3PUPA 1GZOA 3ZDIA 2XB7A 3KN5A 2OXYA 2EB2A 1UKHA 4AQCA 2R3FA 4M14A 2I0VA 5CZHA 3GP0A 3UVQA 1PMUA 3Q4ZA 3OD6X 4F9AA 2YCSA 1OUYA 3CEKA 5JK3A 3ORNA 3Q9WA 4DTAA 4MXCA 3QQJA 3UGCA 2WU6A 5J9LA 5AR4A 2G1TA 3ZO4A 3HP5A 5KMKA 2XH5A 5I0BA 5HNGA 2XKEA 5JFSA 1F0QA 4OT6A 3DU8A 5FBOA 4XG3A 4ZJJA 2JBPA 3U6IA 4IB1A 4YC6A 3UIXA 4MWIA 4H36A 4ASDA 3KULB 4AOJA 4EZ5A 2QD9A 3DTCA 4O0TA 3NPCA 5CAUA 4BGGA 2Y4IC 4M66A 4S33A 3GENA 4G3FA 3ZO1A 3EQCA 2C3LA 3TUCA 3I7CA 3PXRA 1YHVA 4YJRA 5K5NA 2UZDA 4DEAA 5HCYA 3EQDA 2HZ4A 3LPBA 4FV8A 4E6DA 1IA8A 1VR2A 3LIJA 3R1SA 3ZDUA 5E8SA 4ZLZA 1PF8A 3OOGA 4DCAA 1UU8A 1UU9A 4MH7A 4BHZA 1ZAOA 4WG3A 1YDTE 5KMMA 4F0GA 3VUDA 4D4YA 3G15A 2Z7RA 3DDQA 2EU9A 2IJMA 4G6OA 4EQCA 5CEMA 5IQGA 3QTUA 3R7YA 3N4TA 2V5QA 2E2BA 2PE1A 4FZ7A 2OI4X 4RJ4A 4EC9A 5CF6A 2LGCA 1VYWA 1WBSA 4FSMA 4X2JA 3TZ7A 2IVUA 5DEYA 3E8NA 4C02A 4QTEA 5JGBA 2E9PA 3CE3A 4M15A 4M84A 4OUCA 4YJNA 5HGIA 3QZGA 4B7TA 2BKZA 4QMQA 3I5NA 5AUZA 5KHXA 3UYSA 4FEUA 5BNJA 3UIBA 5JQ8A 3UVPA 5DR9A 4BDEA 3UG2A 3KY2A 1S9JA 1AD5A 5K3YA 1H27A 4AOTA 3RPVA 4ITJA 4DE4A 1W8CA 4LGDA 4MXZA 1FVVA 4PP9A 2YACA 4O0SA 3AMAA 4XRLA 4EH5A 5AAFA 5AM6A 5TO8A 5FBNC 1BL6A 5L6WL 3DJ7A 3EQFA 4OTPA 1JKLA 3NVMB 4FVQA 1YI6A 2ITXA 4RJ6A 3R8ZA 4CZTA 3NAXA 4BKYA 2C6LA 4E5BA 4R7HA 5F94A 2O3PA 3P79A 4L67A 5M06A 4UMPA 1UU7A 2PVHA 2VTAA 3LKMA 3P5KA 2UW4A 1H1QA 3QCSA 5B2KA 5CASA 1H07A 2HY0A 2J90A 5HTIA 4D5HA 5ACKA 3WE4A 2XUUA 4IAYA 4AA5A 3MS9A 4EH4A 3FMMA 3UMXA 3H9OA 2I0HA 2JKOA 4BN1A 3CXWA 5HG8A 5EW9A 4ZTMA 2QOCA 4X0MA 4ZSAA 4AZWA 4OAVB 2GHMA
chains in the Genus database with same CATH superfamily
1JBPE 2G9XA 4H3QA 3QD3A 5DH3A 1O6LA 2O8YA 3MFRA 3RM6A 3P5JC 1KSWA 5IKWA 1G8JA 4AW0A 4EHEA 2WMUA 4JAJA 3BEAA 3BBWA 4XUFA 2OFVA 2JDSA 4RC2A 3OOMA 3TZ9A 4APCA 4Y46A 3JY9A 4M69A 2G2IA 3WARA 5G1XA 1UNLA 4O83A 3DAJA 4JBPA 4E73A 2GNGA 3QALE 3TDVA 4RJ3A 4LOPA 2XK4A 2X0QA 4FG7A 4PUZA 4U3YA 4X2NA 2AUHA 5CQUA 3D94A 3GCSA 4IBMA 5A6NA 4I0RA 4MD7E 1U59A 1HCLA 2WOTA 4JNWA 1NXKA 4C7TA 3QCYA 5EQYA 3K3JA 4I5CA 4PTGA 5EG3A 3WE8A 5DEWA 1UKIA 4BDBA 2H96A 4LFIA 2Y8OA 4FODA 3R7OA 4A4XA 4GL9A 3KC3A 3B2WA 4LM5A 4J71A 3VRYA 3UQGA 3ZLSA 4MBJA 4E26A 4CMOA 1IG1A 2R3HA 3LLTA 2WQMA 4KBKA 4YTHA 2VTPA 3JXWA 4L45A 4DFYA 5J5TA 2WTIA 3QTWA 3W2RA 5CAPA 5KMLA 5C9CA 2I7QA 5A4CA 3U6HA 3H9RA 4LYNA 2WPAA 3FBVA 5HOAA 5HO6A 2VUWA 5I9WA 4GFMA 4WUAA 1XMLA 4KRDA 4ZTQA 2OZAA 2BIKB 3H10A 1W84A 3C4XA 2I6LA 5AP0A 4AN9A 4BF2A 2X4ZA 4RIYA 5JRQA 5IUHA 2ETKA 3TYKA 4QMMA 3TG1A 3ZTXA 4XJ0A 4BWXA 4HGEA 2B0QA 3NZ0A 5IISA 1BYGA 1V0OA 4EBWA 5KUPA 1GZNA 2VO7A 3SAYA 3ACKA 3HL7A 3E63A 2NRUA 1P5EA 2V7AA 2P55A 3GXLA 3Q6UA 4BCMA 4KAOA 4ACMA 3A60A 2XANA 4ANBA 3MFTA 5EKNA 4IW0A 2YITA 3NUAA 4OW8A 4BDIA 3ALNA 3CD3A 3GQIA 4O4BB 4IH8A 5EW3A 4D1XA 4D0XA 5AAGA 4PP7A 5K4JA 3PIXA 1Q4LA 3RINA 4FGBA 1CKJA 2HZNA 3QKLA 3FI3A 1AGWA 3O23A 3ZZEA 1OKYA 3VW6A 4BDHA 2PVKA 4RVTA 1YXSA 3FZRA 1Q3DA 4MXXA 4RX9A 3TXOA 4BTKA 2JAVA 3ZLYA 2YDIA 3MV5A 3QQLA 4ERKA 5FUTA 4XHKB 4BI1A 3EN7A 2O5KA 5JFXA 1ZWSA 5CU3A 4EEVA 4RFMA 3TIYA 1OBGA 3HA6A 4L46A 2PUPA 1Q24A 3ZEWA 4NKAA 4D4SA 5DIAA 4JJRA 2OF2A 3NYVA 2C6MA 3BEGA 3BU3A 3AG9A 4BDFA 4WIHA 5FP5A 3R1YA 5AIRA 3ZRKA 2FB8A 3KCFA 3UIMA 1FOTA 4A4LA 2PPQA 1W82A 2BTSA 1YXXA 4QD6A 3FPQA 5HI2A 3QRIA 4G3EA 1WBNA 2PSQA 2Y7JA 5KE0A 3VRZA 5JEBA 4ANMA 3WYXA 4HVDA 2P4IA 5J5SA 3FEGA 4QYHA 3MJ2A 4IADA 3MH3A 4QPMA 1GOLA 1PXMA 5HG9A 3UDBA 4F64A 4U97A 2WO6A 2OSCA 4QMXA 5DT3A 5EFQA 4R8QA 4J96A 3QKMA 2GTMA 4WD5A 4FEWA 5M57A 4TWPA 4AZSA 5C4KA 3ATTA 4GK2A 3PZHA 4FR4A 5FG8A 4OTHA 1A48A 4GUBA 4FTNA 1WVXA 3ACJA 4A9RA 4EI4A 3KRLA 3NFFB 2VTMA 5AV1A 4FKVA 3B8RA 4BDDA 4O0UA 4O7YA 3FZPA 3KIOC 2VTHA 3LFDA 4F7JA 1A06A 5D11A 4G6LA 3QTRA 3NUYA 3OP5A 4TYHA 4BCJA 1W83A 3HEGA 4GYGA 5CSXA 4BZDA 4TNDA 3W2SA 5HE2A 1ZYDA 2C1AA 2JGZA 4DA5A 1WFCA 3ZYAA 3LCDA 4CRSA 5EDPA 2DYLA 2VTIA 4PDYA 4H3PA 4WA9A 3SG9A 2YDJA 2BZKB 3FJQE 4PDSA 3C50A 3RI1A 4C4IA 5BUJA 2XK9A 3DLSA 4USEA 5KMOA 3KRXA 3KVXA 2PY3A 4IAZA 4M8TA 3P23A 4ENXA 3NVKI 2XYNA 4BCGA 4O27B 3CP9A 5L2WA 4F78A 4GV1A 4DFLA 1XHAA 2X2LA 3QHRA 5ETAA 3EQHA 3F61A 4IB0A 2X4FA 4AX8A 5CSPA 1F5QA 2GS6A 2GQSA 2ZV7A 3LM5A 4TKSA 3KMWA 4CV9A 1CKIA 4FK3A 3DKFA 1W98A 3E92A 4FICA 4PNIA 1FPUA 1Y6AA 2OH0E 4MWHA 5H3QA 3VUIA 3QU0A 2WU7A 3EN4A 1J91A 2QODA 4F0IA 2VTTA 4RWIA 1FQ1B 4UMUA 5D7AA 4EJ7A 2QURA 5A3XA 3BE2A 3QXOA 2J0JA 3PY0A 5HKMA 5LXMA 4QMNA 5LWMA 3WZDA 2GS2A 3KEXA 3S1HA 4GKIA 4R78A 3Q32A 2ZV9A 3UOHA 4GG7A 1ZY4A 4JVGA 2W4KA 4ZTNA 1Q8UA 2ZOQA 3IW8A 3CSVA 3VW8A 2XARA 5M53A 3QTSA 5DWRA 2ITNA 4IZ5A 3GU6A 4E6QA 4X3JA 2DWBA 5DRDA 4AOIA 1SVGA 4LQMA 5AR7A 3EZVA 2YEXA 4HYUA 4L8MA 3V5LA 3R00A 5AUVA 1P2AA 3QZIA 3F2NA 3MJ1A 5M51A 3Q4UA 2F7EE 3GCUA 2BPMA 4KBCA 1OZ1A 3MY1A 1ZMWA 3LZBA 4O4CA 2B9FA 1I44A 2WOUA 4FNZA 4FZ6A 4KINA 4FSWA 4V0GB 1K9AA 4BVUA 4ZOGA 5DI1A 2Z7QA 4F9BA 2PL0A 3HRFA 2GCDA 4HCVA 3DXQA 4O86A 4O7SA 2C5NA 4EZ7A 2VNYA 5JKGA 2YM7A 5LCJA 3AC5A 1FGKA 5HD4A 2YLFA 3O7LD 3U87A 4I22A 5J79A 4O2PA 4O7RA 3NNXA 2E9OA 4JLCA 4K6ZA 4FTCA 3BWJA 4JX7A 3UO6A 1ZYLA 1LEZA 3GI3A 4UWBA 1OL1A 2OKRA 4FT3A 5J1VA 3I4BA 3LQ8A 4BI0A 1FMOE 5IA3A 2C0IA 4ZLOA 1M14A 1NVQA 5AV3A 3SXRA 5IH6A 1KUTA 3ZSGA 2VX0A 3MFUA 2PZRA 4QP9A 4EOJA 2CPKE 3MPMA 2XS0A 4Q5HA 3BKBA 3NUSA 3RAKA 1JLUE 5AAEA 2QOQA 4GFOA 4BIBA 1OPJA 3NS9A 1ZXEA 3ORXA 4PV0A 2WELA 4FX3A 4C33A 2CKQA 2CHLA 4BTJA 3R1QA 4O96A 3CJFA 3G9LX 3HP2A 4FTMA 2BHEA 1XR1A 2A98A 2WMSA 4IEBA 4M3QA 5EI2A 3TKHA 3ZM4A 4IWDA 3O50A 4J52A 5IEVA 1OGUA 3MW1A 3ULZA 3D14A 1T45A 2B9JA 3DT1A 4U45A 2BROA 4FIIA 1PXKA 4K77A 4R1VA 5KZ0A 5KNJA 4FRFA 5AR5A 2NP8A 3QAME 5IDNA 3QUEA 5C27A 2YFXA 5FDPA 2ITYA 2C6TA 4MNEB 4BWKA 5HNIX 4O4FA 5E8YA 1Y8YA 3OWKA 1OB3A 2X8IA 3QTXA 2W7XA 2HZIA 4DGLC 3QRKA 5CU6A 3RNYA 5JMSA 3RNIA 3CR0A 1PXPA 4MF1A 3LFCA 3PVBA 5EM5A 1ZOGA 5IQEA 3EL7A 3PJCA 4IANA 4NFMA 4E4NA 3OXTA 4M0YA 2VRXA 1PYEA 3PVUA 3UJGA 4HNFA 2QOIA 4FV3A 4TWNA 1UWJA 3Q6WA 4XOZA 4ZSEA 4FV6A 4GCJA 4FZFB 3GCQA 5DVRA 2XK8A 3NUUA 4O6EA 1E1VA 2PVJA 3RGFA 2F4JA 2W9FB 3D7TA 4O4DA 4OAUC 3W0OA 4OT5A 3BU5A 5DFPA 3U54A 5DPVA 3ZONA 4DH5A 2UW8A 2BALA 3RKBA 4MXAA 1LPUA 4FOCA 3V04A 3JUHA 2A0CX 4NKSA 2QI8A 4JDIA 2CCHA 1WVYA 1Q5KA 2Q0BA 4Y8DA 4P4CA 3RMFA 4CXAA 4CQEA 3F3ZA 3ZSIA 4L3LA 4OTIA 4LRMA 2ITZA 2DS1A 3CGFA 4O7TA 3DZOA 2GMXA 3COHA 5EM6A 2WEVA 2REIA 4HYSA 4NL0A 3VWAA 3ZFMA 3S0OA 4FTOA 2QCSA 4LGHA 5JZNA 2P0CA 3TTJA 1OM1A 4RZWA 3VQHA 3D2KA 1TQPA 2NRYA 4ZS4A 1LEWA 4I6BA 1ST0A 3BLRA 2FSMX 1OPKA 4TY1A 1OKVA 2RG5A 3VQUA 3FMHA 1LUFA 3RK7A 2XM9A 2WHBA 3UNKA 2X8DA 3FKOA 4LUEA 3E62A 2BFXA 3D0EA 1KOAA 2UZEA 3OZ6A 4DFUA 2X7OA 3HECA 3D2IA 4A9YA 1NVRA 3MY5A 3R2BA 3TI1A 4FV7A 2XCHA 4AW2A 5BYYA 2FO0A 4IZYA 2AYPA 3BCEA 2DUVA 4PPAA 4YC3A 1DI8A 4D0WA 4RA4A 4D4RA 4DFNA 4CFMA 4ZTRA 4ZY4A 5A9UA 2C6KA 1PXJA 3PPKA 4FVPA 1OBDA 1XQZA 3NYXA 2BMCA 4JAIA 4U9AA 3C9WA 3R7IA 2WFYA 4YNOA 5FD2A 5M08A 1H25A 4JRVA 4XNEA 4D5KA 4EJNA 4YZNA 4GT4A 3MVJA 5AUXA 4RA5A 2GFCA 4U43A 5B2LA 3GCPA 3N9XA 5I9VA 2GNLA 2OU7A 5M09A 3FMDA 1UNHA 3QXPA 4JQ7A 3IG7A 5I3RA 3GFWA 4G31A 5KMJA 2BRBA 3D4QA 5KX8A 4IJ9A 1OIQA 2CMWA 2UZWE 1R0EA 1FINA 3WZUA 5BVOA 4X6QC 4YHTA 3ORPA 4Q5EA 2V22A 3LM0A 4LMNA 4AA4A 2F7XE 4I4EA 4KUJA 4W4XA 2VTSA 3POOA 2OK1A 2FUMA 2R9SA 4GRBA 4L68A 2IW9A 1H1WA 2IN6A 3TKIA 4BL1A 4DHJA 3HV3A 4LOOA 3L1SA 4NM7A 4TNBA 3ZFXA 3S4QA 3Q9XA 5LMKC 5HBEA 4IDVA 4W9WA 3UIUA 3KMUA 3Q5ZA 2Q0NA 1MRUA 3FKNA 3PSCA 4IVCA 4R6VA 4WUNA 3SRVA 5DR2A 5L8LA 4HZSA 2OWBA 3QFVA 3DXNA 5EOLA 3JVSA 3PTGA 3O51A 2JITA 4DFZE 2WTDA 2WZJA 3R6XA 4AT3A 3HV4A 1WAKA 3HV5A 4J98A 5AP6A 3VBWA 2IZUA 3BYOA 2VZ6A 5LOHA 2EXMA 3Q2MA 1MRYA 4YLJA 4YZMA 3DS6A 4OTRA 4MUQA 3KXNA 3R04A 4LV7A 3PP0A 2X1NA 4EWHA 1JWHA 3NLBA 1JNKA 4FOBA 5LMKA 2OJGA 4FTAA 4I5HA 5FXSA 2XA4A 3VUGA 5CU0A 2JIIA 2PMOX 5M56A 4O7VA 5EOBA 1U54A 2UUEA 2VWIA 5E8WA 5FM2A 5F9EA 1FVRA 5AEPA 2WNTA 3NNWA 4O1PA 5C26A 4RIXB 3Q3BA 3A8WA 1TFFA 4F9WA 4FKWA 4IX3A 1U5QA 3A7IA 5JQ5A 4N0SA 5EM8A 5HG7A 3DBEA 1DAYA 3IW5A 4D2PA 2OBJA 2X7GA 2GSFA 2OJJA 3PYYA 4U42A 3SGCA 4EHVA 5M4FA 2YWPA 3EFKA 4K8AA 4UMRA 3N4VA 5CANA 4BKZA 1TQMA 3MPTA 4MQ2A 2VWBA 4TT7A 5ITAA 2O65A 5EI6A 4MXOA 1XKKA 3V3VA 1QMZA 4ZTHA 5HESA 2OIDA 3NGAA 5BUIA 5HIEA 5HZNA 3BLAA 2IZTA 4JX3A 4XLIA 4TW9A 1T46A 4CFFA 4FZDB 2G01A 2BFYA 4CD0A 1PJKA 4DGMA 4EYJA 5FXQA 5IA5A 3FXXA 5EDRA 1V0BA 2YM5A 3AKKA 5BVDA 2ITPA 3N51A 3W2PA 3AKJA 5TR6A 2J2IB 4RJ7A 5CAQA 5KKRC 4U0IA 5IA0A 2XK6A 3QQHA 4QMLA 2VNWA 5J8IA 3F66A 5I9XA 4OBPA 3IK3A 4NJ3A 4QP2A 5DRBA 3R30A 4ZZMA 2RSVA 3OWPA 4EL9A 5ANDA 5CF4A 4Z7HA 3IECA 1QL6A 2X0OA 3MVMA 3TACA 1A9UA 4F7SA 1NT2A 4NW5A 2IVTA 5CT0A 3NUNA 3TUDA 3H0YA 1Q8YA 3FLWA 3LE6A 5HE1A 4EQUA 4TYEA 3PA3A 3FQEA 1Z5MA 4E7WA 2GPHA 3FKLA 1OUKA 3E64A 4YMJA 2ZB1A 1UA2A 4EH6A 1H00A 3BLQA 5HIBA 4B99A 3R7EA 1YRPA 2ZAZA 3L9LA 4LG4A 3WILA 4FEVA 1KE6A 5LVMA 3MH0A 3A61A 5L4QA 4RSSA 4O81A 2OIBA 2HXQA 4YSJA 2RFSA 5HD7A 1O9UA 2VN9A 4ACCA 4J99A 5A46A 5CF5A 3FLYA 3DFAA 2PZIA 5ANJA 1KE5A 4CTCA 3BYMA 4D1ZA 5C01A 3BL7A 3R8PA 3VC4A 2R3LA 4EH3A 4NH1A 2QR7A 3KB7A 3LHJA 4TYGA 4RQVA 4F7LA 2QHMA 2OICA 4ZZNA 4DG2E 3HMMA 3AC2A 4FL3A 3O5AA 4KA3A 3I81A 3PWDA 3NYNA 3BYSA 4XV2A 5E1SA 3MFSA 4O0VA 2PE0A 3LFSA 4JS8A 5HO8A 3G33A 4EK6A 1CDKA 4XS2A 3TM0A 1B39A 3OWJA 1Q62A 3Q9YA 3FXWA 5GHVA 2CNVA 5EQPA 5I3OA 4FSTA 5L6OA 3EKKA 1H8FA 2F49A 4FV1A 3VS5A 1NY3A 4AWIA 2VWZA 5K0KA 4DHIB 5M07A 3KXHA 3NW6A 2B4SB 2J0LA 3NIZA 4GT3A 5CU4A 4D9UA 2IEWA 2BR1A 4Q2AA 4WHZA 5E8XA 4K18A 5CX9A 2XRUA 3WZJA 2VGOA 3QTIA 3AC1A 4AUAA 3IKAA 4CZUA 1R0PA 1RQQA 2IO6A 5I5ZA 1FVTA 3MBLA 2P3GX 4P5ZA 4R77A 4RT7A 4DEIA 5CWZA 2XBJA 4RIWB 4PL5A 4IVAA 3NUXA 4FKQA 3WF5A 3P86A 4IAAA 3TV7A 3OBGA 5CZIA 4ONAA 3THBA 4BIEA 2BRHA 3RHKA 3D9VA 5D9HA 3U9NA 2VD5A 1F3MC 1L8TA 3CTJA 4L9IA 5J95A 3R8UA 3PFYA 3W16A 2CNUA 1R39A 4FL1A 5TKDA 3M2WA 3MY0A 1WZYA 4FSUA 3UNJA 4D9TA 5FWKK 4BJJA 3A7GA 5AA8A 3KF4A 4O22A 1W0XC 3OY3A 4QYEA 4U79A 3JS2A 4W4YA 5AM7A 5KHWA 4KD1A 1BMKA 4AP7A 4XX9A 2XF0A 4D2VA 3LCTA 4IFCA 5AV4A 5EI8A 4ANSA 4IX4A 4EYMA 4FGRA 1OMWA 1REKA 4RVMA 3WF8A 4CG9A 3HKOA 4BDCA 3RBWA 3OBJA 3FDNA 3GVUA 3OXZA 4EUTA 2OLCA 2HWOA 4XMOA 5EYMA 4WT6A 2QQ7A 2XNGA 3G2FA 3WYYA 4E1ZA 2GDOA 5DLSA 1G5SA 5A14A 5CQWA 1STCE 4F70A 1PKDA 4LUDA 2IW8A 2W5AA 1OL6A 2BAQA 5FXRA 2VV9A 3RPSA 4AE6A 4NJDA 2R3JA 2WQNA 3JR1A 2W1CA 4IM3A 3EQRA 3F3TA 3OWLA 1WMKA 1GJOA 4PL3A 3T9IA 4DEDA 2CLQA 3MSSA 3OW4A 2Q83A 1BKXA 2Y0AA 2BUJA 2GHGA 3FLSA 4DC2A 4G1WA 2PVLA 3AC8A 4QP4A 4M7IA 2QOLA 4AXEA 3V8TA 2PUNA 2W5BA 3BYUA 4HZRA 4CVAA 2ONLC 4ID7A 1Q8WA 3UMWA 4OGRA 1PY5A 1MQBA 4JQEA 3Q60A 5HE3A 3WZEA 3ALOA 2HENA 4O0XA 4DT8A 2KTYA 3BQCA 5BX0A 4FT9A 3R1NA 4FF8A 4PX6A 5HG5A 3V5PA 1M17A 5AIKA 4CEGA 3U55A 4UYAA 4QTAA 1UV5A 4YGAA 2WMTA 2YJRA 3H9FA 4GVAA 4PPBA 5IA1A 4FV0A 4H58A 2C69A 5AUTA 4ANNA 3E87A 3PIZA 3VS2A 3LLAA 2WD1A 3MA6A 5E8UA 4DITA 3OCGA 2X81A 2J0KA 3OUKA 1VYZA 2C1BA 2R3KA 2ONLA 4YTIA 3TZ8A 5ETIA 4AGUA 4BCIA 4BGQA 1GIIA 4CT1A 3VVHA 2BILB 4FKPA 1UU3A 3SXSA 4UX9A 3OW3A 3DV3A 3RTPA 4DH3A 2OGVA 2F57A 2J9MA 4FKOA 4USFA 3ZC6A 4NW6A 4BDKA 3DBQA 2RF9A 2BTRA 3T3VA 4AN2A 2C0TA 4YJSA 4YHFA 2RFNA 2WTWA 2B9IA 3EWHA 5E91A 4EOPA 5HU9A 3KRJA 1IAJA 1CMKE 2CKEA 5GIOE 2RFDA 3PG3A 4QRCA 4BIDA 2BAJA 3U8WA 4CFNA 2W99B 4C2VA 3QC9A 3DZQA 4EKKA 3LFQA 5KCVA 4QPSA 4NEUA 5HX8A 5HTCA 2FSOX 4ZMFA 2O63A 1KWPA 2I40A 3FSKA 5E4HA 1H1RA 3L9NA 4X3FB 5IQHA 2QG5A 1OIYA 2FGIA 2YISA 3EZRA 3MWUA 3PVWA 2YM3A 1NVSA 5D10A 3EQGA 3TDWA 4UXLA 2QU5A 5E7RA 2ZM4A 3I6UA 4OTWA 1XH8A 4J8MA 4PMTA 4RX7A 4QNAA 2E9UA 3KGAA 4WKQA 5DMZA 3HZTA 1OVEA 1YDRE 3E3BX 3EHAA 2ITWA 3VULA 3R9NA 4EORA 3SOCA 3FLQA 2CKPA 4KSPA 4C62A 3Q04A 3UQCA 1Y6BA 4AF3A 3FQHA 3LCOA 2ZV8A 5ANEA 4GSBA 4OTQA 4ZAUA 4U41A 3H3CA 1YI3A 3EYHA 3GOPA 4IM0A 3WIGA 2UZNA 5IH4A 5IQCA 5ANOA 2IZRA 3O7LB 4BBMA 4ASZA 5KMIA 3S00A 5LCKA 4TYIA 5DHJA 4BWPA 3N4UA 3ZUUA 4C4GA 4QO9A 2R0UA 3V8SA 5HE0A 2W1IA 1M52A 2ITQA 4XOYA 4YJVA 2B54A 4HYIA 2EXEA 4RMZA 5CNNA 3UOJA 1QPJA 4O21A 3AGLA 4XH6A 5EHOA 3SA0A 4FSQA 3ZO2A 3CTQA 4G17A 4BBEA 1RJBA 3QKKA 3E8EA 4RC4A 3C0GA 4QYYA 4B4LA 4C38A 4C34A 1JVPP 1L3RE 2W1FA 4ZMEA 2CGUA 3QUDA 2YM8A 5ACBC 3HMPA 3LW0A 3W55A 3C0HA 3FMLA 1BL7A 3DKOA 3F69A 3SVVA 4AXCA 2YCRA 3QYWA 4KNBA 2A2AA 3ODYX 3Q96A 5GJDA 3P7CA 3QZHA 3W0MA 4MKCA 4YBKA 1YKRA 3WF6A 3QA0A 4IB5A 4MK0A 4EOLA 3PJ8A 3ANRA 2UW9A 2OJ9A 4B8LA 4XV1A 2PHKA 4NIFB 5AUUA 3UVRA 2OH4A 4WBBB 4WNKA 4H39A 4CKRA 3SX9A 3UPZA 3I0OA 1JSTA 3BHUA 2XNMA 2XKFA 5IMXA 3W0RA 3O8TA 1QPEA 3F3WA 4KSQA 4BTMA 4M68A 4PMMA 3A2CA 4I5PA 3OTVA 5FM3A 3FL5A 3EFLA 4OBQA 3FC2A 2NPQA 4P90A 4QPAA 3DKGA 2WAJA 5IDPA 3FYJX 4G5PA 3VAPA 4ZSLA 3JVRA 4V05A 4DBXA 3D83A 3C5IA 2QKRA 3K5VA 4FTUA 5JRSA 4KS8A 5DN3A 4BCFA 4I4FA 4DBNA 4C59A 3JPVA 3OUNB 3PPJA 1GNGA 2J5FA 3B8QA 3C1XA 4GIHA 3WZKA 4F4PA 2PZ5A 2W96B 5LARA 2ZDUA 4TL0A 4C4EA 4XG4A 4L7FA 3O8UA 2JDTA 4RVLA 2PVNA 3P78A 3NDMA 4HVGA 1KE9A 5L2QA 3PFQA 2GS7A 4KABA 5AFVA 2ERZE 4FG9A 4WNOA 4V04A 3SQQA 2XCKA 5HVJA 2IWIA 1H1SA 3GT8A 5ANKA 4CMTA 4QYFA 3ZSHA 2Z7LA 2JD5A 3CQUA 5GJFA 3ZRMA 3P7AA 3EOCA 4CV8A 4XV3A 4R7IA 2PMNX 3I6WA 3NUPA 2XALA 3VS3A 4DINA 5FTOA 4GFGA 4ZY6A 1R78A 3COIA 5A6OA 4ASEA 2PMLX 4CFWA 4RC3A 2HW6A 2WTVA 3NYOA 5FEQA 1UNGA 4G3CA 5BVKA 4HGTA 2XKCA 1HCKA 4QTCA 2HCKA 2W1DA 5FLFA 3RP9A 3W2QA 4DTKA 4RX5A 4R7BA 3MB6A 4YP8A 2C6EA 3O71A 3EN6A 3T9TA 4I6LA 4YO4A 1BLXA 2W5HA 3ORIA 5HCZA 2R3OA 4AA0A 4D1SA 4J53A 3R83A 3TJCA 3IQ7A 3HV7A 4DCEA 3CCNA 1E1XA 4YSMA 4BYJA 2B1PA 2CLXA 3NRMA 4Y85A 3BU6A 2PU8A 1SYKA 2QLUA 3B2TA 3OF0A 2VTLA 4FEQA 2WTKB 4QP1A 4JL9A 2Z60A 1ZY5A 4NYEA 4F1MA 3DB8A 3VNTA 2IF8A 5EK7A 2R2PA 1RDQE 4FSRA 2CDZA 4FTTA 1GZ8A 4L3JA 4IE9A 4O82A 1PXNA 4DH1A 3I1AA 4ZJVA 5IQAA 2R3PA 2OXXA 1EH4A 5IA2A 4EHGA 5A4QA 3A4PA 1JOWB 2A4LA 3KXMA 4QMSA 3F3VA 1LR4A 2ACXA 4AACA 2IVSA 4KIKB 3NNUA 1XH5A 4O7WA 2GTNA 3BHYA 3DQWA 4Y83A 2C5OA 4DG3E 2PMIA 3RK9A 4FC0A 2X9EA 3H0ZA 3UE4A 4AFEA 1R3CA 3LXNA 2WQEA 1PMVA 3HUBA 4W4WA 1YXTA 2H34A 3E88A 4G5JA 4X2KA 4QDEA 5LWNA 4I23A 4W8DA 3NAYA 3U4UA 3OMVA 4GJ3A 4UY9A 5J87A 1ZYSA 4YO6A 4ACHA 5IUGA 2XM8A 2YERA 3HV6A 3EN9A 3W1FA 1J3HA 4HGSA 3CKXA 4MAOA 4FKUA 3ZS5A 2P2HA 4AGDA 1XH4A 4O7LA 4YJQA 3NW5A 3U6JA 3ZEPA 3V5TA 4K1BA 2LAVA 4UN0C 5FP6A 2W06A 4GK4A 5CAOA 5FTQA 4C36A 4YZBA 4I92A 4FTQA 3HLLA 4YTFA 3OROA 1Q41A 3IW4A 4F6UA 4LDTA 4ITHA 3MPAA 3ORZA 2JAMA 5CEKA 3SKCA 3H4JA 2WTKC 4O84A 2XEYA 4PDOA 3H30A 4DEEA 2WXVA 3E8CA 3QCXA 4FKSA 4WRGA 4K33A 3RJCA 3VUHA 3WBLA 2YAKA 4H3BA 4QMWA 4BGHA 2QVSE 5K9IA 3HDNA 1SMHA 4GKHA 4II5A 1FMKA 2F2UA 4V0GA 2YIRA 3OVVA 5HIDA 1VJYA 5CYIA 3ZXZA 1PW2A 5CT7A 4RVKA 3W18A 2I0YA 4GYIA 4EK5A 5CNOA 4GH2A 5DNRA 3VONA 5C8KA 1U5RA 4BCOA 1YW2A 4EBVA 5HLNA 4JG7A 2X2MA 5A4LA 2W05A 3V01A 2QO9A 3DAKA 3EMGA 3PSBA 5EQEA 5IQIA 1K3AA 2GU8A 2O64A 4FTKA 5AP7A 3RPRA 4KIQA 1OL2A 3KXXA 5HHWA 5CEQA 3W8LA 2R3QA 3HX4A 4AN3A 2JLDA 3QGWA 3AOXA 2CCIA 3P0MA 4DG0E 2OIQA 2UW3A 1QPCA 2R7IA 2VWVA 4YHJA 5BVEA 3ZBXA 4FSNA 4OBOA 4R3PA 1B38A 3PE1A 3PRFA 3CQWA 3FQSA 3TEIA 3LMHA 1ZLTA 5GZ9A 2V55A 4ENYA 4ITIA 3RZBA 2C5VA 2XIZA 2PVMA 4E4XA 3L8VA 3LFBA 4PNKA 5T3QA 4FIHA 4JDKA 5IPJA 5JZJA 1PYXA 1PXIA 3GUBA 4HOKA 3OXIA 4PF4A 3W2CA 3BV2A 3PY3A 4EOMA 1G8SA 2AC5A 4FTIA 2Y9QA 1PKGA 3ANQA 2JFLA 2JKKA 3Q52A 4FKLA 4XG6A 4S34A 4F1TA 5L2TA 3D5UA 2FH9A 3TT0A 5E1EA 3P4KA 1XBBA 2PZYA 2HW7A 1APME 4XG2A 1UVRA 2C30A 3KN6A 4FT0A 5HICA 1OIRA 4TZRA 2UZLA