1I44A

Crystallographic studies of an activation loop mutant of the insulin receptor tyrosine kinase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
298
structure length
282
Chain Sequence
PDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords INSULIN RECEPTOR
publication title Crystallographic and solution studies of an activation loop mutant of the insulin receptor tyrosine kinase: insights into kinase mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 282
sequence length 298
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2001-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1i44A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1i44A01
4BC6A 4M14A 3F82A 5CENA 3P1AA 3ALOA 5GINE 1H1PA 4JBOA 4FC0A 4IIRA 1XH9A 3L9NA 4HCUA 3DBDA 4L9IA 2WMUA 3VS0A 3GI3A 3PTGA 5CU4A 4QMXA 1H1QA 2GNLA 2WU7A 3UMWA 5EM8A 4JAIA 4A9UA 1U54B 3R1YA 4AF3A 5M44A 2XM9A 3QGYA 2C6MA 2R7IA 5TO8A 1B39A 2YM5A 4JR7A 3O8UA 5BPYA 5LWNA 4ASDA 2JLDA 4JRVA 4C37A 4G9CA 5E8SA 5HOAA 2A27A 5CEIA 4NM0A 3MTLA 4IB1A 2V7OA 4EQUA 1CKIA 5E8UA 4DLJA 3DAEA 4ZJJA 1M2PA 4EK4A 2X4ZA 3MFRA 4LM5A 2CLXA 3KMUA 3OCBA 4MXOA 5KZIA 4EZ5A 2G9XA 3FEGA 2PMIA 3DK3A 3ROYA 3TZ9A 3BGQA 4W4YA 3HDNA 3EMGA 5CEKA 3FZOA 1YDTE 5JMSA 2OFUA 2WQOA 4YPSA 4CFVA 3HUBA 1GZOA 3O0GA 4GIIA 3LLTA 3BYSA 1ZZ2A 2ZVAA 1IRKA 5LCJA 5LXMA 5AP1A 5K0KA 4IXPA 4FKTA 4AP7A 2YM7A 3UIBA 4O38A 2GHMA 3PG3A 4W4XA 4C36A 4G17A 3FE3A 1XBCA 2ITQA 3KRRA 3FMHA 5KKRC 4TWOA 1MRUA 3ZXTA 2J5FA 3P08A 3LCSA 4TYIA 4W9XA 3TIZA 1XH6A 2B9FA 1SMHA 3VS5A 5CAPA 1IR3A 2FO0A 4PMPA 4RJ6A 3NVMB 2VX3A 3FZPA 5L2IA 3EWHA 5I5ZA 3V6RA 4S30A 5FEDA 4IM2A 2UW6A 3NVKI 1YWRA 1QL6A 3G51A 2IVUA 4EOLA 3D5XA 4RZWA 5IQEA 3MVLA 4V0GB 5IA4A 2C5VA 2QHNA 4UXQA 1IA9A 2I0EA 3QGWA 2UW4A 4EHVA 1H0WA 4F1MA 3F3UA 4FNZA 4ZZOA 5CEMA 3A2CA 4LOPA 1CM8A 1CKPA 3ODZX 5C9CA 2IWIA 2OH4A 3NAXA 3OZ6A 2JKKA 3EQFA 3SXFA 5JFVA 5EYKA 3NYNA 4HVGA 3U6IA 2F9GA 2OF4A 5AV1A 2VTMA 4ZTNA 3KGAA 1KWPA 1H00A 4ZTSA 4G34A 3WIGA 5EQEA 4Y8DA 3HMNA 3Q04A 3UC3A 2BRNA 4WIHA 4WBBB 4HZSA 4BYJA 2WMBA 4RWLA 2P33A 4YLLA 3I1AA 3WF5A 4A9SA 3F7ZA 4U3YA 5G6VA 1BKXA 4OGRA 2W99B 3ZBFA 4MQ1A 2HYYA 4R3CA 3OT8A 4WRGA 5EHLA 3COMA 3RINA 4O82A 1OIUA 2PU8A 4O81A 3RPRA 4GS6A 4H1MA 1DM2A 1YQJA 4TPTA 4O0RA 4IANA 3UOKA 1I44A 4G6OA 1UU9A 4CSVA 4TYHA 1PXPA 1GZKA 2ITTA 3P7CA 3VBWA 3WZJA 5L6PA 2JAMA 3KKVA 5FDXA 4YZBA 2IVTA 2HELA 2PVNA 3TNIA 3W2CA 4B8LA 2XIYA 2XIRA 3F2NA 3NX8A 3NCZA 5AP5A 4JBQA 2OU7A 4QP4A 3DY7A 5EFQA 4ZJVA 4D5HA 4B6LA 3V8WA 3BHHA 3OBJA 3BX5A 4JVGA 2OKRA 3HRFA 4F6UA 1F3MC 3DA6A 5AX3A 4D2RA 1WZYA 5TR6A 4J7BA 2YIYA 1YKRA 5M55A 2HY0A 3C0HA 1U54A 3ZUVA 2QVSE 2R3MA 3W18A 2Z7RA 3DKOA 5AUVA 2XEYA 3OCTA 5DH3A 4BCGA 1GIHA 4D28A 4U9AA 2BUJA 5IDNA 4C62A 3DQWA 4TRLA 4MF1A 2B52A 4O7TA 4DFBA 3QL8A 4U80A 4FT7A 1YXUA 5KMJA 4HVIA 4JQ8A 1Q3DA 5FXQA 5KMKA 3ODYX 4E1ZA 5LARA 3NUXA 5CEQA 2FH9A 5H8GA 1QPEA 1ZYJA 1ZZLA 2ITYA 2OFVA 2WELA 3BBWA 3HRCA 3LE6A 4GH2A 5CZIA 3OOMA 3C50A 1Q8UA 3PRIA 5T6KA 3CPBA 4G3DA 3E87A 5C26A 4XG9A 2GFSA 2I40A 4FG7A 4BL1A 3TV4A 3D7TB 4KAOA 4EC9A 3CTQA 4JBVA 5AR2A 4YPDA 2R3OA 3UODA 3NS9A 4TTHB 1KV2A 4NWMA 2PTKA 4P2KA 1WVWA 4RWKA 3R83A 3VBXA 3PJ8A 4AAAA 4EYJA 5L2WA 4NSTA 3TM0A 4TYJA 5CF4A 5JH6A 4M3QA 2WIHA 2XA4A 3GBZA 3KL8A 3U87A 4HVSA 1J1CA 4I5CA 2GPHA 2BRMA 3JUHA 4CRLA 4FZ7A 4YZ9A 2E9OA 2UZVA 4BCOA 4E73A 2PWLA 4AZTA 5M4CA 3HA8A 4IHPA 4K18A 3VBVA 4IAZA 3ZTXA 2QD9A 3JXWA 4KIQA 2XK3A 3HYHA 5M57A 2PE2A 2XJ1A 4TNDA 2WMXA 4DF3A 1XKKA 4PWNA 4QQJA 4A9RA 3DDPA 4HPUE 1VJYA 3WF7A 4O7SA 2UZBA 3V3VA 4WHZA 4JDHA 4ALVA 4IMYA 3DDQA 2QOHA 3KC3A 4AT3A 1XBBA 1UNHA 3EQHA 2UVZA 3FV8A 4GT3A 4OBPA 5IEXA 3R7VA 2YM8A 4RJ4A 5ETFA 4OR5A 3L8XA 4LGDA 4X3JA 1A48A 1NVQA 2PYWA 3V04A 5C01A 4FR4A 4AGUA 3NRMA 3UIUA 3UO6A 2IG7A 3R02A 4XG7A 2C6IA 4FE2A 3G15A 3T9TA 4QNAA 5E8ZA 3OBGA 3A99A 3QZGA 3AT2A 1XH5A 4F08A 5HE3A 2IPXA 3ET7A 4BCKA 3TUDA 3L8VA 1J7IA 2AUHA 2B7AA 3IONA 4MXZA 1JPAA 2V22A 2X9FA 4XS2A 4YJSA 5DA3A 5M53A 2W1DA 2YERA 3NLBA 1Q4LA 2R3KA 1A06A 4QMWA 4A4OA 1ZXEA 3UGCA 1CSNA 4H3PA 4IWDA 4NH1A 4DGMA 4HYIA 3DK7A 4XHKB 3TUBA 4YLJA 1K3AA 1Y8GA 4MCVA 4PL3A 3CKXA 2HENA 3UBDA 4F0IA 1YXSA 3KXNA 4XX9A 4RX8A 5IH5A 3UZTA 5DBXA 2ESMA 5CU3A 5CLPA 4UY9A 4QT1A 4HYHA 4AWIA 4AN9A 4EH9A 2X4FA 3ZO4A 2ACXA 2HAKA 3D83A 1PXOA 4RIWA 2W0JA 4HPTE 3NUUA 4NJDA 4QYFA 4Z7GA 5EI8A 3OY1A 4EUUA 1IASA 3R9NA 1HOWA 2X2MA 4YBJA 5F4NA 3ZDUA 4PQNA 1YOJA 4BTFA 1Z9XA 2JGZA 1OIQA 1Q61A 3ENHA 2V62A 4IM0A 3OD6X 3CPCA 1TQIA 3LVPA 4PUZA 3EL7A 2XCHA 4M15A 3SOAA 5F20A 2GU8A 4RMZA 2QLUA 4ZTLA 4LUDA 2UZNA 4CLIA 4WNMA 5A4EA 1PY5A 3EQBA 1BX6A 3GGFA 3RZBA 5JGAA 5KO1A 4O7YA 4CGAA 1P2AA 4L3JA 5D12A 2C5OA 2J6MA 5E1SA 1R1WA 3QAME 2OJGA 4BY9E 4GFMA 1Q5KA 3CCNA 2OJ9A 2X6EA 4LMUA 5H9BA 4RZVA 3FI3A 3KCFA 1OKWA 4EK5A 3D5UA 4F9BA 3QD0A 3DJ6A 2OF2A 3G33A 5AV0A 5I9UA 5IEYA 4FTMA 3AD6A 5HE1A 2C1BA 3QU0A 4MNEB 4LG4A 4ZSAA 2QOKA 3D7TA 4M69B 2XIZA 4RVKA 4GJ2A 4FYOA 5HO6A 5KMOA 3FAAA 3CP9A 4QMVA 4DEHA 1BLXA 2VO3A 3HMOA 4AGWA 2WTKB 5KMIA 1YXVA 1ZRZA 2XS0A 4I24A 4TWPA 5FM3A 5GJGA 4P5ZA 4EH4A 4EOJA 2HZ4A 3BZ3A 4KINA 3A4OX 3VRZA 5D10A 2GQSA 2OI4X 3QD4A 3W8LA 4IC7A 3REPA 5AWMA 4BBMA 1WBVA 3QHRA 3TT0A 3KRLA 4N0SA 5A14A 3QA8A 3R9DA 4RVMA 2O3PA 3ERKA 4OLIA 4FIHA 1FVTA 3ZC5A 4MYGA 2HY81 3OY3A 5I9WA 2QLQA 4BDBA 1TQPA 4TY1A 4U43A 3QRKA 3TCPA 4DE4A 5AUZA 2OZOA 2XJ0A 2C0IA 1V0BA 2E9VA 3QRUA 2VNYA 4M0YA 4U5JA 4U97A 4GFGA 4CTBA 1YDSE 3E62A 3UP2A 4AZVA 4YTFA 5CANA 1G8AA 4AQCA 4QTDA 4Y5QA 4F4PA 2J2IB 3ZYAA 3H10A 2YIRA 4FK3A 2GNIA 3P78A 4FV7A 5GZAA 4MKCA 3LMGA 5M4UA 3E64A 3R28A 3MIAA 2JBPA 1T45A 3BQRA 3F5XA 5H8BA 2CGUA 3VULA 4FVPA 4QTEA 2PZRA 2VTSA 5J1WA 4G2FA 2J0IA 2W9ZB 5JRQA 5J9YA 4EI4A 3RK9A 4DITA 4KA3A 5IEVA 2C3IB 3F5GA 2B9JA 2Z8CA 4XJ0A 3ITZA 4J99A 4Y95A 4TL0A 2C5XA 4WNPA 3EIDA 2F57A 5AAGA 2VGOA 3OF0A 5FGKA 5D7VA 4FZFB 4O1OA 2CCIA 5I3OA 3UZPA 5CF5A 4UX9A 3VNTA 4OTIA 2PPQA 1GAGA 1ZMVA 5KCVA 4ZS4A 1R3CA 2VTJA 5HLNA 2WHBA 3CR0A 4FKUA 3O7LB 2QR7A 2EB3A 5EI6A 2CPKE 3A61A 3LJ0A 1GY3A 2OGVA 2R0IA 4XH6A 4G31A 5GJDA 3OWKA 3TEIA 3UC4A 4W8EA 2JITA 3F3WA 2W1EA 4GMYA 4RC2A 2IW8A 3W2PA 5KBRA 3UQCA 4NK9A 2BFYA 2AYPA 3CGOA 4FV1A 5TOZA 2YIWA 2JIVA 1GZNA 2VO7A 3UNJA 4HGSA 4YHFA 4CV8A 3G0FA 4E4XA 3QTXA 5J5SA 2WTKC 4XUFA 3Q9WA 4MWHA 4GT4A 5HE0A 2GFCA 3OW4A 3R00A 1DI9A 2WMRA 4UZDA 1ND4A 2QI8A 3CKWA 2ETRA 3VF8A 3M2WA 4ASZA 4D4VA 3UVRA 2VAGA 4K11A 3ZXZA 4FKGA 1H26A 3GXLA 4J71A 3PIYA 3HMMA 2H9VA 2ITOA 4MXAA 3PG1A 3ZLWA 2R3GA 3FI2A 2J51A 1V0PA 4A7CA 2ETKA 4YNEA 3V5PA 1O6LA 3GCVA 4NZWB 3VBQA 4M66A 4X21A 4D1SA 4I94A 1H1WA 2YN8A 3IKAA 1U59A 3BU6A 1OZ1A 3F88A 3GU5A 3SW7A 4WD5A 3IS5A 5EG3A 4FEQA 4EH8A 4IWOA 4DG0E 1JSVA 4UV0A 4JS8A 4EWQA 3PPJA 4GIHA 4D5KA 2FVDA 2I0HA 3AGLA 5A3XA 4XRLA 2VGPA 4C57A 2PY3A 1W0XC 4MNEA 4DFLA 2NRYA 4R1VA 2O65A 4DH7A 4M69A 4M12A 1JLUE 4CZTA 3FC1X 4FKRA 3UQGA 4O7RA 4C34A 3HV3A 4O96A 5ACKA 3KN6A 5T3QA 3DOGA 1OBGA 4HJOA 2C3KA 1AD5A 5DR6A 3I79A 3U6JA 4M84A 1U4DA 4H36A 3VO3A 2H8HA 4IAYA 3COIA 4KABA 4PNIA 4RX9A 2E2BA 3EN9A 3AMAA 5HHWA 5HVYA 4RX5A 2DUVA 4YGAA 5IZFA 3R8LA 4PPAA 4FNYA 3IK3A 5EDRA 3LMIA 3CLYA 3TI1A 3MA6A 4YO4A 4FG9A 2A2AA 4XCUA 3QHWA 2JC6A 2FYSA 2ZMDA 4FUXA 4NKSA 2OZAB 2CHLA 3ELJA 4TW9A 5HNGA 3W32A 4C61A 3UOJA 2H34A 3G9NA 3IW8A 4EK3A 2ITNA 4FOBA 3PE1A 3HX4A 1IA8A 2VO6A 2YWPA 2O63A 1PXMA 3SKCA 4AXAA 2Z7QA 2LAVA 5IQCA 4L00A 2F49A 5B7VA 4H1JA 4MX9A 1YOLA 4QTAA 5M51A 5HZNA 3CGFA 4N6YA 3MB7A 3W1FA 4C0TA 4BI2A 5CQWA 3NUPA 5BUEA 4AW0A 3ID6C 4AUAA 1Q99A 3HLLA 1GIJA 4I1ZA 3ZUTA 3OROA 2OJIA 2WQEA 3QC4A 5DNRA 2DQ7X 4KUJA 2PMLX 5LVNA 4LRMA 3OTUA 1Q3WA 2A0CX 3MH1A 4O0VA 5JN2A 3PA3A 2WMTA 3UIXA 2VWUA 3BGPA 3O50A 1UWHA 5E90A 5FTQA 4LFIA 4AACA 5EHYA 4GYGA 2H6DA 4JT3A 2ZAZA 3QUPA 3UE4A 3TUCA 3DKGA 3AC8A 4JIKA 2ZOQA 4F9WA 3BHYA 3DU8A 3R73A 2PZPA 4FIJA 2BIKB 4B99A 3S1HA 4I5PA 1J7LA 1OECA 2IVSA 3Q4ZA 1YOMA 2JDSA 2C3JA 3S2PA 4M97A 3WARA 4YU2A 3TZ8A 3AMBA 3F3VA 3L8PA 4L43A 5L4QA 5C03A 2OBJA 4XEYA 5GJFA 3KXHA 4AA4A 4FEVA 2Y6MA 4RT7A 1UNLA 3C51A 2BHHA 3MGYA 4X0MA 3UOLA 4YZNA 1Y57A 3CY2A 2YISA 4FZ6A 4GCJA 4OTRA 3LPBA 4Q5EA 1LUFA 4F0FA 2J0JA 4KIKB 3N4TA 3W2OA 1STCE 3P7AA 4I5HA 5CT0A 5IQFA 1XHAA 3I6WA 2XH5A 4IAFA 1U5RA 3SW4A 4GJ3A 3JPVA 1YHVA 1UU3A 2FSLX 4LUEA 5BQ0A 5IUGA 5KX8A 3LM0A 1JNKA 3MYGA 3HDMA 5LVMA 3N4VA 2XMYA 4ERWA 5CNOA 4I20A 1B38A 5G1XA 1O9UA 5LCKA 4PMMA 2XIKA 5IA5A 4G3GA 2CDZA 4D4RA 3ZO1A 1I09A 2BAQA 2J0MB 3FLYA 4WKQA 4L67A 3GCUA 4FSQA 2C0OA 3LJ2A 3IDBA 4G6LA 4AA0A 3EQGA 3QD3A 3ZONA 4F1TA 2JDOA 5CQUA 3V8SA 2Q83A 4F9AA 1ZYCA 3QQHA 1PKGA 3QX2A 2CN8A 5HCYA 3WYXA 2WMAA 2CKEA 4CFXA 1REKA 3HA6A 4C4FA 2C6KA 2VX0A 2YJRA 1XJDA 5IUHA 5FLFA 3C4XA 4N6ZA 4MXYA 4EOKA 1DI8A 4IVCA 3TNHA 1P5EA 3R9OA 3E8CA 3PLAE 1ZYSA 4FTUA 4FIGA 4FKWA 4NCTC 1H1RA 1KE7A 5BNJA 2J4ZA 5AUXA 5BUJA 5IMXA 5E7RA 5EYMA 2OZAA 2QODA 4MQ2A 3F66A 5K4IA 3A62A 4YMJA 4ZLZA 1UNGA 2BAJA 2YM6A 2B54A 4NTTA 2XNBA 5AFVA 3PXKA 3EZVA 4RFZA 2IW6A 5EW9A 4LGHA 3G6HA 4TZRA 4YSJA 4N57A 3FZSA 5GHVA 4CT1A 5HBJA 5D1JA 2W5HA 2RFDA 2ZM4A 2PVYA 3GFEA 2DWBA 2VWYA 4PDOA 3UQFA 5I9XA 3RAWA 4Y73A 2W4KA 4BKJA 3TIYA 3OTVA 2VUWA 2IZTA 3QD2B 4M8TA 4PF4A 2X39A 1URWA 4NM5A 4RFMA 3JY0A 2V5QA 4FA2A 2WTJA 2Y4IB 2XNPA 3VUKA 2Y7JA 5CAQA 4F6SA 4JXFA 4BKZA 5DR9A 4BBFA 3AXWA 5DEWA 3EHAA 2JEDA 3R8UA 4EOPA 3H3CA 2PVFA 1RQQA 4EL9A 3GFWA 4EH6A 3P0MA 4QQTA 5B0XA 1JKTA 1ZOEA 3E7VA 3UO4A 3FYJX 4NCTA 4PL4A 1WFCA 5IQDA 2CN5A 5EYCA 3HV4A 4AW5A 3LLAA 1OPJA 3BGZA 3WE8A 5HX8A 4QPMA 3IG7A 3NW5A 4FKJA 3L1SA 4UWCA 4IEBA 2YZLA 2W1ZA 3FMJA 3A4PA 5CAOA 3S95A 2HXQA 3MIYA 4FIIA 2VRXA 4K6ZA 4C38A 5ANEA 4ORKA 3D4QA 3F3ZA 3Q3BA 4Y85A 3FMDA 1PMNA 3L9MA 4J53A 4J97A 1FBNA 3QYZA 2VN9A 2ITVA 3FL5A 3TG1A 3ROCA 2C30A 2JIIA 2ZDTA 1UKIA 4KIKA 4C3FA 4E93A 2W1IA 4PPCA 3WI6A 2J50A 2GHLA 1YI6A 3PSDA 4FV0A 4IFGA 5L8KA 4OTWA 4O2ZA 1JQHA 2GNGA 1M2RA 3OUNB 4K2RA 4WT6A 5F9EA 4JDKA 1OGUA 3FY0A 1S9IA 3QXPA 2R3LA 5JEBA 3DKFA 4GVJA 4FIFA 1VYWA 3KREA 3EFJA 3R8MA 2PVRA 4Y83A 1R0PA 1ZY4A 3RZFA 3WZEA 4AU8A 4BDFA 5I9VA 2LGCA 3QA0A 3BHUA 4B4LA 1Y8YA 3CQUA 3MFSA 2ZJWA 2PVJA 3LXKA 4K1BA 4RWIA 4E7WA 3I4BA 3TACA 3PRFA 4O0SA 5KMLA 2NNWB 2QNJA 2VTIA 5AAEA 4ASEA 3DTWA 1URCA 5HU3A 5K4JA 4O6LA 3H0YA 1W98A 2R3QA 5DT4A 2E9NA 2O5KA 5HICA 1SVGA 3BHTA 3FKLA 3KY2A 4NIFB 4AZWA 4Z3VA 4C4HA 4YJQA 5HKMA 2WQBA 2EB2A 4R6VA 5HBHA 4QMQA 5JGDA 2IJMA 2KULA 2Y4IC 4JG7A 4QP1A 5EQPA 2EXCX 4L45A 4DEDA 4LMNA 2ZDUA 4EHZA 3KVXA 2YFXA 3FMEA 3MBLA 2YA9A 3FPQA 4DH3A 1Q41A 4BI0A 1RJBA 4BHZA 5IDPA 1GOLA 1DAYA 4IBMA 4UALA 3O7LD 1UV5A 4J8MA 5EM6A 2DS1A 2BCJA 2ERKA 4QPAA 4X6QC 3VQUA 3DJ7A 3ZUUA 1EH4A 1LPUA 2X0GA 4J1RA 4CVAA 3TXOA 4H39A 3FMMA 4LGGA 3UIMA 4B0GA 2EXEA 3W55A 4IVDA 3BYMA 4MD8E 2P4IA 3NNVA 3P79A 4MHAA 4IFCA 4OBOA 4CKIA 3O96A 3WOWA 2XYUA 2XBJA 3U51A 3SOCA 3ZRKA 3BU3A 4FNXA 4G9RA 3R2BA 2VTOA 5JFXA 1BL7A 3I60A 5CU2A 4KS7A 4DCAA 1JOWB 3NNXA 1FOTA 3CD3A 2UZWE 4KBAA 2OXYA 4ACGA 5HIBA 4ANOA 3FMLA 4EOSA 4O22A 4FL2A 3RNIA 4O83A 3HMPA 5DYJA 3DCVA 5CXZA 4BCNA 2CSNA 2HZNA 3E8EA 2YAAA 4AW2A 4CFMA 2BILB 4DH5A 3PZEA 3BCEA 3H9OA 5AJQA 4YJTA 1W82A 4KKHA 4EYMA 1YHWA 3S00A 4FT3A 1JAMA 1KUTA 4ZSLA 2GQGA 3ZLSA 3NMUF 1JKLA 3LCTA 4HZRA 3NCGA 4WOVA 3COHA 1ZAOA 4N4SA 1OUKA 3OWPA 5B2MA 1T46A 3KXMA 5E8VA 5EW8A 3NIEA 2Z7SA 1KV1A 1P14A 2JD5A 2B4SB 3IOPA 4LL5A 4BDJA 4AOIA 1OITA 4FL3A 5E8YA 2VWBA 4D1ZA 5L6OA 5EI2A 2BKKA 2J5EA 4OTHA 3SAYA 3GC9A 3Q4UA 3FLNC 3D9VA 3AD5A 3PXZA 3UJGA 3LQ5A 3F3TA 3F61A 2UVYA 4R3PA 4C4JA 2R0UA 3NUNA 4FTKA 1XH7A 2YZAA 3M11A 1PYXA 4TNBA 4BDCA 3RK5A 3GOKA 4ITHA 5AP6A 3PJ2A 3II5A 2W7XA 1YVJA 4ZLOA 3V5WA 4TN6A 2PUPA 4OT6A 2I7QA 4HCTA 3MPMA 3VS2A 4ACHA 3NGAA 3R2YA 4Y5HA 5AR8A 5IH4A 2Y8OA 1SNUA 3FJQE 4HGEA 3DFAA 4ALUA 3GP0A 2UW5A 2BZIB 3RWQA 2C1AA 3TNWA 4BDDA 3GC7A 4JJRA 5HI2A 5H8EA 2XP2A 3KXGA 4YHJA 4IZ5A 4QMTA 1BI7A 2C3LA 4XG2A 1U5QA 2W5BA 3CD8A 4XMOA 4MD9E 3Q52A 4QOXA 4X7QA 4E8AA 2WKMA 3ACJA 3I6UA 1WBWA 3AG9A 3P4KA 4I23A 4TWCA 5DPVA 1PXIA 1TKIA 3KRJA 4NYEA 4HVHA 4NIFA 3PZHA 4XV2A 3UPZA 3UDBA 3BV3A 1OKVA 1Q8WA 2R3JA 5F94A 3LMHA 4AGCA 2A19B 2XKCA 3L9PA 3BYVA 4WG5A 2PUIA 3K3JA 5TF9A 1H08A 3UPXA 2WOUA 3MY1A 4YP8A 3QWKA 4UBAA 2YABA 2WTVA 1XWSA 3PIZA 4IVBA 4YZDA 3AT3A 4TXCA 3FC2A 2Y9QA 4KSQA 4BCHA 4YJRA 4JX7A 2XIXA 1Y6AA 2VU3A 4QO9A 4QP8A 1ZOGA 4Z7HA 2AC5A 2OXDA 1FGKA 3E8DA 3RPVA 5M4IA 3UZRA 3MDYA 3OXZA 2HOGA 4ZS0A 3ZFMA 2JDVA 5BMSA 5DFPA 1OB3A 4P4CA 2G2HA 3OCSA 3VWAA 4BIEA 1FPUA 4C7TA 5HG7A 3ZC6A 4EUTA 4V0GA 4XG6A 3B2TA 2GSFA 3PFQA 2WOTA 2UW9A 3HZTA 4ENXA 4RJ3A 4F9YA 4FTQA 3EL8A 2OG8A 4R5YA 4UMTA 2Z7LA 4KD1A 4FSTA 4ANMA 5HNBA 3RI1A 1UKHA 3R1QA 3U6HA 4J8NA 4Y46A 2XB7A 3C9WA 3R04A 2VZ6A 5AP2A 4BRXA 3POZA 3R8PA 1Z57A 2UV2A 2QQ7A 3ZH8A 4K77A 4FKVA 2W1FA 5ICPA 1WBPA 5DIAA 3F5UA 5JRSA 1H01A 3GB2A 4CTCA 4F99A 4W9WA 3NYVA 3QZHA 3C13A 1ZY5A 4ANQA 4CG9A 4TWNA 4C58A 2HZIA 3KCKA 4FV9A 1G3NA 2YEXA 3LW0A 4NU1A 2I0YA 3ZM4A 2W1CA 4UYAA 4ZOGA 4XP3A 4YURA 3PJ1A 2X7OA 2XVDA 5CTPA 4MF0A 5CI6A 4JG6A 3ANRA 4XV3A 3LM5A 3EYGA 4QYGA 1E1XA 1X8BA 4O0WA 3B2WA 3D5WA 1XBAA 3DBCA 3FXZA 3MVJA 2XK4A 3IGGA 3V5JA 3UMXA 2GNJA 4E6CA 5EKNA 4QMSA 4WUAA 3PY3A 3G5DA 4FOCA 1OL7A 2X8DA 2C69A 2R2PA 1NY3A 1SYKA 3DBQA 5F95A 5J95A 5LVLA 1RE8A 4BDIA 3VUGA 2EU9A 3KF4A 4RIYB 3C4ZA 3B8RA 3NUSA 4GV1A 5JK3A 3ORNA 4PNKA 3R6XA 4EOOA 5K3YA 3SG8A 3BPRA 2UW0A 4GG5A 3SRVB 4RJ5A 3OVVA 4NT4A 4H3BA 3R7EA 1RDQE 3PPKA 4G5JA 3VUHA 4MXXA 3BBTB 4Q9SA 2PUUA 4V05A 2XUUA 2P3GX 4LV5A 1F5QA 5H2UA 5CSXA 2BROA 4IADA 5JZJA 4Q5HA 5CAUA 3I0OA 3V6SA 5EHOA 5CI7A 4MVFA 4C02A 4UEUA 2O2UA 3R7GA 5CASA 4L44A 2UZLA 4BIDA 4X2NA 2GTMA 3LAUA 3R7UA 3RM6A 2XF0A 3V5LA 3PWDA 5E4HA 4ZSGA 1R0EA 5TKDA 4FICA 1NXKA 2IVVA 4FZDB 3LXLA 4X3FB 3RCJA 3E3PA 3QX4A 4C35A 5C8KA 1XQZA 2W1GA 5AR5A 4DHFA 5I3RA 3TDVA 4IAAA 2J0LA 3DB6A 2EVAA 4FIEA 5D9HA 3TJCA 3D0EA 4U81A 3G9LX 4L53A 3HP5A 3ZMMA 4EQCA 3OWLA 2JBOA 3OMVA 5JT2A 3BI6A 3C4FA 3LCDA 5CX9A 2XNGA 4FSUA 2BPMA 2ZV7A 2VWIA 4U6RA 5ETIA 2C0TA 5AM7A 3PPZA 3ENMA 5ACBC 3K54A 3GCQA 4XLVA 3FY2A 5AR4A 3GC8A 3MWUA 2UW8A 5GZ8A 4RLKA 4HNFA 5BX0A 1H28A 4QP3A 5KMMA 3DAKA 3RKBA 2BFXA 2V55A 4TYGA 4YZMA 4KKGA 3BYUA 4ITJA 2XKDA 1XH4A 4G6NA 3AT4A 4L3LA 2VV9A 1BUHA 1PJKA 3ORXA 3OS3A 2ZV9A 3CY3A 4FUYA 3HV7A 4U42A 3HAVA 1OM1A 4YTIA 3FYKX 3FKNA 3R0TA 4AZSA 3JYAA 3O2MA 4XV1A 5AUTA 4IX5A 3W2SA 4GVAA 3PE2A 2X8EA 5IKWA 4F7NA 3KMMA 4DGOA 5CF8A 3GNIB 2R3HA 3FZRA 4PP9A 3DBFA 4NW5A 2BALA 3HP2A 3PSBA 4F09A 2RG6A 2GMXA 4YO6A 4Z55A 2E9PA 2YCQA 4TYEA 2BTRA 3NUYA 1PF8A 3QCXA 3I5NA 1V1KA 3EN6A 3MPTA 3ZLXA 2QG5A 5J7BA 3W10A 1FMKA 3ZSGA 2RGPA 3OOGA 4CFNA 3NZ0A 5A54A 5IA0A 4TT7A 4G5PA 3MB6A 3AMYA 4YR8A 4RG0A 5M56A 3HV5A 1JSTA 1Z5MA 3SX9A 3NYXA 1MUOA 1OL2A 2WQMA 4XP2A 4CEGA 3SG9A 3MVMA 1NA7A 3AOXA 4O1PA 2XYNA 3BHVA 4X3FC 4IB3A 5DR2A 3ZZWA 5FP6A 2GHGA 2JDTA 4DBXA 1OKZA 4CCUA 3C4CA 3EFKA 4XOYA 2ZMCA 2GDOA 3R7OA 2WEIA 3RGFA 2O0UA 4FTCA 2OJFE 2QR8A 4EBWA 4KRDA 3MSSA 1OIYA 2J0KA 5EDQA 4APCA 3BE2A 3FL4A 4QMPA 2WNTA 1V0OA 3NSZA 3EQRA 1ERKA 2XEZA 4RIYA 1YWNA 2P55A 5BYYA 4UMPA 4XBRA 1UU7A 3SRVA 4QMNA 1AQ1A 4IJPA 1REJA 4HNIA 1IEPA 3WBLA 2WTDA 4AW1A 5BYZA 3L9LA 3QQLA 2FUMA 3DBEA 4I6HA 4KRCA 5L2QA 3NR9A 5LVOA 1WBSA 3ZRLA 5DRDA 3F2RA 3PDTA 5HG5A 3NW7A 4ZMEA 2R3NA 1L8TA 5C4KA 1PXJA 2RFSA 1IG1A 3DB8A 2R3PA 3VF9A 4PDYA 4JR3A 4USDA 3IQ7A 3DGKA 5BVWA 4GT5A 4R7IA 3BKBA 3NWWA 1R39A 4HGLA 3UNKA 3HGKA 4FTRA 4IH8A 4CZYB 4E4LA 3UP7A 3UOHA 2QOLA 3RBWA 3BLQA 3IECA 3W16A 2CKQA 3FQHA 3U9NA 3Q2JA 3BU5A 1M17A 4D2WA 3KA0A 3FXXA 4X3FA 3SXRA 5KUPA 3RWPA 4NM3A 5ANKA 5AP4A 5JZNA 4BZNA 4F7SA 3N4UA 3UVPA 4MH7A 5A4TA 3N51A 3ULIA 1MRVA 1U46A 3PIXA 3KEXA 3FHIA 3NAYA 4FGRA 2FSOX 3GCSA 3PY0A 4Q9ZA 4HOKA 2VWVA 4CT2A 4EOQA 1ZMUA 3R7IA 2XK8A 3BWFA 4AA5A 4CXAA 1YXTA 4U79A 3WE4A 3SVVA 4FMQA 4FSZA 4L6QA 2QG7A 4W4WA 1M7NA 5IU2A 4FVQA 1DAWA 2X6DA 3F2AA 3MS9A 4ZZNA 3W33A 3PJCA 2C5YA 2IZUA 1JWHA 1GZ8A 1FVRA 2B55A 3R8VA 2QOCA 3NW6A 4W4VA 2X9EA 5E8WA 3SGCA 4I0SA 5CSPA 2F7EE 2XRUA 4BICA 2OK1A 2DYLA 3FSKA 3O8PA 2WMQA 4AE9A 5DG5A 3BQCA 2OW3A 3RAHA 2YIQA 3TJDA 4EEVA 2YCFA 2BRHA 4X6RA 3KN5A 2V7AA 2XRWA 3C5UA 2ERZE 4NKAA 3GCPA 4GKHA 2CNUA 1OBDA 4NEUA 4YLKA 5F1ZA 5E1EA 2Z02A 2C6OA 2X2KA 4UMRA 5IF1A 5FTGA 2XCKA 3DZQA 3EN5A 3R8ZA 3G90X 5E8TA 5L6WL 2R3RA 3B8QA 3PYYA 2GCDA 3PWYA 2XJ2A 3A8XA 3POOA 5IPJA 5DWRA 4MBIA 3VHEA 4O7LA 4DGNA 4GUBA 4HW7A 1SZMA 1JBPE 4GU9A 4OAUC 1WVYA 2YM3A 3R7YA 4BWXA 1AGWA 3FDNA 1FMOE 3CBLA 2XBAA 4JRNA 4ONAA 3FBVA 4Y72A 5FWKK 2C68A 2GS7A 3QLFA 3PLSA 2X8IA 4CCBA 4CMOA 4FSNA 4ZAUA 4GUEA 4FTLA 4EH5A 2P2IA 1NVSA 3CQEA 3E3BX 4BCJA 4GG7A 3ZCLA 1WBNA 4EC8A 2UZTA 3CJGA 2ONLA 4DH1A 3Q9YA 3MESA 3VQHA 2Q0BA 3QTQA 2X81A 3AQVA 5CU0A 4J52A 4G1WA 2HWPA 5BMMA 4PPBA 5DVRA 2WTCA 4XG3A 4D0XA 4WNOA 5AP3A 2ZV2A 3QFVA 1PMEA 4JI9A 3TKIA 5CT7A 4APPA 4OT5A 4FSRA 2VTRA 4P90A 4RA4A 4ZP5A 4H05A 4EZ7A 5LOHA 5IISA 4YJVA 3ULZA 3V8TA 4FL1A 5M07A 4WNKA 2GQRA 2IZSA 5I4NA 3EKKA 3IW6A 5HBEA 1WBTA 3H9FA 3QWJA 3MI9A 3LCOA 2I6LA 3A7JA 1FVVA 4O0TA 4QP6A 4MBJA 5ANJA 4CRSA 5FUTA 3MH3A 3D2IA 1LEZA 4EONA 4OTGA 5EW3A 4I93A 3QQUA 4MAOA 1PYEA 3OCGA 3FZ1A 4IAKA 3QUDA 4J96A 4II5A 4HVDA 5K9IA 3VUIA 3ZLYA 3TKUA 4BWPA 4F63A 4M13A 1ZYLA 3UYSA 3ZHPC 4NJ3A 4O7NA 2QCSA 3DK6A 3ORIA 3ORMA 4BYIA 4CMUA 1XO2B 1HCLA 2A1AB 2PVMA 3QXOA 4C33A 4N70A 4U44A 4V04A 3RJCA 3HL7A 4IAIA 5JGBA 5M09A 3ALNA 1DS5A 2VNWA 2FSMX 3OWJA 1CKJA 3AGMA 3P9JA 3Q4CA 1KE5A 1MP8A 5CSVA 5HEZA 4IQ6A 4FVRA 3THBA 2G2IA 4BDHA 4F65A 3NUAA 3TN8A 1PMVA 3CE3A 3KB7A 2XKFA 4FTAA 4WUNA 4GRBA 2F2UA 2XKEA 4O27B 4QTCA 5L8JA 3ATTA 4I92A 3Q96A 4USEA 2PMNX 4WG4A 2F2CB 3P7BA 3DXQA 4QYHA 1M52A 1XH8A 4RVTA 2W1HA 1KOAA 3PXYA 3MN3A 4Z9LA 5D7AA 3OEFX 5EQYA 1ZOHA 1BMKA 3S4QA 1BL6A 4I6QA 4FTJA 4R1YA 3QCYA 5HG8A 3SLSA 3PY1A 4FT5A 4O91A 2BIYA 3IGOA 3V51A 1KE9A 4DFNA 4IZYA 4QPSA 4D1XA 4BTKA 4A06A 5M06A 2QU6A 5ETAA 4FV8A 5AV4A 2F4JA 5C1QB 3Q5IA 2R64A 3E7OA 3RCDA 4F1OA 3TDWA 3UTOA 4RBLA 4HYUA 2YJSA 3BYOA 3O8TA 2VTTA 5FXRA 4FV2A 3I81A 4I4EA 3VS4A 2G2FA 2PMOX 3MH2A 5A4CA 4LOOA 4E4NA 4ID7A 5JFWA 3EFLA 4EJ7A 3IW7A 1JKKA 2W17A 3OFMA 3TV6A 2Q0NA 1P4FA 1BI8A 4EKKA 4D55A 4GEOA 4RIXB 3S0OA 4RGJA 3UO5A 3RVGA 2RSVA 4BGGA 2OXXA 4RQKA 4ZMFA 4I22A 4JOAA 3GQLA 4KSPA 4RJ7A 2BVAA 3FLSA 4ANLA 4R78A 3BIZA 3MJ2A 1YW2A 4DFUA 3SQQA 3QRJA 3Q6WA 1ZWSA 3AC4A 3IO7A 1J91A 2VTLA 2XK9A 3MY0A 3RPOA 4ACCA 4PP7A 2CNVA 4L7FA 2OO8X 3QZIA 4BZDA 4BDAA 1CDKA 2BTSA 5KKRB 3IPHA 3KU2A 3A7HA 3DXNA 4MNFA 4IX4A 1CMKE 5HVKA 4XYFA 2B9HA 3R21A 3F69A 5KHXA 1YHSA 3TNPC 2J9MA 1OKYA 4PTCA 4BTJA 3HV6A 4JDIA 4FNWA 2UZEA 3LFCA 3T3UA 4D9UA 3GU8A 4Q2AA 2WIPA 3QKKA 4O7VA 3NNUA 4QQCA 3OHTA 2SRCA 4OW8A 4IZ7A 3VW6A 3WYYA 5J79A 3PJ3A 2PE0A 2BMCA 4OTPA 5JKGA 3EOCA 5AA9A 4AOJA 3ORPA 3ZEPA 5HO8A 4R7BA 4YHTA 4AX8A 5K5XA 1QCFA 3R63A 3R22A 3BRBA 4G16A 4EOIA 3MTFA 2ZV8A 3LIJA 3P86A 1APME 2IO6A 2NP8A 4NL0A 5HIDA 5LJJA 5IQIA 2IZRA 2X1NA 3TTJA 4E5BA 3MFTA 3RTPA 2PL0A 3PVWA 4D2PA 4O0UA 1QPDA 4EK6A 5IH6A 1Y6BA 3QYWA 5J1VA 2UW3A 4BCMA 2W4OA 4QNYA 2VTHA 2QO9A 1PXNA 4FKSA 3KVWA 5FD2A 3VBTA 4A4LA 4L46A 1A9UA 1M7QA 2C5NA 2QO2A 4PRJA 5CEPA 2B9IA 5HD4A 2WQNA 3QALE 4F9CA 1KE6A 3HRBA 2GNHA 2JKMA 5KZ0A 4DYMA 5HIEA 2W96B 3AC5A 2F7XE 2CNQA 3MA3A 4ALWA 4I4FA 4RRVA 4CFFA 5L3AA 4J98A 4U3ZA 4IX6A 4S34A 4EORA 3ZDIA 3MV5A 4RFYA 2CKOA 4V01A 4A9TA 2CLQA 4S2ZA 1UVRA 3RHXA 4FV3A 4KIOA 5KE0A 3RK7A 3VUDA 5DT3A 4DEBA 3QZFA 5EM5A 4CZUA 4O0YA 4RC3A 4D0WA 3LXNA 4I0RA 4QP7A 4ANSA 5GIPE 4KS8A 4FTTA 4CYIA 2RF9A 4DCEA 4RWJA 4DFXE 3IDPA 3V5TA 2AC3A 2FB8A 4IC8A 2WU6A 3ZS5A 2RFEA 2QOBA 4QMYA 3OXIA 4XP0A 3WZDA 4BHNA 4AG8A 4DBNA 4EOMA 1B6CB 1QMZA 4IWQA 3TWJA 2XK6A 3ZRMA 4KBCA 3LFBA 5JSMA 5CNNA 1R78A 3VBYA 4MBLA 4U8ZA 4G3FA 3LQ3A 4ZY6A 3S3IA 3TV7A 5EOLA 1L3RE 3GOPA 5DRBA 3Q5ZA 2ZB1A 3H30A 4AT4A 3O17A 5FQDC 4OAVB 3IOKA 2HW6A 1PW2A 3MVHA 2OSCA 3Q2MA 3RAIA 3GU6A 4RIXA 2WPAA 4GL9A 4AZFA 4I21A 5CALA 3PVBA 4BCPA 3LCKA 4W8DA 2NRUA 5TE0A 4FEWA 4IDTA 5LMKC 3FLWA 4J95A 3CTHA 1W84A 4IX3A 2CGVA 3KULB 4FV4A 3IDCA 3WZKA 4BN1A 4FTNA 5AV2A 4NTSA 3JVRA 2ZM3A 2C6TA 4ZSJA 2ITXA 3D94A 1H27A 1ZYDA 3IW5A 3JY9A 4IB5A 3R1SA 4BB4A 4E6AA 5M08A 4I41A 4NW6A 5AP0A 1VR2A 2PVHA 2RFNA 5E92A 3FMKA 4IJ9A 5LWMA 1KSWA 4YJPA 2CKPA 3BV2A 4Z16A 1J7UA 1JSUA 4IE9A 4BR3A 3K5UA 4BVUA 3DLZA 5FBOA 4UXLA 5FM2A 2WAJA 3QCSA 5IA1A 4FI1A 4JL9A 2BRBA 2BDJA 5DHJA 4RIOA 4BI1A 2BR1A 3ETAA 4UZHA 4O7ZA 1H25A 5A6NA 3EKNA 4IDVA 5HO7A 4LOQA 2WTIA 4RIWB 5EDPA 2YIXA 5DT0A 4BTMA 3ANQA 2GS2A 3DS6A 4U41A 4BDKA 5AADA 2C4GA 3I7CA 4YBKA 2VO0A 3K2LA 4CKJA 4IVAA 3MY5A 2CGXA 3MJ1A 5EH0A 4AT5A 5LMKA 3F9NA 2YDIA 3EQIA 1OL6A 3VUTA 2FSTX 4AZEA 5CSHA 4DTBA 3U4UA 5IA3A 2E9UA 3HNGA 2BDWA 2BZJA 5HLWA 5CF6A 3ZM9A 1Q62A 4BFMA 3U55A 5CS6A 5D11A 3TL8A 5LQFA 4F70A 4JBPA 3EN7A 3ZSIA 2WGJA 2R9SA 3GT8A 5C4LA 4ZSEA 3ZO2A 1LEWA 4JQEA 3W2RA 3NIZA 3ACKA 2XZSA 4BF2A 2IW9A 2QURA 2R3FA 4BIBA 2QOQA 4R8QA 3A7FA 4JAJA 4ZTMA 2YWVA 4K0YA 5IG1A 3FWQA 2X7FA 4PY1A 2G01A 3D15A 3DKCA 3UG1A 4YJOA 2QONA 3OP5A 3F5PA 5DGZA 3F7WA 3Q9ZA 5EK7A 3DZOA 5KNJA 3DQXA 4DT9A 3N9XA 1ZMWA 4FG8A 4WO5A 4ZXTA 2YACA 4ENYA 5IUIA 2HW7A 5LVPA 2KTYA 5CVFA 1MQ4A 3DNEA 1JVPP 3QUEA 3VS7A 5HNIX 4PX6A 5DE2A 5CEOA 4MWIA 2ZYBA 4XOZA 2R4BA 3E88A 3LXPA 5C8MA 3RALA 3CSVA 3NPCA 3I7BA 1OPLA 3LOKA 2GNFA 2P2HA 3EQPA 3MPAA 3NNWA 4DEAA 4L8MA 4B8MA 1MRYA 1S9JA 3BEGA 3KRWA 4K33A 1OMWA 3HKOA 4L7SA 5J7HA 3CJFA 3C5IA 4JDJA 4LYNA 5ANIA 2F7ZE 1G8SA 3FHRA 4AN2A 4BDEA 3A7GA 5BVDA 2XNOA 5I9ZA 2VTNA 4UWBA 4FZAB 2OIDA 4D4SA 5HTBA 5KMNA 4OTQA 4CG8A 4F7LA 1YWVA 1ZARA 2BRGA 2CJMA 3A8WA 5BVEA 3G6GA 4UYNA 3A7IA 3WZUA 3TZ7A 2WZJA 3LFSA 4I6FA 5CSWA 1WBOA 2IN6A 2QOOA 3R1NA 1M14A 2XNNA 3KULA 2P0CA 5J87A 3CIKA 3Q4TA 4RX7A 5AAFA 4DFZE 3HAMA 2JKOA 1H0VA 4QMLA 4LL0A 5HG9A 3UYTA 4M0ZA 4WRSA 3VAPA 4MD7E 5C27A 3FSFA 4FK6A 4FT0A 5DLSA 3QC9A 3QQFA 1RW8A 4ZJIA 4DGLC 5GNKA 2QKRA 3E92A 5CYIA 2QU5A 4ANNA 2YITA 2OLCA 2JDRA 4FKIA 2WMVA 1NT2A 5ANGA 3NDMA 5CY3A 4JIAA 4BZOA 3RM7A 4DEEA 2EUFB 4L52A 2EWAA 2I1MA 4NUSA 2ZB0A 5FDPA 4RPVA 1G5SA 2GS6A 5IA2A 3BE9A 3EYHA 3DPKA 3VJOA 4YUQA 3EB0A 3ZOSA 4K8AA 4DINA 4E5WA 4EKLA 1K9AA 1OL1A 1Q8TA 3CXWA 4I3ZA 4U0IA 4F6WA 3GU4A 4CKRA 3C0GA 5D41A 3KK8A 5AEPA 5IQBA 1OPKA 5HQ0A 4U45A 4CYJA 4DT8A 3OT3A 4YC6A 1WAKA 4MTAA 1PKDA 2R5TA 1VYZA 3BWJA 4A4XA 4L3PA 3DV3A 4AGDA 4G3EA 1PRYA 4FYNA 4YJNA 4YC3A 4FODA 5AR3A 4C4EA 2BAKA 2YLFA 4X2KA 5CXHA 2YAKA 1VEBA 4RVLA 2RL5A 3DAJA 3FUPA 3QCQA 4KBKA 4X2JA 5FG8A 5HTIA 3V5QA 3V01A 4O86A 4DTAA 1YDRE 2BZKB 5I9YA 4GK2A 1OIRA 4FBXA 3NYOA 4O21A 3AC2A 3GVUA 2C6DA 2HIWA 3ORZA 4FF8A 4KKEA 4QTBA 3RPYA 3LFQA 4BCFA 3ZFYA 1SNXA 4QYEA 3DNDA 3E5AA 3HECA 5BVFA 4CQGA 4FV6A 1UWJA 4QMZA 3PP0A 2PULA 5BVOA 3BLRA 1P4OA 4EWHA 4DGGA 4YSMA 1F0QA 2HZ0A 3UNZA 4JG8A 3PVUA 5HTCA 4E26A 4ZIMA 4U7ZA 4E3CA 3W2QA 5AX9A 4DEIA 1WVXA 4DC2A 3ZZEA 4EQMA 4RSSA 4OUCA 1W83A 2WFYA 3HEGA 4XRJA 2HWOA 3KF7A 4BWKA 3QQKA 4O2PA 4FTIA 5AA8A 4OTDA 2PZYA 4CV9A 3QQGA 2XNEA 3CQWA 3K5VA 4S33A 1CTPE 2B53A 3JS2A 3FLQA 3QKLA 4BCQA 2XK7A 2NPQA 2J90A 3EZRA 3R01A 4R5SA 5A4LA 1SVEA 3H4JA 4QMUA 1OL5A 5J9LA 1YI4A 3ZEWA 5L2TA 3TNQB 2REIA 4FKLA 3C7QA 3VN9A 3H0ZA 3FI4A 4DH8A 5A46A 1LR4A 2W4JA 4QQ5A 3KK9A 4S32A 5HD7A 5L8LA 2WXVA 1ATPE 1Y91A 5HESA 4O84A 3PVGA 2VTPA 4WBOA 4AN3A 5AP7A 3VW8A 4GKIA 2VX1A 1YXXA 5AR7A 4UWYA 4PDSA 4X2FA 5ETCA 3TTIA 4XV9A 4BDGA 2PVKA 1M2QA 2OWBA 5FBNC 2Z2WA 2PVLA 4FSWA 2QC6A 3QBNA 3LKMA 3EQCA 3TZMA 4P7EA 4R7HA 1H1SA 3AC1A 2QOIA 2ITUA 3LHJA 2QKWB 3OEZA 3G2FA 4OBQA 3RMFA 4YC8A 5EKOA 4FT9A 4LI5A 4X2GA 4HYSA 1PXLA 4ZZMA 2WMWA 4K9YA 3KFAA 4ZTRA 3Q9XA 5IQGA 3LFFA 5AMNA 2FGIA 4DA5A 2YCSA 3FZTA 4FV5A 5FTOA 1KOBA 4EHGA 1LP4A 3CTJA 4L42A 2G1TA 4NFNA 4PMTA 5DMZA 5FEQA 3QLGA 4F0GA 2HXLA 3GU7A 4ASXA 4YZCA 5CU6A 2YM4A 4JNWA 3Q6UA 3OW3A 1TQMA 2C6EA 2RG5A 3L8SA 2B0QA 3VVHA 1MQBA 5AUYA 4GSBA 3RP9A 5IMEA 3Q32A 4M67A 5EM7A 5TT7A 3QKMA 5JQ8A 4TKSA 3M1SA 1OVEA 2UUEA 4E6DA 3ZBXA 4ZTQA 4C3RA 5AV3A 4MK0A 5HLPA 5ANOA 2JFMA 2FA2A 3PUPA 2PZIA 3DTCA 3QTUA 5EYDA 3PA4A 4EHEA 2Y6OA 3MFUA 3PXQA 3VHKA 3GC0A 3ZO3A 5KHWA 2UZUE 1BYGA 1PXKA 3WF8A 2VWZA 3ZFXA 4A9YA 3MH0A 3CS9A 4DEGA 2JAVA 3U9CA 1H24A 4FGBA 4D4YA 1OI9A 4C8BA 5AM6A 5CWZA 4QD6A 1YRPA 5DOSA 3T9IA 3UVQA 4A07A 2OIQA 4XG8A 3BELA 4YNOA 3WILA 4C2WA 5HCXA 4PMSA 2Z60A 5LMBA 4O7WA 4R77A 1J1BA 4P5QA 4XG4A 2G15A 4EBVA 1IAHA 4KWPA 3PXRA 3KXZA 3ORKA 2BHEA 3CEKA 3D2KA 4UMQA 4CLJA 5E9EA 2GTNA 4E5AX 4EK8A 2BKZA 4PTGA 3KMWA 5ANDA 2PE1A 3D5VA 1W7HA 2ONLC 4IWPA 3O23A 4IB0A 1H8FA 3U4WA 4ERKA 3COKA 3OXTA 3O51A 2Y0AA 4RA5A 5DEYA 4D2VA 5BYLA 5B2KA 4GK3A 1H4LA 5HCZA 3FQEA 2UZOA 3RHKA 1PHKA 1OUYA 3VC4A 2YDJA 3IW4A 4IM3A 3QF9A 1UU8A 3EJ1A 4FKPA 4ANBA 3R30A 4YTCA 3SC1A 4YTHA 4USFA 2WB8A 2V0DA 4DFYA 3T3VA 5HORA 2W9FB 4ZLYA 1FGIA 4QMMA 4ACDA 5J9ZA 4WSYA 2A4LA 4E20A 5GIOE 4LV8A 4QP2A 5E8XA 4UMUA 2ITWA 1Q8YA 3OG7A 3C1XA 2UVXA 2PHKA 3KXXA 2CMWA 5FP5A 5CVHA 4BKYA 2OJJA 4EJNA 1SM2A 3JVSA 3QQJA 3VS1A 2CCHA 4HCVA 1WCCA 2VD5A 4I5MA 5HE2A 2X7GA 2ZM1A 4PTEA 4D9TA 5A4QA 5KBQA 2BZHB 3D14A 4HGTA 4PV0A 5IQHA 5EOBA 4R3RA 4G3CA 3LFNA 3QTIA 5HX6A 1WMKA 2R3IA 5IQAA 2QO7A 5BUIA 5AUUA 4FEXA 3FMNA 2NO3A 1IAJA 2QOFA 5AUWA 2VWWA 5K5NA 2W06A 3G0EA 3W8QA 5ITAA 3FKOA 5M4FA 2JIUA 2O8YA 1TVOA 4I0TA 4FEUA 4H3QA 3LFAA 3H9RA 5AIKA 4UB7A 3DT1A 3VRYA 3CC6A 4C59A 4OTFA 2B1PA 2WO6A 4L68A 3AD4A 2QHMA 5JFSA 2VWXA 3E8NA 3M42A 4U40A 1XR1A 2CGWA 3GEQA 5I0BA 5J8IA 4ZY4A 3TKHA 4JQ7A 3QTSA 5L2SA 1H07A 5FRIA 3VJNA 4BGHA 3BEAA 4B9DA 4EH3A 1FQ1B 2OICA 3SV0A 1K2PA 2WD1A 3VIDA 1PMUA 2PZ5A 1J3HA 4C3PA 4E4MA 5C8NA 2JFLA 4QP9A 1GJOA 1Q24A 4PDPA 3PXFA 4AS0A 5JQ5A 3JR1A 1Q8ZA 2C6LA 4C4GA 2Y4PA 3Q60A 2XNMA 3ORLA 4ITIA 4S31A 3R71A 5LMAA 4CNHA 4D58A 4FKQA 3E63A 3FI8A 3QRIA 3WF6A 1QPCA 1GIIA 4FX3A 5T68A 3ZSHA 3RAKA 3OC1A 4ZEGA 5CZHA 4F7JA 4BBEA 4DG3E 4UN0C 3U8WA 5K0XA 5FEEA 3RPSA 2I0VA 2R7BA 2W05A 4FKOA 1SVHA 4O0XA 4ACMA 2ITPA 4CQEA 3I0QA 4PL5A 3VS6A 3BLHA 4EH7A 4MEDA 2HCKA 4AFEA 2BDFA 2YLEA 3ORTA 4AOTA 5CAVA 3T8OA 3PA5A 3DJ5A 1VZOA 2PK9A 4I6BA 2PSQA 4JX3A 4YJUA 3SXSA 3OUKA 5AIRA 3QTZA 3LFDA 4GFOA 4ZTHA 2H96A 2ETMA 3LZBA 2VTAA 4C4IA 4GU6A 2JKQA 3ATSA 3FQSA 1Q97A 2O64A 4RQVA 4NM7A 3WIKA 3VUMA 1YI3A 4DN5A 4BCIA 4MXCA 3K3IA 4XBUA 3GQIA 4ARKA 5H3QA 4CMTA 3WF9A 4JLCA 4E6QA 2XM8A 3QTRA 4M7IA 2YDKA 3FLZA 3DXPA 3C4EA 4GW8A 4H58A 3ZU7A 4RJ8A 5J5TA 3U54A 3EQDA 4AFJA 4GYIA 4KB8A 4ZY5A 3R9HA 3E93A 3UG2A 1FINA 2RIOA 3QRTA 3C4WA 5CVGA 4DTKA 4L01A 3SA0A 3GENA 1NVRA 2W5AA 3R9RA 3I5ZA 1JKSA 1UA2A 4KIPA 4LQMA 5DI1A 3RNYA 4CD0A 3HMIA 2UZDA 4IZAA 4FSMA 4ZK5A 1GNGA 1NW1A 1W8CA 1ZLTA 2PUNA 4QRCA 2WTWA 2YCRA 4FSYA 4M68A 4O6EA 4F64A 3HUCA 4RC4A 2HK5A 3DLSA 2YHVA 5B2LA 5BVKA 3FXWA 4LRJA 3DFCB 5E91A 2UW7A 4DG2E 3Q53A 5DN3A 4XLIA 1E9HA 3LFEA 4GK4A 3QTWA 3C0IA 5BVNA 4D2SA 4QYYA 2C47A 2OH0E 2VTQA 3SHEA 4IW0A 2WEVA 4KNBA 3D7ZA 2RKUA 4DLIA 4WSQA 3F6XA 4B7TA 2ITZA 5HGIA 4BGQA 2J7TA 3GUBA 4NFMA 3EFWA 3EN4A 3VS3A 4LRKA 5HVJA 1QPJA 2OIBA 3P5KA 3KRXA 5HU9A 3LJ1A 1O6YA 5FXSA 4DAWA 4CFUA 1O6KA 3KQ7A 5A9UA 3AC3A 2EXMA 5A6OA 4AE6A 3SD0A 3LQ8A 4QMOA 4RLLA 4TYHB 3PSCA 4EZ3A 4XNEA 4WG3A 1E1VA 3PP1A 4EH2A 2X2LA 3EH9A 3HVCA 3NEWA 4WA9A 3SDJA 5GZ9A 1HCKA 4FTOA 4D2TA 2WMSA 4IACA 3O71A 4CFWA 1KE8A 3A60A 3P23A 3FPMA 4C2VA 3MW1A
chains in the Genus database with same CATH superfamily
4BC6A 4M14A 3F82A 5CENA 3P1AA 3ALOA 5GINE 1H1PA 4JBOA 4FC0A 4IIRA 1XH9A 3L9NA 4HCUA 3DBDA 4L9IA 2WMUA 3O5AA 3VS0A 3GI3A 3PTGA 5CU4A 4QMXA 1H1QA 2GNLA 2WU7A 3UMWA 5EM8A 4JAIA 4A9UA 1U54B 3R1YA 4LDTA 4AF3A 5M44A 2XM9A 3QGYA 2C6MA 2R7IA 5TO8A 1B39A 2YM5A 4JR7A 3O8UA 5BPYA 5LWNA 4ASDA 2JLDA 4JRVA 4C37A 4G9CA 5E8SA 5HOAA 2A27A 5CEIA 4NM0A 3MTLA 4IB1A 2V7OA 4EQUA 1CKIA 5E8UA 4DLJA 3DAEA 4ZJJA 1M2PA 4EK4A 2X4ZA 3MFRA 4LM5A 2CLXA 3KMUA 3OCBA 4MXOA 5KZIA 4EZ5A 2G9XA 3FEGA 2PMIA 3DK3A 3ROYA 3TZ9A 3BGQA 4W4YA 3HDNA 3EMGA 5CEKA 3FZOA 1YDTE 5JMSA 2OFUA 2WQOA 4YPSA 4CFVA 3HUBA 1GZOA 3O0GA 4GIIA 3LLTA 3TMOA 3BYSA 1ZZ2A 2ZVAA 1IRKA 5LCJA 5LXMA 5AP1A 5K0KA 4IXPA 4FKTA 4AP7A 2YM7A 3UIBA 4O38A 2GHMA 3PG3A 4W4XA 4C36A 4G17A 3FE3A 1XBCA 2ITQA 3KRRA 3FMHA 5KKRC 4TWOA 1MRUA 3ZXTA 2J5FA 3P08A 3LCSA 4TYIA 4W9XA 3TIZA 1XH6A 2B9FA 1SMHA 3VS5A 5CAPA 1IR3A 2FO0A 4PMPA 4RJ6A 3NVMB 2VX3A 3FZPA 5L2IA 3EWHA 5I5ZA 2A98A 3V6RA 4S30A 5FEDA 4IM2A 2UW6A 3NVKI 1YWRA 1QL6A 3G51A 2IVUA 4EOLA 3D5XA 4RZWA 5IQEA 3MVLA 4V0GB 5IA4A 2C5VA 2QHNA 4UXQA 1IA9A 2I0EA 3QGWA 2UW4A 4EHVA 1H0WA 4F1MA 3F3UA 4FNZA 4ZZOA 5CEMA 3A2CA 4LOPA 1CM8A 1CKPA 3ODZX 5C9CA 2IWIA 2OH4A 3NAXA 3OZ6A 2JKKA 3EQFA 3SXFA 5JFVA 5EYKA 3NYNA 4HVGA 3U6IA 2F9GA 2OF4A 5AV1A 2VTMA 4ZTNA 3KGAA 1KWPA 1H00A 4ZTSA 4G34A 3WIGA 5EQEA 4Y8DA 3HMNA 3Q04A 3UC3A 2BRNA 4WIHA 4WBBB 4HZSA 4BYJA 2WMBA 4RWLA 2P33A 4YLLA 3I1AA 3WF5A 4A9SA 3F7ZA 4U3YA 5G6VA 1BKXA 4OGRA 2W99B 3ZBFA 4MQ1A 2HYYA 4R3CA 3OT8A 4WRGA 5EHLA 3COMA 3RINA 4O82A 1OIUA 2PU8A 4O81A 3RPRA 4GS6A 4H1MA 1DM2A 1YQJA 4TPTA 4O0RA 4IANA 3UOKA 1I44A 4G6OA 1UU9A 4CSVA 4TYHA 1PXPA 1GZKA 2ITTA 3P7CA 3VBWA 3WZJA 5L6PA 2JAMA 3KKVA 5FDXA 4YZBA 2IVTA 2HELA 2PVNA 3TNIA 3W2CA 4B8LA 2XIYA 2XIRA 3F2NA 3NX8A 3NCZA 5AP5A 4JBQA 2OU7A 4QP4A 3DY7A 5EFQA 4ZJVA 4D5HA 4B6LA 3V8WA 3BHHA 3OBJA 3BX5A 4JVGA 2OKRA 4DHIB 4DHJA 3HRFA 4F6UA 1F3MC 3DA6A 5AX3A 4D2RA 1WZYA 2X0QA 5TR6A 4J7BA 2YIYA 1YKRA 5M55A 2HY0A 3C0HA 1U54A 3ZUVA 2QVSE 2R3MA 3W18A 2Z7RA 3DKOA 5AUVA 2XEYA 3OCTA 5DH3A 4BCGA 1GIHA 4D28A 4U9AA 2BUJA 5IDNA 4C62A 3DQWA 4TRLA 4MF1A 2B52A 4O7TA 4FRFA 4DFBA 3QL8A 4U80A 4FT7A 1YXUA 5KMJA 4HVIA 4JQ8A 1Q3DA 5FXQA 5KMKA 3ODYX 4E1ZA 5LARA 3NUXA 5CEQA 2FH9A 5H8GA 2XALA 1QPEA 1ZYJA 1ZZLA 2ITYA 2OFVA 2WELA 3BBWA 3HRCA 3LE6A 4GH2A 5CZIA 3OOMA 3C50A 1Q8UA 3PRIA 5T6KA 3CPBA 4G3DA 3E87A 5C26A 4XG9A 2GFSA 2I40A 4FG7A 4BL1A 3TV4A 3D7TB 4KAOA 4EC9A 3CTQA 4JBVA 5AR2A 3PFYA 4YPDA 2R3OA 3UODA 3NS9A 4TTHB 1KV2A 4NWMA 2PTKA 4P2KA 1WVWA 4RWKA 3R83A 3VBXA 3PJ8A 4AAAA 4EYJA 5L2WA 4NSTA 3TM0A 4TYJA 5CF4A 5JH6A 4M3QA 2WIHA 2XA4A 3GBZA 3KL8A 3U87A 4HVSA 1J1CA 4I5CA 2GPHA 2BRMA 4BJJB 3JUHA 4CRLA 4FZ7A 4YZ9A 2E9OA 2UZVA 4BCOA 4E73A 2PWLA 4AZTA 5M4CA 3HA8A 4IHPA 4K18A 3VBVA 4IAZA 3ZTXA 2QD9A 3JXWA 4KIQA 2XK3A 3HYHA 5M57A 2PE2A 2XJ1A 4TNDA 2WMXA 4DF3A 1XKKA 4PWNA 4QQJA 4A9RA 2AEGA 3DDPA 4HPUE 1VJYA 3WF7A 4O7SA 2UZBA 3V3VA 4WHZA 4JDHA 4ALVA 4IMYA 3DDQA 2QOHA 3KC3A 4AT3A 1XBBA 1UNHA 3EQHA 2UVZA 3FV8A 4GT3A 4OBPA 5IEXA 3R7VA 2YM8A 4RJ4A 5ETFA 4OR5A 4AXEA 4JMQA 3L8XA 4LGDA 4X3JA 1A48A 1NVQA 2PYWA 3V04A 5C01A 4FR4A 4AGUA 3NRMA 3UIUA 3UO6A 2IG7A 3R02A 4XG7A 2C6IA 4FE2A 3G15A 3T9TA 4QNAA 5E8ZA 3OBGA 3A99A 3QZGA 3AT2A 1XH5A 4F08A 5HE3A 2IPXA 3ET7A 4BCKA 3TUDA 3L8VA 1J7IA 2AUHA 2B7AA 3IONA 4MXZA 1JPAA 2V22A 2X9FA 4XS2A 4YJSA 5DA3A 5M53A 2W1DA 2YERA 3NLBA 1Q4LA 2R3KA 1A06A 4QMWA 4A4OA 1ZXEA 3UGCA 1CSNA 4H3PA 4IWDA 4NH1A 4DGMA 4HYIA 3DK7A 4XHKB 3AKLA 3TUBA 3VONA 4YLJA 1K3AA 1Y8GA 4MCVA 4PL3A 3CKXA 2HENA 3UBDA 4F0IA 1YXSA 3KXNA 4XX9A 1VLRA 4RX8A 5IH5A 3UZTA 5DBXA 2ESMA 5CU3A 5CLPA 4UY9A 4QT1A 4HYHA 4AWIA 4AN9A 4EH9A 2X4FA 3ZO4A 2ACXA 2HAKA 3D83A 1PXOA 4RIWA 2W0JA 4HPTE 3NUUA 4NJDA 4QYFA 4Z7GA 5EI8A 3OY1A 4EUUA 1IASA 3R9NA 1HOWA 2X2MA 4YBJA 5F4NA 3ZDUA 4PQNA 1YOJA 4BTFA 1Z9XA 2JGZA 1OIQA 1Q61A 3ENHA 2V62A 4IM0A 3OD6X 3CPCA 1TQIA 3LVPA 4PUZA 3EL7A 2XCHA 4M15A 3SOAA 5F20A 2GU8A 4RMZA 2QLUA 4ZTLA 4LUDA 2UZNA 4CLIA 4WNMA 5A4EA 1PY5A 3EQBA 1BX6A 3GGFA 3RZBA 5JGAA 5KO1A 4O7YA 4CGAA 1P2AA 4L3JA 5D12A 2C5OA 2J6MA 5E1SA 1R1WA 3QAME 2OJGA 4BY9E 4GFMA 1Q5KA 3CCNA 2OJ9A 2X6EA 4LMUA 5H9BA 4RZVA 3FI3A 3KCFA 1OKWA 4EK5A 3D5UA 4F9BA 3QD0A 3DJ6A 2OF2A 3G33A 5AV0A 5I9UA 5IEYA 4FTMA 3AD6A 5HE1A 2C1BA 3QU0A 4MNEB 4LG4A 4ZSAA 2QOKA 3D7TA 4M69B 2XIZA 4RVKA 4GJ2A 4FYOA 5HO6A 5KMOA 3FAAA 3CP9A 4QMVA 4DEHA 1BLXA 2VO3A 3HMOA 4AGWA 2WTKB 5KMIA 1YXVA 1ZRZA 2XS0A 1TZDA 4I24A 4TWPA 5FM3A 4P5ZA 5GJGA 4EH4A 4EOJA 2HZ4A 3BZ3A 1ST0A 1XMLA 4KINA 3A4OX 3VRZA 5D10A 2GQSA 2OI4X 3QD4A 3W8LA 4IC7A 3REPA 5AWMA 4BBMA 1WBVA 3QHRA 3TT0A 3KRLA 4N0SA 4BJJA 5A14A 3BL9A 3QA8A 3R9DA 4RVMA 2O3PA 3ERKA 4OLIA 4FIHA 1FVTA 3ZC5A 4MYGA 2HY81 3OY3A 5I9WA 2QLQA 4BDBA 1TQPA 4TY1A 4U43A 3QRKA 3TCPA 4DE4A 5AUZA 2OZOA 2XJ0A 2C0IA 1V0BA 2E9VA 3QRUA 2VNYA 4M0YA 4U5JA 4U97A 4GFGA 4CTBA 1YDSE 3E62A 3UP2A 4AZVA 4YTFA 5CANA 1G8AA 4AQCA 4QTDA 4Y5QA 4F4PA 2J2IB 3ZYAA 3H10A 2YIRA 4FK3A 3NFFB 2GNIA 3P78A 4FV7A 5GZAA 4MKCA 3LMGA 5M4UA 3E64A 3R28A 3MIAA 2JBPA 1T45A 3BQRA 3F5XA 5H8BA 2CGUA 3VULA 4FVPA 4QTEA 2PZRA 2VTSA 5J1WA 4G2FA 2J0IA 2W9ZB 5JRQA 5J9YA 4EI4A 3RK9A 4DITA 4KA3A 5IEVA 2C3IB 3F5GA 2B9JA 2Z8CA 4XJ0A 3ITZA 4J99A 4Y95A 4TL0A 2C5XA 4WNPA 3EIDA 2F57A 4AAYA 5AAGA 2VGOA 3OF0A 5FGKA 5D7VA 4FZFB 4O1OA 2CCIA 5I3OA 3UZPA 5CF5A 4UX9A 3VNTA 4OTIA 2PPQA 1GAGA 1ZMVA 5KCVA 4ZS4A 1R3CA 2VTJA 5HLNA 2WHBA 3CR0A 4FKUA 3O7LB 2QR7A 2EB3A 5EI6A 2CPKE 3A61A 3LJ0A 1GY3A 2OGVA 2R0IA 4XH6A 4G31A 5GJDA 3OWKA 3TEIA 3UC4A 4W8EA 2JITA 3F3WA 2W1EA 4GMYA 4RC2A 2IW8A 3W2PA 5KBRA 3UQCA 4NK9A 2BFYA 2AYPA 3CGOA 4FV1A 5TOZA 2YIWA 2JIVA 1GZNA 2VO7A 3UNJA 4HGSA 4YHFA 4CV8A 3G0FA 4E4XA 3QTXA 5J5SA 2WTKC 4XUFA 3Q9WA 4MWHA 4GT4A 5HE0A 2GFCA 3OW4A 3R00A 1DI9A 2WMRA 4UZDA 1ND4A 2QI8A 3CKWA 2ETRA 3VF8A 3M2WA 4ASZA 4D4VA 3UVRA 2VAGA 4K11A 3ZXZA 4FKGA 1H26A 3GXLA 4J71A 3PIYA 3HMMA 2H9VA 2ITOA 4MXAA 3PG1A 3ZLWA 2R3GA 3FI2A 2J51A 1V0PA 4A7CA 2ETKA 4YNEA 3V5PA 1O6LA 3GCVA 4NZWB 3VBQA 4M66A 4X21A 4D1SA 4I94A 1H1WA 2YN8A 3IKAA 1U59A 3BU6A 1OZ1A 3F88A 3GU5A 3SW7A 4WD5A 3IS5A 5EG3A 4FEQA 4EH8A 4IWOA 4DG0E 1JSVA 4UV0A 4JS8A 4EWQA 3PPJA 4GIHA 4D5KA 2FVDA 2I0HA 3AGLA 5A3XA 4XRLA 2VGPA 4C57A 2PY3A 1W0XC 4MNEA 4DFLA 2NRYA 4R1VA 2O65A 4DH7A 4M69A 4M12A 1JLUE 4CZTA 3FC1X 4FKRA 3UQGA 4O7RA 4C34A 3HV3A 4O96A 5ACKA 3KN6A 5T3QA 3DOGA 1OBGA 4HJOA 2C3KA 1AD5A 5DR6A 3I79A 3U6JA 4M84A 1U4DA 4H36A 3VO3A 2H8HA 4IAYA 3COIA 4KABA 4PNIA 4RX9A 2E2BA 3EN9A 3AMAA 5HHWA 5HVYA 4RX5A 2DUVA 4YGAA 5IZFA 3R8LA 4PPAA 4FNYA 3IK3A 5EDRA 3LMIA 3CLYA 3TI1A 3MA6A 4YO4A 4FG9A 2A2AA 4XCUA 3QHWA 2JC6A 2FYSA 2ZMDA 4FUXA 4NKSA 2OZAB 2CHLA 3ELJA 4TW9A 5HNGA 3W32A 4C61A 3UOJA 2H34A 3G9NA 3IW8A 4EK3A 4QDVA 2ITNA 4FOBA 3PE1A 3HX4A 1IA8A 2VO6A 2YWPA 2O63A 1PXMA 3SKCA 4AXAA 2Z7QA 2LAVA 5IQCA 3W0NA 4L00A 2F49A 5B7VA 4H1JA 4MX9A 1YOLA 4QTAA 4F78A 5M51A 5HZNA 3CGFA 4N6YA 3MB7A 3W1FA 4C0TA 4BI2A 5CQWA 3NUPA 5BUEA 4AW0A 3ID6C 4AUAA 1Q99A 3HLLA 1GIJA 4I1ZA 3ZUTA 3OROA 2OJIA 2WQEA 3QC4A 5DNRA 2DQ7X 4KUJA 2PMLX 5LVNA 4LRMA 3OTUA 1Q3WA 2A0CX 3MH1A 4O0VA 5JN2A 3PA3A 2WMTA 3UIXA 2VWUA 3BGPA 3O50A 1UWHA 5E90A 5FTQA 4LFIA 4AACA 5EHYA 4GYGA 2H6DA 4JT3A 2ZAZA 3QUPA 3UE4A 3TUCA 3DKGA 3AC8A 4JIKA 2ZOQA 4F9WA 3BHYA 3DU8A 3R73A 2PZPA 4FIJA 2BIKB 4B99A 3S1HA 4I5PA 1J7LA 1OECA 2IVSA 3Q4ZA 1YOMA 2JDSA 2C3JA 3S2PA 4M97A 3WARA 4YU2A 3TZ8A 3AMBA 3F3VA 3L8PA 4L43A 5L4QA 5C03A 2OBJA 4XEYA 5GJFA 3KXHA 4AA4A 4FEVA 2Y6MA 4RT7A 1UNLA 3C51A 2BHHA 3MGYA 4X0MA 3UOLA 4YZNA 1Y57A 3CY2A 2YISA 4FZ6A 4GCJA 4OTRA 3LPBA 4Q5EA 1LUFA 4DDIA 4F0FA 2J0JA 4KIKB 3N4TA 3W2OA 1STCE 3P7AA 4I5HA 5CT0A 5IQFA 1XHAA 3I6WA 2XH5A 4IAFA 1U5RA 3SW4A 4GJ3A 3JPVA 1YHVA 1UU3A 2FSLX 4LUEA 5BQ0A 5IUGA 5KX8A 3LM0A 1JNKA 3MYGA 3HDMA 5LVMA 3N4VA 2XMYA 4ERWA 5CNOA 4I20A 1B38A 5G1XA 1O9UA 5LCKA 4PMMA 2XIKA 5IA5A 4G3GA 2CDZA 4D4RA 3ZO1A 1I09A 2BAQA 2J0MB 3FLYA 4WKQA 4L67A 3GCUA 4FSQA 2C0OA 3LJ2A 3IDBA 4G6LA 4AA0A 3EQGA 3QD3A 3ZONA 4F1TA 2JDOA 5CQUA 3V8SA 2Q83A 4F9AA 1ZYCA 3QQHA 1PKGA 3QX2A 2CN8A 5HCYA 3WYXA 2WMAA 2CKEA 4CFXA 1REKA 3HA6A 4I6LA 4C4FA 2C6KA 2XARA 2VX0A 2YJRA 1XJDA 5IUHA 5FLFA 3C4XA 4N6ZA 4MXYA 4EOKA 1DI8A 4IVCA 3TNHA 1P5EA 3R9OA 3E8CA 3PLAE 1ZYSA 4FTUA 4FIGA 4FKWA 4NCTC 1H1RA 1KE7A 5BNJA 2J4ZA 5AUXA 5BUJA 5IMXA 5E7RA 5EYMA 2OZAA 2QODA 4MQ2A 3F66A 5K4IA 3A62A 4YMJA 4ZLZA 1UNGA 2BAJA 2YM6A 2B54A 4NTTA 2XNBA 5AFVA 3PXKA 3EZVA 4RFZA 2IW6A 5EW9A 4LGHA 3G6HA 4TZRA 4YSJA 4N57A 3FZSA 5GHVA 4CT1A 5HBJA 5D1JA 2W5HA 2RFDA 2ZM4A 2PVYA 3GFEA 2DWBA 2VWYA 4PDOA 3UQFA 5I9XA 3RAWA 4Y73A 2W4KA 4BKJA 3TIYA 3OTVA 2VUWA 2IZTA 3QD2B 4M8TA 4PF4A 2X39A 1URWA 4NM5A 4RFMA 3JY0A 2V5QA 4FA2A 4AXDA 2WTJA 2Y4IB 2XNPA 3VUKA 2Y7JA 5CAQA 4F6SA 4JXFA 4BKZA 5DR9A 4BBFA 3AXWA 5DEWA 3EHAA 2JEDA 3R8UA 4EOPA 3H3CA 2PVFA 1RQQA 4EL9A 3GFWA 4EH6A 3P0MA 4QQTA 5B0XA 1JKTA 1ZOEA 3E7VA 3UO4A 3FYJX 4NCTA 4PL4A 1WFCA 5IQDA 2CN5A 5EYCA 3HV4A 4AW5A 3LLAA 1OPJA 3BGZA 3WE8A 5HX8A 4QPMA 3IG7A 3NW5A 4FKJA 3L1SA 4UWCA 4IEBA 2YZLA 2W1ZA 3FMJA 3A4PA 5CAOA 3S95A 2HXQA 3MIYA 4FIIA 2VRXA 4K6ZA 4C38A 5ANEA 4ORKA 3D4QA 3F3ZA 3Q3BA 4Y85A 3FMDA 1PMNA 3L9MA 4J53A 4J97A 1FBNA 3QYZA 2VN9A 2ITVA 3FL5A 3TG1A 3ROCA 2C30A 2JIIA 2ZDTA 1UKIA 4KIKA 4C3FA 4E93A 2W1IA 4PPCA 3WI6A 2J50A 2GHLA 1YI6A 3PSDA 4FV0A 4IFGA 5L8KA 4OTWA 4O2ZA 1JQHA 2GNGA 1M2RA 3OUNB 4K2RA 4WT6A 5F9EA 4JDKA 1OGUA 3FY0A 1S9IA 3QXPA 2R3LA 5JEBA 3DKFA 4GVJA 4FIFA 1VYWA 3KREA 3EFJA 3R8MA 2PVRA 4Y83A 1R0PA 1ZY4A 3RZFA 3WZEA 4AU8A 4BDFA 5I9VA 2LGCA 3QA0A 3BHUA 4B4LA 1Y8YA 3CQUA 3MFSA 2ZJWA 2PVJA 3LXKA 4K1BA 4RWIA 4E7WA 3I4BA 3TACA 3PRFA 4O0SA 5KMLA 2NNWB 2QNJA 2VTIA 5AAEA 4ASEA 3DTWA 1URCA 5HU3A 5K4JA 4O6LA 3H0YA 1W98A 2R3QA 5DT4A 2E9NA 2O5KA 5HICA 1SVGA 3BHTA 3FKLA 3KY2A 4NIFB 4AZWA 4Z3VA 4C4HA 4YJQA 5HKMA 2WQBA 2EB2A 4R6VA 5HBHA 4QMQA 5JGDA 2IJMA 2KULA 2Y4IC 4JG7A 4QP1A 5EQPA 2EXCX 4L45A 4DEDA 4LMNA 2ZDUA 4EHZA 3KVXA 2YFXA 3FMEA 3MBLA 2YA9A 3FPQA 4DH3A 1Q41A 4BI0A 1RJBA 4BHZA 5IDPA 1GOLA 1DAYA 4IBMA 4O4FA 4UALA 3O7LD 1UV5A 4J8MA 5EM6A 2DS1A 2BCJA 2ERKA 4QPAA 4X6QC 3VQUA 3DJ7A 3ZUUA 1EH4A 1LPUA 2X0GA 4J1RA 4CVAA 3TXOA 4H39A 3FMMA 4LGGA 3UIMA 4B0GA 2EXEA 3W55A 4IVDA 3BYMA 4MD8E 2P4IA 3NNVA 3P79A 4MHAA 4IFCA 4OBOA 4CKIA 3O96A 3WOWA 2XYUA 2XBJA 3U51A 3SOCA 3ZRKA 3BU3A 4FNXA 4G9RA 3R2BA 2VTOA 5JFXA 1BL7A 3I60A 5CU2A 4KS7A 4DCAA 1JOWB 3NNXA 1FOTA 3CD3A 2UZWE 4KBAA 2OXYA 4ACGA 5HIBA 4ANOA 3FMLA 4EOSA 4O22A 4FL2A 3RNIA 4O83A 3HMPA 5DYJA 3DCVA 5CXZA 4BCNA 2CSNA 2HZNA 3E8EA 2YAAA 4AW2A 4CFMA 2BILB 4DH5A 3PZEA 3BCEA 3H9OA 5AJQA 4YJTA 1W82A 4KKHA 4EYMA 1YHWA 3S00A 4QDEA 4FT3A 1JAMA 1KUTA 4ZSLA 2GQGA 3ZLSA 3NMUF 1JKLA 3LCTA 4HZRA 3NCGA 4WOVA 3COHA 1ZAOA 4N4SA 1OUKA 3OWPA 5B2MA 1T46A 3KXMA 5E8VA 5EW8A 3NIEA 2Z7SA 1KV1A 1P14A 2JD5A 2B4SB 3IOPA 4LL5A 4BDJA 4AOIA 1OITA 4FL3A 5E8YA 2VWBA 4D1ZA 5L6OA 5EI2A 2BKKA 2J5EA 4OTHA 3SAYA 3GC9A 3Q4UA 3FLNC 3D9VA 3AD5A 3PXZA 3UJGA 3LQ5A 3F3TA 3F61A 2UVYA 4R3PA 4C4JA 2R0UA 3NUNA 4FTKA 1XH7A 2YZAA 3M11A 1PYXA 4TNBA 4BDCA 3RK5A 3GOKA 4ITHA 5AP6A 3PJ2A 3II5A 2W7XA 1YVJA 4ZLOA 3V5WA 4TN6A 2PUPA 4OT6A 2I7QA 4HCTA 3MPMA 3VS2A 4ACHA 3NGAA 3R2YA 4Y5HA 5AR8A 5IH4A 2Y8OA 1SNUA 3FJQE 4HGEA 3DFAA 4ALUA 3GP0A 2UW5A 2BZIB 3RWQA 2C1AA 3TNWA 4BDDA 3GC7A 4JJRA 5HI2A 5H8EA 2XP2A 3KXGA 4YHJA 4IZ5A 4QMTA 1BI7A 2C3LA 4XG2A 1U5QA 2W5BA 3CD8A 4XMOA 4MD9E 3Q52A 4QOXA 4X7QA 4E8AA 2WKMA 3ACJA 3I6UA 1WBWA 3AG9A 3P4KA 4I23A 4TWCA 5DPVA 1PXIA 1TKIA 3KRJA 4NYEA 4HVHA 4NIFA 3PZHA 4XV2A 3UPZA 3UDBA 3BV3A 1OKVA 1Q8WA 2R3JA 4O4BB 5F94A 3LMHA 4AGCA 2A19B 2XKCA 3L9PA 3BYVA 4WG5A 2PUIA 3K3JA 5TF9A 1H08A 3UPXA 2WOUA 3MY1A 4YP8A 3QWKA 4UBAA 2YABA 2WTVA 1XWSA 3PIZA 4IVBA 4YZDA 3AT3A 4TXCA 3FC2A 2Y9QA 4KSQA 4BCHA 4YJRA 4JX7A 2XIXA 1Y6AA 2VU3A 4QO9A 4QP8A 1ZOGA 4Z7HA 2AC5A 2OXDA 1FGKA 3E8DA 3RPVA 5M4IA 3UZRA 3MDYA 3OXZA 2HOGA 4ZS0A 3ZFMA 1OGYA 2JDVA 5BMSA 5DFPA 1OB3A 4P4CA 2G2HA 3OCSA 3VWAA 4BIEA 1FPUA 4C7TA 5HG7A 3ZC6A 4EUTA 4V0GA 4XG6A 3B2TA 2GSFA 3PFQA 2WOTA 2UW9A 3HZTA 4ENXA 4RJ3A 4F9YA 4FTQA 3EL8A 2OG8A 4R5YA 4UMTA 2Z7LA 4KD1A 4FSTA 4ANMA 5HNBA 3RI1A 1UKHA 3R1QA 3U6HA 4J8NA 4Y46A 2XB7A 3C9WA 3R04A 2VZ6A 5AP2A 4BRXA 4O4CA 3POZA 3R8PA 1Z57A 3PUFC 2UV2A 2QQ7A 3ZH8A 4K77A 4FKVA 2W1FA 2XANA 5ICPA 1WBPA 5DIAA 3F5UA 5JRSA 1H01A 3GB2A 4CTCA 4F99A 4W9WA 3NYVA 3QZHA 3C13A 1ZY5A 4ANQA 4CG9A 4TWNA 4C58A 2HZIA 3KCKA 4FV9A 1G3NA 2YEXA 3LW0A 4NU1A 2I0YA 3ZM4A 2W1CA 4UYAA 4ZOGA 4XP3A 4YURA 3PJ1A 2X7OA 2XVDA 5CTPA 4MF0A 5CI6A 4JG6A 3ANRA 4XV3A 3LM5A 3EYGA 4QYGA 1E1XA 1X8BA 4O0WA 3B2WA 3D5WA 1XBAA 3DBCA 3FXZA 3MVJA 2XK4A 3IGGA 3V5JA 3UMXA 2GNJA 4E6CA 5EKNA 4QMSA 4WUAA 3PY3A 3G5DA 4FOCA 1OL7A 2X8DA 2C69A 2R2PA 1NY3A 1SYKA 3DBQA 5F95A 5J95A 5LVLA 1RE8A 4BDIA 3VUGA 2EU9A 3KF4A 4RIYB 3C4ZA 3B8RA 3NUSA 4GV1A 5JK3A 3ORNA 4PNKA 3R6XA 4EOOA 5K3YA 3SG8A 3BPRA 2UW0A 4GG5A 3SRVB 4RJ5A 3OVVA 4NT4A 4H3BA 3R7EA 1RDQE 3PPKA 4G5JA 3VUHA 4MXXA 3BBTB 4Q9SA 2PUUA 4V05A 2XUUA 2P3GX 4LV5A 1F5QA 5H2UA 5CSXA 2BROA 4IADA 5JZJA 4Q5HA 5CAUA 3I0OA 3V6SA 5EHOA 5CI7A 4MVFA 4C02A 4UEUA 2O2UA 3R7GA 5CASA 4L44A 2UZLA 4BIDA 4X2NA 2GTMA 3LAUA 3R7UA 3RM6A 2XF0A 3V5LA 3PWDA 5E4HA 4ZSGA 1R0EA 5TKDA 4FICA 1NXKA 2IVVA 4FZDB 3LXLA 4X3FB 3RCJA 3E3PA 3QX4A 4C35A 5C8KA 1XQZA 2W1GA 5AR5A 4DHFA 5I3RA 3TDVA 4IAAA 2J0LA 3DB6A 2EVAA 4FIEA 5D9HA 3TJCA 3D0EA 4U81A 3G9LX 4L53A 3HP5A 3ZMMA 4EQCA 3AKJA 3OWLA 2JBOA 3OMVA 5JT2A 3BI6A 3C4FA 3LCDA 5CX9A 2XNGA 4FSUA 2BPMA 2ZV7A 2VWIA 4U6RA 5ETIA 2C0TA 5AM7A 3PPZA 3ENMA 5ACBC 3K54A 3GCQA 4XLVA 3FY2A 5AR4A 3GC8A 3MWUA 2UW8A 5GZ8A 4RLKA 4HNFA 5BX0A 1H28A 4QP3A 5KMMA 3DAKA 3RKBA 2BFXA 2V55A 4TYGA 4YZMA 4KKGA 3BYUA 4ITJA 2XKDA 1XH4A 4G6NA 3AT4A 4L3LA 2VV9A 1BUHA 1PJKA 3ORXA 3OS3A 2ZV9A 3CY3A 4FUYA 3HV7A 4U42A 3HAVA 1OM1A 4YTIA 3FYKX 3FKNA 3R0TA 4AZSA