1I44A

Crystallographic studies of an activation loop mutant of the insulin receptor tyrosine kinase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
298
structure length
282
Chain Sequence
PDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INSULIN RECEPTOR
publication title Crystallographic and solution studies of an activation loop mutant of the insulin receptor tyrosine kinase: insights into kinase mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 282
sequence length 298
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2001-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1i44A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1i44A01
3TNHA 1G8AA 5DYJA 5I9VA 2ZM4A 3UYSA 1QPJA 1XH4A 4WUNA 3BWJA 3MPTA 4BYIA 2X9EA 1Q5KA 3W2RA 4QTBA 3BGZA 5KMKA 2WU6A 4YZCA 4EOJA 3ORMA 5IMEA 2V5QA 3ODZX 1U54A 2G15A 5EG3A 3ZEWA 2E9UA 5AR2A 2P2HA 3MB6A 3U6HA 4FKOA 3WE4A 3ZSHA 4CSVA 5KHWA 1UA2A 4GFGA 3ZDIA 2HW7A 2QOFA 3DB8A 4RQVA 2B55A 2Z7LA 3QGYA 2B52A 3RAHA 2GNLA 4RIXA 3SX9A 4G2FA 4C8BA 3GXLA 1DAWA 3VN9A 4XLVA 4ASDA 2GU8A 2OI4X 3OBGA 2R3QA 5E8UA 4H05A 4RMZA 4PDOA 3TZ8A 4FE2A 3MIAA 2A19B 2JC6A 1YHVA 3G51A 4ZY6A 5M4IA 3PP0A 4QP4A 3IOPA 5L3AA 2YZLA 2B9IA 2ZV9A 1MQ4A 3Q4UA 4KIQA 4ZIMA 3RPSA 2PVYA 3QCXA 2CCIA 3QD4A 4KS7A 5IH6A 4EORA 5JZJA 2PU8A 1OVEA 4QP1A 4EWHA 4FK3A 4G9CA 5EQEA 3SRVA 1YXSA 5FEDA 4XRJA 3R9NA 2I7QA 5F4NA 3R7GA 3R21A 4FV8A 3D5VA 3MY0A 3VBQA 4L6QA 3QXOA 1ERKA 5ICPA 3AMBA 4M69B 3CTHA 5ANEA 4MVFA 4EOIA 3FZTA 2R3MA 1H27A 2J0MB 3E8NA 4G5PA 4JX7A 4LGGA 5HORA 3NVKI 4HGLA 3PLSA 1SVEA 3EFJA 4AW1A 2BTRA 3HAMA 3N51A 3IOKA 2CNUA 4U97A 4C36A 4WUAA 4XS2A 4CV9A 3ZLYA 4DEDA 1UU7A 3QTZA 4G34A 1SNXA 3EKKA 3VW6A 3COHA 5LVNA 4W4YA 3KRJA 3QALE 1UKHA 4HYUA 4X3FB 4QMNA 3HYHA 5A46A 1JOWB 4PTGA 4X2KA 5EI8A 3NX8A 3C9WA 4JAIA 4O1OA 4BDKA 2IW8A 4F7SA 5I4NA 4IHPA 3C4ZA 2ITVA 4JNWA 2IO6A 4I24A 4UV0A 4AZFA 1H25A 3ZFMA 4CMUA 5TF9A 4W9WA 5IQEA 4W4WA 2ITZA 1V0PA 5CEPA 5AUYA 1SZMA 1VZOA 4FUYA 5DT3A 1HCKA 3R73A 1BX6A 4C4HA 1WBOA 3IQ7A 4RZVA 4XP3A 4JDIA 4K33A 1SMHA 1KE5A 5C1QB 3C4FA 4ZAUA 2JDTA 2XCHA 3ZFXA 2J90A 3M1SA 4ACDA 4F1TA 3PLAE 4DG0E 4FTTA 4QMMA 5CXHA 2YM6A 4DLJA 5LMKC 3QZFA 4JRVA 4BTFA 3UOHA 3F7WA 3H0ZA 2C5XA 1YI4A 1YQJA 4FKPA 4X3FC 4J96A 4M7IA 4PP7A 2W1FA 1PXKA 2KTYA 4ZMEA 4OTGA 5CTPA 3NPCA 3RTPA 5DBXA 5A14A 5BYZA 5E1EA 4MXZA 3WIGA 4KRDA 2GMXA 3AG9A 5EKNA 1J7UA 3DBQA 4JAJA 4FG7A 1FVRA 3LQ8A 4OT5A 4WNPA 3UVRA 1T45A 2X6EA 1J1BA 5CALA 3FHIA 3V6RA 3PTGA 4D28A 5EDRA 1O6KA 2VX0A 3LCDA 1I09A 2R3PA 4MF1A 4R3RA 4EONA 3C50A 5EYCA 3BHTA 4TPTA 2WIPA 5ANGA 4AW5A 1OUYA 4QMQA 3HV3A 4ACMA 2IJMA 3PVWA 4F6WA 5FM3A 4L3LA 4YNOA 4QPSA 1ZWSA 3ZUVA 1PXMA 3QHWA 2C47A 5HLNA 3QRJA 3V3VA 4MWIA 5DR6A 4BDGA 1PRYA 5E4HA 4QMLA 1JNKA 3ZSIA 3LM0A 2QNJA 4FTKA 4Y83A 2OIDA 2R9SA 4I22A 4C3FA 4ARKA 2YAKA 4CV8A 5E8SA 4HJOA 4DAWA 4O81A 4IX4A 3LM5A 2WXVA 5HVJA 4B6LA 3R04A 4CFNA 4ZJJA 3ULIA 5I9WA 5CEIA 5AWMA 4CFMA 2UV2A 3R1QA 4AFEA 3ET7A 2YCRA 1FBNA 2BILB 3PG3A 2VWVA 2EXMA 2I1MA 3HZTA 5BVEA 3Q2MA 3ZU7A 2FSLX 4D0WA 2HIWA 3KC3A 4XBUA 3BQRA 2QOOA 3QQKA 2J0IA 3Q4CA 4FV0A 4D9TA 2PUNA 4O0VA 4NYEA 3POOA 2P55A 3BI6A 3MY5A 3UG1A 4EBVA 4WKQA 4CYIA 2ITYA 2IW9A 2H6DA 3U55A 4QTDA 1IA8A 2YA9A 5M53A 3QCQA 4BHNA 3SG9A 4O0SA 3R7IA 5L6WL 3D2IA 4FZ6A 5K0KA 4APPA 3DQWA 3OVVA 4D1SA 4F7LA 1BYGA 3W8LA 5HBJA 4PF4A 1I44A 3C7QA 4IQ6A 2NNWB 4GL9A 4RWIA 3MH1A 3VAPA 2UW0A 4Z7GA 2CKEA 4FTLA 4CFUA 4DFYA 5AIKA 4QTAA 1Y8YA 1FINA 2BZJA 2PVRA 5HIBA 2JDSA 3R9HA 3W16A 5L2WA 4N57A 1XH8A 5EM6A 4NIFB 3EQHA 3EQRA 1REKA 2BFYA 1U46A 3EJ1A 3PDTA 3LFFA 3W10A 5GZAA 3F5XA 1B38A 4UEUA 2QI8A 2A2AA 3D5XA 4M14A 3GU5A 4CZUA 4ZTHA 5HTCA 4RJ7A 2B9FA 3RZFA 2R0IA 4G3EA 3E63A 3VUDA 4ORKA 4U45A 2A0CX 4JIAA 5J7BA 4FSMA 2VO7A 3P0MA 4IM2A 5LQFA 3GU8A 4RVTA 1Q3WA 3CBLA 3A61A 3U51A 2BDFA 3KGAA 3MYGA 4O22A 5HHWA 5M51A 1W8CA 3D15A 4GUEA 1CSNA 4PPAA 4KUJA 4B99A 3CQEA 2YM3A 3UOKA 3BU6A 2CMWA 3Q32A 4D1ZA 1IAHA 3HX4A 2HY0A 3DK6A 3V5PA 2OICA 4NZWB 2ZJWA 4C59A 3GOPA 3KK9A 4FTAA 4OTIA 2UVYA 4WNOA 5M4FA 2O64A 3Q96A 2OK1A 4J97A 5IDPA 3MH3A 1ZOEA 1DI9A 5CU6A 3QKLA 3HDNA 2XBJA 4JBQA 1Q97A 3RINA 5KUPA 3FEGA 3V5JA 4ZOGA 4BB4A 3WOWA 5EW8A 3TIZA 3UMXA 3G9NA 4X21A 3ZO3A 3A7HA 2YITA 4BCOA 5IA2A 2JDVA 2BKZA 4I0RA 4C57A 5LARA 2GHMA 5ANKA 1FGKA 4AZVA 5TOZA 5L8LA 3L8PA 3O17A 1H0VA 3BHUA 4F1OA 4YTFA 3OOMA 3ZMMA 3LOKA 2WO6A 5B7VA 2R3KA 4E5BA 3JS2A 4RPVA 4U79A 2R3HA 3V6SA 4QP9A 4IJPA 3G2FA 1H07A 3EYGA 5I0BA 2CJMA 1YVJA 4HVSA 4RFMA 4IIRA 5HVKA 4JG7A 2VNWA 1PXJA 4MD7E 4EYJA 4MWHA 3VUGA 1LPUA 2IZUA 3C4WA 5A4CA 5J9LA 2CGXA 2QG7A 2HWPA 3RVGA 3IO7A 3A8WA 4LFIA 2DS1A 4BDJA 2B9HA 4ANBA 1JSTA 3FZRA 1LP4A 2GNHA 4M66A 2Q83A 4DGNA 4FA2A 2QONA 5CSPA 1T46A 2HXLA 2XEZA 4R8QA 4XNEA 2EUFB 5CAUA 5KZ0A 4U3YA 5E8TA 1ZYSA 5CF4A 4J99A 4FVPA 4JOAA 4GKHA 1QPDA 2PE0A 2WD1A 1FGIA 4CKIA 4IX5A 2PVFA 4CLJA 5FP5A 5IA3A 3V5WA 1JSUA 4IAFA 3KMWA 1H1RA 2HXQA 3NEWA 4J1RA 1OKWA 2BRBA 3NDMA 3NYXA 4WBBB 3ZOSA 3WF5A 4QYYA 4JG8A 2IVSA 3QC4A 4GKIA 3DFCB 1UV5A 3DTWA 4MF0A 4USDA 1TKIA 4MD8E 1LUFA 4LOOA 4BICA 4RLKA 3SXFA 2I0HA 3FQHA 3UNZA 3NW5A 3RALA 4DA5A 1FOTA 3I1AA 4DEAA 3OCTA 3OUKA 1HCLA 3QZIA 2GQRA 4QMVA 5DRBA 2VTPA 4CGAA 4ALVA 3FSFA 3V01A 2ITUA 4BIEA 2IG7A 5AP3A 4GCJA 3OCSA 5CSXA 4AN3A 4I4FA 3UDBA 5JFSA 4LRMA 4IAAA 5D41A 2BRHA 2XJ0A 4Y5HA 2HW6A 3T3UA 3WF7A 2X8IA 3BELA 4ERWA 4E6CA 1IEPA 1TQMA 3U9NA 2HELA 5CNNA 3A7IA 3H30A 1GOLA 2J7TA 5LCKA 2BUJA 4AZTA 1AQ1A 4K0YA 3UO5A 4Q2AA 3RPRA 5HU9A 5GZ9A 4D55A 3V5QA 3DT1A 3P79A 4FTOA 3TV7A 5BPYA 2X8EA 4R6VA 3VQUA 5HE1A 1JPAA 2OU7A 5L6OA 2UZDA 3KVWA 1P2AA 2PUIA 3DB6A 3H9OA 2VTMA 2ESMA 4FSTA 3RPVA 1URCA 4AGWA 1YDSE 1OIYA 3ALNA 4CFXA 3AC2A 4RIWB 3NW6A 3RM6A 2E9PA 3IDPA 3WF8A 4JX3A 4KINA 2VTOA 3R8VA 3VS0A 5IEXA 4QO9A 5J95A 1UU8A 2C4GA 3RPYA 3NUNA 4A9UA 4EUTA 2YHVA 4GU6A 3RK9A 4EK3A 2ZM3A 4KSPA 2WAJA 4KBKA 3R83A 4IAKA 1MRVA 1Y6AA 3I5NA 3EIDA 3EN9A 5JT2A 3IDCA 4O27B 1AD5A 4RX7A 4EWQA 5JGDA 4EZ5A 3SXRA 4IXPA 4L46A 1OIUA 4XV1A 2AUHA 3GCUA 2YZAA 3FZOA 4Y46A 4C4IA 3HA6A 3NYOA 3FC1X 1NXKA 3E5AA 1RDQE 3BYUA 3MPMA 4GT3A 3ORNA 3CSVA 1M2PA 3ZC6A 3NCZA 5AP5A 2BRGA 2B9JA 3CPCA 2PZRA 4HPUE 3DDQA 1REJA 2Y4IB 2CNQA 4TYIA 2XRWA 3R00A 4IH8A 1WMKA 5CAPA 3GQIA 2ZVAA 3DJ6A 2XKDA 2WGJA 4IFCA 4ZS0A 3QRKA 3VUKA 3ZO2A 2YACA 5HG8A 3ZH8A 1LEZA 2Z8CA 3GC8A 1GJOA 3QQUA 4GFMA 4A9RA 2WQOA 2GDOA 2GCDA 4O2ZA 3HMPA 1H0WA 3MPAA 5FTQA 3F88A 2VWIA 4GRBA 5M55A 1R78A 2GNJA 3CQWA 5IDNA 3IKAA 4EUUA 4QD6A 4ANQA 2JAVA 3NAXA 4UYAA 4AG8A 2ITOA 2VV9A 4WHZA 3MVJA 1O6YA 3OUNB 1V1KA 2Y4IC 5B2KA 3ZZEA 4HNFA 4KA3A 3P7CA 2OSCA 4NW5A 5AUTA 3U8WA 3KCFA 3CD3A 2XIKA 3D2KA 2O5KA 3JUHA 4ANNA 4DF3A 3ZUTA 5FEQA 2QOIA 2YM5A 2OGVA 2RG6A 4E4LA 3FMKA 2ZMDA 4BDCA 2W1IA 4A7CA 4GS6A 5J87A 3ZHPC 2G2IA 4XOZA 2UZTA 3VF8A 3EQBA 1WZYA 3F3WA 3FI2A 3IW6A 4FICA 4L42A 5E1SA 3VO3A 2CSNA 4CT1A 2V7OA 2JDRA 3P08A 4BBFA 2BCJA 3OP5A 3QKKA 2CKOA 4AA4A 4RA4A 3VQHA 4ZTNA 4QOXA 3TIYA 4MEDA 2F2CB 4RFYA 3LLAA 2G1TA 2O65A 2RGPA 3F5UA 4FOBA 2WTKC 1E1VA 5DA3A 5J79A 2XMYA 1JKSA 1OKZA 2GHLA 4NKAA 1IA9A 1P4OA 2CCHA 3SKCA 4C7TA 3PWYA 1QPCA 4HYHA 5BMSA 2OZAB 2IPXA 3P23A 4RIYB 2XK9A 2QHMA 1CKJA 4FX3A 1ZYLA 4FYOA 3CCNA 3HRBA 1SVHA 2PVMA 2VO6A 4RT7A 3CD8A 3FSKA 5H2UA 5HNBA 5I9ZA 4O7YA 4L8MA 2C5YA 2IZSA 4P2KA 1WBWA 5KHXA 3UTOA 1E1XA 5C4LA 4OAUC 3FKLA 3DK3A 3Q9ZA 5F94A 3THBA 4C3PA 5HQ0A 3RZBA 4PMSA 5IUHA 2ZDTA 1YWRA 3C4EA 4I94A 1NY3A 3DZQA 4MQ1A 4DCAA 3Q04A 3QA8A 3TV4A 1UWHA 3QYZA 4QYFA 2UZWE 3I81A 5ACKA 5HE3A 1YXUA 1V0OA 4QMXA 4X2GA 1ATPE 2UW3A 3ALOA 3QGWA 4QPMA 4HCUA 3VUTA 3QRTA 5EM7A 5JQ5A 4DHFA 4WG5A 3E8EA 4X2FA 3D14A 1PY5A 3LXKA 4IZ7A 2OJJA 2JIUA 1BI7A 3HV4A 3QXPA 2ITNA 4IC8A 5DVRA 4KWPA 4KIKB 4J52A 1OUKA 2R4BA 3DQXA 2CLQA 5FTOA 4UMTA 4ZSAA 5JKGA 3KRWA 4G31A 1BUHA 3DXNA 3EH9A 4IB0A 5DGZA 4GK3A 5A4TA 4W9XA 3SV0A 2BR1A 3ZRMA 3A4OX 3A7JA 3F7ZA 2F7EE 4V0GA 4G6NA 4DFLA 3FWQA 2QLUA 3BEAA 2QO9A 3L9MA 4FKWA 3SAYA 3VHEA 5JK3A 2VO3A 3ZFYA 5EKOA 3PJ3A 4EK4A 4G3DA 3H3CA 5DLSA 2ETKA 2QU6A 3G0FA 5CNOA 5D7AA 4CCUA 3DBDA 3MVHA 4J95A 4F1MA 1CMKE 3W2SA 3FMMA 1Q61A 3Q9WA 4L53A 4O2PA 4RJ6A 5F95A 1PJKA 3NRMA 3SQQA 4YR8A 5EW3A 3II5A 3FYJX 2HYYA 2BHHA 2WMVA 4IMYA 4NL0A 2P2IA 4EOOA 3F5GA 2Y6MA 2PVJA 4KKEA 5C4KA 3QD0A 5FGKA 3EN5A 3H9RA 2WMBA 4LRJA 1B6CB 4AE9A 4D2WA 1E9HA 3BV2A 4AA5A 4KBCA 3GGFA 2EXEA 2NRYA 3KCKA 3KULB 3EYHA 3L8VA 1KE6A 1JAMA 2F7ZE 5EYMA 2W06A 3V8TA 4CKJA 5HX8A 4BR3A 3NMUF 3VVHA 1YDRE 2WQBA 5ETFA 4YPSA 1VYWA 4DTKA 4R5SA 1GIIA 2H34A 5E8WA 4EH7A 3SVVA 4FTCA 2BZKB 4MX9A 3KU2A 1EH4A 1XH9A 2GS7A 2ZB0A 2GFCA 2ITQA 1Z57A 4O0YA 4LUEA 3MA6A 3WE8A 4JT3A 3NW7A 2UZBA 2XA4A 4U3ZA 3Q4ZA 2W1GA 4FZAB 3T8OA 5IPJA 3UQFA 1ZARA 3L9LA 4YBKA 4BCFA 4EHVA 2OZOA 2UZUE 1B39A 1ZMVA 2C1BA 4D1XA 4XEYA 5AV2A 2RF9A 3HRFA 5CXZA 4MNEB 3HAVA 4CCBA 3HNGA 2W4KA 3AOXA 4ZZNA 2QOCA 2VNYA 2VU3A 3FL4A 4G6OA 4I5HA 3ZM9A 4QP8A 3ANRA 4F08A 2BAQA 2B54A 4BIDA 1YKRA 2OLCA 1SVGA 3LCOA 1URWA 2W1DA 3QUPA 4MXCA 4WG3A 4ZTQA 4EZ7A 4I92A 5IA4A 2O63A 3REPA 1VEBA 4GG5A 4KKGA 1TQPA 1UNGA 1GZOA 3A4PA 3MFSA 2XIYA 3G6GA 5CZIA 2VTAA 3TTIA 2OJGA 4AE6A 4YURA 3KN6A 1UVRA 2ACXA 4KIPA 3CQUA 3MH0A 2QCSA 5FXRA 3BKBA 3VRZA 3ZLSA 4O86A 1YHWA 3DKFA 3HV6A 4QQTA 3WYXA 4EQCA 3R0TA 4FKSA 5AJQA 4O84A 4TZRA 2B4SB 4J7BA 4FR4A 2BFXA 4YLKA 1ZOHA 2OIQA 4FSQA 1ZMWA 4GV1A 3DY7A 1UU3A 3TT0A 3ZTXA 3TNPC 2FSTX 4AGDA 3BGPA 4E4XA 4ZY5A 4FTIA 2XK6A 2YFXA 3LE6A 4QMPA 4BVUA 3G6HA 4GSBA 4N4SA 4QP3A 3V8WA 4F9WA 4GG7A 5DH3A 5DN3A 3U6IA 2A1AB 2R5TA 4QTCA 5LMAA 2BZHB 5EI6A 2VTJA 3GCPA 4BWPA 1W98A 2QD9A 4KSQA 4LMNA 3ZDUA 2YDIA 3R1SA 4ASXA 1JVPP 2QOBA 3IW5A 4N70A 4IE9A 4HW7A 4JRNA 5HBEA 3OWPA 3IGOA 3KVXA 4A4XA 5F1ZA 5AR4A 3MFTA 5HO8A 4D2PA 3U54A 4L7SA 2PMOX 5H8EA 3PY0A 3SG8A 4B7TA 2PVKA 4BGGA 2DQ7X 2YAAA 1WBNA 2ZYBA 3BEGA 3H10A 4U9AA 4BDFA 4J71A 2C68A 3F3UA 4FT5A 5L6PA 3R9RA 4LL0A 2G2FA 2WTDA 2QOLA 4QQCA 3PVBA 2ZOQA 4BCIA 3KXHA 5HE0A 3P7BA 5KMJA 2VTTA 4G16A 4C0TA 4D0XA 4D2SA 5LXMA 2QODA 4S33A 4FEUA 5FDPA 3ID6C 2O0UA 3R2BA 4MBLA 4FKIA 4DG3E 2XYUA 2GS2A 4H1MA 4TNBA 2VTRA 4C33A 3UBDA 5AUUA 2X4ZA 5K5NA 5EOLA 4XG9A 2OXDA 3E93A 2J0LA 4S32A 1J7IA 3LJ2A 5AP2A 1WBVA 2FYSA 3KRXA 3KEXA 4WO5A 3R8UA 4FTMA 4K18A 2J9MA 2O2UA 2CDZA 2QVSE 1OM1A 2WOUA 2YIWA 3D94A 1H1WA 3ORLA 4CFWA 2X7FA 2J50A 4R1VA 1H8FA 4F4PA 4A06A 4ENXA 5HICA 5CT7A 3R71A 5M09A 4L3PA 4UALA 1H01A 1S9JA 1UKIA 2OH4A 2WEVA 5KMIA 1DI8A 2I40A 4PX6A 5CU3A 1K9AA 1FVVA 2XIRA 3UZTA 2PSQA 3RNYA 5IQCA 4RJ5A 3NUAA 1STCE 3TZMA 4X2NA 4GVAA 2YCQA 4JXFA 3D9VA 4NM5A 4BGQA 3UC4A 4PWNA 2VO0A 3FQSA 5GINE 3LFDA 4NFNA 2HAKA 1K3AA 2Y6OA 4L68A 5DHJA 5I9YA 2HENA 1R0EA 1XBAA 4GK4A 4MXAA 2CGWA 2BIYA 3BLHA 3W1FA 1AGWA 2C5OA 5F20A 3PE2A 3QQLA 4EHZA 4HVIA 5JEBA 3WARA 5FD2A 3W55A 2ITPA 3VC4A 5CX9A 2VWZA 4CYJA 2X7OA 2XIXA 4L3JA 4EOPA 5EFQA 4DBNA 3KREA 4WSYA 3PVGA 3AD4A 3QWKA 4FIIA 3QU0A 2W4JA 4QNAA 4R3CA 1SM2A 4FTJA 1PMVA 4OW8A 1YWNA 1DAYA 5JRSA 4FIEA 4QQJA 2AC3A 3ZO4A 3ORKA 5EHLA 5LCJA 4M13A 3RAKA 3MTFA 4II5A 3JVRA 3JY9A 3MVLA 4YZ9A 4V01A 1NT2A 3MY1A 3HEGA 2C6EA 2R64A 3FLZA 4RWLA 5IA1A 3P86A 3Q53A 3WZUA 4LGDA 2BRNA 4M3QA 3O8TA 3WZKA 4CTBA 2J6MA 4M69A 4TYGA 3FZ1A 4YJPA 3N9XA 4DN5A 3AGMA 5IMXA 3HL7A 1YXTA 5J9YA 2WMTA 3SHEA 3WZEA 5HTIA 5AM6A 2OO8X 4P90A 4R5YA 4WA9A 3M2WA 4BZOA 2XBAA 4WOVA 3RGFA 4NH1A 2QO2A 4NUSA 3K5VA 2H96A 5E8XA 5M56A 3PYYA 4X3JA 5LMKA 3TUDA 5T68A 5BMMA 3JVSA 2DUVA 4XBRA 4NCTC 2OF2A 4FNYA 4I6QA 3TN8A 4BCKA 4X3FA 3EQIA 4MHAA 4TYJA 1WAKA 4K2RA 1ZYJA 4QT1A 4RC2A 4OLIA 1OKYA 2PE2A 4DFNA 4PNKA 3CY2A 2WOTA 1OPKA 5HIEA 5IEYA 3QTWA 2W1EA 2R3NA 3DFAA 3K3JA 3KXNA 1Q8YA 2JBPA 4CXAA 2REIA 3DLZA 2E9VA 4U81A 2EXCX 4AOTA 2QR7A 3EQCA 5E8YA 5AX9A 4A9TA 1PXNA 5HNIX 5AR7A 1CKPA 2WKMA 5L2QA 1OMWA 3RK5A 3AC4A 5HCXA 3RP9A 5JRQA 3R6XA 3PJCA 1RQQA 3NCGA 3QL8A 4MYGA 1PMEA 2ZMCA 4CEGA 5D1JA 3LQ3A 3L9NA 4HCVA 3RMFA 1J1CA 2W4OA 4PTEA 4U42A 3DNDA 4XLIA 5BVWA 4A9YA 4IAZA 4L67A 1OECA 4U0IA 4DEGA 4CVAA 4ZLOA 2VTQA 3OW3A 4FV9A 3FAAA 3I7CA 3C13A 3PFQA 3LCTA 3VBWA 4F64A 3R2YA 3FKOA 4NCTA 3QTXA 1YI6A 1PHKA 2VWBA 2XEYA 3MFUA 3MGYA 4H58A 1PYEA 1PMUA 1ZAOA 3P1AA 1HOWA 4LGHA 3C5IA 2RFNA 4FV5A 1XWSA 4MK0A 4DFBA 1MRYA 3ORZA 5DEWA 2JIVA 3EOCA 5BX0A 2F57A 1CKIA 4C3RA 4O7TA 4M97A 4FL1A 3UVPA 4EJ7A 4X2JA 3FLNC 3PXYA 4AF3A 4WSQA 4LOQA 4FBXA 5AV4A 3FI3A 3ZRKA 4L45A 4IWOA 3FMEA 3P5KA 5M44A 4AZEA 4ASEA 2PZIA 4MXYA 2CKPA 3FZSA 4IM3A 3COMA 3Q6WA 4K77A 1S9IA 3BIZA 2XNEA 3AT3A 5CQUA 4OUCA 5LWNA 4IWPA 4E20A 1OI9A 3HV7A 4L7FA 3WYYA 4E7WA 1IAJA 2VTIA 4NWMA 5J8IA 2V62A 2YM8A 5EH0A 1GNGA 5HU3A 3BYVA 4AW0A 1SYKA 2NP8A 2C1AA 3NUSA 2F9GA 4CD0A 2O3PA 4IX6A 3S2PA 4BCQA 4EL9A 1XJDA 4TNDA 4UMRA 1LR4A 5CF8A 3ITZA 4E93A 5C27A 3BLRA 2OH0E 3VS6A 2J5FA 3FE3A 4JLCA 5AAGA 5KNJA 4PNIA 5JZNA 3GVUA 3UO6A 4DTAA 4NTTA 4RVMA 4R78A 4IVDA 3LFEA 3TV6A 3ZXTA 4DFZE 4X0MA 2HCKA 1UNLA 5B0XA 2QKRA 1VR2A 4EH9A 4J98A 3DAJA 4QP2A 5LJJA 4HPTE 1OPJA 3K54A 3O8PA 2OG8A 1IG1A 4FT9A 3Q6UA 3FZPA 3CEKA 4U5JA 3RPOA 4DEEA 3QQGA 4D2TA 5LOHA 2CKQA 2HZ0A 1R39A 4O0TA 4XCUA 4K11A 5C26A 4FSZA 3C5UA 4E6QA 1H26A 1YHSA 2JKKA 3F6XA 4BWKA 3QZHA 2OIBA 4WNMA 3SOAA 3PZEA 4NIFA 5CF5A 2YIXA 4C4JA 4EHGA 4O0WA 3QX4A 4RC3A 3RJCA 3VWAA 5CEOA 2B53A 4BIBA 4Y95A 5F9EA 3LXLA 3I5ZA 2XUUA 3QCSA 1BMKA 4F63A 3FMDA 2A27A 4OR5A 4DBXA 2OBJA 4O1PA 2OF4A 2XRUA 4Y85A 4XP0A 4DGOA 5IA5A 3LFBA 4C4FA 3TNQB 2JFMA 3EQPA 5CSWA 3F2RA 4BCNA 3NAYA 1OL7A 5IQAA 4F9AA 4TYEA 4GJ2A 4FYNA 4ACCA 3BV3A 3NNXA 3B8RA 2RG5A 4APCA 4BRXA 2WMXA 2YIQA 2XVDA 2X2KA 4CMTA 4AFJA 3D0EA 4H3BA 4IEBA 4C02A 2W96B 4I1ZA 3DV3A 3DJ5A 2EVAA 2BAJA 2C69A 3SA0A 3PPJA 4Z7HA 4WBOA 4BZDA 2XNBA 3ZBFA 4FT3A 5FP6A 3S1HA 2VN9A 4XG2A 4EH4A 3GBZA 3UODA 3IPHA 4RJ3A 2WQEA 3LJ0A 4L01A 4MH7A 3WF9A 1DS5A 2I0YA 4G9RA 3TM0A 4FKTA 3QF9A 4ITJA 5JMSA 2GNFA 3JYAA 5GNKA 3A62A 2UUEA 4OTFA 4Q5EA 4GEOA 2UW7A 3H4JA 3D7TB 3OFMA 1KWPA 4GIHA 4K8AA 4NK9A 4ZSLA 4BI1A 1Z9XA 1UU9A 2WHBA 1MQBA 2XK3A 3DPKA 4GT5A 1A48A 4FUXA 3D83A 4JL9A 3E8CA 3ATTA 4BY9E 4P5QA 3OTUA 2FUMA 2BALA 3BU5A 3O8UA 4AP7A 5TR6A 3Q5ZA 3O51A 3ORXA 5CY3A 1OPLA 1P5EA 5HO6A 2YLEA 3R7VA 2JAMA 4C58A 3DAEA 2PL0A 4MCVA 4DINA 3UOLA 2OKRA 3ENMA 3PXQA 3C4XA 3DJ7A 2DYLA 4JR7A 2EWAA 2ZV2A 4RWJA 4XX9A 3LVPA 4FKGA 3AD5A 5HG7A 4FIFA 2QG5A 3HP5A 1LEWA 2W99B 3P9JA 5BUIA 5AA8A 3MTLA 3TDWA 3PXZA 2FVDA 5C03A 3I4BA 2VTNA 3BYSA 4A9SA 3KB7A 4AAAA 3HMIA 4GU9A 1ND4A 3EQFA 4RVLA 4R1YA 5IQHA 4Q5HA 1JQHA 1Q24A 4F9CA 2C0IA 4LM5A 4YC3A 3E7OA 3DKCA 3OWLA 3QBNA 3UC3A 4Z9LA 2SRCA 3AC1A 2PMLX 1Q99A 3GP0A 3TKIA 4RJ4A 4NM7A 3TI1A 3Q60A 5AEPA 3EB0A 2WMRA 4L52A 1KV2A 4YJNA 2A4LA 5AP6A 4AA0A 5LWMA 3CPBA 4C38A 4D4YA 1OITA 3MESA 4QYEA 1R3CA 4FGBA 2ITWA 2WMUA 3PSCA 4QQ5A 2H8HA 3UNKA 2UVXA 5GJFA 1J91A 3FMJA 3P7AA 4RZWA 3S00A 4AOJA 3VIDA 3OG7A 1Q3DA 2Y4PA 2YABA 4EHEA 3G90X 1YDTE 1M14A 2VRXA 3HA8A 5CASA 2IN6A 4LV5A 4TWOA 3R1NA 2PZYA 3T9TA 4E4MA 2X1NA 2HOGA 1XH5A 5HGIA 3TEIA 4AGCA 3ZXZA 5K5XA 4YJQA 5AP0A 3KXZA 1PXPA 3UQGA 3E62A 2R3GA 4NTSA 3PA3A 4UWCA 4RBLA 3CTQA 4F6SA 5HZNA 1WBTA 3DOGA 4G5JA 4AACA 2Y9QA 2PVLA 3KRRA 4EBWA 4FSRA 5AUWA 4FMQA 4PL4A 2BRMA 2C6KA 2J2IB 3EN4A 1APME 2VZ6A 3P4KA 4YJTA 3UIBA 1M7QA 5C8KA 3A2CA 1Y91A 3COIA 4N6YA 3KF4A 4D2VA 1JWHA 4IVBA 3W18A 2IZRA 5CEKA 3LFCA 3HKOA 1IR3A 1XO2B 4RFZA 1XH7A 2YJSA 3BE2A 3IGGA 4RIWA 2R7IA 4PMTA 4UZDA 1Q8WA 4WNKA 4ZTMA 3CKWA 4YHJA 4DT8A 1J3HA 3PG1A 5ANDA 3FYKX 4KIOA 4EQMA 4XHKB 1OL6A 2GNIA 3O2MA 4O91A 2RSVA 5FM2A 3TACA 5M4UA 2ZAZA 4D9UA 2YIRA 1PW2A 5JFVA 4F9BA 3DNEA 4OT6A 5CENA 3Q3BA 4CRLA 5ITAA 3ORIA 4B4LA 3EQGA 4HZRA 3AC5A 4I0SA 4AT5A 1WBPA 3RBWA 3VF9A 5D12A 4ZTLA 5KBRA 4E1ZA 3O96A 4NM3A 2Y0AA 2YM4A 3DGKA 4XV3A 3R30A 1KE7A 4YZDA 4YO4A 3RM7A 3OW4A 2C5NA 3QTSA 4EK8A 3AT4A 2UW9A 2ZB1A 4Y72A 3PRIA 3O50A 3FPQA 3TXOA 4B0GA 3BHYA 3OT8A 4I5MA 3W8QA 3LXPA 1F5QA 2QOQA 5BYYA 4FL3A 4RVKA 4YJRA 4USEA 3GUBA 4TYHB 3EN7A 3C0HA 3LXNA 3QQHA 3RAIA 2RL5A 5M4CA 3DKOA 5AAEA 5IQDA 3VHKA 5HESA 3TG1A 4FKUA 2I0VA 4ZSGA 2XIZA 3LKMA 2R7BA 4ZMFA 4IDVA 3UIXA 3FI8A 5H8GA 5IQBA 3JPVA 5G6VA 3ZC5A 3RAWA 4AS0A 3EL7A 1ZMUA 3NR9A 4K1BA 3A7GA 4XRLA 5I9UA 2F4JA 3BU3A 4GYIA 3FI4A 5K4JA 3CXWA 4N6ZA 3A7FA 4JR3A 3VS7A 4RX5A 1PXLA 4JBVA 5AUXA 2Z7RA 4LL5A 2G2HA 2QHNA 1Z5MA 2BROA 4GH2A 5IQFA 4I93A 3VUIA 4U43A 4M0ZA 2XJ1A 2XNNA 2WTWA 4RX9A 4CTCA 2CLXA 2UZNA 2J0JA 2ERZE 5ANJA 4O6EA 5FXSA 2HZ4A 4C4GA 3QRUA 4E6AA 3DBEA 4UN0C 4O0RA 2FH9A 3ACKA 2UW4A 4FT7A 4JDJA 4W4VA 3ROYA 4JBPA 3SDJA 4EEVA 3LMIA 2VWUA 3I7BA 2R3IA 2PVNA 4NEUA 1JLUE 4ANLA 5GIOE 3UO4A 3R8MA 3W2OA 4PP9A 5HCYA 1G5SA 3MVMA 3IS5A 4DH8A 2ITXA 2IVTA 4MBJA 1GZNA 3SC1A 3GI3A 1J7LA 4CG9A 3QA0A 2W1CA 4JQ8A 1M17A 2PUUA 4WRSA 4ZP5A 1XH6A 4FI1A 2OZAA 3HGKA 2ERKA 4RIYA 4S30A 4AU8A 3PXFA 4CNHA 5IUGA 2Z60A 3HMMA 3SLSA 4IAIA 3M42A 2DWBA 3ZO1A 1ZYCA 3QZGA 3RWQA 3I6WA 4IVAA 2P4IA 2UZEA 3QQFA 4F09A 4B9DA 2CNVA 3A60A 3VUMA 5D11A 3UMWA 5AM7A 5HEZA 4D4VA 1W7HA 2JKOA 2Z7QA 3NUUA 4IFGA 5CU2A 4ASZA 3VBYA 2WTJA 4RLLA 3RI1A 4YC8A 2UZOA 3KFAA 4FZDB 3S95A 3F69A 2J0KA 3TZ9A 3TNIA 4ID7A 5JGAA 3LFAA 4S31A 2QR8A 2WB8A 3O23A 4LMUA 5FUTA 1Q62A 4C62A 4O7WA 1U5RA 3QLGA 2XNOA 3KMMA 3BYOA 1SNUA 1U54B 3NIZA 4UWBA 4BKYA 4M68A 2O8YA 4DH3A 5J1WA 3R7UA 3V5LA 3KXXA 4PQNA 5E91A 4YGAA 1G8SA 2KULA 5HKMA 3SD0A 1Q8UA 1U59A 4IWQA 4OTPA 3OXIA 2XK8A 3VULA 4RIXB 3G33A 4RQKA 2UW6A 1L3RE 4EH8A 2B7AA 3FL5A 1TVOA 3UPXA 3WIKA 4NT4A 1JKTA 2WNTA 5JH6A 3B2WA 3MWUA 3Q9XA 4FKJA 4U44A 1ZZ2A 3TWJA 1ZYDA 5CAVA 5CEMA 2BZIB 3UIUA 5EK7A 3ZLWA 4R7IA 4M8TA 4UMUA 4L00A 3OXTA 1OL2A 4BN1A 5ETAA 4RIOA 2EU9A 5CT0A 4RJ8A 2CGUA 3KK8A 5IH5A 2C0OA 5CANA 3SRVB 4ZZOA 3EN6A 4UY9A 1IRKA 4TWCA 4WIHA 4E3CA 4J53A 2YJRA 3CIKA 4UXQA 3ORPA 2EB2A 4U8ZA 3NYVA 4J8MA 2GNGA 1F3MC 3VJNA 3F2NA 4EZ3A 1VJYA 1JBPE 4YZBA 3IK3A 3QLFA 5CQWA 5HLWA 3AC8A 1H28A 5M06A 1NVRA 4OBOA 4BI2A 2W1HA 3KULA 4IX3A 4I6HA 5BQ0A 3POZA 5LVPA 3MB7A 2QC6A 4IBMA 5H3QA 4UX9A 5IA0A 4AXAA 4HZSA 3MN3A 4G3CA 1FMOE 1DM2A 3F3TA 4GMYA 1WCCA 3HP2A 4EKLA 3FKNA 2VX3A 1RE8A 3OTVA 4XG8A 1KUTA 3ULZA 4YPDA 4BGHA 3HDMA 3OY1A 1XR1A 4PTCA 2C6DA 1G3NA 5A6NA 1YRPA 4W8EA 5CAQA 1PXOA 1YXVA 3OT3A 4WD5A 4XG4A 4BCHA 5E7RA 3EWHA 2OXYA 2C0TA 3QD3A 1ZY5A 3GNIB 4NJDA 2C30A 3PXRA 4TW9A 4UBAA 3Q2JA 4AW2A 4V05A 5E92A 4F0GA 4ANSA 4FTQA 4FTNA 2G01A 3AGLA 2NO3A 5CU4A 2P33A 3NUXA 5I3OA 5A3XA 4W8DA 4DLIA 4MBIA 4D4SA 4MNEA 3U4WA 3IONA 2UZLA 3DTCA 4KNBA 4BBMA 5H9BA 4DCEA 2WQNA 4FF8A 3UZPA 4JG6A 4HNIA 3T9IA 4OTRA 3ELJA 1OZ1A 2F49A 4AUAA 3K2LA 5EQYA 4F0IA 4FC0A 4FIGA 5TKDA 4OTHA 4BC6A 1H1SA 4DG2E 2QOHA 4IADA 5C9CA 3BHVA 3E7VA 3FPMA 2FGIA 4JI9A 4YZMA 5GZ8A 4B8MA 4GK2A 2WTVA 1GZ8A 1PKDA 2J4ZA 3FBVA 1V0BA 3PPZA 3FLWA 4G1WA 4H39A 3CTJA 2YERA 4GW8A 4HGEA 3O71A 4UXLA 5HCZA 2BAKA 2Z2WA 5DWRA 1KOBA 2X9FA 4O7NA 2GTNA 1YW2A 2PK9A 3G5DA 1YOMA 2PZPA 2FO0A 4JDKA 1PYXA 4PUZA 4M84A 3A99A 3C51A 2OWBA 5C8MA 4ZTRA 3DLSA 3GCSA 3JY0A 3PSDA 4GIIA 5EYKA 1ZY4A 2C6IA 3W32A 4CZYB 1OIQA 5IH4A 3UOJA 1PF8A 2WQMA 3MS9A 5C8NA 5K3YA 3D7ZA 4IVCA 4L44A 2AC5A 2B0QA 4IJ9A 2C3IB 3RHKA 4BYJA 3MFRA 4C2WA 3FMNA 4C2VA 3FY0A 3KY2A 4GYGA 3OOGA 3C4CA 4H3QA 4HYIA 4G6LA 2I6LA 5LVMA 2ETMA 3W2QA 2B1PA 2QU5A 3S0OA 4GT4A 3DDPA 4ALWA 4O7ZA 3NUPA 4ZK5A 2VTSA 2XCKA 5EQPA 5I9XA 4NFMA 3Q4TA 1H1QA 1YWVA 4ZLYA 2W9ZB 5I3RA 2V55A 3A8XA 2VD5A 1YOLA 3B8QA 5GIPE 2Y8OA 3KF7A 4DGLC 4MKCA 5CS6A 4TWNA 4TWPA 3CLYA 5IF1A 2XK7A 4QRCA 5L2TA 5C01A 2W17A 2YCFA 3LHJA 2HZIA 4RC4A 4DEBA 4F9YA 3AD6A 3COKA 1P4FA 4FK6A 3TUCA 3LFNA 2C6MA 1WFCA 4IB3A 3SOCA 5ANOA 4BCPA 4FNXA 2UVZA 2JDOA 2PYWA 5FEEA 3CC6A 1O6LA 3GEQA 3P78A 3PY1A 4FSNA 3I60A 4I6FA 4D4RA 3HMOA 5EDPA 5EHYA 3BQCA 3EZRA 4FOCA 5I5ZA 3BHHA 5A9UA 5KO1A 2YEXA 2XZSA 3PZHA 4O7SA 3R7OA 3S3IA 4A07A 3CE3A 2PPQA 5AR5A 5BNJA 3IW8A 1X8BA 4TT7A 3TJCA 5IU2A 3UIMA 3F2AA 4NSTA 4ZJVA 3BX5A 4FV2A 4ZZMA 3QQJA 4YUQA 2Z02A 5HO7A 5KX8A 2VTHA 3QX2A 3RK7A 2QURA 4XV2A 5CVGA 4R77A 5JQ8A 4PY1A 3GU4A 4I41A 4YZNA 1OL5A 3CKXA 2F7XE 2F2UA 3F82A 4X6QC 5M08A 4KB8A 2PHKA 4RSSA 3QTRA 3TKUA 4XJ0A 3NGAA 1JKLA 3EKNA 5KMMA 2BKKA 1YOJA 3ZYAA 2YLFA 3QFVA 5GJGA 4LUDA 4TTHB 5B2LA 2W5HA 4FV7A 4PPCA 2FSMX 4FKQA 5IUIA 3JR1A 5CZHA 2WTIA 1M2RA 3FLYA 3D5WA 1Q4LA 3LFSA 4CLIA 5KMLA 3VS4A 3CGOA 5D10A 4EKKA 2WZJA 2XNGA 1KV1A 4J8NA 4BDBA 1TQIA 1NVSA 1WBSA 4DH7A 4BDEA 4PPBA 5GHVA 2BVAA 4U40A 1K2PA 3PIXA 5EW9A 4O6LA 4YBJA 5AV3A 3VS2A 4F99A 1H4LA 1OGUA 3GFEA 4ZXTA 1XKKA 2OFUA 4FIHA 1KSWA 2P0CA 4BBEA 5CI6A 3HMNA 4ANOA 2ZV7A 4LYNA 4O0XA 5J5SA 3HECA 3I6UA 3NZ0A 3QTQA 3KKVA 4YSJA 3MDYA 1KOAA 2OFVA 4IZ5A 3KXMA 4R7HA 4IB1A 3E3BX 2WTCA 4XUFA 3RWPA 2H9VA 2IW6A 5A6OA 2VWYA 1H1PA 2J5EA 3TUBA 4LQMA 4UWYA 3PJ1A 3VS1A 4QMUA 3QUEA 3F66A 4ZTSA 3CJGA 4KABA 4NJ3A 3GT8A 4D5HA 4USFA 4CFVA 4CRSA 3H9FA 3UP2A 3ZONA 1Y8GA 2R3JA 3BBTB 4Z3VA 4U41A 4LV8A 5FWKK 4EC8A 3B2TA 3KMUA 5DT4A 4M15A 4AZWA 1P14A 5AUZA 3MJ1A 1QMZA 5DT0A 3AQVA 3OD6X 1OB3A 5HI2A 4ZLZA 4QTEA 5LMBA 4FTRA 1A06A 1W0XC 4PDYA 5HE2A 3L9PA 3R9DA 3GC0A 4FTUA 3PUPA 5HBHA 4CZTA 3AC3A 4BFMA 3LIJA 1ZXEA 3KRLA 5L4QA 2W5BA 3R02A 4O38A 1MUOA 4OAVB 3G9LX 4O21A 5CI7A 5A54A 4FG9A 3W2PA 1GY3A 4QMSA 4YSMA 4E73A 2IVUA 3LFQA 4I20A 4ONAA 2XKFA 4QMTA 4YJOA 3UYTA 4P4CA 5FDXA 2WFYA 5FQDC 3ZCLA 4YMJA 2CPKE 3FQEA 4YJVA 4ACGA 5HLPA 5J1VA 4YC6A 4W4XA 5A4EA 3IW7A 2GHGA 4OTWA 4KS8A 1ZLTA 1BL7A 4O83A 4EH2A 2JKQA 4V04A 4AGUA 3MSSA 2C5VA 4FSWA 4FKRA 2YWVA 1CM8A 1Q41A 2J51A 3LPBA 5KE0A 3Q52A 5KZIA 5LVLA 5IQGA 2R2PA 4HVGA 4QMYA 2ZM1A 2RFDA 5FBOA 3R7YA 4X6RA 3Q5IA 4E26A 2GPHA 3FXWA 5IG1A 5FBNC 3QWJA 2LAVA 3EHAA 3OEFX 4N0SA 3FMLA 4ITIA 5CVFA 4K6ZA 4DH1A 4IW0A 4S34A 2JEDA 4TY1A 3UE4A 5ACBC 3LQ5A 5E8VA 3SGCA 2R3RA 4PDSA 5DR2A 3UJGA 3LMGA 2PUPA 4FSYA 4JIKA 4XV9A 4GVJA 4E8AA 4XG3A 4JDHA 2G9XA 3DZOA 3GCQA 5DPVA 5K0XA 3BGQA 4RG0A 5DMZA 3Q9YA 4WT6A 4ZSJA 3R01A 3VS5A 2WPAA 4X7QA 3C0IA 3ANQA 3PXKA 4Y5QA 2CHLA 4BKJA 5JSMA 2WMAA 3OF0A 3E8DA 4BTMA 5H8BA 5CAOA 2JKMA 4ZSEA 2PMNX 3PA4A 2W1ZA 4U80A 3U9CA 2RIOA 3E3PA 1Q8ZA 4HYSA 4MTAA 1NW1A 4LOPA 5E90A 4HOKA 3CS9A 3DA6A 4FNZA 2R0UA 4XMOA 2QKWB 4ERKA 4CMOA 3O7LD 5CYIA 4BZNA 5LVOA 2XP2A 4DYMA 2VWWA 4FL2A 5ANIA 1Y6BA 2JBOA 4QYHA 5GJDA 2Y7JA 2W7XA 3V5TA 3CP9A 4GUBA 3GU6A 5AAFA 4OBPA 4YHTA 2R3OA 3E88A 3E92A 3GCVA 3I0QA 4KAOA 4BWXA 2PY3A 2JLDA 4HGTA 3OC1A 5DR9A 2E9NA 3VW8A 3WZJA 3VBXA 4IM0A 2XH5A 1Y57A 3CJFA 3HV5A 2CN5A 3UVQA 4WRGA 5DNRA 4PMMA 3S4QA 5T6KA 2X2LA 3EZVA 4EOSA 4YO6A 5IISA 5CVHA 5K4IA 4QNYA 1ZOGA 4BCMA 4BI0A 3R7EA 3K5UA 4A4OA 3KL8A 2OW3A 3LJ1A 1R0PA 5HD4A 2YISA 3TKHA 2OJIA 3ORTA 4BCGA 3PVUA 4C4EA 3ZBXA 3L8SA 1R1WA 3FY2A 4ZEGA 4Y8DA 3ZS5A 3OS3A 4I6BA 2IWIA 3AMYA 4NM0A 5DEYA 3UGCA 3WF6A 3UPZA 5BUJA 3KQ7A 3QTUA 3PP1A 4FV4A 5JFXA 1ZZLA 4PDPA 2XYNA 5CF6A 3FHRA 4I3ZA 4D58A 5BVOA 3NVMB 3NNWA 1VYZA 4O7VA 4AT4A 3OXZA 1QL6A 3OY3A 4I4EA 1BI8A 4Z55A 5IEVA 2PULA 3NYNA 5HOAA 4QYGA 4KBAA 2YIYA 3K3IA 5EOBA 4I21A 4RRVA 4Y73A 4MAOA 3QYWA 5DFPA 4EH3A 3MIYA 5HVYA 4PMPA 1M52A 2ETRA 1H24A 2OJ9A 3SW4A 4YTCA 3N4VA 5K9IA 4DE4A 4UB7A 3VRYA 3KA0A 4DC2A 5A4LA 2BTSA 4AQCA 5L8KA 4FEWA 5D7VA 1WVWA 3AXWA 2Q0BA 2GSFA 4FZ7A 5AV0A 3RCJA 4EC9A 2WU7A 2X39A 5T3QA 3V04A 2GQSA 5CWZA 4AT3A 2XNPA 3QC9A 3UNJA 5JN2A 1GZKA 1XHAA 2FB8A 3ERKA 3VBTA 3M11A 4DGMA 4QPAA 3JXWA 4DEHA 4DH5A 1BL6A 4L43A 4TXCA 3QHRA 4FV6A 3N4TA 2UZVA 1RJBA 2IVVA 3LAUA 3BCEA 3OCGA 4PV0A 5DRDA 3RCDA 4FVQA 5KBQA 1RW8A 3TZ7A 5BVNA 1JKKA 4YHFA 3OBJA 4O7LA 1O9UA 2W0JA 3EFKA 3HUCA 4JQ7A 4XH6A 1ZRZA 4C35A 1OBDA 1Q8TA 4FT0A 4NU1A 2BPMA 4BDAA 4FEVA 1GIHA 2JD5A 4BTKA 4EK6A 3MH2A 4RX8A 4RA5A 4YP8A 4M12A 2X0GA 3E87A 1OL1A 2XKEA 2X2MA 3NLBA 3PJ8A 4AN2A 4NW6A 1KE8A 3F5PA 3GFWA 3ZEPA 4I5CA 5AP4A 4BTJA 4D5KA 3ETAA 2WMSA 5BVDA 3FUPA 2ONLC 2RFEA 2X81A 4OTDA 5HNGA 3LW0A 4I0TA 3HUBA 1WVXA 1L8TA 5EDQA 4EOLA 5HX6A 2RFSA 5J9ZA 4DFUA 3AMAA 1QPEA 4NKSA 3OHTA 2PZ5A 3UG2A 1CDKA 5FXQA 3GU7A 5TT7A 3C0GA 3HRCA 3LCKA 4P7EA 3V51A 1GIJA 4IANA 4BHZA 4LI5A 3D5UA 2C3JA 2PTKA 4PL3A 3OZ6A 1W82A 3MV5A 1UNHA 4IZYA 3EQDA 3PRFA 3FXZA 1YI3A 4EOMA 3D7TA 1W84A 2VX1A 4D2RA 5BVFA 3ATSA 4RWKA 1NA7A 2OJFE 3FLSA 4DFXE 2E2BA 4MD9E 5L2SA 3R28A 2X7GA 4FGRA 4HGSA 1NVQA 3GB2A 4QP6A 3FLQA 4EOQA 3PA5A 3DS6A 3U4UA 4F7NA 5CU0A 4HCTA 3ZUUA 5E9EA 4FKVA 3W33A 4CQGA 4G3GA 2PWLA 2HY81 5AADA 2BIKB 4IACA 4EH6A 3EL8A 4FNWA 4DTBA 4OGRA 4C61A 4XYFA 2X4FA 5FRIA 2AYPA 2JFLA 3DCVA 3WILA 3F3ZA 3QCYA 2UW8A 3RNIA 3I79A 2YDKA 2ONLA 3PIZA 4JVGA 5BUEA 3BE9A 4YLLA 5CSVA 3VNTA 3DK7A 3GQLA 3LCSA 3R9OA 3ZLXA 4Q9ZA 2XM9A 4AN9A 4E5AX 3PWDA 1OKVA 5J5TA 3G0EA 4R7BA 2QO7A 2P3GX 3GENA 5BVKA 2YCSA 5AV1A 3PY3A 4L9IA 4H3PA 4OBQA 5EM5A 1U5QA 2XJ2A 3H0YA 4BDDA 2JIIA 5BYLA 4TN6A 4U7ZA 2VUWA 4ACHA 4CQEA 5AFVA 4FSUA 4F6UA 5HG9A 2VWXA 4E5WA 5EYDA 2WTKB 2BHEA 4QP7A 3FC2A 4EK5A 4EQUA 1QCFA 3EFLA 2WELA 4IAYA 3QAME 5JGBA 5AR3A 2GQGA 5CLPA 5KMNA 4JQEA 2XS0A 5CSHA 3AT2A 1IASA 4R3PA 3DXPA 2Z7SA 2PMIA 2WEIA 3PIYA 3C1XA 4FKLA 3DBFA 4V0GB 2W05A 4XP2A 4ALUA 5AA9A 4DGGA 3NNVA 4BL1A 4P5ZA 5IQIA 2VTLA 1M2QA 3NWWA 5TO8A 4AX8A 3T3VA 3R8PA 2C6TA 3BPRA 2BDJA 2C3KA 4ZY4A 3U87A 3PE1A 2CN8A 2LGCA 2JGZA 3BRBA 5IZFA 4LRKA 3BBWA 3SW7A 4E6DA 3V8SA 3I0OA 4HVDA 3CGFA 3W2CA 5HTBA 2UW5A 2XF0A 5B2MA 4IDTA 4BKZA 2C3LA 3VUHA 2GS6A 4OTQA 2YDJA 1OBGA 4HVHA 1CTPE 4IB5A 4YTIA 3OCBA 3F9NA 1U4DA 4BCJA 5L2IA 1XBCA 2HK5A 3WBLA 3ACJA 3E64A 3R22A 3D4QA 4KD1A 5AR8A 4ENYA 5JFWA 4AZSA 3UQCA 5G1XA 5M07A 4K9YA 3DAKA 2VGOA 5DOSA 2X8DA 4C37A 3WZDA 3ZRLA 2XM8A 4QMZA 4RGJA 3TNWA 4PL5A 4BDIA 2BDWA 5M57A 4PRJA 2NRUA 3NUYA 4I23A 5DG5A 3RHXA 3SXSA 4Z16A 2Q0NA 3HVCA 3IG7A 4JJRA 2VGPA 4JS8A 4XG6A 2FA2A 4MNFA 4YLJA 3N4UA 2RKUA 3PPKA 3UP7A 4F0FA 3R1YA 4FV3A 4EOKA 4LG4A 4U6RA 2W9FB 4KKHA 4YNEA 4TKSA 3ZM4A 4TL0A 3BLQA 2C6OA 3EFWA 3QD2B 1XBBA 4XOYA 2PVHA 3R8LA 4O0UA 2CGVA 2E9OA 2W5AA 3NNUA 3O0GA 3ODYX 5FLFA 5KKRB 4JBOA 1PKGA 5E8ZA 3ROCA 3GOKA 4A4LA 5AP1A 3VBVA 4E4NA 1H00A 4QMOA 4KRCA 4MXXA 3UZRA 3CY3A 5AUVA 2OXXA 5ETIA 4B8LA 4XG7A 5HG5A 3EMGA 4F7JA 4FV1A 3DKGA 2XNMA 5TE0A 4YU2A 3G15A 2GFSA 5ETCA 4AWIA 2EB3A 4O7RA 4IC7A 4M0YA 3MJ2A 4AOIA 4I5PA 3IECA 4O96A 3NIEA 3PJ2A 5EM8A 4DITA 4CKRA 2QLQA 4EI4A 3VS3A 3TL8A 3IDBA 4CT2A 2R3LA 2X6DA 2ZDUA 3TTJA 5D9HA 5J7HA 4FODA 3MBLA 4BF2A 3OWKA 4TYHA 3KXGA 4GJ3A 5AIRA 4H36A 5KKRC 4CG8A 2YWPA 3HLLA 4FEXA 5FG8A 3IW4A 3BWFA 1FQ1B 2I0EA 4DT9A 1JSVA 3QRIA 2PE1A 4G17A 5AMNA 3FJQE 3U6JA 2WMQA 4FZFB 1FVTA 2V0DA 2R3FA 3GC9A 4MQ2A 5FTGA 5L8JA 3DXQA 3BZ3A 5EHOA 3RKBA 5HD7A 5KCVA 1KE9A 1A9UA 4ANMA 5KMOA 2QQ7A 3LZBA 3TJDA 4EH5A 4FVRA 3R8ZA 2C6LA 3FMHA 3GC7A 3F3VA 1MP8A 5CEQA 1W83A 3BYMA 3TCPA 4M67A 4KIKA 5A4QA 3ENHA 1FMKA 3KN5A 4DEIA 3LMHA 3CR0A 2XK4A 1BKXA 3MA3A 4QMWA 4ZS4A 1MRUA 4C34A 1FPUA 2YN8A 4FEQA 3QUDA 2FSOX 1BLXA 2HWOA 3F61A 3R63A 4Q9SA 1GAGA 2WMWA 1PMNA 4IZAA 5DE2A 3MW1A 4ITHA 2BMCA 2HZNA 4UYNA 4YJUA 2XB7A 4YJSA 1XQZA 2NPQA 3TDVA 5AP7A 4S2ZA 4H1JA 5AX3A 2VAGA 2IZTA 2GTMA 2XKCA 3L1SA 3OMVA 1F0QA 4GFOA 3OROA 4TRLA 4WG4A 3WI6A 4EJNA 3QTIA 3FDNA 2ZV8A 2ITTA 4ZJIA 2V7AA 2WIHA 4BDHA 3FXXA 4UMPA 2YM7A 1H08A 4UMQA 3NSZA 2JITA 4UZHA 4O82A 2V22A 5EI2A 3DU8A 4EYMA 3O7LB 3VJOA 4F65A 5IKWA 3ZSGA 1PXIA 1WVYA 5DI1A 5DIAA 3OWJA 4IWDA 3FV8A 4YTHA 3DBCA 4G3FA 5HIDA 3OEZA 1OIRA 2QOKA 3MI9A 3ZZWA 3PSBA 4MXOA 3LLTA 3QKMA 1M7NA 4FG8A 1YXXA 3L8XA 4F70A 3NS9A 4CFFA 4FIJA 1UWJA
chains in the Genus database with same CATH superfamily
3TNHA 1G8AA 5DYJA 5I9VA 2ZM4A 3UYSA 1QPJA 1XH4A 2X0QA 4WUNA 3BWJA 3MPTA 4BYIA 2X9EA 1Q5KA 3W2RA 4QTBA 3BGZA 5KMKA 2WU6A 4YZCA 4EOJA 3ORMA 5IMEA 2V5QA 3ODZX 1U54A 2G15A 5EG3A 3ZEWA 2E9UA 5AR2A 2P2HA 3MB6A 3U6HA 4FKOA 3WE4A 3ZSHA 4CSVA 5KHWA 1UA2A 4GFGA 3ZDIA 1TFFA 2HW7A 2QOFA 3DB8A 4RQVA 2B55A 2Z7LA 3QGYA 2B52A 3RAHA 2GNLA 4RIXA 3SX9A 4G2FA 4C8BA 3GXLA 1DAWA 3VN9A 4XLVA 4ASDA 2GU8A 2OI4X 2X0PA 2R3QA 3OBGA 5E8UA 4H05A 4RMZA 4PDOA 3TZ8A 4FE2A 3MIAA 2A19B 2JC6A 1YHVA 3G51A 4ZY6A 5M4IA 3PP0A 4QP4A 3IOPA 5L3AA 2YZLA 2B9IA 2ZV9A 1MQ4A 3Q4UA 4KIQA 4ZIMA 3RPSA 2PVYA 3QCXA 2CCIA 3QD4A 4KS7A 5IH6A 4EORA 5JZJA 2PU8A 1OVEA 4QP1A 4EWHA 4FK3A 4G9CA 5EQEA 3SRVA 1YXSA 5FEDA 4XRJA 3R9NA 2I7QA 5F4NA 3R7GA 3R21A 4FV8A 3D5VA 3MY0A 3VBQA 4L6QA 3W0NA 3QXOA 1ERKA 5ICPA 3AMBA 4M69B 3CTHA 5ANEA 4MVFA 4QDVA 4EOIA 3FZTA 2R3MA 1H27A 2J0MB 3E8NA 4G5PA 4JX7A 4LGGA 5HORA 3NVKI 4HGLA 3PLSA 1SVEA 3EFJA 4AW1A 2BTRA 3HAMA 3N51A 3IOKA 2CNUA 4U97A 4C36A 4WUAA 4XS2A 4CV9A 3ZLYA 4DEDA 1UU7A 3QTZA 4G34A 1SNXA 3EKKA 3VW6A 3COHA 5LVNA 4W4YA 3KRJA 3QALE 1UKHA 4HYUA 4X3FB 4QMNA 3HYHA 5A46A 1JOWB 4PTGA 4X2KA 5EI8A 3NX8A 3C9WA 4JAIA 4O1OA 4BDKA 2IW8A 4F7SA 5I4NA 4IHPA 3C4ZA 2ITVA 4JNWA 2IO6A 4I24A 4UV0A 4AZFA 1H25A 3ZFMA 4CMUA 5TF9A 4W9WA 5IQEA 4W4WA 2ITZA 1V0PA 5CEPA 5AUYA 1SZMA 1VZOA 4FUYA 5DT3A 1HCKA 3R73A 1BX6A 4C4HA 1WBOA 3IQ7A 4RZVA 4XP3A 4JDIA 4K33A 1SMHA 1KE5A 5C1QB 3C4FA 4ZAUA 2JDTA 2XCHA 3ZFXA 2J90A 3M1SA 4ACDA 4F1TA 3PLAE 4DG0E 4FTTA 4QMMA 5CXHA 2YM6A 4DLJA 5LMKC 3QZFA 4JRVA 4BTFA 3UOHA 3F7WA 3H0ZA 2C5XA 1YI4A 1YQJA 4FKPA 5BV3A 4X3FC 4J96A 4M7IA 4PP7A 2W1FA 1PXKA 2KTYA 4ZMEA 4OTGA 5CTPA 3NPCA 3RTPA 5DBXA 5A14A 5BYZA 5E1EA 4MXZA 3WIGA 4KRDA 2GMXA 3AG9A 5EKNA 1J7UA 3DBQA 4JAJA 4FG7A 1FVRA 3LQ8A 4OT5A 4WNPA 3UVRA 1T45A 2X6EA 1J1BA 5CALA 2AEGA 3ML1A 3FHIA 3V6RA 3PTGA 4D28A 5EDRA 1O6KA 2VX0A 3LCDA 1I09A 2R3PA 4MF1A 4R3RA 4EONA 3C50A 5EYCA 3BHTA 4TPTA 2WIPA 5ANGA 4AW5A 1OUYA 4QMQA 3HV3A 4ACMA 2IJMA 3PVWA 4F6WA 5FM3A 4L3LA 4YNOA 4QPSA 1ZWSA 3ZUVA 1PXMA 3QHWA 2C47A 5HLNA 3QRJA 3V3VA 4MWIA 5DR6A 4BDGA 1PRYA 5E4HA 4QMLA 1JNKA 3ZSIA 3W0SA 3LM0A 2QNJA 4FTKA 4Y83A 2OIDA 2R9SA 4I22A 4C3FA 4ARKA 2YAKA 4CV8A 5E8SA 4HJOA 4DAWA 4O81A 4IX4A 3LM5A 2WXVA 5HVJA 4B6LA 3R04A 4CFNA 4ZJJA 3ULIA 5I9WA 5CEIA 5AWMA 4CFMA 2UV2A 3R1QA 4AFEA 3ET7A 2YCRA 1FBNA 2A98A 2BILB 4QDEA 3PG3A 2VWVA 2EXMA 2I1MA 3HZTA 5BVEA 3Q2MA 3ZU7A 2FSLX 4D0WA 2HIWA 3KC3A 4XBUA 3BQRA 2QOOA 3QQKA 2J0IA 3Q4CA 4FV0A 4D9TA 2PUNA 4O0VA 4NYEA 3POOA 2P55A 3UDSA 3BI6A 3MY5A 3UG1A 4EBVA 4WKQA 4CYIA 2ITYA 2IW9A 2H6DA 3U55A 4QTDA 1IA8A 2YA9A 5M53A 2X0OA 3QCQA 4BHNA 3SG9A 2XAOA 4O0SA 3W0QA 3R7IA 5L6WL 3D2IA 4FZ6A 5K0KA 4APPA 3DQWA 3OVVA 4D1SA 4F7LA 1BYGA 3W8LA 5HBJA 4PF4A 1I44A 3C7QA 4IQ6A 2NNWB 1W2CA 4GL9A 4RWIA 3MH1A 3VAPA 2UW0A 4Z7GA 2CKEA 4FTLA 4CFUA 4DFYA 5AIKA 4QTAA 1Y8YA 1FINA 2BZJA 2PVRA 5HIBA 2JDSA 3R9HA 3W16A 5L2WA 4N57A 1XH8A 5EM6A 4NIFB 3EQHA 3EQRA 1REKA 2BFYA 1U46A 3EJ1A 3PDTA 3LFFA 3W10A 5GZAA 3F5XA 1ST4A 1B38A 4UEUA 2QI8A 2A2AA 3D5XA 4M14A 3GU5A 4CZUA 4ZTHA 5HTCA 4BJJB 4RJ7A 2B9FA 3RZFA 2R0IA 4G3EA 3E63A 3VUDA 4ORKA 4U45A 2A0CX 4JIAA 5J7BA 4FSMA 2VO7A 3P0MA 4IM2A 5LQFA 1G8KA 3GU8A 4RVTA 1Q3WA 3CBLA 3A61A 3U51A 2BDFA 3KGAA 3MYGA 4O22A 5HHWA 5M51A 1W8CA 3D15A 4GUEA 1CSNA 4PPAA 4KUJA 4B99A 3CQEA 2YM3A 3UOKA 3BU6A 2CMWA 3Q32A 4D1ZA 1IAHA 3HX4A 2HY0A 3DK6A 3V5PA 2OICA 4NZWB 1OGYA 2ZJWA 4C59A 3GOPA 3KK9A 4FTAA 4OTIA 2UVYA 4WNOA 5M4FA 2O64A 3Q96A 2OK1A 4J97A 5IDPA 3MH3A 1ZOEA 1DI9A 5CU6A 3QKLA 3HDNA 2XBJA 4JBQA 1Q97A 3RINA 5KUPA 3FEGA 3V5JA 4ZOGA 4BB4A 3WOWA 5EW8A 3TIZA 3UMXA 3G9NA 4X21A 3ZO3A 3A7HA 2YITA 4BCOA 5IA2A 2JDVA 2BKZA 4I0RA 4C57A 5LARA 2GHMA 5ANKA 1FGKA 4AZVA 5TOZA 5L8LA 3L8PA 3O17A 1H0VA 3BHUA 4F1OA 4YTFA 3OOMA 3ZMMA 3LOKA 2WO6A 5B7VA 2R3KA 4E5BA 3JS2A 4RPVA 4U79A 2R3HA 3V6SA 4QP9A 4IJPA 3G2FA 1H07A 3EYGA 5I0BA 2CJMA 1YVJA 4HVSA 4RFMA 4IIRA 5HVKA 4JG7A 2VNWA 1PXJA 4MD7E 4EYJA 4MWHA 3VUGA 1LPUA 2IZUA 3C4WA 5A4CA 5J9LA 2CGXA 2QG7A 2HWPA 3RVGA 3IO7A 3A8WA 4LFIA 2DS1A 4BDJA 2B9HA 4ANBA 1JSTA 3FZRA 1LP4A 2GNHA 4M66A 2Q83A 4DGNA 4FA2A 2QONA 5CSPA 1T46A 2HXLA 2XEZA 4R8QA 4XNEA 2EUFB 5CAUA 5KZ0A 4U3YA 5E8TA 1ZYSA 5CF4A 4J99A 4FVPA 4JOAA 4GKHA 1QPDA 2PE0A 2WD1A 1FGIA 4CKIA 4IX5A 2PVFA 4CLJA 5FP5A 5IA3A 3V5WA 1JSUA 4IAFA 3KMWA 1H1RA 2HXQA 3NEWA 4J1RA 1OKWA 2BRBA 3NDMA 3NYXA 4WBBB 3ZOSA 3WF5A 4QYYA 4JG8A 3W0OA 2IVSA 3QC4A 4GKIA 3DFCB 1UV5A 3DTWA 4MF0A 4USDA 1TKIA 4MD8E 1LUFA 4LOOA 4BICA 4RLKA 3SXFA 2I0HA 3FQHA 3UNZA 3NW5A 3RALA 4DA5A 1FOTA 3I1AA 4DEAA 3OCTA 3OUKA 1HCLA 3QZIA 2GQRA 4QMVA 5DRBA 2VTPA 4CGAA 4ALVA 3FSFA 3V01A 2ITUA 4BIEA 2IG7A 5AP3A 4GCJA 3OCSA 5CSXA 4AN3A 4I4FA 3UDBA 5JFSA 4LRMA 4IAAA 5D41A 2BRHA 2XJ0A 4Y5HA 2HW6A 3T3UA 3WF7A 2X8IA 3BELA 4ERWA 4E6CA 1IEPA 1TQMA 3U9NA 2HELA 5CNNA 3A7IA 3H30A 1GOLA 2J7TA 5LCKA 2BUJA 4AZTA 1AQ1A 4K0YA 3UO5A 1ST0A 3W0RA 4Q2AA 3RPRA 5HU9A 5GZ9A 4D55A 3V5QA 3DT1A 3P79A 4FTOA 3TV7A 5BPYA 2X8EA 4R6VA 3VQUA 5HE1A 1JPAA 2OU7A 5L6OA 2UZDA 3KVWA 1P2AA 2PUIA 3DB6A 3H9OA 2VTMA 2ESMA 4FSTA 1W2DA 3RPVA 1URCA 4AGWA 1YDSE 3TYKA 1OIYA 3ALNA 4CFXA 3AC2A 4RIWB 3NW6A 3RM6A 2E9PA 3IDPA 3WF8A 4JX3A 4KINA 2VTOA 3R8VA 2IF8A 3VS0A 5IEXA 4QO9A 5J95A 1UU8A 2C4GA 3RPYA 3NUNA 4A9UA 4EUTA 2YHVA 4GU6A 3RK9A 4EK3A 2ZM3A 4KSPA 2WAJA 4KBKA 3R83A 4IAKA 1MRVA 1Y6AA 3I5NA 3EIDA 3EN9A 5JT2A 3IDCA 4O27B 1AD5A 4RX7A 4EWQA 5JGDA 4EZ5A 1VLRA 3SXRA 4IXPA 4L46A 1OIUA 4XV1A 2AUHA 3GCUA 2YZAA 3FZOA 4Y46A 4C4IA 3HA6A 3NYOA 3FC1X 1NXKA 3E5AA 1RDQE 3BYUA 3MPMA 4GT3A 3ORNA 3CSVA 1M2PA 3ZC6A 3NCZA 5AP5A 2BRGA 2B9JA 3CPCA 2PZRA 4HPUE 3DDQA 1REJA 2Y4IB 2CNQA 4TYIA 2XRWA 3R00A 4IH8A 1WMKA 5CAPA 3GQIA 2ZVAA 3DJ6A 2XKDA 2WGJA 4IFCA 4ZS0A 3QRKA 3VUKA 3ZO2A 2YACA 5HG8A 3ZH8A 1LEZA 2Z8CA 3GC8A 1GJOA 3QQUA 4GFMA 4A9RA 2WQOA 2GDOA 2GCDA 4O2ZA 4O4CA 3HMPA 1H0WA 3MPAA 5FTQA 3F88A 2VWIA 4GRBA 5M55A 1R78A 2GNJA 3CQWA 5IDNA 3IKAA 4EUUA 4QD6A 4ANQA 2JAVA 3NAXA 4UYAA 4AG8A 2ITOA 2VV9A 4WHZA 3MVJA 1O6YA 3OUNB 1V1KA 2Y4IC 5B2KA 3ZZEA 4HNFA 4KA3A 3P7CA 2OSCA 4NW5A 5AUTA 3W0PA 3U8WA 3KCFA 3CD3A 2XIKA 3D2KA 2O5KA 3JUHA 4ANNA 4DF3A 3ZUTA 5FEQA 2QOIA 2YM5A 2OGVA 2RG6A 4E4LA 3FMKA 2ZMDA 4BDCA 2W1IA 4A7CA 4GS6A 5J87A 3ZHPC 2G2IA 4XOZA 2UZTA 3VF8A 3EQBA 1WZYA 3F3WA 3FI2A 3IW6A 4FICA 4L42A 5E1SA 3VO3A 2CSNA 4CT1A 2V7OA 2JDRA 3P08A 4BBFA 2BCJA 3OP5A 3QKKA 2CKOA 4AA4A 4RA4A 3VQHA 4ZTNA 4QOXA 3TIYA 4MEDA 2F2CB 4RFYA 3LLAA 2G1TA 2O65A 2RGPA 3F5UA 4FOBA 2WTKC 1E1VA 5DA3A 5J79A 2XMYA 1JKSA 1OKZA 2GHLA 4NKAA 1IA9A 1P4OA 2CCHA 3SKCA 4C7TA 3PWYA 1QPCA 4HYHA 5BMSA 2OZAB 2IPXA 3P23A 4RIYB 2XK9A 2QHMA 1CKJA 4FX3A 1ZYLA 4FYOA 3CCNA 3HRBA 1SVHA 2PVMA 2VO6A 4RT7A 3CD8A 3FSKA 5H2UA 5HNBA 5I9ZA 4O7YA 4L8MA 2C5YA 2IZSA 4P2KA 1WBWA 5KHXA 3UTOA 1E1XA 5C4LA 4OAUC 3FKLA 3DK3A 3Q9ZA 5F94A 3THBA 4C3PA 5HQ0A 3RZBA 4PMSA 5IUHA 2ZDTA 1YWRA 3C4EA 4I94A 1NY3A 3DZQA 4MQ1A 4DCAA 3Q04A 3QA8A 3TV4A 1UWHA 3QYZA 4QYFA 2UZWE 3I81A 5ACKA 5HE3A 3AKLA 1YXUA 1V0OA 4QMXA 4X2GA 1ATPE 2UW3A 3ALOA 3QGWA 4QPMA 4HCUA 3VUTA 3QRTA 5EM7A 5JQ5A 4DHFA 4WG5A 3E8EA 4X2FA 3D14A 1PY5A 3LXKA 4IZ7A 2OJJA 2JIUA 1BI7A 3HV4A 3QXPA 2ITNA 4IC8A 5DVRA 4KWPA 4KIKB 4J52A 4DHZA 1OUKA 2R4BA 3DQXA 2CLQA 5FTOA 4UMTA 4ZSAA 5JKGA 3KRWA 4G31A 1BUHA 3DXNA 3EH9A 4IB0A 5DGZA 4GK3A 5A4TA 4W9XA 3SV0A 2BR1A 3ZRMA 3A4OX 3A7JA 3F7ZA 2F7EE 4V0GA 4G6NA 4DFLA 3FWQA 2QLUA 3BEAA 2QO9A 3L9MA 4FKWA 3SAYA 3VHEA 5JK3A 2VO3A 3ZFYA 5EKOA 3PJ3A 4EK4A 4G3DA 4LV7A 3H3CA 5DLSA 2ETKA 2QU6A 3G0FA 5CNOA 5D7AA 4CCUA 3DBDA 3MVHA 4J95A 4F1MA 1CMKE 3W2SA 3FMMA 1Q61A 3Q9WA 4L53A 4O2PA 4RJ6A 5F95A 1PJKA 3NRMA 3SQQA 4YR8A 5EW3A 3II5A 3FYJX 2HYYA 2BHHA 2WMVA 4IMYA 4NL0A 2P2IA 4EOOA 3VONA 3F5GA 2Y6MA 2PVJA 4KKEA 3UDZA 5C4KA 3QD0A 5FGKA 3EN5A 3H9RA 2WMBA 4LRJA 1B6CB 4AE9A 4D2WA 1E9HA 3BV2A 4AA5A 4KBCA 3GGFA 2EXEA 2NRYA 3KCKA 3KULB 3EYHA 3L8VA 1KE6A 1JAMA 2F7ZE 5EYMA 2W06A 3V8TA 4CKJA 5HX8A 4BR3A 3NMUF 3VVHA 1YDRE 2WQBA 5ETFA 4YPSA 1VYWA 4DTKA 4R5SA 1GIIA 2H34A 5E8WA 4EH7A 3SVVA 4FTCA 2BZKB 4MX9A 3KU2A 1EH4A 1XH9A 2GS7A 2ZB0A 2GFCA 2ITQA 1Z57A 4O0YA 4LUEA 3MA6A 3WE8A 4JT3A 3NW7A 2UZBA 2XA4A 4U3ZA 3Q4ZA 2W1GA 4FZAB 3T8OA 5IPJA 3UQFA 1ZARA 3L9LA 4YBKA 4BCFA 4EHVA 2OZOA 2UZUE 1B39A 1ZMVA 2C1BA 4D1XA 4XEYA 5AV2A 2RF9A 3HRFA 5CXZA 4MNEB 3HAVA 4CCBA 3HNGA 2W4KA 3AOXA 4ZZNA 2QOCA 2VNYA 2VU3A 3FL4A 4G6OA 4I5HA 3ZM9A 4QP8A 3ANRA 4F08A 2BAQA 2B54A 4BIDA 1YKRA 2OLCA 1SVGA 3LCOA 1URWA 2W1DA 3QUPA 4MXCA 4WG3A 4ZTQA 4EZ7A 4I92A 5IA4A 2O63A 3REPA 1VEBA 4GG5A 4KKGA 1TQPA 1UNGA 1GZOA 3A4PA 3MFSA 2XIYA 3G6GA 5CZIA 2VTAA 3TTIA 2OJGA 4AE6A 4YURA 3KN6A 1UVRA 2ACXA 4KIPA 3CQUA 3MH0A 2QCSA 5FXRA 3BKBA 3VRZA 3ZLSA 4O86A 1YHWA 3DKFA 3HV6A 4QQTA 3WYXA 4EQCA 3R0TA 4FKSA 5AJQA 4O84A 4QEBA 4TZRA 2B4SB 4J7BA 4FR4A 2BFXA 4YLKA 1ZOHA 2OIQA 4FSQA 1ZMWA 4GV1A 3DY7A 1UU3A 3TT0A 3ZTXA 3TNPC 2FSTX 4AGDA 3BGPA 4E4XA 4ZY5A 4FTIA 2XK6A 2YFXA 3LE6A 4QMPA 4BVUA 3G6HA 4GSBA 4N4SA 4QP3A 3V8WA 4F9WA 4GG7A 5DH3A 5DN3A 3U6IA 2A1AB 2R5TA 4QTCA 5LMAA 2BZHB 5EI6A 2VTJA 3GCPA 4BWPA 1W98A 2QD9A 4KSQA 4LMNA 3ZDUA 2YDIA 3R1SA 4ASXA 1JVPP 2QOBA 3IW5A 4N70A 4IE9A 4HW7A 4JRNA 5HBEA 3OWPA 3IGOA 3KVXA 4A4XA 5F1ZA 5AR4A 3MFTA 5HO8A 4D2PA 3U54A 4L7SA 2PMOX 5H8EA 3PY0A 3SG8A 1XMLA 4B7TA 2PVKA 4BGGA 2DQ7X 2YAAA 1WBNA 2ZYBA 3BEGA 3H10A 4U9AA 4BDFA 4J71A 2C68A 3F3UA 4FT5A 5L6PA 3R9RA 4LL0A 2G2FA 2WTDA 2QOLA 4QQCA 3PVBA 4I6LA 2ZOQA 4BCIA 3KXHA 5HE0A 3P7BA 5KMJA 2VTTA 4G16A 4C0TA 4D0XA 4D2SA 5LXMA 2QODA 4S33A 4FEUA 5FDPA 3ID6C 2O0UA 3R2BA 4MBLA 4FKIA 4DG3E 2XYUA 2GS2A 4H1MA 4TNBA 2VTRA 4C33A 3UBDA 5AUUA 2X4ZA 5K5NA 5EOLA 4XG9A 2OXDA 3E93A 2J0LA 4S32A 1J7IA 3LJ2A 4O4BB 5AP2A 1WBVA 2FYSA 3KRXA 3KEXA 4WO5A 3R8UA 4FTMA 4K18A 2J9MA 2O2UA 2CDZA 2QVSE 1OM1A 2WOUA 2YIWA 3D94A 1H1WA 3ORLA 4CFWA 2X7FA 2J50A 4R1VA 1H8FA 4F4PA 4A06A 4ENXA 5HICA 5CT7A 3R71A 5M09A 4L3PA 4UALA 1H01A 1S9JA 1UKIA 2OH4A 2WEVA 5KMIA 1DI8A 2I40A 4PX6A 5CU3A 1K9AA 1FVVA 2XIRA 3UZTA 2PSQA 3RNYA 5IQCA 4RJ5A 3NUAA 1STCE 3TZMA 4X2NA 4GVAA 2YCQA 4JXFA 3D9VA 4NM5A 4BGQA 3UC4A 4PWNA 2VO0A 3FQSA 5GINE 3LFDA 4NFNA 2HAKA 1K3AA 2Y6OA 4L68A 5DHJA 5I9YA 2HENA 1R0EA 1XBAA 4GK4A 4MXAA 2CGWA 2BIYA 3BLHA 3W1FA 1AGWA 2C5OA 5F20A 3PE2A 3QQLA 4EHZA 4HVIA 5JEBA 3WARA 5FD2A 3W55A 2ITPA 3VC4A 5CX9A 2VWZA 4CYJA 2X7OA 2XIXA 4L3JA 4EOPA 5EFQA 4DBNA 3KREA 4WSYA 3PVGA 3AD4A 3QWKA 4FIIA 3QU0A 2W4JA 4QNAA 4R3CA 1SM2A 4FTJA 1PMVA 4OW8A 1YWNA 1DAYA 5JRSA 4FIEA 4QQJA 2AC3A 3ZO4A 3ORKA 5EHLA 5LCJA 4M13A 3RAKA 3MTFA 4II5A 3JVRA 3JY9A 3MVLA 4YZ9A 4DHJA 4V01A 1NT2A 3MY1A 3HEGA 2C6EA 2R64A 3FLZA 4RWLA 5IA1A 3P86A 3Q53A 3WZUA 4LGDA 2BRNA 4M3QA 3O8TA 3WZKA 4CTBA 2J6MA 4M69A 4TYGA 3FZ1A 4YJPA 3N9XA 4DN5A 3AGMA 5IMXA 3HL7A 1YXTA 5J9YA 2WMTA 3SHEA 3WZEA 5HTIA 5AM6A 2OO8X 4P90A 4R5YA 4WA9A 3M2WA 4BZOA 2XBAA 4WOVA 3RGFA 4NH1A 2QO2A 4NUSA 3K5VA 2H96A 5E8XA 5M56A 3PYYA 4X3JA 5LMKA 3TUDA 5T68A 5BMMA 3JVSA 2DUVA 4XBRA 4NCTC 2OF2A 4FNYA 4I6QA 3TN8A 4BCKA 4X3FA 3EQIA 4MHAA 4TYJA 1WAKA 4K2RA 1ZYJA 4QT1A 4RC2A 4OLIA 1OKYA 2PE2A 4DFNA 4PNKA 3CY2A 2WOTA 1OPKA 5HIEA 5IEYA 3QTWA 2W1EA 2R3NA 3DFAA 3K3JA 3KXNA 1Q8YA 2JBPA 4CXAA 2REIA 3DLZA 2E9VA 4U81A 2EXCX 4AOTA 2QR7A 3EQCA 5E8YA 5AX9A 4A9TA 1PXNA 5HNIX 5AR7A 1CKPA 2WKMA 5L2QA 1OMWA 3RK5A 4O4DA 3AC4A 5HCXA 3RP9A 5JRQA 3R6XA 3PJCA 1RQQA 3NCGA 3QL8A 4MYGA 1PMEA 2ZMCA 4CEGA 5D1JA 3LQ3A 3L9NA 4HCVA 3RMFA 1J1CA 2W4OA 4PTEA 4U42A 3DNDA 4XLIA 5BVWA 4A9YA 4IAZA 4L67A 1OECA 4U0IA 4DEGA 4CVAA 4ZLOA 2VTQA 3OW3A 4FV9A 3FAAA 3I7CA 3C13A 3PFQA 3LCTA 3VBWA 4F64A 2ZFYA 3R2YA 3FKOA 4NCTA 1G8JA 3QTXA 4AXEA 1YI6A 1PHKA 2VWBA 2XEYA 3MFUA 3MGYA 4H58A 1PYEA 1PMUA 1ZAOA 3P1AA 1HOWA 4LGHA 3C5IA 2RFNA 4FV5A 1XWSA 4MK0A 4DFBA 1MRYA 3ORZA 5DEWA 2JIVA 3EOCA 5BX0A 2F57A 1CKIA 4C3RA 4O7TA 4M97A 4FL1A 3UVPA 4EJ7A 4X2JA 3FLNC 3PXYA 4AF3A 4WSQA 4LOQA 4FBXA 5AV4A 3FI3A 3ZRKA 4L45A 4IWOA 3FMEA 3P5KA 5M44A 4AZEA 4ASEA 2PZIA 4MXYA 2CKPA 3FZSA 4IM3A 3COMA 3Q6WA 4K77A 1S9IA 3BIZA 2XNEA 3AT3A 5CQUA 4OUCA 5LWNA 4IWPA 4E20A 1OI9A 3HV7A 4L7FA 3WYYA 4E7WA 1IAJA 2VTIA 4NWMA 5J8IA 2V62A 2YM8A 5EH0A 1GNGA 5HU3A 3BYVA 4AW0A 1SYKA 2NP8A 2C1AA 3NUSA 2F9GA 4CD0A 2O3PA 4IX6A 3S2PA 4BCQA 4EL9A 1XJDA 4TNDA 4UMRA 1LR4A 5CF8A 3ITZA 4E93A 5C27A 3BLRA 2OH0E 3VS6A 2J5FA 3FE3A 4JLCA 5AAGA 5KNJA 4PNIA 5JZNA 3GVUA 3UO6A 4DTAA 4NTTA 4RVMA 4R78A 4IVDA 3LFEA 3TV6A 3ZXTA 4DFZE 4X0MA 2HCKA 1UNLA 5B0XA 2QKRA 1VR2A 4EH9A 4J98A 3DAJA 4QP2A 5LJJA 4HPTE 1OPJA 3K54A 3O8PA 2OG8A 1IG1A 4FT9A 3Q6UA 3FZPA 3CEKA 4U5JA 3RPOA 4DEEA 3QQGA 4D2TA 5LOHA 2CKQA 2HZ0A 3BL7A 1R39A 4O0TA 4XCUA 4K11A 5C26A 4FSZA 3C5UA 4E6QA 1H26A 1YHSA 2JKKA 3F6XA 4BWKA 3QZHA 2OIBA 4WNMA 3SOAA 3PZEA 4NIFA 5CF5A 2YIXA 4C4JA 4EHGA 4O0WA 3QX4A 4RC3A 3RJCA 3VWAA 5CEOA 2B53A 4BIBA 4BJJA 4Y95A 5F9EA 3LXLA 3I5ZA 2XUUA 3QCSA 1BMKA 4F63A 3FMDA 2A27A 4OR5A 4DBXA 2OBJA 4O1PA 2OF4A 2XRUA 4Y85A 4XP0A 4DGOA 5IA5A 3LFBA 4C4FA 3TNQB 2JFMA 3EQPA 5CSWA 3F2RA 4BCNA 3NAYA 1OL7A 5IQAA 4F9AA 4TYEA 4GJ2A 4FYNA 4ACCA 3BV3A 3NNXA 3B8RA 2RG5A 4APCA 4BRXA 2WMXA 2YIQA 2XVDA 2X2KA 4CMTA 4AFJA 3D0EA 4H3BA 4IEBA 4C02A 2W96B 4I1ZA 3DV3A 3DJ5A 2EVAA 2BAJA 2C69A 3SA0A 3PPJA 4Z7HA 4WBOA 4BZDA 2XNBA 3ZBFA 4FT3A 5FP6A 3S1HA 2VN9A 4XG2A 4EH4A 3GBZA 3UODA 3IPHA 4RJ3A 2WQEA 3LJ0A 4L01A 4MH7A 3WF9A 1DS5A 2I0YA 4G9RA 3TM0A 4FKTA 3QF9A 4ITJA 5JMSA 2GNFA 4LDTA 3JYAA 5GNKA 3A62A 2UUEA 4OTFA 4Q5EA 4GEOA 2UW7A 3H4JA 3D7TB 3OFMA 1KWPA 4GIHA 4K8AA 4NK9A 4ZSLA 4BI1A 1Z9XA 1UU9A 2WHBA 1MQBA 2XK3A 3DPKA 4GT5A 1A48A 4FUXA 3D83A 4JL9A 3E8CA 3ATTA 4BY9E 4P5QA 3OTUA 2FUMA 2BALA 3BU5A 3O8UA 4AP7A 5TR6A 3Q5ZA 3O51A 3ORXA 5CY3A 1OPLA 1P5EA 5HO6A 2YLEA 3R7VA 2JAMA 4C58A 3DAEA 1TZDA 2PL0A 4MCVA 4DINA 3UOLA 2OKRA 3ENMA 3PXQA 3C4XA 3DJ7A 2DYLA 4JR7A 2EWAA 2ZV2A 4RWJA 4XX9A 3LVPA 4FKGA 3AD5A 5HG7A