1I44A

Crystallographic studies of an activation loop mutant of the insulin receptor tyrosine kinase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
298
structure length
282
Chain Sequence
PDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INSULIN RECEPTOR
publication title Crystallographic and solution studies of an activation loop mutant of the insulin receptor tyrosine kinase: insights into kinase mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 282
sequence length 298
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2001-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1i44A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1i44A01
4O0VA 3UPZA 3KKVA 4M12A 3DK3A 2XKEA 4GU9A 4J52A 4WG4A 5FP5A 4PNKA 2I0VA 2CGXA 2PSQA 3ZLSA 3PVWA 4M68A 4MXXA 3R7VA 5CU6A 4DE4A 3O2MA 4IB3A 4XV9A 1Q3WA 4ZTRA 4ZTNA 3WYXA 4PF4A 2FYSA 3G9LX 2KTYA 5IA0A 5DIAA 5LWMA 5IQAA 3OY1A 4QQTA 3TM0A 4EBWA 2QOQA 4TWCA 5CU0A 3POOA 2QKRA 3AC4A 5HNIX 4FGRA 3PZEA 2CN8A 2R3NA 1QL6A 4Q9ZA 4KBAA 5JGAA 2OFVA 4G3DA 3W2SA 3QLGA 4ZSGA 4WG3A 3C0IA 1QPDA 3PYYA 2WD1A 2YZLA 1KUTA 4NJDA 4IAFA 4N0SA 2O8YA 4O0WA 4WNOA 3LMHA 4OTPA 4RX7A 2FUMA 3CIKA 4D0WA 5DPVA 2FH9A 4K11A 4MCVA 3TV7A 2A2AA 4GT5A 4D1XA 4HVIA 4GT4A 2HWPA 2WAJA 3LM5A 5JSMA 2BAKA 3C7QA 4KIQA 5JRQA 3RP9A 3A62A 5J95A 4DLJA 4Z7HA 3RPRA 4MF0A 4MXYA 1QPJA 2EB3A 4AN3A 2W17A 4LGDA 2C3JA 2BMCA 3OVVA 3MY1A 4FYNA 3DBDA 2XNEA 2DUVA 4IAKA 2C0OA 3NMUF 4E5AX 4BRXA 2XNNA 2C0IA 1Q24A 4FK6A 4I24A 4P7EA 4F7LA 4YJPA 2RKUA 2ZMDA 4YGAA 4HVSA 4JRNA 1Y8YA 4B8LA 4E73A 4PQNA 1L3RE 3ORPA 4P4CA 4FG8A 3HMNA 1IR3A 1H8FA 2VTLA 3GP0A 3R9OA 4IC7A 3FZOA 5D10A 4AP7A 3AT2A 3NUAA 3IKAA 5DVRA 2J0IA 4WUAA 2C6EA 5HTIA 3DCVA 3BGZA 3HKOA 4WG5A 4K77A 3Q96A 2G2FA 2XB7A 3PPJA 4I1ZA 3DFCB 3A2CA 3HV5A 4BR3A 2XK3A 4Z16A 2WMQA 4WNPA 2Y7JA 4NH1A 4RLKA 4EI4A 2IVVA 1PY5A 2X1NA 4FIIA 1MRUA 4AT4A 4H3PA 4ZOGA 4C3PA 5IUGA 4I4FA 2J50A 3FC1X 4WD5A 1OUKA 3FMMA 2WNTA 4Z9LA 2F9GA 3L8XA 5FEEA 2BDJA 2GQSA 4JI9A 5HCYA 4TWPA 2BAQA 3BGPA 4Y85A 4H3QA 5IG1A 2Z7SA 1Q8YA 4II5A 5CAPA 3CPBA 4QPAA 3W8LA 2JKKA 3QA0A 2UZNA 3FL4A 4RC2A 2XEYA 4DGGA 3ULIA 2WMXA 3MTFA 4DLIA 3Q2MA 5AP0A 3TV6A 5M4CA 2RFNA 1H1RA 5AIKA 5A4EA 3TKIA 2IN6A 3F3TA 3MY0A 3SGCA 3EQGA 2JAMA 4HPTE 4ACDA 4JBQA 3V3VA 4ZJIA 2QU5A 3MGYA 4MKCA 4F65A 3AXWA 4JDHA 5K9IA 1Q97A 5BMMA 2XKFA 1UKHA 4OTWA 5BUJA 4ZZOA 2OWBA 3HMPA 3QA8A 4G34A 2PZPA 3A4OX 2YACA 1NVRA 4PMMA 4C62A 4AA5A 4RJ7A 4CLJA 2W96B 3K3IA 3S1HA 1VYWA 3MA3A 4P2KA 3ZTXA 4G6LA 4EKLA 5FTQA 4ZTSA 3C1XA 4EOLA 1ND4A 5CU3A 4ASEA 4MHAA 2H9VA 3ZXZA 1SYKA 3VNTA 3Q5ZA 5LMAA 4H1JA 3HRCA 3HV3A 2O63A 3TKUA 5HE3A 2WMSA 3CLYA 3PA3A 4ASDA 1PXLA 3PJ8A 4JR3A 4FEVA 4QQ5A 4J96A 3NPCA 3R22A 4BCKA 3QAME 3QTWA 5KBQA 4HGTA 4WA9A 3TXOA 3L9NA 4FT3A 5H2UA 3LFCA 5HG5A 1NW1A 2Y4IB 4CCBA 4EQCA 3WZJA 4AOIA 5HD4A 2C6DA 1NA7A 2ZJWA 3PVBA 5GJDA 4RFZA 4QNAA 3AT3A 2C5XA 4TRLA 5BVOA 5CALA 1GZNA 4FICA 3MA6A 3OCTA 2ACXA 3EL7A 3EN6A 3ZFMA 4RX9A 1OECA 3R04A 4J53A 1Q61A 4YU2A 5E92A 4BDKA 3QLFA 4UWYA 4BKJA 4RVTA 4KD1A 2VO6A 2Y6MA 5CQUA 4U79A 4H1MA 5DR2A 3ZS5A 4RWJA 3OFMA 3LJ1A 4DEHA 1KE7A 2X8DA 4D2RA 1PMNA 2FSOX 5EM8A 3EQRA 4KBKA 3EQCA 5CS6A 3QTSA 5DA3A 5ETIA 3BE2A 5EDPA 2QONA 4K2RA 1P5EA 4IW0A 4WRSA 4CFXA 2E9OA 4FA2A 5ANOA 4M84A 4OTRA 4C34A 2C0TA 3I6UA 3LCOA 3NIEA 3LFSA 3TACA 5EQEA 5J79A 4F4PA 3QTIA 4F1TA 5KNJA 1RE8A 4BI1A 2W1HA 2OZOA 4LUEA 4TWOA 4DH5A 4YJNA 2GS2A 1Z9XA 3OXZA 1KE8A 3TCPA 4ACHA 3ZLYA 2PMLX 2E9VA 4I6QA 5TF9A 3R7EA 3VW8A 1UKIA 3KMMA 2YM7A 3TZMA 3ULZA 4G5JA 2HZ4A 3VBWA 2EXCX 3PXKA 5ANKA 3KRRA 3WF6A 1YRPA 2VTOA 4LOPA 4NW5A 2ZV8A 3C4EA 1OL1A 4HCVA 4XLIA 3O7LD 5C1QB 4XNEA 3DKGA 2UZEA 4L00A 4WNMA 3UO5A 3S2PA 2Y4IC 2P4IA 4U81A 1KE9A 3BYOA 4NTSA 3G2FA 3PWYA 4NCTC 4AE6A 4BWKA 2RF9A 2OXYA 1H0VA 3R8MA 4OGRA 5FG8A 3F3VA 3EQDA 4BCQA 4B4LA 4YNEA 5J1VA 2VTIA 3DA6A 2E2BA 4FMQA 1NY3A 3BYVA 4NK9A 4QMYA 5K0KA 3VN9A 4JL9A 3UQGA 3TUDA 3A61A 4GW8A 3OZ6A 3GU5A 3UBDA 2PVRA 2XM9A 3VUMA 5EOBA 3R8VA 2F49A 4ALVA 4V0GA 4MD8E 3TZ7A 4EKKA 4FTUA 5AMNA 5DHJA 5DN3A 3L8SA 2J90A 3MS9A 4K33A 3RM6A 5CU2A 5TO8A 3RMFA 3Q32A 1H0WA 3SVVA 3KULB 4DFNA 4IVDA 2R0UA 4O96A 3FMEA 3QQGA 3ZONA 4FT9A 5HESA 3ZUUA 4BCJA 3QTUA 1H08A 3Q53A 3BU5A 4O81A 3QBNA 4OT5A 3Q60A 2W1CA 4EOSA 3C51A 5AR2A 1PMEA 3D2IA 4X7QA 4XRJA 5ANDA 2OG8A 1YKRA 4F1OA 1PF8A 2GHLA 5JKGA 4GYIA 1LEWA 4IX6A 1WBTA 3BI6A 1A9UA 1O6LA 3EJ1A 4NUSA 4RFMA 3BE9A 3QRUA 4O7VA 5A54A 4KWPA 3HP5A 3IGOA 4YO6A 4GH2A 3LPBA 3KU2A 3D9VA 4Q2AA 3CR0A 4QOXA 4RSSA 2E9PA 1Q8ZA 4B0GA 4DINA 2V7OA 5EW9A 2VNYA 4R6VA 5CF4A 5AP7A 2OI4X 5A4LA 4EHVA 2AYPA 4EH3A 2GHMA 4E5BA 3W1FA 2P2HA 3VUTA 4CFVA 3GU7A 1V1KA 5IH5A 1HOWA 4MNEB 4QYFA 4DFZE 1WBSA 2P3GX 3D5VA 4B99A 3SLSA 4O1OA 3E8DA 5FDXA 2XZSA 4RVLA 3ENMA 4UB7A 5CEIA 4BDIA 5LVMA 4RIXA 2A0CX 3HECA 5C4LA 2C6KA 2VTHA 3FQHA 4FTOA 1XBBA 3ZXTA 1XR1A 5JEBA 4RX8A 3BZ3A 3WF8A 2B7AA 2J51A 3OOGA 4MWHA 4QYEA 5B2KA 3P5KA 4FNYA 4I22A 3OG7A 5ANGA 1YHVA 3ZH8A 5DNRA 4YZ9A 5CSXA 2VWVA 3VQUA 4JVGA 2VO3A 2UZLA 4FKUA 4X2KA 4D4RA 4MTAA 4RLLA 3NUYA 5DR6A 3ZUVA 3JR1A 4DYMA 2VTNA 2YN8A 3HL7A 1ATPE 5L2SA 2WTKB 4FSRA 1W8CA 3AQVA 5L2QA 4CV8A 3BCEA 4G1WA 4DT9A 1RQQA 2YLFA 3AD5A 3LQ3A 3ORMA 5L6OA 3IW7A 4QMWA 3WF7A 1H28A 2ZB0A 3ROCA 1WZYA 1JBPE 4NKAA 1H25A 3GC7A 3OCGA 3GCSA 3U51A 4DBNA 3F7WA 3MPTA 5ETFA 1JSVA 2ZM3A 3DNEA 5EYCA 3BKBA 3RPVA 1U59A 4APPA 4RRVA 3FPMA 5F95A 5AUVA 3BYSA 3I7BA 3MVHA 3E62A 3PXZA 2PE2A 4IZ7A 2R3MA 4KRDA 5ETCA 1SZMA 3DJ6A 4RQVA 4DEAA 3FEGA 4YZBA 2RSVA 5HBHA 3EFKA 4O7TA 4BB4A 5JH6A 1P4FA 4CG8A 4FKWA 5EQPA 1BL6A 2QR8A 3QZIA 3V5JA 1CDKA 1H27A 3ZC5A 5HOAA 4XV1A 5I9VA 4GFGA 3FLSA 5HKMA 3FI4A 4O6EA 5CXHA 3F9NA 4ZSEA 3Q9YA 4FE2A 4DEDA 2OGVA 2PZYA 2X8EA 3TV4A 4XUFA 1YHSA 4GK2A 3E93A 1KE6A 5AP4A 4GIHA 2XA4A 4C4IA 3HX4A 2VWYA 3HMOA 4YTIA 2CKOA 2R3HA 5I9ZA 1JKSA 4ZLYA 3DZOA 3G6GA 4RA4A 4YO4A 3U6HA 2F7EE 5G1XA 4E3CA 4U3YA 1R3CA 3D5WA 2W5HA 4JT3A 3ZO2A 4L46A 2WTKC 4FKGA 4ZTHA 1YXXA 3G0FA 3AOXA 3RWPA 3FJQE 4OAUC 3N9XA 3MW1A 4CKJA 3TDWA 1A48A 3EQPA 4O6LA 4IADA 4AT5A 4PX6A 3SRVB 2DWBA 3F3UA 4GIIA 2PVFA 4TN6A 4BFMA 5I9UA 3ZYAA 4HVGA 4YURA 2I40A 3FI8A 4FUYA 3AD4A 2NPQA 3NYVA 3WARA 4GKHA 1TQMA 1ZYSA 1TQIA 4GVAA 5E8ZA 5JFVA 3CE3A 4V01A 1OKVA 3KXZA 5AP6A 2QHMA 2R3FA 5M53A 4S31A 3IW5A 3KA0A 4IX5A 3QQKA 2QG7A 4H05A 2ONLA 5CAQA 2AUHA 4IVBA 4FG7A 5CNOA 4QMMA 4R3RA 4YLJA 4FKTA 5AAFA 2G15A 2Z60A 4DFXE 5TOZA 5BYZA 4JG7A 4FSYA 5EYDA 4YPSA 4TYHB 5CAUA 3EIDA 4EOOA 5EW8A 5BUEA 4TTHB 4U42A 3JPVA 2B52A 2OXDA 2J0LA 4FBXA 2W4OA 4Y8DA 5CXZA 1G3NA 3WZDA 2BIKB 3COKA 5DT4A 2CSNA 1SMHA 3WI6A 3A7IA 3P86A 2BRGA 1BYGA 4MBIA 3E7VA 3VUGA 3R9RA 3HV4A 2WTVA 3BRBA 2EXMA 2IZTA 2F2CB 3PG3A 4WBOA 2VD5A 2ERZE 5HE0A 3ZZWA 5L8LA 3VVHA 2XJ0A 4QO9A 4BZDA 2QOBA 4HW7A 2AC3A 2B4SB 4FTKA 2X7GA 2CGUA 1XQZA 3EFJA 4RJ6A 4CFNA 5HVKA 2YDKA 3LHJA 3GC9A 1REJA 3PSBA 4JIAA 4O0RA 3GEQA 4O82A 2PPQA 1H07A 3IO7A 4O7YA 5DE2A 4EZ7A 2XP2A 3ORZA 5BPYA 4IFGA 4MH7A 2FGIA 2F7XE 4LRJA 5EKOA 4GUBA 1OKWA 4X2GA 3ANQA 5L6PA 4F0FA 4E7WA 5EM7A 4I5PA 4Y5HA 1JAMA 3O8PA 2VRXA 1T45A 2JFLA 3OROA 3Q9XA 4NIFB 2JC6A 2WFYA 1HCKA 4KKHA 3UOKA 3HZTA 1YHWA 4I3ZA 3QYWA 2WMAA 3UIBA 3BHUA 2XKCA 3QZHA 4ZTLA 3TTJA 5EKNA 3GI3A 3HA8A 3M42A 1PMVA 2X9EA 4E6DA 2XNOA 4FL3A 2W99B 4PPCA 3R00A 3UP2A 2QHNA 2R7IA 2B54A 4OBPA 2OH0E 4NW6A 2UVYA 4IZAA 3SAYA 5JZJA 4BDCA 4N6ZA 3KL8A 3OWPA 5DT3A 2HZNA 4MX9A 4P90A 5K4IA 1NXKA 1VZOA 4F9CA 1CKPA 5E4HA 4YLKA 3I5NA 1UWJA 4MVFA 4EOKA 2PMNX 4QQCA 3Q4TA 4GG5A 3ZRKA 5AEPA 5CNNA 3EB0A 4EOQA 2J7TA 2ITZA 1J7IA 1NT2A 5C01A 3R8UA 3UO4A 1ZXEA 3RCJA 4LM5A 4OR5A 4AW0A 3U87A 2WEVA 3I81A 2WTDA 4AZWA 4FKRA 4CGAA 5JMSA 5CVGA 3OWLA 1UU9A 4JIKA 1OL7A 1W0XC 2OF2A 4UBAA 3U6IA 4NZWB 3W2OA 5KKRB 1TQPA 3IG7A 4PMTA 3MJ1A 3W55A 4HVHA 4YMJA 3KXNA 4EH2A 4XG8A 4LMNA 4FSWA 3ZRMA 2XIRA 4QQJA 3C4ZA 1PJKA 4AG8A 2SRCA 4ZIMA 3BGQA 3KMUA 4NL0A 2QOKA 3NS9A 4YJVA 1GZKA 1WAKA 2ZDUA 2ZYBA 3F3ZA 3MTLA 2IW8A 1U46A 3ZBXA 4E20A 5LCKA 1XJDA 4L67A 4LGGA 4M97A 4KA3A 4OTFA 1B38A 4X3JA 4XV2A 2RFDA 3U54A 2OZAB 1F3MC 2CHLA 4UMRA 4A7CA 4E5WA 3DAJA 4DH3A 4UMUA 4UMTA 3QX2A 4FV5A 4KBCA 1CMKE 4C38A 2QLQA 2CCIA 2PZIA 5A4CA 3E5AA 3M2WA 3O0GA 2F7ZE 2GS7A 3QXPA 1OPKA 4F1MA 2Z02A 1R78A 4DA5A 4XBUA 3B8RA 2VTSA 2WEIA 2CLXA 4I4EA 2R3JA 2UUEA 3HUCA 3ORKA 5GZ8A 3OBJA 2QURA 2WTIA 3VIDA 3WIKA 4FSMA 2R2PA 2R3IA 4MK0A 5AUWA 3I5ZA 3RGFA 3UIMA 3WIGA 3QQJA 4FIHA 3TNQB 1LPUA 4USFA 3R2YA 3AG9A 3E88A 5LVOA 3PRIA 4IB5A 4IB0A 4UEUA 4DN5A 1M2PA 4TWNA 5B2MA 4EJNA 2UZDA 2C69A 3A8WA 4IM2A 4D4SA 5IQIA 4EH6A 5FWKK 3RZFA 5I0BA 5K5NA 3I6WA 4BIEA 2EUFB 5AAEA 2JDTA 5HCXA 4CKRA 4EOIA 3UNJA 2RFSA 2ITQA 4A4XA 2UVXA 4C59A 3DTCA 3GOPA 3UPXA 3GC0A 4QRCA 3UZPA 5DOSA 3VUHA 1CM8A 5KKRC 4WBBB 4CMTA 4CCUA 3FXWA 4FV2A 4JDIA 4C58A 2BRHA 4IWQA 1WCCA 1F0QA 2WMRA 4KRCA 4YPDA 5DBXA 1BI8A 4ALWA 4C4EA 1BLXA 3FZPA 3C9WA 3E3PA 4O0UA 2CNVA 3N4UA 2HOGA 5CT0A 1UVRA 4XOZA 4E1ZA 4RX5A 2O2UA 3TIZA 4L7SA 4C4GA 5L2WA 2VTQA 3AT4A 1J7UA 2UZWE 2YA9A 3UGCA 4IIRA 4FTMA 4PPBA 5AX9A 2ZV7A 5M4UA 3FI3A 2QCSA 2ZV2A 5DEWA 3ODYX 3H10A 1JPAA 3TL8A 1KOAA 4JXFA 2ZOQA 4BTKA 2OJGA 3K2LA 1Y57A 4C8BA 3DDPA 5KMJA 2YCSA 4S2ZA 1LP4A 3OHTA 3SXFA 3BLQA 4BBEA 4FV4A 3TUBA 5KE0A 1OMWA 3O71A 2EU9A 3TJDA 3V5QA 4FV7A 4F7NA 4JLCA 2CNUA 3DBFA 2GTNA 4ZSLA 4LMUA 4M0YA 4OW8A 5KZIA 1YXTA 3B2WA 5HBEA 4DG0E 2WTWA 2A4LA 2BVAA 4FZAB 1W82A 3QL8A 5FEQA 4R78A 1JLUE 3NYXA 5HO7A 3OY3A 2QO2A 2C68A 5FXSA 3W33A 4L53A 4TY1A 3UMXA 2C6LA 2OSCA 4QMVA 4OTGA 3S95A 2HAKA 5TKDA 3HYHA 3UJGA 3UG2A 3UQCA 3R73A 2YCFA 1O6KA 1OGUA 3D14A 3JVSA 2ITYA 4GSBA 4RWLA 4EQMA 4HGSA 3T3VA 5J7HA 2XK9A 1IA9A 4FKIA 3POZA 5HHWA 1APME 4KIKB 5IKWA 3Q4ZA 2R64A 5LWNA 2YITA 3MWUA 3ODZX 4YHJA 2OIBA 5CZIA 3VS3A 2VTTA 3DOGA 2B9FA 3O17A 4XG4A 5CTPA 4J71A 5FM2A 1ZMWA 3LFAA 3QCYA 1PW2A 4JBOA 3G5DA 1RDQE 2CGVA 4OT6A 3HNGA 3PZHA 2XIXA 4Y46A 3ZM9A 4D5HA 4CD0A 1DAYA 3PXQA 4IDVA 3SV0A 2VX1A 4TL0A 3TZ9A 2IWIA 5E8TA 4BN1A 4HCUA 4IH8A 4EL9A 1J91A 3P0MA 3JUHA 3AC1A 4ERKA 3PY3A 4V05A 3P79A 3NYNA 3TJCA 4C61A 3FMLA 5M44A 3VBQA 4EHEA 5EHYA 4FEUA 1E1XA 2GSFA 4GK3A 4BTJA 5T3QA 5KCVA 3N4TA 1BMKA 2IJMA 2W1GA 2QU6A 3ZFYA 4CT1A 1FVTA 4FKQA 1XKKA 3ERKA 2G1TA 4XG2A 4C3FA 4E4XA 5I3OA 1OIYA 4FX3A 4YZNA 2XF0A 1CKJA 1OL5A 3V8SA 2C6OA 4R5SA 3L9PA 3HV7A 3WE8A 3DGKA 4FI1A 4I5MA 4PDSA 1TKIA 3VS5A 3VUKA 4BVUA 3WBLA 2E9NA 2PYWA 2BTRA 4NM5A 1PKGA 1FBNA 1XH9A 5KMOA 2XBJA 3E8NA 4U43A 3QQLA 2WZJA 4Z3VA 1LR4A 2GNGA 2YIRA 4RFYA 4HPUE 1CKIA 3D0EA 4D2SA 4FEXA 2CKPA 4USEA 1W84A 2YIYA 5A6OA 1U54B 3COHA 2OK1A 3P23A 4X2FA 3PWDA 1ZOGA 2G01A 4BDHA 3ORXA 2XIYA 3PXFA 4DBXA 4O7NA 3FSFA 4AE9A 3QTZA 5B7VA 3ZLXA 1TVOA 3CSVA 3PJ1A 3LVPA 3QKLA 5LVPA 3DXQA 3LFBA 4QYGA 2R3OA 2YIWA 4FL1A 3HEGA 2W1IA 5A4TA 2PTKA 3F66A 3EN4A 1FQ1B 5J8IA 5HLPA 2PHKA 4DFUA 4IZYA 4GYGA 2C6MA 3ORIA 3VF8A 4BBFA 4RIWA 4R7BA 3WOWA 4EC9A 5AADA 1YXUA 2XM8A 2PK9A 4XG3A 2GNHA 3UMWA 3ATTA 5M56A 5CWZA 3RNIA 3SOAA 2P0CA 5AUYA 3EQHA 4DCAA 2X6EA 3G9NA 4IWOA 1ZARA 1KSWA 1AGWA 3F82A 4RVKA 2BFXA 4IAYA 4KB8A 2WIPA 5EI6A 2PMOX 3R7YA 4EH8A 4C4HA 2XMYA 4PTGA 3ZSIA 4C4JA 2JKQA 4BZOA 2V62A 3QUPA 4M69B 5J1WA 4DFBA 3C5UA 3M11A 5M57A 1REKA 2WIHA 4ZP5A 5LXMA 3QCSA 4PPAA 4AWIA 4B6LA 3GCQA 5HD7A 2F57A 4RIOA 1M2QA 4A9TA 5HG8A 3G51A 5HO6A 3UOJA 2J0MB 1RW8A 4D2WA 3OP5A 4RJ5A 3ANRA 4KSQA 5IA3A 3CXWA 3F61A 5IA1A 3ENHA 3SC1A 2W9ZB 2OF4A 3FI2A 4FYOA 5CI6A 4WO5A 3S00A 4FV0A 5ACBC 2IW6A 3OW4A 4QPMA 2YHVA 4BCFA 4X3FA 3MPAA 2R3LA 4WHZA 3UP7A 2HENA 3WILA 3HVCA 1GNGA 4TW9A 4D55A 3BHVA 3FAAA 2LGCA 4G3GA 3IOKA 4DFLA 4QTDA 3DBCA 3CQWA 1G8SA 2W1ZA 4RJ8A 1WBWA 5AR4A 3G6HA 1VJYA 4BI2A 1YXSA 4RJ4A 5ITAA 3KVXA 3KRJA 5TT7A 4CXAA 2UZBA 4QD6A 2PVJA 4IMYA 4L44A 3RBWA 4XP2A 4B9DA 4AZVA 4F0GA 4FT7A 4GVJA 4MD9E 4WSQA 4WRGA 3RHXA 4AX8A 5CF8A 3F2RA 4AOJA 2Z2WA 2QLUA 3LLTA 4FSZA 4M0ZA 5FBNC 5KMIA 4ITIA 5IISA 2R3KA 3F5UA 3KN6A 5CSWA 3C4FA 4GG7A 3FHIA 4DITA 4S32A 3GOKA 3PPKA 4L7FA 1URCA 2C1BA 3BEGA 3BU3A 5I9WA 4FL2A 4GFMA 1WBPA 1GIIA 4IAIA 3UDBA 2JDSA 1BL7A 3PG1A 5M51A 1SNUA 4G31A 3CS9A 4YZCA 4AT3A 4BDDA 3I0QA 3NVKI 3R1NA 2XKDA 1XH6A 1YDTE 5IUHA 4L3PA 3UZTA 4FZDB 4JBPA 3KY2A 2HWOA 4K1BA 4KIPA 4KABA 3FUPA 2A19B 3R9NA 3D83A 4KSPA 1GIJA 3COMA 3QCXA 3NW5A 2DYLA 2FSLX 3PE1A 2AC5A 5HE2A 3H4JA 4RA5A 2W9FB 4E93A 5CEMA 5IA5A 5BVWA 5T6KA 1AQ1A 3W16A 3DT1A 4O0SA 2O64A 1Y6BA 5A3XA 3Q4CA 1H01A 4HGEA 2VGPA 3LOKA 4C02A 4PL4A 2VAGA 3LFQA 3ZC6A 1MUOA 4ZZMA 3WE4A 2VO7A 3C13A 2BDFA 3NSZA 3S4QA 3SA0A 3AMBA 3OD6X 3BHTA 3R7IA 4ZSAA 2GNIA 3QC4A 3LCDA 4IDTA 1KWPA 4QMUA 1PKDA 4MXOA 3QRTA 4D9TA 2HY0A 2CKEA 4O84A 5KMKA 1ERKA 2PVHA 4M15A 5C9CA 1ZOEA 4BDEA 5BVDA 2BPMA 1WMKA 2GFCA 5D11A 4XHKB 3R1YA 4F63A 4WIHA 3KCFA 4WKQA 4CNHA 4X6QC 3EQIA 3LQ8A 4AQCA 3NNUA 3KK8A 4HJOA 2FA2A 5J5TA 4OTDA 3FLZA 5FUTA 3K3JA 3ZCLA 5FXRA 1OPJA 2X4ZA 4ID7A 3NGAA 5LVNA 4JS8A 2PWLA 4DH7A 2RGPA 3PVUA 5L6WL 5C26A 4YC3A 1DS5A 4EEVA 4K8AA 5JK3A 1UU3A 1H26A 1ZZ2A 3MB6A 2Q0NA 4NM7A 4FKVA 1GZ8A 5JN2A 3CEKA 4RIYB 3ZZEA 1OBGA 1IG1A 4IJ9A 2UW8A 5CSHA 3WZKA 2H34A 3ORLA 4RZVA 3VULA 3JY0A 4CFFA 3EZRA 5IMEA 2CKQA 4X0MA 5IDPA 1E9HA 4RWKA 5LOHA 3LCSA 4FKPA 4IWDA 2R3PA 5IA4A 2UZUE 3H9RA 4Y73A 3SHEA 2VWZA 5AUXA 3TZ8A 2X2MA 2WQNA 3RAHA 3OC1A 1Z5MA 5JGBA 2JD5A 2VWIA 4CRSA 2YERA 4LYNA 5AV3A 4FOCA 4CTBA 3UOHA 4U0IA 3C4WA 3RZBA 2YABA 4FIJA 3TNPC 5M4FA 4V04A 4EUUA 3HAVA 4FIEA 5M07A 5E8VA 3BV3A 3T9IA 4EUTA 3U6JA 3LFDA 4JG6A 3NYOA 3OWJA 5E8UA 5A9UA 4HYHA 4HYIA 4O27B 4J7BA 2VWBA 3OEFX 4N4SA 4QP9A 4UMQA 3L8VA 2NNWB 2LAVA 4AW5A 2BKZA 1H00A 3QWKA 5FGKA 4C0TA 4UV0A 2OH4A 1DI9A 3MV5A 1YDSE 2X0GA 3A8XA 3F6XA 5EQYA 3R1QA 4BY9E 3BIZA 4RGJA 3RI1A 3DAKA 5F94A 4YUQA 2VX0A 4O22A 1YI6A 3LFNA 3EN7A 4NJ3A 4L42A 3SXSA 2NRUA 3GFEA 5E8XA 1JVPP 3R7UA 2GU8A 4IACA 3U9CA 4C33A 3RKBA 2OBJA 3REPA 4QP7A 3FMKA 4FC0A 2WQEA 1JOWB 3D7TB 3VS1A 4CLIA 2P2IA 2WQOA 2XK6A 3HUBA 4O2PA 4E26A 3H9FA 5IQBA 3COIA 4U97A 4ZY4A 2JLDA 3TN8A 2YIQA 3D7ZA 2I0EA 1FGIA 2GS6A 3FHRA 4G3CA 2BAJA 4O7LA 2GMXA 1YI4A 3PVGA 3LXNA 3CCNA 4QMZA 5AA8A 1LEZA 4BYJA 5LMKA 5CX9A 4DHFA 4AACA 1P4OA 4FV6A 3HDMA 4XLVA 4L01A 1GZOA 3PP0A 5KX8A 5E9EA 4YNOA 1PYXA 4Q9SA 4C4FA 2CDZA 5ANEA 4XRLA 5CU4A 4QMQA 5J9YA 4S34A 3O23A 5HG9A 4EHGA 1KOBA 4PUZA 5AP3A 3ZEWA 4BKZA 1GY3A 3PIXA 2Z7QA 4FTCA 2WTJA 3QGYA 3FZSA 5KMLA 3OXIA 3F69A 2WMWA 4Y83A 3RCDA 4LL0A 2ZM4A 4RJ3A 5FRIA 5IU2A 4NM3A 5EI8A 3S3IA 2JGZA 4L3LA 3O51A 1S9JA 2VNWA 3F7ZA 4BC6A 3W10A 4ANOA 3D2KA 4O86A 3KRXA 4G5PA 2W1FA 3W2CA 5HEZA 3LLAA 4R5YA 4CSVA 4A9YA 2F2UA 3MFTA 1UNGA 4QMTA 3VW6A 4JX7A 4BGHA 3E64A 3EMGA 5IMXA 3PA5A 4FVPA 5F9EA 4W4XA 4PDYA 2EB2A 5CF6A 3K5UA 3ZLWA 4LOQA 5AM6A 3MESA 5CANA 1SVHA 3DU8A 4EK3A 2WHBA 4PMSA 4A9SA 4WNKA 4FEWA 4CMUA 1M14A 4F7JA 1CTPE 4YP8A 5E90A 2WU6A 3R8ZA 4UWCA 1L8TA 3EN5A 5H3QA 4F9AA 3IDBA 4RPVA 5CAOA 2R3GA 2ITXA 1XBCA 1PRYA 3EQBA 1M2RA 1RJBA 3KCKA 4ZY5A 3FXZA 4MF1A 4EH7A 3R21A 4CRLA 3T9TA 5J9LA 2QODA 3E7OA 5K3YA 2BDWA 3O8UA 4K6ZA 4DEBA 2FVDA 4H36A 4D2VA 4B8MA 4NCTA 2UW9A 5LJJA 4O0XA 2B53A 5DT0A 3OT3A 4F0IA 4A4OA 4ZJVA 4KUJA 4HGLA 1W98A 1ZMVA 1JWHA 5G6VA 5GIPE 2QQ7A 3EFWA 5H8GA 3G90X 4U6RA 2VN9A 4MXCA 4IVAA 5DG5A 4APCA 1GAGA 3ZO4A 3SW7A 2VTPA 2WMTA 5ANJA 4C57A 5LARA 1LUFA 4D0XA 1JKLA 3QF9A 2ZVAA 3QD4A 4CT2A 3DFAA 3KN5A 4U8ZA 2J2IB 3CQUA 3U8WA 2CLQA 5HZNA 4LQMA 1YDRE 3H0YA 3D5UA 2A27A 2XBAA 3AGLA 3TIYA 1OUYA 4ASZA 5DR9A 3SKCA 1UU7A 2J9MA 2J0JA 1IEPA 2OW3A 4BGGA 3NW6A 5JT2A 4ZAUA 2P33A 4G16A 1J1CA 1PXOA 2QG5A 5AX3A 1WVWA 4RBLA 4U5JA 5FLFA 1M7NA 2W5BA 1X8BA 4L6QA 3QQHA 1Q8WA 5FTOA 1Z57A 3IW4A 3QZFA 4S33A 2Z7RA 4TNDA 1WBNA 1R39A 1UNHA 4X2NA 5EHOA 2VUWA 3Q6UA 4X6RA 3TNIA 3TG1A 1XO2B 1W7HA 3FLYA 5IPJA 5KHXA 4TYGA 3MJ2A 2OJFE 3W2QA 3UO6A 5EYKA 5GIOE 3GQIA 3DKCA 4JNWA 4MBJA 1T46A 3BLRA 1J1BA 3D15A 3H0ZA 3PJ2A 4GK4A 5BVEA 2WMVA 4R3CA 5HI2A 3RJCA 4D1SA 4R3PA 4QMPA 3IDCA 3RAIA 2R7BA 3DPKA 4DC2A 3CTQA 1ZYJA 5EG3A 4D28A 2BKKA 2PZ5A 3LCTA 3V5TA 3ZU7A 1Q99A 3LIJA 4P5ZA 1VEBA 2XUUA 3LFFA 4AW1A 1BKXA 5EI2A 2JIVA 3DDQA 2IO6A 4KAOA 2R5TA 4Y95A 5IQCA 5AP5A 4DEGA 4JDKA 3KULA 4A06A 4FKSA 3VHEA 3CJGA 5HGIA 3R28A 5AWMA 3CKWA 4YLLA 1FVVA 3VBYA 5HX8A 4LRMA 1JSUA 1PYEA 3FWQA 3FLQA 4R7HA 2W1DA 2WELA 4E4MA 5JQ5A 4DH1A 4U41A 1KV1A 5EFQA 3QALE 2QOHA 3DS6A 4ARKA 3AMYA 3A99A 5HNGA 1K9AA 2W1EA 3QUDA 4ANNA 1Y8GA 3MI9A 3CKXA 4AFEA 4AUAA 4J97A 5AR7A 1Y6AA 2QO9A 5ANIA 1OVEA 2OFUA 2R3QA 3NR9A 4GJ2A 2CJMA 4FNZA 2G2HA 4FODA 2OJ9A 4IFCA 2VTMA 5K0XA 4LOOA 4QP4A 1QCFA 4ZTMA 3HAMA 3UNKA 4L43A 3QTRA 1QMZA 3LJ0A 4AF3A 4AZSA 3IGGA 4QMLA 2NRYA 4L45A 4G3EA 2WPAA 4W9XA 3VUDA 3QXOA 4IANA 3QX4A 2XYUA 4HZSA 3UC3A 2PE0A 4FZ7A 2I7QA 4FNXA 4FTLA 4QNYA 4CFMA 4O0TA 3P08A 4FR4A 5IH4A 5B2LA 3OUNB 4NTTA 4MXZA 4OBOA 4MNEA 3LE6A 4FZFB 1JKKA 4FTTA 3THBA 2UZVA 4EYMA 3PJ3A 4A9RA 1YQJA 1YOLA 4EWQA 4ZS0A 5HICA 1XH8A 3UVPA 1MP8A 3KRWA 3CBLA 4QMXA 4EK5A 4Z7GA 4I6BA 4U3ZA 5FXQA 3GU8A 2ZAZA 1PXKA 1SNXA 3TEIA 1OIRA 3QRKA 5LMBA 4XG7A 1UWHA 4FSNA 4O7RA 2XCHA 4JAIA 4EOMA 4FTQA 5CAVA 4N6YA 4GKIA 2PU8A 2Q83A 1IASA 3QCQA 3TI1A 4YC6A 4U44A 2YJSA 3GENA 4TT7A 2QKWB 3EYHA 4IWPA 4F70A 4QMOA 4ZMFA 5F1ZA 3RPSA 4RG0A 4ANBA 5HTCA 2OIDA 4YHFA 4WUNA 4YR8A 1J7LA 4PTCA 3PY1A 4D2PA 2OJJA 5KO1A 4EYJA 4FTAA 4BF2A 3SX9A 3OF0A 1ZY5A 3VAPA 2BROA 3NAYA 4GCJA 4XP0A 3L9LA 2IW9A 5AV2A 1ZOHA 4RT7A 2BALA 2ITTA 4ASXA 3L1SA 2R4BA 5AV0A 5DGZA 5JGDA 1DAWA 2ITVA 5I9XA 4N57A 4KS8A 2B9HA 5IF1A 3GQLA 1BI7A 1U5QA 4UX9A 4ZJJA 5L4QA 5AV1A 1U5RA 4CFWA 5AUUA 3MH1A 2GTMA 3BBWA 3Q52A 1KE5A 1YXVA 3QZGA 4CZYB 3ZHPC 5BMSA 5HLNA 2PL0A 3P7CA 5KMNA 5BQ0A 3ACJA 1J3HA 1Q3DA 4YZDA 3O96A 2X7FA 3W2RA 4XG6A 2QVSE 2BZHB 3L9MA 4BCPA 5FDPA 4I23A 1FMOE 4F99A 1R1WA 4I5CA 2PUIA 3JYAA 3VS4A 4BCIA 4CEGA 4EORA 2GNLA 3AGMA 3R9HA 2XVDA 3C0GA 3FLWA 4I92A 4GL9A 2HELA 4KKGA 2UW3A 2YLEA 3AC5A 5ACKA 3RWQA 4MNFA 2WB8A 1Q4LA 2C30A 4LI5A 5KMMA 1XH4A 2NO3A 3MVJA 4NT4A 5LVLA 5M55A 3ZDUA 3SRVA 1M52A 4GT3A 5M06A 2YWPA 2XS0A 4PRJA 5J9ZA 5HCZA 2QOLA 3HMMA 2JDVA 2XIKA 3KQ7A 4KNBA 3H9OA 5DMZA 4UXQA 4W4YA 2E9UA 2J6MA 3KXGA 3UVQA 3WF9A 3W18A 4MAOA 2HY81 2ZMCA 3PLSA 4BDBA 5T68A 2VO0A 2J0KA 4AA4A 1V0BA 4L9IA 4A07A 4ACMA 2O65A 3MFRA 3NZ0A 1XHAA 3A7GA 3D4QA 4EHZA 4TYHA 3SXRA 5HU9A 1PXMA 3V6SA 3HLLA 4BCMA 2F4JA 4QYYA 3UZRA 3C4CA 4FV3A 4PL3A 3MYGA 5C27A 2HCKA 5HE1A 3FZTA 2PULA 4XG9A 5EM6A 3DQWA 4J8MA 3W2PA 3PRFA 3Q5IA 2XJ1A 2QOFA 3II5A 3R30A 4ITJA 1KV2A 4V0GB 4AAAA 4PDPA 3PLAE 4HNIA 4BWXA 1YWNA 3PDTA 4FTNA 4FK3A 4C37A 4FSQA 1M17A 2X7OA 3CJFA 2HXQA 2FO0A 3PFQA 4FV9A 4ZY6A 4C2WA 3V6RA 3ZBFA 1A06A 2C5VA 3NDMA 2RFEA 1B6CB 5D7VA 5AFVA 4I6FA 4I93A 4O0YA 4XV3A 4IEBA 3MH3A 2BUJA 4OBQA 3FZRA 3WZEA 4A4LA 4F9WA 2X8IA 4ITHA 3VS2A 1Y91A 3QGWA 4BCOA 2CPKE 4O83A 4I5HA 3PXRA 3RALA 1BX6A 3Q04A 4FKOA 2OKRA 4LRKA 5HX6A 5HBJA 4OTIA 3DJ7A 4F9BA 2C6TA 3ITZA 3KEXA 4TNBA 5M09A 3A4PA 5GNKA 2DS1A 4EOJA 4NYEA 1Q8TA 4MXAA 2XYNA 2J5FA 1ZMUA 4GUEA 4NIFA 1WVXA 4DEEA 2FB8A 2XRUA 4GMYA 2WOTA 4ERWA 3IOPA 2H8HA 3DBQA 4DTKA 5TR6A 3CY2A 3R0TA 3PSDA 4EK6A 4GEOA 4BDJA 3HRBA 4AGWA 5JZNA 4ENXA 3R2BA 1PMUA 2ITPA 1OL6A 3DZQA 3E92A 2FSTX 1URWA 2C3LA 4MD7E 4FOBA 3UODA 3WZUA 4PNIA 3H3CA 1WVYA 2VX3A 2J5EA 1E1VA 4FSTA 2JDOA 2YM3A 3R02A 5CEQA 3JXWA 4AN9A 2YDJA 4WOVA 2W06A 3FQSA 4GV1A 3UG1A 4XP3A 4F7SA 4RIXB 5AUTA 3S0OA 4PP7A 3LMIA 3A7FA 3OTVA 3CGFA 3F5XA 3UIUA 5KBRA 4FTJA 4IBMA 4EK4A 3PPZA 3U55A 3ORNA 5IQFA 2WKMA 3B2TA 4FV1A 5KUPA 2VGOA 1NVSA 1FOTA 4KIOA 3QD3A 4H3BA 2G9XA 4LUDA 4RWIA 3P7AA 3AD6A 3IECA 4FVQA 5AR3A 1YW2A 3F3WA 3ATSA 5J7BA 1OITA 2YAKA 4K0YA 3NNWA 4BI0A 5H8EA 5HORA 5FBOA 2PE1A 3LMGA 2Q0BA 2JEDA 4AXAA 5CVHA 1UU8A 2YFXA 3MPMA 2OZAA 4Y5QA 1U4DA 5E8YA 4YBJA 4BWPA 3OBGA 2PZRA 5C8MA 5DEYA 4XYFA 5AR5A 3PP1A 2C3IB 3I0OA 5IQEA 4MQ1A 1H1PA 4FIFA 4M14A 4XCUA 1MRYA 2RG6A 3FL5A 3FYJX 3FMHA 3EFLA 3PIYA 4FGBA 4CTCA 2V0DA 3JS2A 4HZRA 4AGCA 5EK7A 4MEDA 2YM6A 5BYYA 4NKSA 4BIDA 4XEYA 2YCRA 5KZ0A 2I0HA 2JKMA 2PUUA 5H9BA 3RHKA 4CQGA 4TYIA 3F5PA 1V0OA 5BUIA 2JITA 3CC6A 3EKNA 4IZ5A 3OT8A 4NFNA 4YHTA 1P14A 2YM5A 4O91A 2CN5A 4UXLA 5TE0A 4NEUA 3NUPA 4WT6A 3EYGA 3FC2A 5JFSA 5DRDA 4IAAA 4OUCA 4YJOA 2WMBA 4C2VA 4D2TA 3NLBA 4F6UA 3FV8A 3FKNA 5AP2A 2OU7A 4QTBA 4ENYA 2IZSA 5K5XA 5HU3A 3IW6A 4OLIA 4DAWA 4CMOA 3OOMA 4ZLOA 2PVNA 2OIQA 1OPLA 1YVJA 2W7XA 3SW4A 2HZIA 2NP8A 3HDNA 3JY9A 2H96A 4PV0A 4TKSA 5AM7A 2GQRA 3I60A 3V8WA 1UV5A 3C4XA 3MY5A 3Q9WA 4HNFA 4XX9A 2PY3A 3BU6A 3LFEA 5LMKC 3EOCA 2YCQA 3EHAA 3U4WA 3DNDA 1H1WA 4U9AA 4BL1A 4YTHA 2YJRA 2OJIA 1DM2A 2CCHA 3BX5A 4LFIA 4TYJA 3P7BA 5DH3A 3ZOSA 3VRZA 1S9IA 2I6LA 5A6NA 2JIIA 4I0TA 5IEVA 4RQKA 3NEWA 2O3PA 3K5VA 5EH0A 3RK9A 3SDJA 3DK6A 3IPHA 3FMJA 1QPCA 3BWFA 2ZV9A 3NWWA 4ANLA 3BHHA 2BZIB 5FTGA 4UYNA 3E87A 3MH0A 4BICA 4ZZNA 3DKFA 4WSYA 3A60A 5CY3A 4EH4A 3L8PA 5EM5A 2RL5A 4XBRA 2WO6A 3QYZA 2BIYA 2IVUA 4XH6A 3EZVA 3OXTA 4ZTQA 4BBMA 4EQUA 4CG9A 4CKIA 3CPCA 5BVFA 4U45A 4AFJA 3MFUA 4TPTA 3SQQA 1GIHA 1XBAA 4FKLA 3DQXA 4FT5A 2P55A 4AU8A 3LJ2A 3TUCA 4CZUA 3BEAA 4QP6A 3V01A 3QWJA 4C7TA 5L2IA 3DXPA 3DXNA 5DRBA 3MDYA 3FY2A 4GFOA 4KIKA 3CTJA 3LXKA 2FSMX 5EDRA 4HOKA 5HVJA 4W9WA 4D9UA 2GDOA 3FBVA 1OIUA 3IW8A 3IQ7A 3VUIA 3GBZA 4ZK5A 3IDPA 5DLSA 3AMAA 3OWKA 3OTUA 1SVGA 3ZO3A 4DH8A 3PIZA 3EWHA 4X21A 3RAWA 4E4NA 5JFWA 3NVMB 3VS7A 1OI9A 2YIXA 4IXPA 4XOYA 4AS0A 1EH4A 5E1SA 1FGKA 1G8AA 2XIZA 5FP6A 3R8PA 4D4VA 4ACCA 2X2KA 4O7WA 4QTCA 2Y8OA 3NUNA 1H1QA 3UYTA 4DGLC 3NCZA 2V22A 4JOAA 4Q5HA 2ONLC 2OXXA 3MIAA 1H24A 3VBXA 5K4JA 5HO8A 3MN3A 5BYLA 4PDOA 3QRJA 1R0EA 2IZRA 2REIA 3GC8A 2HYYA 3MFSA 3P1AA 4MYGA 4F6WA 4DT8A 3H30A 4YBKA 2BRMA 2X4FA 5D12A 2XNMA 3MSSA 5BVKA 3SG9A 5GINE 3OCBA 3QU0A 2RG5A 5AA9A 3QQFA 5EHLA 3QTXA 4GJ3A 3R7GA 5B0XA 1ZY4A 4EONA 3RNYA 1WFCA 2HIWA 3W32A 2ERKA 2G2IA 3P78A 2Y0AA 4ZXTA 3QKKA 3VJNA 2VWWA 3R63A 1W83A 4FUXA 4LV5A 2JIUA 4C3RA 4EOPA 3RVGA 5J87A 4BCNA 3CQEA 4YJRA 3I79A 2BR1A 2QR7A 5HIEA 2XH5A 2V5QA 1OKZA 3D5XA 1XH7A 3NUUA 2XNPA 1U54A 4DG3E 3QHRA 2JBPA 4DFYA 3QD2B 2UW7A 3VS6A 4YJUA 3ACKA 1VR2A 2XK7A 4Z55A 1IA8A 3QUEA 2UZTA 3LM0A 4M7IA 2VTAA 3HRFA 3BV2A 4MQ2A 4EC8A 3FMNA 5CVFA 3R7OA 5I4NA 4CVAA 2WMUA 2Z7LA 3PE2A 1FINA 4IQ6A 3ZRLA 4E6AA 2C3KA 5BNJA 3LZBA 4TXCA 3U9NA 5FD2A 4EBVA 4BHZA 2BFYA 2B1PA 2H6DA 2HW6A 2IPXA 3FLNC 2JBOA 1P2AA 2GPHA 3R83A 1V0PA 2ITOA 4YC8A 2WQMA 1OBDA 1STCE 1PXNA 5DI1A 4EWHA 5ICPA 4HYUA 4PY1A 2EXEA 4L8MA 2UV2A 4YSMA 5E91A 3BQCA 3NAXA 4BDGA 4JG8A 4IJPA 4W4VA 4XMOA 2YWVA 5D1JA 4E6CA 2XRWA 4JBVA 3GCVA 4HVDA 2ITUA 3G15A 3CD3A 1YI3A 4JQ7A 3EQFA 2XNBA 3NUXA 1ZAOA 5C4KA 2CMWA 4QTAA 4R1VA 4QP2A 1WBVA 3PJCA 4M69A 2YM4A 4XS2A 3DAEA 2BRNA 4AGUA 1BUHA 3DK7A 3V5LA 2C47A 2JFMA 1PHKA 2OO8X 4R1YA 4R8QA 5E8WA 4D58A 1OB3A 5A46A 2VTJA 3PSCA 3UC4A 1OKYA 2BILB 3T8OA 3WF5A 1MQBA 3A7HA 2ZB1A 2VWUA 4H39A 3QTQA 4O7ZA 4M67A 4ORKA 2YDIA 3FKLA 4I94A 4EH9A 2QNJA 2ZDTA 4G6OA 5CEPA 1JNKA 2QI8A 2I1MA 3GU6A 4IAZA 5HLWA 4GS6A 4UN0C 4I20A 2KULA 3DKOA 5GHVA 3SD0A 5IA2A 2O5KA 3EKKA 3TWJA 4BZNA 2BHHA 3BYUA 3T3UA 3ET7A 3BPRA 4C36A 3M1SA 4JX3A 4BIBA 4FZ6A 2R3RA 3FZ1A 4B7TA 4ZLZA 4EJ7A 3P9JA 3KXMA 5M08A 4IHPA 3ZEPA 3DY7A 3TNWA 3UOLA 4G9CA 4LG4A 5D41A 3GCPA 2C5YA 5CASA 4FEQA 5L8JA 2PVMA 3V8TA 4QP8A 1MRVA 1OIQA 5GJFA 2GNFA 4KINA 4F9YA 4F6SA 3Q4UA 3DLZA 5F20A 4FIGA 4JDJA 4BGQA 4ANMA 1XH5A 4G6NA 3HA6A 4ANQA 3N4VA 1JQHA 1MQ4A 5CZHA 2UW6A 2IVTA 1I09A 5IDNA 5L2TA 4MBLA 4KKEA 3C0HA 4PL5A 3DBEA 3KB7A 4QP3A 2W0JA 2Y6OA 4IVCA 5H8BA 3GGFA 5HG7A 3D94A 3FY0A 3OMVA 2ITWA 4R77A 3FXXA 3HMIA 3UTOA 4LL5A 4UWBA 4BKYA 1FMKA 1IAHA 1IAJA 3E8EA 3V5WA 4FV8A 2W4KA 4DEIA 4OTQA 4ACGA 4AZFA 1ZRZA 4AZEA 4U7ZA 2B9IA 3MBLA 4L3JA 2VZ6A 1G5SA 4W8EA 3UE4A 1AD5A 3AC2A 4IM3A 2PVYA 3R6XA 1ZYDA 2JAVA 1B39A 3NX8A 4G9RA 4IX3A 5AR8A 3NNVA 4BTMA 3PUPA 3GT8A 2Y4PA 4YJSA 2QO7A 4UY9A 4YZMA 5CEOA 3QC9A 2WQBA 2B55A 3FQEA 3ZO1A 1O6YA 3PTGA 3ZUTA 4J98A 3V5PA 2PUPA 2O0UA 4W8DA 3IONA 4I21A 4PMPA 3LCKA 2X6DA 5EOLA 2UW5A 4UMPA 5GZAA 4EZ3A 2UZOA 4S30A 4AA0A 1CSNA 4C35A 4AW2A 3E3BX 3CGOA 2BCJA 4LV8A 3EN9A 5LCJA 4U80A 1SM2A 3UIXA 1H4LA 2VU3A 2B9JA 2WGJA 4JQEA 3DJ5A 3SOCA 4ANSA 1UA2A 4DGOA 3FPQA 3ZFXA 2IG7A 3ID6C 2HK5A 4YTCA 2DQ7X 3C50A 4K18A 4UZDA 4Y72A 1H1SA 4HCTA 4NU1A 5ETAA 3LAUA 5IUIA 3UYSA 5L3AA 3EL8A 4XJ0A 5AP1A 2A1AB 2QC6A 2WU7A 2GCDA 4JQ8A 4DTAA 3C5IA 4O1PA 2BZKB 1YWRA 2J4ZA 2JDRA 3NUSA 2OLCA 4BCGA 5CSPA 4QTEA 4DF3A 3FDNA 4H58A 4E8AA 2R9SA 2XEZA 3BYMA 5IQGA 4U40A 2IVSA 4QMSA 3RTPA 4G17A 3VF9A 2XNGA 2C5OA 3MVLA 5JFXA 3QHWA 4FTRA 4NM0A 2VWXA 5CT7A 5AIRA 1ZLTA 4PP9A 3TNHA 4RIYA 2BHEA 4ZS4A 2ETRA 2X39A 4E4LA 5I5ZA 2ETMA 4IB1A 3OCSA 2BTSA 2X81A 3KXHA 3F2NA 5HVYA 4FG9A 3I7CA 3VO3A 4QMNA 3F88A 3ELJA 5C03A 1PXJA 3RM7A 5IEXA 5IQDA 3BLHA 2YZAA 3OW3A 3VQHA 4G3FA 4I0SA 4I0RA 4AN2A 5HTBA 2XK8A 3KFAA 4GRBA 4IM0A 5BX0A 5CLPA 4ZEGA 4BYIA 2PMIA 5D9HA 1YWVA 4TYEA 4DGMA 2VV9A 3GXLA 3AC8A 3CP9A 3R71A 3G0EA 3VBVA 5AAGA 4RIWB 5D7AA 2QD9A 2GNJA 3PXYA 3RK5A 4Q5EA 1OL2A 5CENA 4FVRA 3DB6A 5CF5A 2QOOA 3ALOA 3BHYA 3TT0A 4YSJA 3R8LA 4DGNA 1NVQA 3OS3A 3IK3A 4UALA 3OEZA 4QT1A 4E6QA 3KREA 3LXLA 4PWNA 5E8SA 3RPYA 1FVRA 5GZ9A 4RC3A 3LQ5A 3Q3BA 4BDAA 5HIBA 3RAKA 3F5GA 3NIZA 4RMZA 4IC8A 3RK7A 2BRBA 5IZFA 4EZ5A 4ZMEA 1VYZA 4F64A 5AV4A 5IEYA 4AGDA 4O7SA 1PXIA 3MVMA 3GNIB 3FSKA 3BELA 4KS7A 3UVRA 4YJTA 3GCUA 3NNXA 3JVRA 2X2LA 2YEXA 3D7TA 3LKMA 5E1EA 2V55A 2W4JA 5CSVA 5L8KA 4YJQA 4BTFA 3FE3A 3NRMA 5LQFA 2YM8A 2HW7A 2HXLA 3A7JA 1Q5KA 4JRVA 3VHKA 4HYSA 1PXPA 5HQ0A 2UVZA 1IRKA 4ZSJA 4CYJA 3W8QA 3GUBA 3O8TA 4GU6A 4O38A 4X3FB 5KHWA 3G33A 5EYMA 4NSTA 2YISA 3NW7A 4F09A 3UNZA 2CNQA 4RVMA 1HCLA 4CV9A 4QP1A 4CFUA 3QFVA 2EWAA 3EH9A 3VS0A 4DTBA 2WOUA 4USDA 4F08A 2ZM1A 3Q2JA 5JQ8A 4M3QA 2WTCA 3FKOA 3P4KA 4BHNA 4JAJA 3IS5A 4PTEA 5A4QA 1JKTA 3DV3A 2UW4A 3PA4A 4L52A 2VTRA 4I6HA 3VC4A 3N51A 2YAAA 3DB8A 2GQGA 1ZYLA 4FKJA 3HGKA 5HNBA 4UZHA 4ALUA 1O9UA 2XK4A 5F4NA 4M13A 1QPEA 2CGWA 2XCKA 5EW3A 2HZ0A 3QRIA 2Y9QA 4A9UA 2W05A 4N70A 2GHGA 3FMDA 2WXVA 5A14A 3NCGA 4M66A 5I9YA 4RZWA 3RINA 1YOMA 5GJGA 3HV6A 5HIDA 4L68A 3SG8A 4X2JA 4AZTA 1WBOA 3GB2A 3I4BA 3MB7A 5J5SA 2UW0A 5CI7A 3KGAA 4IX4A 1ZYCA 4FF8A 4FTIA 3DLSA 4MWIA 3VBTA 4JR7A 5JRSA 5IQHA 2EVAA 2QOIA 3Q6WA 3R1SA 3ROYA 4CYIA 4W4WA 3VJOA 5M4IA 3LW0A 3UQFA 3KMWA 4J99A 3QD0A 1GOLA 3V04A 5AUZA 1F5QA 2ITNA 5DWRA 2PVLA 3ZM4A 4J1RA 3KF4A 4IE9A 3HP2A 3KC3A 1K2PA 1SVEA 5AJQA 3CD8A 3VWAA 3KRLA 4X3FC 5DYJA 2OICA 3GFWA 4D5KA 3KXXA 4D1ZA 2R0IA 5DFPA 5FEDA 3U4UA 5IH6A 4NWMA 4JJRA 3FYKX 1JSTA 3GVUA 3ZMMA 3E63A 4NFMA 1M7QA 5I3RA 4OTHA 4ONAA 3DTWA 3KF7A 1I44A 4AOTA 2Z8CA 5C8KA 3BQRA 2PVKA 3KVWA 2I0YA 2C6IA 3CTHA 1Q62A 2B0QA 1ZZLA 3B8QA 3WYYA 1FPUA 5C8NA 4RC4A 5E7RA 3BWJA 4FNWA 3ZDIA 1GJOA 1OZ1A 4R7IA 4DG2E 3AC3A 2PUNA 2XJ2A 3ORTA 1DI8A 3PY0A 1UNLA 5FQDC 1K3AA 2ETKA 4K9YA 4FSUA 3O7LB 4O2ZA 5EDQA 4QYHA 3ZSGA 3QQUA 1YOJA 3I1AA 3TKHA 4J95A 4UYAA 1R0PA 3CY3A 3TDVA 3ZSHA 3ETAA 3R01A 4P5QA 3O50A 3ALNA 5BVNA 4BCHA 3F2AA 3QKMA 1XWSA 3GU4A 3Q9ZA 3R9DA 4CQEA 4D4YA 2C1AA 5CEKA 2IZUA 4LGHA 1Q41A 2ESMA 2V7AA 2X9FA 4I41A 4CZTA 2GFSA 3BBTB 3MH2A 4FT0A 4J8NA 4YTFA 3RPOA 3OUKA 2C4GA 3TTIA 2C5NA 4O21A 5CQWA 4EK8A 2RIOA 1OM1A 2QOCA 1Q8UA 4QPSA 3K54A 2W5AA 4G2FA 4TZRA 4OAVB 3LXPA 4BDFA 5FM3A 3KK9A 1ZWSA 4EH5A 3E8CA 5CYIA 3VRYA 2BZJA 4DCEA 2JKOA 3V51A 4M8TA 3MIYA
chains in the Genus database with same CATH superfamily
4O0VA 3UPZA 3KKVA 4M12A 3DK3A 2XKEA 4GU9A 4J52A 4WG4A 5FP5A 4PNKA 2I0VA 2CGXA 2PSQA 3ZLSA 3PVWA 4M68A 4MXXA 3R7VA 5CU6A 4DE4A 3O2MA 4IB3A 4XV9A 1Q3WA 4ZTRA 4ZTNA 3WYXA 4PF4A 2FYSA 3G9LX 2KTYA 5IA0A 5DIAA 5LWMA 5IQAA 3OY1A 4QQTA 3TM0A 4EBWA 2QOQA 4TWCA 5CU0A 3POOA 2QKRA 3AC4A 5HNIX 4FGRA 3PZEA 2CN8A 2R3NA 1QL6A 4Q9ZA 4KBAA 5JGAA 2OFVA 4G3DA 3W2SA 3QLGA 4ZSGA 4WG3A 3C0IA 1QPDA 3PYYA 2WD1A 2YZLA 1KUTA 4NJDA 4IAFA 4N0SA 2O8YA 4O0WA 4WNOA 3LMHA 4OTPA 4RX7A 2FUMA 3CIKA 4D0WA 5DPVA 2FH9A 4K11A 3NFFB 4MCVA 3TV7A 2A2AA 4GT5A 4D1XA 4HVIA 4GT4A 2HWPA 2WAJA 3LM5A 5JSMA 2BAKA 3C7QA 4KIQA 5JRQA 3RP9A 3A62A 5J95A 4DLJA 4Z7HA 3RPRA 4MF0A 4MXYA 1QPJA 2EB3A 4AN3A 2W17A 4LGDA 2C3JA 2BMCA 3OVVA 3MY1A 4FYNA 3DBDA 2XNEA 2DUVA 4IAKA 2C0OA 3NMUF 4E5AX 4BRXA 2XNNA 2C0IA 1Q24A 4FK6A 4I24A 4P7EA 4F7LA 4YJPA 2RKUA 2ZMDA 4YGAA 4HVSA 4JRNA 1Y8YA 4B8LA 4E73A 3W0PA 4PQNA 1L3RE 3ORPA 4P4CA 4FG8A 3HMNA 1IR3A 1H8FA 2VTLA 3GP0A 3R9OA 4IC7A 3FZOA 5D10A 4AP7A 3AT2A 3NUAA 3IKAA 5DVRA 2J0IA 4WUAA 2C6EA 5HTIA 3DCVA 3BGZA 3HKOA 4WG5A 4K77A 3Q96A 2G2FA 2XB7A 3PPJA 4I1ZA 3DFCB 3A2CA 3HV5A 4BR3A 2XK3A 4Z16A 2WMQA 4WNPA 2Y7JA 4NH1A 4RLKA 4EI4A 2IVVA 1PY5A 2X1NA 4FIIA 1MRUA 4AT4A 4H3PA 4ZOGA 4C3PA 5IUGA 4I4FA 2J50A 3FC1X 4WD5A 1OUKA 3FMMA 2WNTA 4Z9LA 2F9GA 3L8XA 5FEEA 2BDJA 2GQSA 4JI9A 5HCYA 4TWPA 2BAQA 3BGPA 4Y85A 4H3QA 5IG1A 2Z7SA 1Q8YA 4II5A 5CAPA 3CPBA 4QPAA 3W8LA 2JKKA 3QA0A 2UZNA 3FL4A 4RC2A 2XEYA 4DGGA 3ULIA 2WMXA 3MTFA 4DLIA 3Q2MA 5AP0A 3TV6A 5M4CA 2RFNA 1H1RA 5AIKA 5A4EA 3TKIA 2IN6A 3F3TA 3MY0A 3SGCA 3EQGA 2JAMA 4HPTE 4ACDA 4JBQA 3V3VA 4ZJIA 2QU5A 3MGYA 4MKCA 4F65A 3AXWA 4JDHA 5K9IA 1Q97A 5BMMA 2XKFA 1UKHA 4OTWA 5BUJA 4ZZOA 2OWBA 3HMPA 3QA8A 4G34A 2PZPA 3A4OX 2YACA 1NVRA 4PMMA 4C62A 4AA5A 4RJ7A 4CLJA 2W96B 3K3IA 3S1HA 1VYWA 3MA3A 4P2KA 3ZTXA 4G6LA 4EKLA 5FTQA 4ZTSA 3C1XA 4EOLA 1ND4A 5CU3A 4ASEA 4MHAA 2H9VA 3ZXZA 1SYKA 3VNTA 3Q5ZA 5LMAA 4H1JA 3HRCA 3HV3A 2O63A 3TKUA 5HE3A 2WMSA 3CLYA 3PA3A 4ASDA 1PXLA 3PJ8A 4JR3A 4FEVA 4QQ5A 4J96A 3NPCA 3R22A 4BCKA 3QAME 3QTWA 5KBQA 4HGTA 4WA9A 3TXOA 3L9NA 4FT3A 5H2UA 3LFCA 5HG5A 1NW1A 2Y4IB 4CCBA 4EQCA 3WZJA 4AOIA 5HD4A 2C6DA 1NA7A 2ZJWA 3PVBA 5GJDA 4RFZA 4QNAA 3AT3A 2C5XA 4TRLA 5BVOA 5CALA 1GZNA 4FICA 3MA6A 3OCTA 2ACXA 3EL7A 3EN6A 3ZFMA 4RX9A 1OECA 3R04A 4J53A 1Q61A 4YU2A 5E92A 4BDKA 3QLFA 4UWYA 4BKJA 4RVTA 4KD1A 2VO6A 2Y6MA 5CQUA 4U79A 4H1MA 5DR2A 3ZS5A 4RWJA 3OFMA 3LJ1A 4DEHA 1KE7A 2X8DA 4D2RA 1PMNA 2FSOX 5EM8A 3EQRA 4KBKA 3EQCA 5CS6A 3QTSA 5DA3A 5ETIA 3BE2A 5EDPA 2QONA 4K2RA 1P5EA 4IW0A 4WRSA 4CFXA 2E9OA 4FA2A 5ANOA 4M84A 4OTRA 4C34A 2C0TA 3I6UA 3LCOA 3NIEA 3LFSA 3TACA 5EQEA 5J79A 4F4PA 3QTIA 4F1TA 5KNJA 1RE8A 4BI1A 2W1HA 2OZOA 4LUEA 4TWOA 4DH5A 4YJNA 2GS2A 1Z9XA 3OXZA 3W0NA 1KE8A 3TCPA 4ACHA 3ZLYA 2PMLX 2E9VA 4I6QA 5TF9A 3R7EA 3VW8A 1UKIA 3KMMA 2YM7A 3TZMA 3ULZA 4G5JA 2HZ4A 3VBWA 2EXCX 3PXKA 5ANKA 3KRRA 3WF6A 1YRPA 2VTOA 4LOPA 4NW5A 2ZV8A 3C4EA 1OL1A 4HCVA 4XLIA 3O7LD 5C1QB 4XNEA 3DKGA 2UZEA 4L00A 4WNMA 3UO5A 3S2PA 2Y4IC 2P4IA 4U81A 1KE9A 4DHIB 3BYOA 4NTSA 3G2FA 3PWYA 4NCTC 4AE6A 4BWKA 2RF9A 2OXYA 1H0VA 3R8MA 4OGRA 5FG8A 3F3VA 3EQDA 4BCQA 4B4LA 4YNEA 5J1VA 2VTIA 3DA6A 2E2BA 4FMQA 1NY3A 3BYVA 4NK9A 4QMYA 5K0KA 3VN9A 4JL9A 3UQGA 3TUDA 3A61A 4AXFA 4GW8A 3OZ6A 3GU5A 3UBDA 2PVRA 2XM9A 3VUMA 5EOBA 3R8VA 2F49A 4ALVA 4V0GA 4MD8E 3TZ7A 4EKKA 4FTUA 5AMNA 5DHJA 5DN3A 3L8SA 2J90A 3MS9A 4K33A 3RM6A 5CU2A 5TO8A 3RMFA 3Q32A 1H0WA 3SVVA 3KULB 3O5AA 4DFNA 4IVDA 2R0UA 4O96A 3FMEA 3QQGA 3ZONA 4FT9A 5HESA 3ZUUA 4BCJA 3QTUA 1H08A 3Q53A 3BU5A 4O81A 3QBNA 4OT5A 3Q60A 2W1CA 4EOSA 3C51A 5AR2A 1PMEA 3D2IA 4X7QA 4XRJA 5ANDA 2OG8A 1YKRA 4F1OA 1PF8A 2GHLA 5JKGA 4GYIA 1LEWA 4IX6A 1WBTA 3BI6A 1A9UA 1O6LA 3EJ1A 4NUSA 4RFMA 3BE9A 3QRUA 4O7VA 5A54A 4KWPA 3HP5A 3IGOA 4YO6A 4GH2A 3LPBA 3KU2A 3D9VA 4Q2AA 3CR0A 4QOXA 4RSSA 2E9PA 1Q8ZA 4B0GA 4DINA 2V7OA 5EW9A 2VNYA 4R6VA 5CF4A 5AP7A 2OI4X 5A4LA 4AXCA 4EHVA 2AYPA 4EH3A 2GHMA 4E5BA 3W1FA 2P2HA 3VUTA 4CFVA 3GU7A 1V1KA 5IH5A 1HOWA 4MNEB 4QYFA 4DFZE 1WBSA 2P3GX 3D5VA 4B99A 3SLSA 4O1OA 3E8DA 5FDXA 2XZSA 4RVLA 3ENMA 4UB7A 5CEIA 4BDIA 5LVMA 4RIXA 2A0CX 3HECA 5C4LA 2C6KA 2VTHA 3FQHA 4FTOA 1XBBA 3ZXTA 1XR1A 5JEBA 4RX8A 3BZ3A 3WF8A 2B7AA 2J51A 3OOGA 4MWHA 4O4BB 4QYEA 5B2KA 3P5KA 4FNYA 4I22A 3OG7A 5ANGA 1YHVA 3ZH8A 5DNRA 4YZ9A 5CSXA 2VWVA 3VQUA 4JVGA 2VO3A 2UZLA 4FKUA 4X2KA 4D4RA 4MTAA 2XARA 4RLLA 3NUYA 5DR6A 4O4DA 3ZUVA 4DYMA 3JR1A 2VTNA 2YN8A 3HL7A 1ATPE 5L2SA 2WTKB 4FSRA 1W8CA 3AQVA 5L2QA 4CV8A 3BCEA 4G1WA 4DT9A 1RQQA 2YLFA 3AD5A 3LQ3A 3ORMA 5L6OA 3IW7A 4QMWA 3WF7A 1H28A 2ZB0A 3ROCA 1WZYA 1JBPE 4NKAA 1H25A 3GC7A 3OCGA 3GCSA 3U51A 4DBNA 4MUQA 3F7WA 3MPTA 5ETFA 1JSVA 2ZM3A 3DNEA 5EYCA 3BKBA 3RPVA 1U59A 2IF8A 4APPA 4RRVA 3FPMA 5F95A 5AUVA 4F78A 3BYSA 3I7BA 3MVHA 3E62A 3PXZA 2PE2A 4IZ7A 2R3MA 4KRDA 5ETCA 1SZMA 3DJ6A 4RQVA 4DEAA 3FEGA 4YZBA 2RSVA 5HBHA 3EFKA 4O7TA 4BB4A 5JH6A 1P4FA 3ML1A 4CG8A 4FKWA 5EQPA 1BL6A 2QR8A 3QZIA 3V5JA 1CDKA 1H27A 3ZC5A 5HOAA 4XV1A 5I9VA 4GFGA 3FLSA 5HKMA 3FI4A 4O6EA 5CXHA 3F9NA 4ZSEA 3Q9YA 4FE2A 4DEDA 2OGVA 2PZYA 2X8EA 3TV4A 4XUFA 1YHSA 4GK2A 3E93A 1KE6A 5AP4A 4GIHA 2XA4A 4C4IA 3HX4A 2VWYA 3HMOA 4YTIA 2CKOA 2R3HA 5I9ZA 1JKSA 4ZLYA 3DZOA 3G6GA 4RA4A 4YO4A 3U6HA 2F7EE 5G1XA 4E3CA 4U3YA 1R3CA 3D5WA 2W5HA 4JT3A 3ZO2A 4L46A 2WTKC 4FKGA 4ZTHA 1YXXA 3G0FA 3AOXA 3RWPA 3FJQE 4OAUC 3N9XA 3MW1A 4CKJA 3TDWA 1A48A 3EQPA 4O6LA 4IADA 4AT5A 4BJJB 4PX6A 3SRVB 3P5JC 2DWBA 3F3UA 4GIIA 2PVFA 4TN6A 4BFMA 5I9UA 3ZYAA 4HVGA 4YURA 2I40A 3FI8A 4FUYA 3AD4A 2NPQA 3NYVA 3WARA 4GKHA 1TQMA 1ZYSA 1TQIA 4GVAA 5E8ZA 5JFVA 3CE3A 4V01A 1OKVA 3KXZA 5AP6A 2QHMA 2R3FA 5M53A 4S31A 3IW5A 3KA0A 4IX5A 3QQKA 2QG7A 4H05A 2ONLA 5CAQA 2AUHA 4IVBA 4FG7A 5CNOA 4QMMA 4R3RA 4YLJA 4FKTA 5AAFA 2G15A 2Z60A 4DFXE 5TOZA 5BYZA 4JG7A 4FSYA 5EYDA 4YPSA 4TYHB 5CAUA 3EIDA 4EOOA 5EW8A 5BUEA 4TTHB 4U42A 3JPVA 2B52A 2OXDA 2J0LA 4FBXA 2W4OA 4Y8DA 5CXZA 1G3NA 3WZDA 2BIKB 3COKA 5DT4A 2CSNA 1SMHA 3WI6A 3A7IA 3P86A 2BRGA 1BYGA 4MBIA 3E7VA 3VUGA 3R9RA 3HV4A 2WTVA 3BLAA 3BRBA 2EXMA 2IZTA 2F2CB 3PG3A 4WBOA 2VD5A 2ERZE 5HE0A 3ZZWA 5L8LA 3VVHA 2XJ0A 4QO9A 4BZDA 2QOBA 4HW7A 2AC3A 2B4SB 4FTKA 2X7GA 2CGUA 1XQZA 3EFJA 4RJ6A 4CFNA 5HVKA 2YDKA 3LHJA 3GC9A 1REJA 3PSBA 4JIAA 4O0RA 3GEQA 4O82A 2PPQA 1TZDA 1H07A 3IO7A 4O7YA 5DE2A 4EZ7A 2XP2A 3ORZA 2XAMA 5BPYA 4IFGA 4MH7A 2FGIA 2F7XE 4LRJA 5EKOA 4GUBA 1OKWA 4X2GA 3ANQA 5L6PA 4F0FA 4E7WA 5EM7A 4I5PA 4Y5HA 1JAMA 3O8PA 2VRXA 1T45A 2JFLA 3OROA 3Q9XA 4NIFB 2JC6A 2WFYA 1ST0A 1HCKA 4KKHA 3UOKA 3HZTA 1YHWA 4I3ZA 3QYWA 2WMAA 3UIBA 3BHUA 2XKCA 3QZHA 4ZTLA 3TTJA 5EKNA 3GI3A 3HA8A 3M42A 1PMVA 2X9EA 4E6DA 2XNOA 4FL3A 2W99B 4PPCA 3R00A 3UP2A 2QHNA 2R7IA 2B54A 4OBPA 2OH0E 4NW6A 2UVYA 4IZAA 3SAYA 5JZJA 4BDCA 4N6ZA 3KL8A 3OWPA 5DT3A 2HZNA 4MX9A 4P90A 5K4IA 2XAOA 1NXKA 1VZOA 4F9CA 1CKPA 5E4HA 4YLKA 3I5NA 1UWJA 4MVFA 4EOKA 2PMNX 4QQCA 3Q4TA 4GG5A 3ZRKA 5AEPA 5CNNA 3EB0A 4EOQA 2J7TA 2ITZA 1J7IA 1NT2A 5C01A 3R8UA 3UO4A 1ZXEA 3RCJA 4LM5A 4OR5A 4AW0A 3U87A 2WEVA 3I81A 2WTDA 4AZWA 4FKRA 4CGAA 5JMSA 5CVGA 3OWLA 1UU9A 4JIKA 1OL7A 1W0XC 2OF2A 4UBAA 3U6IA 4NZWB 3W2OA 5KKRB 1TQPA 3IG7A 4PMTA 3MJ1A 3W55A 4HVHA 4YMJA 3KXNA 4EH2A 4XG8A 4LMNA 4FSWA 3ZRMA 2XIRA 4QQJA 3C4ZA 1PJKA 4AG8A 2SRCA 4ZIMA 3BGQA 3KMUA 4NL0A 2QOKA 3NS9A 4YJVA 1GZKA 1WAKA 2ZDUA 2ZYBA 3F3ZA 3MTLA 2IW8A 1U46A 3ZBXA 4E20A 5LCKA 1XJDA 4L67A 4LGGA 4M97A 4KA3A 4OTFA 1B38A 4X3JA 4XV2A 2RFDA 3U54A 2OZAB 1F3MC 2CHLA 4UMRA 4A7CA 4E5WA 3DAJA 4DH3A 4UMUA 4UMTA 3QX2A 4FV5A 4KBCA 1CMKE 4C38A 2QLQA 2CCIA 2PZIA 5A4CA 3E5AA 3M2WA 3O0GA 2F7ZE 2GS7A 3QXPA 1OPKA 4F1MA 2Z02A 1R78A 4DA5A 4XBUA 3B8RA 2VTSA 2WEIA 2CLXA 4I4EA 4AAYA 2R3JA 2UUEA 3HUCA 3ORKA 5GZ8A 3OBJA 2QURA 2WTIA 3VIDA 3WIKA 4FSMA 2R2PA 2R3IA 4MK0A 5AUWA 3I5ZA 3RGFA 3UIMA 3WIGA 3QQJA 4FIHA 3TNQB 1LPUA 4USFA 3R2YA 3AG9A 3E88A 5LVOA 3PRIA 4IB5A 4IB0A 4UEUA 4DN5A 1M2PA 4TWNA 5B2MA 4EJNA 2UZDA 2C69A 3A8WA 4IM2A 4D4SA 5IQIA 4EH6A 5FWKK 3RZFA 5I0BA 5K5NA 3I6WA 4BIEA 2EUFB 5AAEA 2JDTA 5HCXA 4CKRA 4EOIA 3UNJA 2RFSA 2ITQA 4A4XA 2UVXA 4C59A 3DTCA 3GOPA 3UPXA 3GC0A 4QRCA 3UZPA 5DOSA 3VUHA 1CM8A 5KKRC 4WBBB 4CMTA 4CCUA 3FXWA 4FV2A 4JDIA 4AQKA 4C58A 2BRHA 4IWQA 1WCCA 1F0QA 2WMRA 4KRCA 4YPDA 5DBXA 1BI8A 4ALWA 4C4EA 1BLXA 3FZPA 3C9WA 3E3PA 4O0UA 2CNVA 3N4UA 2HOGA 5CT0A 1UVRA 4XOZA 4E1ZA 4RX5A 2O2UA 3TIZA 4L7SA 4C4GA 5L2WA 2VTQA 3AT4A 1J7UA 2UZWE 2YA9A 3UGCA 4IIRA 4FTMA 4PPBA 5AX9A 2ZV7A 5M4UA 3FI3A 2QCSA 2ZV2A 5DEWA 3ODYX 3H10A 1JPAA 3TL8A 1KOAA 4JXFA 2ZOQA 4BTKA 2OJGA 3K2LA 2X0QA 1Y57A 4C8BA 3DDPA 5KMJA 2YCSA 4S2ZA 1LP4A 3OHTA 3SXFA 3BLQA 4BBEA 4FV4A 3TUBA 5KE0A 1VLRA 1OMWA 3O71A 2EU9A 3TJDA 3V5QA 4FV7A 4F7NA 4JLCA 2CNUA 3DBFA 2GTNA 4ZSLA 4LMUA 4M0YA 4OW8A 5KZIA 1YXTA 3B2WA 5HBEA 4DG0E 2WTWA 2A4LA 2BVAA 4FZAB 1W82A 3QL8A 5FEQA 4R78A 1JLUE 3NYXA 5HO7A 3OY3A 2QO2A 2C68A 5FXSA 3W33A 4L53A 4TY1A 3UMXA 2C6LA 2OSCA 4QMVA 4OTGA 3S95A 2HAKA 5TKDA 3HYHA 3UJGA 3UG2A 3UQCA 3R73A 2YCFA 1O6KA 1OGUA 3D14A 3JVSA 2ITYA 4GSBA 4RWLA 4EQMA 4HGSA 3T3VA 5J7HA 2XK9A 1IA9A 4FKIA 3POZA 5HHWA 1APME 4KIKB 5IKWA 3Q4ZA 2R64A 5LWNA 2YITA 3AKKA 3MWUA 3ODZX 4YHJA 2OIBA 5CZIA 3VS3A 2VTTA 3DOGA 2B9FA 3O17A 4XG4A 5CTPA 4J71A 5FM2A 1ZMWA 3LFAA 3QCYA 1PW2A 4JBOA 3G5DA 1RDQE 2CGVA 4OT6A 3HNGA 3PZHA 2XIXA 4Y46A 3ZM9A 4D5HA 4CD0A 1DAYA 3PXQA 4IDVA 3SV0A 2VX1A 4TL0A 3TZ9A 1G8KA 2IWIA 5E8TA 4BN1A 4HCUA 4IH8A 4EL9A 1J91A 3P0MA 3JUHA 3AC1A 4ERKA 3PY3A 4V05A 3P79A 3NYNA 3TJCA 4C61A 3FMLA 5M44A 3VBQA 4EHEA 5EHYA 4FEUA 1E1XA 2GSFA 4GK3A 4BTJA 5T3QA 5KCVA 3TYKA 3N4TA 1BMKA 2IJMA 2W1GA 2QU6A 3ZFYA 4CT1A 1FVTA 4FKQA 1XKKA 3ERKA 2G1TA 4XG2A 4C3FA 4E4XA 5I3OA 1OIYA 4FX3A 4YZNA 4O4EA 2XF0A 1CKJA 1OL5A 3V8SA 2C6OA 4R5SA 3L9PA 3HV7A 3WE8A 3DGKA 4FI1A 4I5MA 4PDSA 1TKIA 3VS5A 3AKJA 3VUKA 4BVUA 3WBLA 2E9NA 2A98A 2PYWA 2BTRA 4NM5A 1PKGA 1FBNA 1XH9A 5KMOA 2XBJA 3E8NA 4U43A 3QQLA 2WZJA 4Z3VA 1LR4A 2GNGA 2YIRA 4RFYA 4HPUE 1CKIA 3D0EA 4D2SA 4FEXA 2CKPA 4USEA 1W84A 2YIYA 5A6OA 1U54B 3COHA 2OK1A 3P23A 4X2FA 3PWDA 1ZOGA 2G01A 1W2CA 3ORXA 2XIYA 3PXFA 4BDHA 4DBXA 4O7NA 3FSFA 4AE9A 3QTZA 5B7VA 3ZLXA 1TVOA 3CSVA 3PJ1A 3LVPA 3QKLA 5LVPA 3DXQA 3LFBA 4QYGA 2R3OA 2YIWA 4FL1A 3HEGA 2W1IA 5A4TA 2PTKA 3F66A 3EN4A 1FQ1B 5J8IA 5HLPA 2PHKA 4DFUA 4IZYA 4GYGA 2C6MA 3ORIA 3VF8A 4BBFA 4RIWA 4R7BA 3WOWA 4EC9A 5AADA 1YXUA 2AQXA 2XM8A 2PK9A 4XG3A 2GNHA 3UMWA 3ATTA 5M56A 5CWZA 3RNIA 3SOAA 2P0CA 5AUYA 3EQHA 4DCAA 2X6EA 3G9NA 4IWOA 1ZARA 1KSWA 1AGWA 3F82A 4RVKA 2BFXA 4IAYA 4KB8A 2WIPA 5EI6A 2PMOX 3R7YA 4EH8A 4C4HA 2XMYA 4PTGA 3ZSIA 4C4JA 2JKQA 4BZOA 2V62A 3QUPA 4M69B 5J1WA 4DFBA 3C5UA 3M11A 5M57A 1REKA 2WIHA 4ZP5A 5LXMA 3QCSA 4PPAA 4AWIA 4B6LA 3GCQA 5HD7A 2F57A 4RIOA 1M2QA 4A9TA 5HG8A 3G51A 5HO6A 3UOJA 2J0MB 1RW8A 4D2WA 3OP5A 4RJ5A 3ANRA 4KSQA 5IA3A 3CXWA 3F61A 5IA1A 3ENHA 3SC1A 2W9ZB 2OF4A 3FI2A 4FYOA 5CI6A 4WO5A 3S00A 4FV0A 5ACBC 2X0OA 2IW6A 3OW4A 4QPMA 2YHVA 4BCFA 4X3FA 3MPAA 2R3LA 4WHZA 3UP7A 2HENA 3WILA 3HVCA 1GNGA 4TW9A 4D55A 3BHVA 3FAAA 2LGCA 4G3GA 3IOKA 4DFLA 4QTDA 3DBCA 3UDTA 3CQWA 1G8SA 2W1ZA 4RJ8A 1WBWA 5AR4A 3G6HA 1VJYA 4BI2A 1YXSA 4RJ4A 5ITAA 3KVXA 3KRJA 5TT7A 4CXAA 2UZBA 4QD6A 2PVJA 4IMYA 4L44A 3RBWA 4XP2A 4B9DA 4AZVA 4F0GA 4FT7A 4GVJA 4MD9E 4WSQA 4WRGA 3RHXA 4AX8A 5CF8A 3F2RA 3UDZA 4AOJA 2Z2WA 2QLUA 3LLTA 4FSZA 4M0ZA 5FBNC 5KMIA 4ITIA 5IISA 2R3KA 3F5UA 3KN6A 5CSWA 3C4FA 4GG7A 3FHIA 4DITA 4S32A 3GOKA 3PPKA 4L7FA 1URCA 2C1BA 3BEGA 3BU3A 5I9WA 4FL2A 4GFMA 1WBPA 1GIIA 4IAIA 3UDBA 2JDSA 1BL7A 3PG1A 5M51A 1SNUA 4G31A 3CS9A 4YZCA 1ST4A 4AT3A 4BDDA 3I0QA 3NVKI 3R1NA 2XKDA 1XH6A 1YDTE 5IUHA 4L3PA 3UZTA 4FZDB 4JBPA 3KY2A 2HWOA 4K1BA 4KIPA 4KABA 3FUPA 2A19B 3R9NA 3D83A 4KSPA 1GIJA 3COMA 3QCXA 3NW5A 2DYLA 2FSLX 3PE1A 2AC5A 5HE2A 3H4JA 4RA5A 2W9FB 4E93A 5CEMA 5IA5A 5BVWA 5T6KA 1AQ1A 3W16A 3DT1A 4O0SA 2O64A 1Y6BA 5A3XA 3Q4CA 1H01A 4HGEA 2VGPA 3LOKA 4C02A 4PL4A 2VAGA 3LFQA 3ZC6A 1MUOA 4ZZMA 3WE4A 2VO7A 3C13A 2BDFA 3NSZA 3S4QA 3SA0A 3AMBA 3OD6X 3BHTA 3R7IA 4ZSAA 2GNIA 3QC4A 3LCDA 4IDTA 1KWPA 4QMUA 1PKDA 4MXOA 3QRTA 4D9TA 2HY0A 2CKEA 4O84A 5KMKA 1ERKA 2PVHA 4M15A 5C9CA 1ZOEA 4BDEA 5BVDA 2BPMA 1WMKA 2GFCA 5D11A 4XHKB 3R1YA 4FRFA 4WIHA 4F63A 4AXDA 3KCFA 4WKQA 4CNHA 4X6QC 3EQIA 3LQ8A 4AQCA 3PFYA 3NNUA 3KK8A 4HJOA 2FA2A 5J5TA 4OTDA 3FLZA 5FUTA 3K3JA 3ZCLA 5FXRA 1OPJA 2XANA 2X4ZA 4ID7A 3NGAA 5LVNA 4JS8A 2PWLA 4DH7A 2RGPA 3PVUA 5L6WL 5C26A 4YC3A 1DS5A 4EEVA 4K8AA 5JK3A 1UU3A 1H26A 1ZZ2A 3MB6A 2Q0NA 4NM7A 4I6LA 4FKVA 1GZ8A 5JN2A 3CEKA 4RIYB 3ZZEA 1OBGA 1IG1A 4IJ9A 2UW8A 5CSHA 3WZKA 2H34A 3ORLA 4RZVA 3VULA 3W0MA 3JY0A 4CFFA 3EZRA 5IMEA 2CKQA 4X0MA 5IDPA 1E9HA 4RWKA 5LOHA 3LCSA 4FKPA 4IWDA 2R3PA 5IA4A 2UZUE 3H9RA 4Y73A 3SHEA 2VWZA 5AUXA 3TZ8A 2X2MA 2WQNA 3RAHA 3OC1A 1Z5MA 5JGBA 2JD5A 2VWIA 4CRSA 2YERA 4LYNA 5AV3A 4FOCA 4CTBA 3UOHA 4U0IA 3C4WA 3RZBA 2YABA 4FIJA 3TNPC 5M4FA 4V04A 4EUUA 3HAVA 4FIEA 5M07A 5E8VA 3BV3A 3T9IA 4EUTA 3U6JA 3LFDA 4JG6A 2X0PA 3NYOA 3OWJA 5E8UA 4HYHA 4HYIA 4O27B 4J7BA 2VWBA 3OEFX 4N4SA 4QP9A 4UMQA 3L8VA 2NNWB 2LAVA 4AW5A 2BKZA 1H00A 3QWKA 5FGKA 4C0TA 4UV0A 2OH4A 1DI9A 3MV5A 1YDSE 2X0GA 3A8XA 3F6XA 5EQYA 3R1QA 4BY9E 3BIZA 4RGJA 3BL7A 3RI1A 3DAKA 5F94A 4YUQA 2VX0A 4O22A 1YI6A 3LFNA 3EN7A 4NJ3A 4L42A 3SXSA 2NRUA 3GFEA 5E8XA 1JVPP 3R7UA 2GU8A 4IACA 3U9CA 4C33A 3RKBA 2OBJA 3REPA 4QP7A 3FMKA 4FC0A 2WQEA 1JOWB 3D7TB 3VS1A 4CLIA 2P2IA 2WQOA 2XK6A 3HUBA 4O2PA 4E26A 3H9FA 5IQBA 3COIA 4U97A 4ZY4A 2JLDA 3TN8A 2YIQA 3D7ZA 2I0EA 1FGIA 2GS6A 3FHRA 4G3CA 2BAJA 4O7LA 2GMXA 1YI4A 3PVGA 3LXNA 3CCNA 4QMZA 5AA8A 1LEZA 4BYJA 5LMKA 1W2DA 5CX9A 4DHFA 4AACA 1P4OA 4FV6A 3HDMA 4XLVA 4L01A 1GZOA 3PP0A 5KX8A 5E9EA 4YNOA 1PYXA 4Q9SA 4C4FA 2CDZA 5ANEA 4XRLA 5CU4A 4QMQA 5J9YA 4S34A 3O23A 5HG9A 4EHGA 1KOBA 4PUZA 5AP3A 3ZEWA 4BKZA 1GY3A