2PMIA

Structure of the pho85-pho80 cdk-cyclin complex of the phosphate-responsive signal transduction pathway with bound atp-gamma-s
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
284
structure length
284
Chain Sequence
b'ATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKYNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWFAEYYH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent protein kinase PHO85
publication title Structure of the Pho85-Pho80 CDK-Cyclin Complex of the Phosphate-Responsive Signal Transduction Pathway
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein,transferase/cell cycle
total genus 73
structure length 284
sequence length 284
chains with identical sequence C
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pmiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pmiA01
5F1ZA 4O7NA 4DTAA 4GU6A 4O7RA 5LVNA 5IQIA 4MD7E 3C50A 2XIYA 4DN5A 4G1WA 4D1SA 3AXWA 3BIZA 2OH0E 3RPYA 3GVUA 3QHRA 5HTCA 4IZAA 4X3FA 4FV1A 2XS0A 4P90A 2BDWA 3EFJA 5AWMA 3VW6A 5J9LA 5D10A 3H9FA 3UNZA 4FKIA 2Z7LA 3UO4A 3FMDA 5JGAA 3VHEA 4QOXA 2JITA 3RZBA 3ULZA 4ASEA 1JKTA 4LRJA 2YM6A 4FUYA 4AACA 3PWDA 5L2IA 4FKUA 4FSMA 3PXRA 1IEPA 5L4QA 4C3FA 4BCPA 4U6RA 4BDHA 4E4MA 5KMKA 5CAVA 4JG6A 2BHHA 5E7RA 3TV6A 1RE8A 4O91A 1WAKA 4QT1A 5IPJA 1DI8A 4BCJA 3PA3A 5DH3A 5L6PA 3QXPA 3UQCA 3KU2A 4CNHA 4D5HA 5EQEA 3Q5ZA 2W96B 2PPQA 4GKIA 4AN2A 4XNEA 1OKYA 3E8DA 4FKWA 4CQEA 5HI2A 5DHJA 3TWJA 4QMTA 4QYYA 1Y8GA 5GZAA 3ACJA 5IDNA 1XBBA 5ANOA 4ASDA 4EOMA 3NYNA 4JQ8A 3EN7A 4JIKA 1JKSA 1ZAOA 4RGJA 5TO8A 4CD0A 5FG8A 3LLTA 5IMXA 4DEHA 3TUDA 2O2UA 3ZFMA 2B9HA 4YR8A 4MNEA 3QGYA 3NX8A 4FGBA 5TE0A 1L8TA 2GNIA 4FYNA 5HNGA 4S31A 2E9VA 4D9TA 4D2VA 5JEBA 2XMYA 2W5AA 2UZDA 1CKPA 4X3JA 3QLFA 2HW6A 4J53A 5ETCA 4F7JA 4ZIMA 4FSTA 2PUIA 1GNGA 2P4IA 3VIDA 4ACDA 4E6AA 3BRBA 4MBJA 5K3YA 4C4JA 4ORKA 4YJQA 4ZMFA 3UO5A 3S95A 1T46A 3NAXA 4DH3A 2R3NA 5DT4A 5HNIX 3GEQA 4MWIA 4RJ3A 2JIVA 4BYJA 2XNMA 4YZCA 1CMKE 2YIXA 1I44A 2YCQA 3A7HA 4LG4A 4E20A 1PRYA 5IQEA 4AGWA 2WU7A 3ORMA 4GFGA 1OKZA 2ERKA 4O6EA 3MGYA 4FZFB 5E8VA 3JVRA 5J9ZA 2C3JA 3TNPC 2YN8A 3NCZA 3OEFX 5BVDA 5CY3A 4FV9A 4LV8A 5DI1A 3ZTXA 4XOZA 4AW0A 2Z8CA 3ZDUA 4EOQA 5IUHA 2Z2WA 5KHXA 2AC3A 4YPSA 2J0MB 1ZZ2A 1PMEA 3NWWA 4FV3A 3W2SA 1GZKA 1VZOA 3CD3A 4RWLA 5AV2A 5FTGA 3KK9A 2R3GA 2QG5A 3TNIA 4EH5A 4IW0A 5HG8A 2C30A 3Q9XA 4M97A 4Q9SA 5EI6A 3DXPA 3ZM9A 4G3EA 3E7VA 3EZVA 4TT7A 4KAOA 4B7TA 2Y0AA 3GU7A 2ETKA 3F61A 1HOWA 3DDPA 3MTLA 2O8YA 4Q2AA 2WGJA 4JRVA 3W8QA 3NMUF 1K3AA 3OUNB 4O82A 4PL5A 3R8UA 3VULA 5HD7A 4I6FA 1K2PA 4O21A 1GZNA 1GZ8A 1YXSA 3JY9A 4QNYA 4QTAA 4DGGA 3KXGA 4OAUC 4AOTA 3LPBA 3GXLA 2V7AA 2BVAA 4QNAA 4AT4A 2UZEA 3QD4A 5HBJA 4C2WA 3TZ8A 5I5ZA 2P33A 1AQ1A 5FQDC 2B4SB 3HDMA 1BMKA 5F4NA 3MFTA 4RX5A 3AD6A 5A14A 1U54B 4GT4A 4U80A 4L67A 4CLJA 4AX8A 3I7BA 2IW8A 3R8PA 3E3BX 1M2PA 5HOAA 4XRLA 4YZ9A 1M17A 1ZOEA 3KF4A 3RGFA 1OM1A 4EYJA 5BPYA 3UVRA 3LFEA 4NH1A 2R3OA 2W5HA 5AP2A 1XR1A 3ATTA 2OO8X 5E1EA 2IWIA 3O7LD 4N0SA 2WQOA 3CY3A 3R7OA 4XG7A 5JKGA 4GK2A 4R7IA 4H58A 4BL1A 3TACA 2PMNX 3BWJA 3SRVB 5KNJA 4KD1A 1PMNA 5FEEA 5AX3A 4O7ZA 2Q0NA 5D1JA 4DEAA 2JKOA 4FTRA 1BUHA 3IGGA 3OHTA 4FSYA 1FVRA 3SXRA 3QGWA 5KMOA 5T68A 4EONA 1HCKA 1BL6A 2VTPA 2VWYA 4FV6A 2PE1A 4K2RA 4RIWB 3R8VA 2GNJA 3OVVA 4FV2A 5EHYA 2YERA 3V5QA 4GT5A 3I5ZA 3S00A 4NT4A 3CPBA 4NW5A 3FMNA 4PV0A 4YC6A 5FTOA 3FSKA 4IM2A 4KSQA 4QYHA 1KOAA 4RQKA 2J7TA 5EDRA 3V5TA 3E8CA 3DA6A 3ZSIA 2H9VA 3P9JA 5M4UA 4WUNA 5K0XA 4EHZA 1R0PA 3O96A 4PNIA 3CTQA 1CDKA 2HAKA 3JS2A 2C5VA 5LCKA 1NA7A 2XCHA 4GFMA 4U3YA 5AJQA 2R3JA 2R3HA 3SW4A 4BFMA 4F6UA 4ZEGA 3ZOSA 3COHA 4A9TA 3ZO2A 2QU5A 4LMNA 3BU6A 2PYWA 2R0UA 5DN3A 4L7SA 1Q8WA 4YO4A 5KCVA 4U43A 3T9TA 3D83A 3HA8A 2CDZA 4Q5HA 3SXSA 4FOCA 1KV1A 2F2UA 4QRCA 1QCFA 3TKHA 3TL8A 4WSQA 3LMIA 3ANRA 4FSNA 3CQUA 4HGTA 4W9WA 3MH1A 1ZYDA 2G2HA 4Y46A 1JQHA 4OW8A 2GQSA 5LQFA 2VO3A 3ORZA 4HVDA 3PY3A 3W2RA 4IZYA 1VR2A 2I0VA 4FT7A 4C61A 5HO7A 4FICA 3OXIA 3FC1X 3HRBA 4YBKA 5DR2A 2VAGA 4M66A 4ANQA 3ANQA 2PU8A 3P7AA 3GCPA 4I20A 3O71A 2BRBA 2OIDA 4RWKA 4BI1A 5AIRA 1JNKA 3OWJA 4F6SA 4RVLA 3QUDA 1FVTA 2QOHA 4JDIA 3C9WA 4D4YA 3OCBA 3L9LA 2W1IA 1FGIA 5EM5A 5BYLA 4FOBA 3FI3A 2PE0A 2OF4A 4DFXE 1V0OA 3ZO1A 4PMPA 3DTCA 5IDPA 1NY3A 3DXNA 4NEUA 3UYSA 3KULB 3OCGA 4FKJA 2V0DA 3RAWA 3DZQA 4I93A 2W0JA 4LI5A 4Y5HA 2NNWB 3BHVA 2IW6A 2WOUA 5CAQA 1PXPA 1UNGA 1ZRZA 5FXSA 5CF4A 3BHYA 1JVPP 1FQ1B 4FI1A 1UKIA 3LXNA 5FM3A 5AM7A 2OU7A 4BYIA 1F5QA 3BI6A 2ITZA 4Y5QA 2V5QA 3NAYA 3QRUA 3OC1A 1XH4A 4C57A 3LFSA 4H05A 4CZTA 3C4CA 4IAZA 4JQ7A 5TR6A 4E7WA 2XK7A 4GRBA 4D9UA 2QG7A 3LLAA 4TL0A 2VWVA 5KO1A 4TPTA 3ORTA 5ETFA 5AEPA 4L3PA 3AD5A 2C6TA 3TJDA 3ORXA 4I5CA 4WKQA 5H3QA 3G6GA 4PP7A 4UYAA 4DG2E 4RX8A 3C1XA 2OK1A 3FQHA 5KMNA 4FNWA 1UU7A 2WEIA 4CTCA 3KMWA 3ZSHA 4WNOA 3K5VA 4RA5A 1H1SA 2XIRA 3ZBFA 4JS8A 5D41A 3RAKA 3FMHA 3NNXA 3IGOA 3MY1A 4USDA 5EKNA 3RM7A 4GU9A 4CT1A 3ZUVA 5CX9A 3DCVA 3VUKA 2VX0A 1S9JA 2XCKA 2UW9A 4RX7A 2J90A 4J8NA 4DCEA 5CENA 4GW8A 5AUWA 2F4JA 2RFDA 4A07A 1JOWB 2WTCA 5CU6A 5AX9A 3U4UA 1WBWA 2C6IA 2X7GA 2JAMA 4JL9A 4WNPA 3VJOA 5LVLA 3RPRA 3PXQA 4IC7A 3NYXA 5CZIA 2BTRA 3PFQA 4RFZA 2YM5A 4QMYA 4MCVA 3IW5A 4FNXA 4IMYA 3CJFA 4M15A 4XRJA 4UYNA 4BHNA 3Q2JA 4AW2A 2BFXA 2ERZE 3MPMA 2WIPA 3UOLA 3QUPA 1M7QA 4RIYA 3FUPA 4YSMA 2JD5A 4DH8A 5CAPA 2E9UA 5AR3A 2DUVA 5CANA 5M09A 3HV4A 3RK5A 2JFLA 5JRSA 4QPMA 3QRKA 3ITZA 2CKQA 5LMAA 4AP7A 2I1MA 3H10A 3PIZA 3WZKA 4FKLA 4KB8A 2YAKA 4YZNA 3RPVA 1ZXEA 1H27A 3HUCA 4IJ9A 4LL5A 3SKCA 4BI0A 1IA9A 1LP4A 4ZJJA 1IG1A 3UO6A 2G1TA 1ZWSA 3D7TA 3V6SA 2YCFA 5L2TA 2BZKB 4QMWA 2QOOA 2WMBA 3IPHA 3PG1A 3DBEA 4FT5A 3U6IA 2I6LA 4DEBA 4IACA 4EKKA 1W0XC 3EFKA 3MH3A 3OWKA 5CEIA 1Y6AA 3QQUA 2X2MA 3I81A 4EWHA 5C03A 3FZPA 1OIYA 4EOLA 2R3KA 4BKYA 3P4KA 2NPQA 2A19B 4PTCA 5J5TA 2UZLA 2O65A 3W16A 3QU0A 3MESA 4I5MA 2YCRA 4OT6A 2VO6A 4YJVA 4XG2A 4I22A 5JZNA 2C5YA 5L6OA 3D2IA 3HGKA 3MYGA 3E64A 4ZXTA 1U5QA 4ZJVA 3DBQA 3SGCA 4ID7A 4KIPA 4IAFA 4IB1A 3R1SA 2G2FA 4DBNA 3OW3A 3U4WA 4XX9A 3AD4A 3FE3A 5EDPA 4PDYA 4BCOA 1UU9A 4A4XA 1Z57A 4QTBA 4EBWA 2J50A 3DLSA 3R1YA 5FD2A 3E62A 4JOAA 2C0OA 3PIYA 3V5PA 4AG8A 5AR5A 5EK7A 5EYDA 4RPVA 4S33A 4MD9E 3NW7A 3HMIA 4OBQA 4HYSA 3DK7A 1Q41A 4R7BA 4FIJA 5KZ0A 4II5A 2P55A 4KKGA 4KBAA 4ZJIA 4JAIA 4AW5A 4F0GA 1P14A 3FKLA 5EW3A 4PP9A 3FBVA 2LGCA 3LW0A 2ZB1A 3C4WA 5KMMA 2WTVA 4HNFA 3R7EA 2GNFA 2XJ0A 3EIDA 4CYIA 4C36A 4WT6A 5CEOA 3RAHA 2B52A 3NYVA 1BYGA 4IXPA 2QOBA 4O22A 3GNIB 4DINA 4C33A 4G6NA 3V01A 2YISA 2JBPA 4L43A 1KOBA 1GIJA 4O83A 3LFNA 1RJBA 2BKZA 3ZU7A 3C4XA 3D5VA 3MFUA 4RJ4A 5HU9A 5AV4A 4P4CA 2E9NA 2OJ9A 3GCSA 4FTAA 5IEYA 3QZGA 5C8NA 5KHWA 3ORNA 2C47A 2VWUA 4FK3A 4I5HA 3U9CA 3EQFA 4EH9A 3BHHA 3FSFA 3PVBA 5J5SA 3VF8A 5DA3A 3DOGA 4K18A 3A4PA 5C4KA 2PMOX 1TQMA 1OKWA 3HV3A 3LHJA 3O8PA 5AMNA 5AP5A 4C59A 1XHAA 4CEGA 4DEIA 4EOKA 1GY3A 3MWUA 4FG7A 4U7ZA 3A4OX 1XH7A 3K54A 2OI4X 4IB0A 3KL8A 5EDQA 4KIQA 3QRTA 3DXQA 2XNGA 1IRKA 4YJPA 5CSXA 2RKUA 2C6LA 5LWNA 4EH8A 1YHWA 3NZ0A 3IW6A 5JFSA 2CMWA 4GT3A 3PZEA 5C27A 3F5XA 4JI9A 4V04A 1R3CA 2F7ZE 2I0HA 4F65A 3FKOA 3R9RA 3KRWA 3Q9YA 3PXKA 3CP9A 2O3PA 4KIKB 4LOQA 4GJ2A 4K1BA 3W8LA 5FP5A 4BIEA 3F66A 3RHKA 1H28A 3NLBA 3H4JA 3PLAE 5ANKA 4AT3A 5LVMA 1VYWA 5D11A 4NM0A 1PXMA 3FYKX 4YJSA 2BRMA 2EB2A 3E92A 4YBJA 4ZTQA 3CEKA 5KZIA 4D2PA 3UP7A 3PWYA 4XP0A 1V0BA 3CLYA 4ZY6A 3Q04A 3HA6A 2CN5A 3TG1A 4AZTA 5IA3A 1YWNA 3A8XA 4IIRA 4ALVA 4C8BA 4HVSA 5CF5A 3GC9A 3GFEA 4EHGA 3OG7A 4GG5A 4MXCA 3ZRLA 2QNJA 2W1ZA 4XOYA 3OUKA 4PQNA 5D7AA 4O0UA 4UWYA 3QRJA 3FZOA 3I7CA 2PVFA 2ZDUA 3UOJA 3RWQA 2WMVA 4G17A 2W5BA 4IAYA 2Z60A 3OW4A 2R7IA 3BCEA 5A3XA 3UVQA 5IU2A 3R1QA 4QP4A 3T3UA 3FLSA 4FKTA 3BHUA 2VNYA 2NRYA 3EKNA 4YJUA 4E3CA 1JPAA 3FWQA 3HP5A 3AQVA 5AIKA 4E4NA 4YSJA 5JQ8A 3R22A 4HYHA 3FLWA 1MQBA 3CJGA 3DZOA 2JLDA 2B55A 5CT7A 4EUUA 2AC5A 4XV1A 3RINA 5LARA 4YTFA 4FT9A 4FIEA 4X2JA 3EFLA 3TT0A 2PMIA 3CXWA 3N4UA 2Z7QA 3EH9A 3WYYA 4KBKA 1YXUA 3II5A 3PDTA 4QMPA 1B38A 4LOOA 5FBOA 5HGIA 2WTWA 2X6EA 3B8RA 3FHRA 2EU9A 2QO2A 2FSLX 3G9NA 3MDYA 3MN3A 4DGMA 4UMPA 2YJSA 5CSWA 2BDFA 3KRXA 3QA8A 4IWPA 1R39A 4HW7A 5CALA 2YEXA 3UP2A 2UW7A 3CE3A 4JVGA 4PF4A 2QCSA 2YM3A 5I9WA 3GC7A 5AP7A 5L8KA 4LGDA 2ITYA 1ZYSA 5HIDA 1APME 3VBWA 3ORLA 3NSZA 2R3IA 3JYAA 3NVMB 2PTKA 2BDJA 2RFSA 4B4LA 5AUUA 1TKIA 2BHEA 3OXZA 4JQEA 3AGLA 2BIKB 2ITTA 1P4OA 1AD5A 3MA6A 3F5UA 1DI9A 2HENA 4LM5A 4D5KA 1ZY4A 4Z9LA 2R5TA 3ET7A 4BR3A 4AFEA 3PP1A 4BHZA 4FEXA 3QD2B 1XH8A 1J1CA 5AP0A 4BCKA 3MW1A 3ZMMA 3GOPA 4L01A 5G6VA 2FVDA 2IVSA 3EN5A 3GU4A 4ZTLA 4ANSA 3R2YA 4IB5A 4MWHA 4UB7A 4U45A 5H9BA 2JDSA 4LGHA 4CT2A 2W9ZB 1DS5A 5GINE 4ITJA 4IWDA 3AC2A 3OXTA 1WBNA 4LRKA 4ZLOA 5IH5A 3S1HA 3KVWA 4LRMA 5BUJA 3UMWA 1NVRA 1EH4A 3ETAA 4MK0A 3WF5A 4WG3A 2OF2A 2V7OA 4E6CA 4HPTE 4AE9A 4PUZA 2VTHA 5EM8A 2V62A 3UODA 4OTWA 2RL5A 4FIHA 3W1FA 2E2BA 2UZNA 4S30A 5JK3A 5DMZA 4RRVA 2QKRA 3NCGA 1LR4A 3FZ1A 5HD4A 3V5LA 5HCXA 4F9AA 2IJMA 4CZYB 1A48A 4BIDA 3REPA 4L8MA 3VS5A 3SG8A 4AZEA 1XH5A 1Q3WA 4R1YA 1R1WA 2YHVA 1R0EA 4MD8E 4JJRA 4CMTA 4K11A 4ACGA 2WTKB 4KSPA 1YDTE 1JAMA 3C5UA 3PTGA 4CKIA 1OUKA 2OZAB 5DGZA 2YM4A 4UY9A 3D7ZA 5LCJA 3ERKA 2OH4A 4DFBA 3DNDA 1V1KA 4FKSA 4U81A 4E26A 3KB7A 4MXZA 4GJ3A 1UWHA 1WCCA 2UZBA 4NJ3A 3IDBA 5HG7A 4DGNA 2PVHA 5JMSA 1Q24A 3MPAA 4TN6A 4CLIA 2GFCA 2GMXA 4ONAA 3UGCA 3LJ1A 4E1ZA 4IX3A 3EL7A 2UUEA 4UMUA 3F2RA 1H1RA 4GK4A 2X9EA 3VQHA 4CFMA 1VEBA 4M67A 1UU3A 3KXNA 3M1SA 2GNGA 4F1TA 4RC2A 2DWBA 4S2ZA 4W4VA 1WBOA 4ZSJA 3PIXA 3HL7A 3GOKA 4LUEA 4K0YA 2HY81 3AC4A 3LM0A 4G6LA 4F9CA 3UIBA 5A6NA 5JFVA 1H4LA 3G6HA 2Y7JA 4NSTA 3V51A 4KA3A 2W1HA 3W32A 2VGOA 4FTIA 2R3FA 2VTAA 4YJRA 3EN6A 3EYHA 3IONA 3ZFYA 3QQKA 3EQCA 5E8XA 3PSCA 4MEDA 4C4HA 2Z02A 2PVMA 4ASXA 3FXWA 2IVTA 3KXXA 4YO6A 2UW4A 2WEVA 3HV5A 3GI3A 4DH1A 5I3RA 5KBRA 3DPKA 4M68A 5E4HA 2PE2A 3P86A 3TV7A 4GK3A 4Q9ZA 3QTWA 3C4ZA 4AGDA 1YDRE 3TUCA 3QQLA 5K0KA 5HBEA 3PRIA 1ZMVA 4M7IA 3SOAA 4FTKA 5GJFA 3KN5A 3HEGA 3VO3A 3NIZA 1JLUE 2XBJA 4OT5A 5AAFA 3ZYAA 3QFVA 4PNKA 2OBJA 3I4BA 4XV9A 4FC0A 3QZIA 3V5WA 5ETAA 4H1MA 3KXHA 4RIXB 4BRXA 3Q9ZA 4IM0A 4EQCA 4F09A 5FP6A 2W4JA 3NUNA 4IJPA 3GU6A 3R30A 4RWJA 1KE6A 2W1DA 3DTWA 5IUIA 4AZSA 2VD5A 5TF9A 3AC8A 5BQ0A 2ITOA 3NDMA 3NUYA 5FGKA 4WIHA 5ANGA 3AG9A 3TDVA 2C68A 1OPKA 3GENA 3LIJA 3COMA 5E8YA 4XV2A 3QQFA 2J0IA 2X9FA 3UPXA 1H24A 2WB8A 4KNBA 4U44A 3IECA 4IANA 2B53A 3H0YA 3L1SA 2VWXA 1XH6A 3V8TA 3QALE 4R1VA 5JFXA 3L8SA 4BCMA 4O86A 3IO7A 1FBNA 1FINA 3GBZA 3V8WA 2F57A 5C8KA 3U55A 5JFWA 2ETRA 4FSRA 4A9UA 3QKKA 3G2FA 4LL0A 2FO0A 2ACXA 2R2PA 5BYZA 3KY2A 3FI2A 5CQWA 3Q3BA 3HVCA 3K5UA 4IAKA 4R5YA 5DBXA 5KBQA 4MXXA 4BZOA 5IEXA 3UNKA 4F9BA 2W9FB 4LYNA 1H8FA 3ZEPA 4F1OA 3MTFA 4FG9A 4TWCA 3HMOA 5T6KA 3UOHA 3B2TA 3DY7A 3TIYA 4B8MA 5ANIA 4FZ7A 4DEEA 1FOTA 4NM5A 4HVHA 2B9FA 2OZAA 4MYGA 4NCTA 4DAWA 4Y85A 3TTJA 3ZO4A 4EWQA 5AAEA 3LZBA 4NU1A 4E6QA 2B54A 5H2UA 3BQRA 2QI8A 3Q5IA 4UXLA 2FA2A 3U9NA 3ZRKA 3TUBA 1U5RA 3PZHA 4H3BA 3FI8A 2BZIB 2CGUA 3I79A 3ZCLA 3OWPA 2ZJWA 3C4EA 3UZPA 2X8DA 5EOBA 2YM7A 3PVUA 4YZBA 4MXOA 3PRFA 1WVWA 4ZTNA 5LXMA 2QOFA 4I0TA 4QP7A 4BDBA 4HNIA 2QKWB 1O6KA 4DITA 4DT8A 2F7XE 5KMLA 2XM9A 1UV5A 3SAYA 4PRJA 4UWBA 5HHWA 3VBTA 4DG0E 4OTQA 1MRVA 1U59A 2J51A 2YIRA 2Z7RA 4GG7A 4X2GA 3WZEA 3EWHA 5AR2A 3QC9A 2OIQA 3AMAA 3ORPA 4RVTA 4F4PA 4J71A 4KS7A 5HO8A 4TW9A 4IH8A 5A4QA 4KS8A 3D4QA 3P79A 4XV3A 1G8AA 3QQHA 4CCBA 3COKA 2BRNA 2GS2A 1MQ4A 2WKMA 3C0HA 2OJGA 4L42A 4KKHA 1FGKA 4NTSA 1Q99A 3R2BA 4FNZA 3TZ7A 3B2WA 5GZ8A 2OSCA 5EW9A 2A4LA 3ZUUA 3FPMA 4O2PA 4BGQA 1BI7A 4BKZA 5E9EA 1H0VA 4L68A 4EC9A 4RJ8A 5DLSA 2PHKA 1OL5A 3G5DA 3MH0A 3W18A 4CMOA 3H30A 3NW5A 5FEQA 2CGXA 2WTIA 4UMTA 5B7VA 2ITNA 3ZC5A 2CCHA 4UN0C 4C2VA 5EHOA 4JDJA 2J2IB 3KRRA 4HVGA 2XNPA 2JIUA 2QOKA 3SV0A 3VBXA 4LGGA 2EXMA 4BGGA 3QUEA 4DTKA 4CVAA 3DFAA 5CF8A 1J7LA 4J98A 2J9MA 1PKDA 2RGPA 3EQDA 2PZRA 4DFNA 4F64A 5B2KA 4I23A 2DQ7X 3KQ7A 4EH3A 1LPUA 3PJ8A 4IDTA 3TXOA 2QD9A 4CFNA 2IN6A 3BE9A 5DT3A 3QLGA 4R77A 3QQJA 4GYGA 5AP4A 3R7VA 5CXZA 5EKOA 3AMYA 2UZWE 2VUWA 4G16A 2PSQA 3FPQA 1OIUA 2KULA 4BTFA 4Y95A 3VUIA 4O1PA 5KE0A 4ZY4A 2GNLA 3QD0A 1OGUA 4ZLZA 1H07A 3RJCA 4IWOA 3LM5A 5AUYA 4ANLA 4FVQA 1Q8ZA 3MB7A 4QMZA 4IB3A 5E90A 5EG3A 4UXQA 5FWKK 1YOLA 2C0TA 3WF9A 4ACHA 4U0IA 3SXFA 5M44A 3FY0A 3R0TA 4Z16A 1NVQA 5J1VA 4FIIA 5A6OA 4TYJA 4F7LA 1PXKA 4RT7A 2WELA 1PKGA 3BGQA 3H0ZA 2UW8A 2RG5A 3FMJA 4DFLA 4MF1A 5F9EA 5E8UA 4BWXA 3MV5A 2AUHA 5E8TA 5HE2A 5TT7A 3HMNA 2PVRA 4K9YA 4PMSA 3F2AA 4C4EA 3ACKA 4EOPA 3HAMA 2QO7A 5AR4A 4XYFA 4IADA 3IW8A 4Y73A 3KA0A 5I9XA 4TYEA 4B9DA 5HVYA 4LMUA 1WZYA 4X2FA 3VUDA 3QWJA 3ZONA 2NO3A 4IX4A 4R6VA 3HV6A 5IA5A 5C9CA 2WO6A 5IH6A 3PXYA 3O51A 5TOZA 3LFQA 3E8NA 4QMXA 5ACKA 4D4VA 1PJKA 2FUMA 3AOXA 3O0GA 3P0MA 4IEBA 2PWLA 1XO2B 2P2IA 3LJ0A 4ENXA 3BGZA 1PMVA 2UW3A 1YI6A 4HPUE 4DHFA 4F7NA 2XK3A 2I0EA 3BV2A 4U5JA 1W84A 2YM8A 4ZSEA 3LCTA 3V04A 3PXZA 5IQBA 1BKXA 4FTJA 2PUPA 5IQGA 3R01A 3WF8A 3DQWA 3A61A 3R63A 1U54A 3ZZEA 3D5WA 4XP3A 3VUMA 4RJ6A 1GAGA 5HLNA 4O7LA 3SLSA 2YWPA 1Q3DA 1Z5MA 4BDFA 2G2IA 3OBGA 5ANEA 4C4GA 3OP5A 3N4TA 4DTBA 3U51A 1GIHA 2ZMDA 5IQAA 4OR5A 4KKEA 2BUJA 5CNNA 2CGVA 4BDJA 4CMUA 2YITA 5KX8A 1Y8YA 3EQIA 2GU8A 4IWQA 4U9AA 2CNUA 3HZTA 4L53A 2BCJA 3FEGA 4UMQA 4J52A 2E9PA 4D28A 5BNJA 3ELJA 3FMEA 3PA5A 2J6MA 2ZM4A 4C0TA 5J95A 3SRVA 5IA1A 2JKQA 4ANBA 4HCVA 1H26A 1YQJA 1H1QA 4I6QA 3THBA 4I0SA 2B0QA 4QYEA 1SM2A 2ITQA 1J7UA 2ITWA 4YLKA 3POOA 4RIWA 3R9HA 4BDKA 5H8BA 4JBOA 4U3ZA 3ODZX 2CJMA 3UNJA 3KMMA 4TTHB 3NRMA 2G15A 3GFWA 4XLIA 4BCGA 1M52A 4FGRA 4ZK5A 3ALOA 3OCSA 3C0IA 4YC3A 4XS2A 5AUVA 3CGOA 1QPCA 1BX6A 2UVZA 5HEZA 4O7WA 2QOCA 5AR7A 2UZVA 2C3KA 2GDOA 4OTDA 3HV7A 1UWJA 3OROA 5DNRA 4F63A 3WZUA 4YU2A 3Q96A 1ZLTA 3F6XA 3AC3A 3G51A 3GCQA 2VTSA 3PYYA 4IFCA 4IM3A 2OW3A 4BGHA 5DFPA 4FEWA 4DYMA 4YZDA 5CSPA 1UKHA 3EN4A 3TI1A 4USFA 1KE8A 4KWPA 1YXXA 2QOIA 5M51A 3RPOA 2X4ZA 5CAUA 2F7EE 3OTVA 3ID6C 3QKMA 4F0FA 2WOTA 4AUAA 4XMOA 3HX4A 4S34A 2XRWA 2Q0BA 2XIZA 3C0GA 5M57A 4HGSA 4RVMA 2O63A 1P2AA 4CFVA 3VJNA 2C5XA 2WQBA 2WMWA 4P5QA 5CU2A 2ITVA 2XJ2A 3GQLA 2IZTA 3LFAA 4WG4A 3VN9A 2C6MA 4FV5A 1MRYA 1WVYA 3W2PA 2CPKE 5GNKA 2ZV2A 2W06A 3MJ1A 2C4GA 3GP0A 4P7EA 4ZOGA 4GMYA 5EYKA 4EK8A 4AOIA 2X81A 2H34A 1GOLA 2FSTX 3ZBXA 3BU5A 2BAKA 2JGZA 3NR9A 5HE3A 4N4SA 3BE2A 1O6YA 4OUCA 4ALUA 4E93A 5EQPA 4G3GA 4IVBA 4CZUA 3UG1A 4FTLA 4UALA 4RQVA 5AR8A 3KFAA 4OTGA 3VS7A 5IF1A 2GSFA 3BEAA 1MP8A 3AGMA 1WMKA 4AE6A 3VS6A 4IVCA 2BAQA 4CG9A 2I40A 5B2LA 3A62A 4K6ZA 3U87A 2CKPA 4C62A 1URCA 3V6RA 3IQ7A 5DPVA 4GIHA 5DR9A 2HZ0A 4DLJA 4EQMA 1Q62A 4IAAA 2VX3A 4ZAUA 5HX6A 1YOJA 3FJQE 4ZP5A 2ZOQA 3UTOA 3KULA 3TNWA 4QP8A 4FVRA 3HNGA 1WFCA 3B8QA 4UWCA 4O0TA 3MVJA 1XWSA 2Y6OA 4XJ0A 4FNYA 2W1EA 4MQ1A 2RF9A 4PMTA 5CSVA 5T3QA 2W4OA 1DM2A 3LXLA 3NUSA 3ORIA 3SQQA 5IA4A 1IAJA 1NT2A 4R3PA 5CEQA 1W8CA 3Q4UA 4BBMA 1GJOA 2OIBA 2WTKC 5GJGA 3U8WA 5HCZA 2YZAA 3WARA 3DFCB 4FTTA 4NCTC 5L6WL 3QD3A 2QHMA 5HQ0A 3IS5A 3LCOA 4EJ7A 2VTRA 3F5PA 3AT2A 2PZYA 4D55A 3QTSA 3QTXA 4OTIA 1P5EA 4JDHA 5FRIA 5FDPA 1KUTA 2VU3A 3LQ8A 4L46A 4LUDA 5HKMA 5CXHA 3MS9A 1UVRA 3GUBA 4I1ZA 4NFMA 1OVEA 3HMMA 4X6QC 4BBEA 4Z7GA 2YDJA 5DIAA 5JSMA 4CFFA 1DAYA 1JBPE 2OICA 2XP2A 3MH2A 4JBQA 3K3IA 4EH4A 3W2CA 5HVJA 3F5GA 2XBAA 2Y8OA 4M13A 2WNTA 5I3OA 5I9UA 4IBMA 4HVIA 3O2MA 4RBLA 5GHVA 3DAJA 2JDTA 3DDQA 3PE1A 3C4FA 3PG3A 4YP8A 3RVGA 3NPCA 2YIQA 5LWMA 3Q4TA 2E9OA 4NWMA 4WNKA 1OMWA 1TVOA 3NVKI 2JKKA 4KRCA 4AF3A 2Q83A 5L2WA 4AXAA 3Q4CA 2HXLA 4I4EA 4UEUA 4JX3A 3F69A 4O0XA 3BYMA 4AZWA 5C26A 3VW8A 2QOLA 2VO0A 1VYZA 4FZ6A 5JN2A 3TZ9A 3RKBA 5FDXA 4FIFA 4R7HA 5AUXA 4IVAA 3VWAA 3DT1A 4FL3A 4YHJA 2ZV9A 2HYYA 4JNWA 4E73A 5A4EA 3HRCA 1XJDA 4GH2A 3CS9A 2GHLA 3PSBA 5HE0A 4O27B 4L3LA 3RWPA 4ERWA 4EHVA 4O0WA 4PTEA 3TM0A 3RAIA 1LEWA 1REJA 3QAME 2O0UA 3LCSA 3G90X 4ZY5A 3R9DA 5BUIA 4DA5A 3F7WA 5IA2A 2PUNA 5ETIA 1G5SA 3FYJX 4H36A 2YACA 5JRQA 4MAOA 4D2TA 3D9VA 3Q2MA 3Q60A 1UNLA 4EUTA 1OZ1A 3R7GA 2ZB0A 4M69B 5DRDA 1OB3A 4QMNA 4I41A 1STCE 2XA4A 3KCKA 4JBPA 4BZDA 3NNUA 3PJ1A 4C3RA 3O8TA 4Z3VA 1H01A 3HKOA 5IMEA 2JC6A 2R3MA 3LJ2A 3OD6X 4MH7A 4PL3A 2BALA 2XK4A 4M8TA 4PPCA 5ANJA 3UPZA 1A06A 3KREA 1KE9A 4PDOA 4IX5A 3LFFA 3UBDA 5AV3A 4I21A 3RZFA 4OBOA 2XNEA 3QTIA 1PXIA 2XH5A 2VNWA 3TV4A 4BN1A 3SA0A 2V55A 3ORKA 4S32A 2GTMA 4GSBA 4DBXA 1PYXA 3DLZA 3EQRA 3I6UA 3GT8A 3EHAA 1V0PA 2WHBA 3PPJA 3QCSA 5AP1A 3F2NA 3DNEA 4QP6A 3W10A 3ZHPC 2WD1A 1KWPA 3G0EA 3FQEA 3S4QA 2HCKA 4EQUA 1YHVA 3PPZA 1OBGA 3LKMA 2YFXA 4IHPA 2ZV8A 4OTFA 4RC4A 5M06A 4F70A 3EN9A 1SMHA 4YLJA 2OFVA 3L8VA 4ZTSA 4D2SA 4EKLA 3SHEA 1SVHA 3F7ZA 5BVOA 3QX4A 4L6QA 5HBHA 1R78A 5EM6A 5IQHA 3BYVA 4W8DA 4CQGA 4TNDA 3OT3A 3U6JA 2I0YA 4ENYA 1WBSA 4O0YA 3SX9A 2R0IA 2C6EA 3PE2A 4W9XA 1QL6A 4CYJA 1FMKA 3ZDIA 4D0WA 4QTEA 5EW8A 3BLQA 2GPHA 2WPAA 2OKRA 4OGRA 3KK8A 4KABA 4XBUA 2PUUA 2OJJA 4DE4A 3QCQA 1PY5A 2OLCA 2IZUA 1UA2A 3EQBA 3RCJA 4YGAA 4FVPA 3L9NA 3K3JA 4CFUA 3JY0A 4CKJA 4FUXA 4R5SA 3CPCA 4WG5A 3MJ2A 3OF0A 3HECA 4X3FB 5AADA 3A7IA 1OL2A 2HWOA 4FV7A 3BEGA 4NM7A 3UC4A 4BWKA 3KXZA 4TZRA 4QQTA 2YDKA 4EHEA 4OTPA 3RK9A 2PL0A 4L52A 1P4FA 4F99A 4ITHA 4RC3A 5HICA 4EOSA 4FODA 3EZRA 3LVPA 3OBJA 3P5KA 3P7CA 4CGAA 5B2MA 1J7IA 5L8LA 2PVJA 5CNOA 5GZ9A 4XEYA 4DCAA 2CSNA 4ANOA 3BYOA 2C6OA 3FQSA 1Z9XA 2PMLX 3R8LA 4BB4A 1PXJA 2VO7A 4WRGA 3LXPA 3ENMA 1RDQE 1CKJA 4BCQA 2CNQA 2R3PA 4EEVA 3QHWA 2XYUA 4O0SA 2H96A 4H1JA 1OL6A 2NP8A 4ARKA 2A1AB 3GB2A 2B7AA 5J1WA 4YPDA 3FLYA 3QC4A 3ZO3A 1IAHA 3VBQA 4QP9A 5FM2A 4KIKA 4AT5A 4CRSA 4G9RA 2ITUA 3ULIA 3W2OA 4FTUA 4CG8A 5IH4A 2QOQA 4L45A 3QCXA 1ATPE 3MIAA 5EYMA 5C8MA 3W33A 1M2RA 4P5ZA 4XH6A 5F95A 3WILA 3CQWA 2LAVA 3IG7A 3HRFA 4G5JA 4BTMA 4M69A 4ZTHA 4J99A 5KKRC 4TWOA 5BVFA 2ZM3A 4USEA 5BYYA 3Q4ZA 4GUBA 2RFEA 3GC8A 4ZSAA 2OXYA 5FBNC 4P2KA 4NW6A 2OZOA 2BZHB 1NVSA 2UZUE 3CC6A 3VS4A 4MXAA 4BCIA 3LXKA 1SNXA 3MSSA 3P08A 4YHTA 2IVVA 1Q4LA 3O7LB 4FV4A 3WF6A 1ZARA 3DJ5A 3VUHA 1SVGA 4MKCA 3VRZA 2QO9A 4QMSA 4H3PA 2HK5A 1TQPA 4MNFA 5I4NA 4GS6A 4QPSA 3VUTA 5A4CA 3CY2A 4U41A 3OOGA 4M0ZA 4F1MA 4IC8A 3EKKA 3EMGA 2BTSA 2HZNA 4O2ZA 3CIKA 2QVSE 1YXTA 3OFMA 4L3JA 2QLUA 3GC0A 5FXQA 3VS1A 4FG8A 4B99A 3MVHA 1H1WA 4YUQA 5IISA 1X8BA 4RWIA 3QTUA 3SVVA 5CEPA 4TY1A 3QTZA 3ALNA 4AGCA 4LFIA 4FEUA 2VTJA 4RVKA 3VHKA 4FK6A 3E8EA 3BPRA 4QO9A 4O38A 4FBXA 1YKRA 2WU6A 4FKRA 5K5NA 4HZSA 3RNIA 2W99B 4TYHB 4X21A 5HG5A 4OTHA 2P2HA 3AC5A 3QWKA 3PXFA 5C4LA 4GV1A 3WZJA 4QMLA 5M4IA 3VC4A 3PP0A 4FKVA 2EB3A 5DRBA 4C58A 4OBPA 4QQJA 4X0MA 4YURA 4RIOA 2VTIA 2HZIA 3F3WA 4WBBB 5AAGA 2JEDA 2X1NA 3KKVA 4TWPA 4HGEA 4C38A 1PW2A 2VWIA 1ND4A 5C01A 1OPJA 2XEZA 3OCTA 3POZA 2C6KA 2ZV7A 3CTJA 1PXNA 3KVXA 4UZHA 4C02A 5LMBA 4YTIA 4RLLA 3N9XA 4BICA 2X2LA 4CFWA 5HIBA 2X8IA 3WIKA 4U40A 3UVPA 2X4FA 3CD8A 4FV8A 2IG7A 4HOKA 2VWZA 3F88A 4QPAA 4WHZA 4D4RA 4BI2A 4RMZA 4G9CA 4F9YA 2BZJA 4C35A 3A99A 4RG0A 1JKKA 2J5EA 2YIYA 2R3LA 4QD6A 4I3ZA 4O96A 4U8ZA 2PZ5A 4E6DA 3D0EA 1T45A 1G3NA 3BYUA 2IW9A 1URWA 2PY3A 2BILB 5JQ5A 3FAAA 4ANMA 3QA0A 4R3CA 1YWVA 2BIYA 4YJTA 3V3VA 3E88A 4NYEA 1TQIA 2A2AA 2EXEA 1OIQA 3R7YA 2GHMA 2X6DA 4AA0A 3G33A 3FC2A 4IQ6A 2WAJA 4TXCA 4E4LA 2WTDA 3ZS5A 3PY1A 2UW5A 5J87A 2B9IA 2X2KA 2FGIA 4ZLYA 4F9WA 4QP3A 1OL7A 3R7UA 3HYHA 1U46A 3IW4A 4EOJA 1RQQA 2X0GA 4BDCA 5AV1A 2F2CB 2NRUA 3PPKA 3UQGA 2XB7A 4ZS4A 2UVXA 3FDNA 1LUFA 5DOSA 5JGDA 5IA0A 2X7OA 4ASZA 2Y4IC 2B1PA 4M0YA 4DT9A 3EJ1A 3QYWA 4IZ5A 4EK5A 4EZ7A 2VTTA 3PA4A 4BDIA 4RX9A 5CVFA 2B9JA 2VTOA 5CASA 3FXZA 1W7HA 3OEZA 3RPSA 5CI7A 4CFXA 4BTKA 4XG9A 3PSDA 3VNTA 4I92A 5CTPA 4EYMA 2YZLA 5AM6A 3CKWA 4LOPA 3UG2A 4A4OA 4DH7A 4BDDA 3TKIA 4YNOA 4B0GA 2XNNA 3RM6A 3GQIA 4DEDA 4E4XA 3WF7A 3R83A 3KN6A 3AT4A 3FV8A 4QMQA 1PHKA 2UW0A 4RZWA 2FSMX 3Q32A 5E91A 3R71A 3LFBA 4PTGA 3FXXA 4GFOA 3KMUA 5HE1A 3LFDA 5K4JA 3DKCA 3ZLYA 3CBLA 3P1AA 3ZH8A 4FE2A 3A7GA 5BVEA 4MHAA 4BCHA 2ONLA 3QYZA 4FMQA 1KV2A 4BWPA 4QP1A 4Y8DA 4NM3A 4ZTRA 5AP6A 3RHXA 4EBVA 3BWFA 3UIXA 4TYHA 3M42A 2CLXA 4FYOA 3H3CA 4FL1A 2IVUA 5CQUA 4F6WA 4BC6A 1H25A 2C5OA 3QZFA 4WD5A 4I94A 1ZOHA 3BYSA 1XBAA 4AQCA 4FV0A 2HIWA 3AMBA 1S9IA 2CKEA 4ALWA 3ZFXA 4BDGA 4O84A 3UDBA 5LVPA 5M55A 2VTLA 1PF8A 3IOKA 1ZMUA 2F9GA 2OJIA 1SVEA 2WMUA 4XG8A 5BVNA 5EI2A 2XZSA 1IR3A 2WQMA 4J97A 4MXYA 4XP2A 5L2SA 4RIXA 3KRLA 2XKEA 4Y83A 2UZOA 3F3TA 4FTOA 4J95A 3R9OA 5KKRB 2R4BA 4KIOA 3LE6A 5CS6A 1YDSE 3HDNA 3ZC6A 1OPLA 2EUFB 3OY3A 4GVJA 2YA9A 4U42A 2W1GA 5D9HA 4BDAA 4EC8A 1MUOA 1REKA 5CWZA 3BU3A 5CT0A 2BMCA 2PK9A 1E9HA 2OWBA 4GVAA 3S0OA 2JKMA 2ZMCA 5EH0A 3VS3A 4WOVA 3E93A 4EI4A 4XLVA 4EL9A 1G8SA 3ODYX 4Z55A 5HTBA 3P78A 2QR7A 3MB6A 4E5WA 3F9NA 4D2RA 3UE4A 3UOKA 2GCDA 1ZMWA 2RFNA 4UX9A 3KF7A 4GCJA 2YAAA 1A9UA 4X6RA 1ZYLA 5E92A 4EJNA 2YLFA 2C0IA 5IEVA 3FL4A 3BLHA 2JDOA 5CSHA 5CU0A 5BX0A 4M14A 2XVDA 4G3CA 4V01A 3BBWA 4NZWB 3DK6A 3C51A 1H1PA 3OS3A 2HZ4A 4WA9A 4TRLA 5E8ZA 4BTJA 2BRHA 1F3MC 4QMOA 4FEVA 3BGPA 3HMPA 4PPAA 4YC8A 2BROA 4RIYB 3ZLWA 3S3IA 4V0GB 4J8MA 2P0CA 2HY0A 2WZJA 4FTNA 1Q8YA 3TNQB 3VBYA 1FMOE 5CF6A 5CZHA 3F3ZA 5L2QA 3WI6A 1YI3A 3ZXZA 5HX8A 4M12A 2VTQA 4IVDA 4U79A 3V8SA 3Q6WA 2I7QA 3Q52A 4FT0A 4EH2A 4RLKA 5JGBA 3PLSA 2OGVA 1YW2A 2CLQA 2ZYBA 4QQ5A 2REIA 3VRYA 5LMKC 3D7TB 4TNBA 2C1BA 3QF9A 2PVNA 5BVKA 3E63A 3GU5A 2GQRA 3L9PA 4YJOA 5G1XA 2HW7A 2WMQA 3TCPA 4Q5EA 3I6WA 4GEOA 4ZZNA 2BKKA 1I09A 4JRNA 2WMRA 5D7VA 4QTCA 3FZTA 2PVLA 3OTUA 5HVKA 1CM8A 5IUGA 3FMLA 3P7BA 3E5AA 4N70A 2OJFE 3O17A 5CI6A 3H9OA 1LEZA 3Q53A 3QQGA 5J79A 3QCYA 4BDEA 2QLQA 5BUEA 3VS0A 5HLPA 4FIGA 3A8WA 3R8MA 3WE8A 4EZ3A 3A7JA 2JFMA 4GUEA 3PVWA 4D4SA 2VRXA 4FZDB 4CXAA 4XCUA 3JR1A 2XYNA 1KE5A 2HOGA 4FEQA 2X39A 3BX5A 3I1AA 4LQMA 3QRIA 1FPUA 3O23A 2VTNA 3HAVA 3VUGA 5HLWA 4O7SA 3D14A 3I0OA 4IE9A 3DQXA 5KUPA 1BLXA 2FSOX 3TDWA 2Y9QA 2W1FA 2ESMA 4JIAA 1UNHA 2YJRA 2WXVA 3MFRA 4QQCA 4ZS0A 4H39A 4EORA 2VV9A 2H6DA 5L3AA 2IZSA 2EVAA 1YOMA 2CGWA 3QXOA 4I6BA 2XIKA 5FEDA 5BVWA 5IZFA 4NKAA 3DBCA 1JSUA 3M2WA 3CTHA 4FSQA 5AV0A 4A06A 2Y6MA 3TEIA 3UIUA 1O6LA 3RBWA 2VWWA 5J7HA 2YLEA 3MY5A 4FA2A 3UQFA 4CRLA 4NIFB 4MQ2A 3DK3A 5BMMA 2PULA 3OOMA 3KEXA 4C34A 1YRPA 4CV9A 3EB0A 5I9VA 3ZLSA 2CKOA 3PUPA 4AS0A 2BAJA 1MRUA 4EZ5A 3EYGA 4MBIA 4G2FA 2GNHA 4AGUA 2VWBA 3UMXA 3FMKA 3RI1A 2RSVA 3EQPA 4R8QA 2ZVAA 2QC6A 2O5KA 4OTRA 1Y91A 4TYIA 3R28A 4X7QA 3R7IA 2Y4IB 5B0XA 4MTAA 3DKOA 2W4KA 4LV5A 2R7BA 4XHKB 4AN9A 5DT0A 1W83A 3ZXTA 5F94A 5ANDA 4FKOA 1PXOA 2XNBA 5M56A 3EL8A 3IKAA 5KMIA 4OLIA 5CEMA 4YLLA 1IASA 5JH6A 2YCSA 1J91A 5L8JA 5HCYA 4DH5A 5CEKA 1O9UA 5M4CA 1WBTA 4NL0A 4ACMA 2XKCA 2XKFA 3D5UA 2EXCX 4DG3E 1HCLA 3IOPA 3NUUA 3NIEA 3DU8A 4X3FC 3BQCA 3I5NA 5FTQA 5EYCA 5K9IA 2BR1A 4F0IA 3N4VA 3O50A 4QTDA 2QURA 2OXDA 4A7CA 4HYUA 3ZSGA 5CU4A 4C4IA 4EOOA 4YHFA 1QPJA 4NK9A 2QHNA 3AC1A 2XK8A 4FT3A 5FUTA 5EFQA 4AA4A 3C13A 4DFYA 3BELA 4G31A 3MVMA 4V0GA 3RNYA 4WSYA 4EK6A 2OXXA 3R73A 4CV8A 1PXLA 3LCDA 3LQ3A 3ZM4A 1Y6BA 1GZOA 1OUYA 3QBNA 4FKPA 4L7FA 1OL1A 3TTIA 3R02A 4FKGA 3W2QA 1XQZA 3U6HA 3DV3A 4JAJA 4MVFA 4HJOA 2WTJA 3WZDA 2JAVA 4EK4A 1SNUA 2YABA 2YIWA 5HZNA 4D0XA 2XEYA 3WBLA 2OG8A 5DEWA 4AWIA 2AYPA 3NYOA 2KTYA 4I5PA 4XG3A 2HXQA 3DGKA 4E5AX 5HIEA 2PVKA 5IQDA 3L9MA 4QMUA 3U54A 4AW1A 4WBOA 3IK3A 4YTCA 2ETMA 2ZAZA 4KUJA 4DGOA 4AU8A 2XK6A 2R3RA 3EOCA 1WBPA 3L8XA 2UZTA 1QPEA 4HCTA 5CVGA 5HG9A 3T8OA 3W55A 4BIBA 5M07A 3V5JA 1JSTA 4J1RA 4DF3A 4DEGA 3OZ6A 4ITIA 4TWNA 4D58A 3LOKA 2CNVA 3Q6UA 4O0VA 4HYIA 4BCNA 3PJ3A 3KXMA 2YDIA 4M3QA 2CCIA 2HELA 3FL5A 3I60A 2PZPA 3EFWA 4MX9A 5DR6A 3MFSA 4FKQA 2ITPA 3MPTA 2GS6A 3BLRA 4PPBA 3TN8A 4H3QA 4PX6A 4XUFA 4EH7A 3D2KA 3A7FA 2C69A 3JVSA 4JG7A 3QTRA 4JLCA 5CLPA 4AFJA 4Z7HA 4N57A 4RA4A 1ZOGA 3DAEA 1CKIA 4G3DA 4JG8A 5EM7A 3UIMA 4DFUA 3CSVA 2W1CA 4W4XA 3BKBA 2C6DA 3TKUA 5I9YA 4UZDA 3FZRA 3DB6A 5A4LA 4YNEA 2V22A 2XKDA 3KCFA 4MF0A 3EQGA 3CGFA 3LQ5A 4APCA 4O7YA 4FTCA 4N6YA 5IQFA 2P3GX 2WQNA 4QMMA 3FLNC 3NNVA 3KC3A 2JDVA 2VX1A 4NIFA 4ACCA 4G3FA 4JBVA 4QYGA 2OFUA 3ZUTA 4D1ZA 2BFYA 4NFNA 3IDPA 4CTBA 5E8SA 5TKDA 1BI8A 3BBTB 4ZZOA 4K33A 3GCVA 2VN9A 1H08A 5F20A 3GGFA 1OI9A 5K5XA 2JIIA 2ONLC 3CQEA 3DAKA 3VS2A 5K4IA 2F49A 4E5BA 2VGPA 4I4FA 4NKSA 4ANNA 4EOIA 3CR0A 4FSUA 5HORA 4GKHA 4HGLA 3DJ6A 2WMXA 3VBVA 2IZRA 4QYFA 5HU3A 3TNHA 2RG6A 3H9RA 5HO6A 4X2KA 3T9IA 2BRGA 1Q97A 3F3VA 5DVRA 2XIXA 1OECA 4FZAB 2GQGA 1QPDA 4W4YA 4WO5A 4WUAA 2W7XA 4YJNA 4XG6A 5AFVA 2RIOA 5DYJA 4RSSA 2JBOA 3MVLA 4PL4A 4A9SA 3T3VA 1B39A 5EI8A 3R04A 2A0CX 5HNBA 1ZY5A 4FF8A 4F08A 5DWRA 2UVYA 2FB8A 2QR8A 3FKNA 4FTMA 1QMZA 3OY1A 3P23A 4M84A 3LAUA 4AAAA 4J96A 4DC2A 4C3PA 4E8AA 4FL2A 1CTPE 4IAIA 5DE2A 3CCNA 3VVHA 1ZYCA 4AOJA 4L9IA 4YTHA 1J3HA 5E1SA 3ROYA 3K2LA 2XF0A 4KBCA 1OKVA 1E1VA 2R64A 5A46A 3LMHA 4O7TA 1JSVA 3QTQA 3L8PA 1SZMA 1NW1A 5I9ZA 3A2CA 5DG5A 2BPMA 4DFZE 3FI4A 4YZMA 3MI9A 2JDRA 3QL8A 4IDVA 5A9UA 4G6OA 5HTIA 3SG9A 5M53A 2XK9A 4ZMEA 4JDKA 4QMVA 3RALA 4FR4A 3S2PA 2C1AA 5AA8A 5J7BA 4HZRA 3OWLA 1Y57A 3VAPA 3I0QA 5J8IA 2ZM1A 2GTNA 3DBDA 3PJCA 3GU8A 4I0RA 1OITA 3MA3A 4PDSA 3FMMA 4PDPA 3ZZWA 3LCKA 1PYEA 2GFSA 1F0QA 3JUHA 4RFMA 4CCUA 2H8HA 3TZMA 3VQUA 2QODA 3UC3A 3D5XA 3NGAA 3RP9A 4B8LA 2QONA 1W82A 2C3IB 2CHLA 5AA9A 3ATSA 2IO6A 4J7BA 3BZ3A 1AGWA 2WIHA 4AA5A 3KGAA 3IW7A 3RCDA 3SD0A 5ICPA 1H0WA 5M08A 3RK7A 1OIRA 5CAOA 2J4ZA 2O64A 3DKFA 3HP2A 1ZYJA 3R8ZA 3NS9A 4A9RA 4APPA 4R3RA 4K8AA 3WIGA 1OBDA 4PWNA 3SOCA 2J0LA 3IDCA 4IX6A 2W05A 4R78A 2WMTA 3TJCA 4RJ5A 2WQEA 1YXVA 3F82A 2VZ6A 4O6LA 4GL9A 3D15A 4L00A 4ERKA 2J5FA 1YI4A 1KE7A 2C5NA 3ENHA 4QP2A 3NUPA 2X7FA 2Z7SA 3DBFA 3RMFA 4C7TA 1Q8TA 4BCFA 4PMMA 2ITXA 3E7OA 5DEYA 5ITAA 5KMJA 2QQ7A 3KRJA 4FTQA 1H00A 4WNMA 3WYXA 4O1OA 3UZTA 5FXRA 4RFYA 2CN8A 3ZLXA 1Q5KA 1M14A 4ZSGA 3DB8A 3OT8A 3SC1A 3GCUA 2IPXA 4BVUA 2EWAA 1YHSA 4ZTMA 5LJJA 4AZFA 1JWHA 4RJ7A 1Q8UA 2YWVA 3G9LX 2C3LA 3DKGA 4G34A 5GJDA 4KRDA 1BL7A 4XBRA 4UV0A 1CSNA 4AZVA 4D2WA 4FX3A 1U4DA 1VJYA 3QX2A 2PZIA 3AT3A 3LMGA 4KINA 4NTTA 4O7VA 2WMSA 1YWRA 4G5PA 4XG4A 4WRSA 3R21A 4DLIA 4O81A 4W4WA 5GIPE 3SW7A 3MIYA 4A9YA 2R3QA 3CKXA 4RZVA 4BBFA 3N51A 2FYSA 2G9XA 4O0RA 4C4FA 4HCUA 1DAWA 5I0BA 4JXFA 5ACBC 2J0KA 2XM8A 4IZ7A 4X2NA 4TKSA 3WE4A 1K9AA 5LMKA 4BZNA 2UV2A 3R1NA 4I24A 3TIZA 1JKLA 4EK3A 3LFCA 1UU8A 3ZEWA 2GHGA 5FLFA 4PY1A 5EQYA 3DS6A 3HLLA 3M11A 5JZJA 4JR7A 3R00A 1YVJA 4YMJA 1GIIA 2FH9A 2UW6A 3EQHA 3BV3A 5LVOA 4GIIA 4W8EA 3FLQA 2XNOA 4K77A 2VTMA 4MNEB 3F3UA 3FZSA 2Y4PA 2XUUA 5A4TA 5M4FA 2X8EA 1IA8A 1WVXA 4Y72A 3NUAA 3FLZA 3Q9WA 4MBLA 3R9NA 3MY0A 4JR3A 3NEWA 3C5IA 1M2QA 4UMRA 2G01A 4GYIA 4B6LA 4OAVB 2SRCA 4V05A 4C37A 5CU3A 2GS7A 4ZSLA 3MBLA 4FSWA 5LOHA 5IQCA 3FY2A 4IFGA 1XKKA 1KSWA 1SYKA 3VF9A 3RTPA 2PVYA 3WOWA 2WMAA 1Q61A 3COIA 2W17A 3R6XA 2XRUA 5C1QB 1FVVA 4AN3A 4EH6A 5IKWA 5AUTA 4FSZA 4F7SA 3E3PA 3A60A 3HUBA 3OMVA 3E87A 3C7QA 3FHIA 3QZHA 3UYTA 1NXKA 3ZRMA 3G15A 2HWPA 2A27A 3SDJA 4TYGA 1E1XA 1PMUA 5JT2A 3PY0A 4NUSA 1WBVA 4ZZMA 4L44A 5GIOE 1M7NA 3JPVA 3QKLA 2QU6A 2DS1A 4JT3A 5H8EA 4U97A 4BF2A 2WFYA 4JX7A 5BMSA 4CKRA 3PJ2A 3JXWA 3O8UA 5J9YA 5E8WA 4I6HA 5AP3A 1B6CB 2XJ1A 5HESA 5A54A 1L3RE 4N6ZA 5CVHA 5AUZA 3BHTA 5IG1A 2DYLA 1ERKA 1XH9A 3NNWA 4UBAA 2R9SA 4D1XA 5EOLA 3NW6A 5EHLA 3PVGA 1RW8A 4BY9E 3NUXA 3UJGA 1XBCA 5H8GA 4CSVA 3G0FA 1ZZLA 2J0JA 5D12A 5CYIA 4A4LA 3UZRA 4BKJA 1W98A 2ZDTA 4NJDA 3ROCA 4DGLC 3DJ7A 1J1BA 3D94A
chains in the Genus database with same CATH superfamily
5F1ZA 4O7NA 4DTAA 4GU6A 4O7RA 5LVNA 5IQIA 4MD7E 3C50A 2XIYA 4DN5A 4G1WA 4D1SA 3AXWA 3BIZA 2OH0E 3RPYA 3GVUA 3QHRA 5HTCA 4IZAA 4X3FA 4FV1A 2XS0A 4P90A 2BDWA 3EFJA 5AWMA 3VW6A 5J9LA 5D10A 3H9FA 3UNZA 4FKIA 2Z7LA 3UO4A 3FMDA 5JGAA 3VHEA 4QOXA 2JITA 3RZBA 3ULZA 4ASEA 1JKTA 4LRJA 2YM6A 4FUYA 4AACA 3PWDA 5L2IA 4FKUA 4FSMA 3TYKA 3PXRA 1IEPA 5L4QA 4C3FA 4BCPA 4U6RA 4BDHA 4E4MA 5KMKA 5CAVA 4JG6A 2BHHA 5E7RA 3TV6A 1RE8A 4O91A 1WAKA 4QT1A 5IPJA 1DI8A 4BCJA 3PA3A 5DH3A 5L6PA 3QXPA 3UQCA 3KU2A 4CNHA 4D5HA 5EQEA 3Q5ZA 2W96B 2PPQA 4GKIA 4AN2A 4XNEA 1OKYA 3E8DA 4FKWA 4CQEA 5HI2A 5DHJA 3TWJA 4QMTA 4QYYA 1Y8GA 5GZAA 3ACJA 5IDNA 1XBBA 5ANOA 4ASDA 4EOMA 3NYNA 4JQ8A 3EN7A 4JIKA 1JKSA 1ZAOA 4RGJA 5TO8A 4CD0A 5FG8A 3LLTA 5IMXA 4DEHA 3TUDA 2O2UA 3ZFMA 2B9HA 4YR8A 4MNEA 3QGYA 3NX8A 4FGBA 5TE0A 1L8TA 2GNIA 4FYNA 5HNGA 4S31A 2E9VA 4D9TA 4D2VA 5JEBA 2XMYA 2W5AA 2UZDA 1CKPA 4X3JA 3QLFA 2HW6A 4J53A 5ETCA 4F7JA 4ZIMA 4FSTA 2PUIA 1GNGA 2P4IA 3VIDA 4ACDA 4E6AA 3BRBA 4MBJA 5K3YA 4C4JA 4ORKA 4YJQA 4ZMFA 3UO5A 3S95A 1T46A 3NAXA 4DH3A 2R3NA 5DT4A 5HNIX 3GEQA 4MWIA 4RJ3A 2JIVA 4BYJA 2XNMA 4YZCA 1CMKE 2YIXA 1I44A 2YCQA 3A7HA 4LG4A 4E20A 4DHIB 1PRYA 5IQEA 4AGWA 2WU7A 3ORMA 4GFGA 1OKZA 2ERKA 4O6EA 3MGYA 4FZFB 5E8VA 3JVRA 5J9ZA 2C3JA 3TNPC 2YN8A 3NCZA 3OEFX 5BVDA 5CY3A 4FV9A 4LV8A 5DI1A 3ZTXA 4XOZA 4AW0A 2Z8CA 3ZDUA 4EOQA 5IUHA 2Z2WA 5KHXA 2AC3A 4YPSA 2J0MB 1ZZ2A 1PMEA 3NWWA 4FV3A 3W2SA 1GZKA 1VZOA 3CD3A 4RWLA 5AV2A 5FTGA 3KK9A 2R3GA 2QG5A 3TNIA 4EH5A 4IW0A 5HG8A 2C30A 3Q9XA 4M97A 4Q9SA 5EI6A 3DXPA 3ZM9A 4G3EA 3E7VA 3EZVA 4TT7A 4KAOA 4B7TA 2Y0AA 3GU7A 2ETKA 3F61A 1HOWA 3DDPA 3MTLA 2O8YA 4Q2AA 2WGJA 4JRVA 3W8QA 3NMUF 1K3AA 3OUNB 4O82A 4PL5A 3R8UA 3VULA 5HD7A 4I6FA 1K2PA 4O21A 1GZNA 1GZ8A 1YXSA 3JY9A 4QNYA 4QTAA 4DGGA 3KXGA 4OAUC 4AOTA 3LPBA 3GXLA 2V7AA 2BVAA 4QNAA 4AT4A 2UZEA 3QD4A 5HBJA 4C2WA 3TZ8A 5I5ZA 2P33A 1AQ1A 5FQDC 2B4SB 3HDMA 1BMKA 5F4NA 3MFTA 4RX5A 3AD6A 5A14A 3W0MA 1U54B 4GT4A 4U80A 4L67A 4CLJA 4AX8A 3I7BA 2IW8A 3R8PA 3E3BX 1M2PA 5HOAA 4XRLA 4YZ9A 1M17A 1ZOEA 3KF4A 3RGFA 1OM1A 4EYJA 5BPYA 3UVRA 3LFEA 3W0QA 4NH1A 2R3OA 2W5HA 5AP2A 1XR1A 3ATTA 2OO8X 5E1EA 2IWIA 3O7LD 4N0SA 2WQOA 3CY3A 3R7OA 4XG7A 5JKGA 4GK2A 4R7IA 4H58A 4BL1A 3TACA 2PMNX 3BWJA 3SRVB 5KNJA 4KD1A 1PMNA 5FEEA 5AX3A 4O7ZA 2Q0NA 5D1JA 4DEAA 2JKOA 4FTRA 1BUHA 3IGGA 3OHTA 4FSYA 1FVRA 3SXRA 3QGWA 5KMOA 5T68A 4EONA 1HCKA 1BL6A 2VTPA 2VWYA 4FV6A 2PE1A 4K2RA 4RIWB 3R8VA 2GNJA 3OVVA 4FV2A 5EHYA 2YERA 3V5QA 4GT5A 3I5ZA 3S00A 4NT4A 3CPBA 4NW5A 3FMNA 4PV0A 4YC6A 5FTOA 3FSKA 4IM2A 4KSQA 4QYHA 1KOAA 4RQKA 2J7TA 5EDRA 3V5TA 3E8CA 3DA6A 3ZSIA 2H9VA 3P9JA 5M4UA 4WUNA 5K0XA 4EHZA 3O5AA 1R0PA 3O96A 4PNIA 3CTQA 1CDKA 2HAKA 3JS2A 2C5VA 5LCKA 1NA7A 2XCHA 4GFMA 4U3YA 5AJQA 2R3JA 2R3HA 3SW4A 4BFMA 4F6UA 4ZEGA 3ZOSA 3COHA 4A9TA 3ZO2A 2QU5A 4LMNA 3UDSA 3BU6A 2PYWA 2R0UA 5DN3A 4L7SA 1Q8WA 4YO4A 5KCVA 4U43A 1ST4A 3T9TA 3D83A 3HA8A 2CDZA 4Q5HA 3SXSA 4FOCA 1KV1A 3W0PA 2F2UA 4QRCA 1QCFA 3TKHA 3TL8A 4WSQA 3LMIA 3ANRA 4FSNA 3CQUA 4HGTA 4W9WA 3MH1A 1ZYDA 2G2HA 4Y46A 1JQHA 4OW8A 2GQSA 5LQFA 2VO3A 3ORZA 4HVDA 3PY3A 3W2RA 4IZYA 1VR2A 2I0VA 4FT7A 4C61A 5HO7A 4FICA 3OXIA 3FC1X 3HRBA 4YBKA 5DR2A 2VAGA 4M66A 4ANQA 3ANQA 2PU8A 2ZFYA 3P7AA 3GCPA 4I20A 3O71A 2BRBA 2OIDA 2IF8A 4RWKA 4BI1A 3NFGB 5AIRA 1JNKA 3OWJA 4F6SA 4RVLA 3QUDA 1FVTA 2QOHA 4JDIA 3C9WA 4D4YA 3OCBA 3L9LA 2W1IA 1FGIA 5EM5A 5BYLA 4FOBA 3FI3A 2PE0A 2AQXA 2OF4A 4DFXE 1V0OA 3ZO1A 4PMPA 3DTCA 5IDPA 1NY3A 3DXNA 4NEUA 3UYSA 3KULB 3OCGA 4FKJA 2V0DA 3RAWA 3DZQA 4I93A 2W0JA 4LI5A 4O4BB 4Y5HA 2NNWB 3BHVA 2IW6A 2WOUA 5CAQA 1PXPA 1UNGA 1ZRZA 5FXSA 5CF4A 3BHYA 1JVPP 1FQ1B 4FI1A 1UKIA 3LXNA 5FM3A 5AM7A 2OU7A 4BYIA 1F5QA 3BI6A 2ITZA 4Y5QA 2V5QA 3NAYA 4QDEA 3QRUA 3OC1A 1XH4A 4C57A 3LFSA 4H05A 4CZTA 3C4CA 4IAZA 4JQ7A 5TR6A 4E7WA 2XK7A 4GRBA 4D9UA 2QG7A 3LLAA 4TL0A 2VWVA 5KO1A 4TPTA 3ORTA 5ETFA 5AEPA 4L3PA 3AD5A 2C6TA 3TJDA 3ORXA 4I5CA 4WKQA 5H3QA 3G6GA 4PP7A 4UYAA 4DG2E 4RX8A 3C1XA 2OK1A 3FQHA 5KMNA 3ML1A 4FNWA 1UU7A 2WEIA 4CTCA 4AXDA 3KMWA 3ZSHA 4WNOA 3K5VA 4RA5A 1H1SA 2XIRA 3ZBFA 4JS8A 5D41A 3RAKA 3FMHA 3NNXA 3IGOA 3MY1A 4USDA 5EKNA 3RM7A 4GU9A 4CT1A 3ZUVA 5CX9A 3DCVA 3VUKA 2VX0A 1S9JA 2XCKA 2UW9A 4RX7A 2J90A 4J8NA 4DCEA 5CENA 4GW8A 5AUWA 2F4JA 2RFDA 4A07A 1JOWB 2WTCA 5CU6A 5AX9A 3U4UA 1WBWA 2C6IA 2X7GA 2JAMA 4JL9A 4WNPA 3VJOA 5LVLA 3RPRA 3PXQA 4IC7A 3NYXA 5CZIA 2BTRA 3PFQA 4RFZA 2YM5A 4QMYA 4MCVA 3IW5A 4FNXA 4IMYA 3CJFA 4M15A 4XRJA 4UYNA 4BHNA 3Q2JA 4AW2A 2BFXA 2ERZE 3MPMA 2WIPA 3UOLA 3PUFC 3QUPA 1M7QA 4RIYA 3FUPA 4YSMA 2JD5A 4DH8A 5CAPA 2E9UA 5AR3A 2DUVA 5CANA 5M09A 3HV4A 3RK5A 2JFLA 5JRSA 3BL9A 4QPMA 3QRKA 3ITZA 2CKQA 5LMAA 4AP7A 2I1MA 3H10A 3PIZA 3WZKA 4FKLA 4KB8A 2YAKA 4YZNA 3RPVA 1ZXEA 1H27A 3HUCA 4IJ9A 4LL5A 3SKCA 4BI0A 1IA9A 1LP4A 4ZJJA 1IG1A 3UO6A 2G1TA 1ZWSA 3D7TA 3V6SA 2YCFA 5L2TA 2BZKB 4QMWA 2QOOA 2WMBA 3IPHA 3PG1A 3DBEA 4FT5A 3U6IA 2I6LA 4DEBA 4IACA 4EKKA 1W0XC 3EFKA 3MH3A 3OWKA 5CEIA 1Y6AA 3QQUA 2X2MA 3I81A 4EWHA 5C03A 3FZPA 1OIYA 4EOLA 2R3KA 4BKYA 3P4KA 2NPQA 2A19B 4PTCA 5J5TA 2UZLA 2O65A 3W16A 3QU0A 3MESA 4I5MA 2YCRA 4OT6A 2VO6A 4YJVA 4XG2A 4I22A 5JZNA 2C5YA 5L6OA 3D2IA 3HGKA 3MYGA 3E64A 4ZXTA 1U5QA 4ZJVA 3DBQA 3SGCA 4ID7A 4KIPA 4IAFA 4IB1A 3R1SA 2G2FA 4DBNA 3OW3A 3U4WA 4XX9A 3AD4A 3FE3A 5EDPA 4PDYA 4BCOA 1UU9A 4A4XA 1Z57A 4QTBA 4EBWA 2J50A 3DLSA 3R1YA 5FD2A 3E62A 4JOAA 2C0OA 3PIYA 3V5PA 4AG8A 5AR5A 5EK7A 5EYDA 4RPVA 4S33A 4MD9E 3NW7A 3HMIA 4OBQA 4HYSA 3DK7A 1Q41A 4R7BA 4FIJA 5KZ0A 4II5A 2P55A 4KKGA 4KBAA 4ZJIA 4JAIA 4AW5A 4F0GA 1P14A 3FKLA 5EW3A 4PP9A 3FBVA 2LGCA 3LW0A 2ZB1A 3C4WA 5KMMA 2WTVA 4HNFA 3R7EA 2GNFA 2XJ0A 3EIDA 4CYIA 1W2DA 4C36A 4WT6A 5CEOA 3RAHA 2B52A 3NYVA 1BYGA 4IXPA 2QOBA 4O22A 3UDTA 3GNIB 4DINA 4C33A 4G6NA 3V01A 2X0OA 2YISA 2JBPA 4L43A 2XALA 1KOBA 1GIJA 4O83A 3LFNA 1RJBA 2BKZA 3ZU7A 3C4XA 3D5VA 3MFUA 4RJ4A 5HU9A 5AV4A 4P4CA 4O4CA 2E9NA 2OJ9A 3GCSA 4FTAA 5IEYA 3QZGA 5C8NA 4AQKA 5KHWA 3ORNA 2C47A 2VWUA 4FK3A 4I5HA 3U9CA 3EQFA 4EH9A 3BHHA 3FSFA 3PVBA 5J5SA 3VF8A 5DA3A 3DOGA 4K18A 3A4PA 5C4KA 2PMOX 1TQMA 1OKWA 3HV3A 3LHJA 3O8PA 5AMNA 5AP5A 4C59A 1XHAA 4CEGA 4DEIA 4EOKA 1GY3A 3MWUA 4FG7A 4U7ZA 3A4OX 1XH7A 3K54A 2OI4X 4IB0A 3KL8A 5EDQA 4KIQA 3QRTA 3DXQA 2XNGA 1IRKA 4YJPA 5CSXA 2XAOA 2RKUA 2C6LA 5LWNA 4EH8A 1YHWA 3NZ0A 3IW6A 5JFSA 2CMWA 4GT3A 3PZEA 5C27A 3F5XA 4JI9A 4V04A 1R3CA 2F7ZE 2I0HA 4F65A 3FKOA 3R9RA 3KRWA 3Q9YA 3PXKA 3CP9A 2O3PA 4KIKB 4LOQA 4GJ2A 4K1BA 3W8LA 5FP5A 4BIEA 3F66A 3RHKA 1H28A 3NLBA 3H4JA 3PLAE 5ANKA 4AT3A 5LVMA 1VYWA 5D11A 4NM0A 1PXMA 3FYKX 4YJSA 2BRMA 2EB2A 3E92A 4YBJA 4ZTQA 3CEKA 5KZIA 4D2PA 3UP7A 3PWYA 2XAMA 4XP0A 1V0BA 3CLYA 4ZY6A 3Q04A 3HA6A 2CN5A 3TG1A 4AZTA 5IA3A 1YWNA 3A8XA 4IIRA 4ALVA 4C8BA 4HVSA 5CF5A 3GC9A 3GFEA 4EHGA 3OG7A 4GG5A 4MXCA 3ZRLA 2QNJA 2W1ZA 4XOYA 3OUKA 4PQNA 5D7AA 4O0UA 4UWYA 3QRJA 3FZOA 3I7CA 2PVFA 2ZDUA 3UOJA 3RWQA 2WMVA 4G17A 2W5BA 4IAYA 2Z60A 3OW4A 2R7IA 3BCEA 5A3XA 3UVQA 5IU2A 3R1QA 4QP4A 3T3UA 3FLSA 4FKTA 3BHUA 2VNYA 2NRYA 3EKNA 4YJUA 4E3CA 1JPAA 3FWQA 3HP5A 3AQVA 5AIKA 4E4NA 4YSJA 5JQ8A 3R22A 4HYHA 3FLWA 1MQBA 3CJGA 3DZOA 2JLDA 2B55A 5CT7A 4EUUA 2AC5A 4XV1A 3RINA 5LARA 4YTFA 4FT9A 4FIEA 4X2JA 3EFLA 3TT0A 2PMIA 3CXWA 3N4UA 2Z7QA 3EH9A 3WYYA 4KBKA 1YXUA 3II5A 3PDTA 4QMPA 1B38A 4LOOA 5FBOA 5HGIA 2WTWA 2X6EA 3B8RA 3FHRA 2EU9A 2QO2A 2FSLX 3G9NA 3MDYA 3MN3A 4DGMA 4UMPA 2YJSA 5CSWA 2BDFA 3KRXA 3QA8A 4IWPA 1R39A 4HW7A 5CALA 2YEXA 3UP2A 2UW7A 3CE3A 4JVGA 4PF4A 2QCSA 2YM3A 5I9WA 3GC7A 5AP7A 5L8KA 4LGDA 2ITYA 1ZYSA 5HIDA 1APME 3VBWA 3ORLA 3NSZA 2R3IA 3JYAA 3NVMB 2PTKA 2BDJA 2RFSA 4B4LA 5AUUA 1TKIA 2BHEA 3OXZA 4JQEA 3AGLA 2BIKB 2ITTA 1P4OA 1AD5A 3MA6A 3F5UA 1DI9A 2HENA 4LM5A 4D5KA 1ZY4A 4Z9LA 2R5TA 3ET7A 4BR3A 4AFEA 3PP1A 4BHZA 4FEXA 3QD2B 1XH8A 1J1CA 5AP0A 4BCKA 3MW1A 3ZMMA 3GOPA 4L01A 3BL7A 5G6VA 2FVDA 2IVSA 3EN5A 3GU4A 4ZTLA 4ANSA 3R2YA 4IB5A 4MWHA 4UB7A 4U45A 5H9BA 2JDSA 4LGHA 4CT2A 2W9ZB 1DS5A 5GINE 4ITJA 4IWDA 3AC2A 2NYAA 3OXTA 1WBNA 4LRKA 4ZLOA 5IH5A 3S1HA 3KVWA 4LRMA 5BUJA 3UMWA 1NVRA 1EH4A 3ETAA 4MK0A 3WF5A 4WG3A 2OF2A 2V7OA 4E6CA 4HPTE 4AE9A 4PUZA 2VTHA 5EM8A 2V62A 3UODA 4OTWA 2RL5A 4FIHA 3W1FA 2E2BA 2UZNA 4S30A 5JK3A 5DMZA 4RRVA 2QKRA 3NCGA 1LR4A 4BJJA 3FZ1A 5HD4A 3V5LA 5HCXA 4F9AA 2IJMA 4CZYB 1A48A 4BIDA 3REPA 4L8MA 3VS5A 3SG8A 4AZEA 1XH5A 1Q3WA 4R1YA 1R1WA 2YHVA 1R0EA 4MD8E 4JJRA 4CMTA 4K11A 4ACGA 2WTKB 4KSPA 1YDTE 1JAMA 3C5UA 3PTGA 4CKIA 1OUKA 2OZAB 5DGZA 2YM4A 4UY9A 3D7ZA 5LCJA 3ERKA 2OH4A 4DFBA 3DNDA 1V1KA 4FKSA 4U81A 4E26A 3KB7A 4MXZA 4GJ3A 1UWHA 1WCCA 2UZBA 4NJ3A 3IDBA 5HG7A 4DGNA 2PVHA 5JMSA 1Q24A 3MPAA 4TN6A 4CLIA 2GFCA 2GMXA 4ONAA 3UGCA 3LJ1A 4E1ZA 4IX3A 3EL7A 2UUEA 4UMUA 3F2RA 1H1RA 4GK4A 2X9EA 3VQHA 4CFMA 1VEBA 4M67A 1UU3A 3KXNA 3M1SA 2GNGA 4F1TA 4RC2A 2DWBA 4S2ZA 4W4VA 1WBOA 4ZSJA 3PIXA 3HL7A 3GOKA 4LUEA 4K0YA 2HY81 3AC4A 3LM0A 4G6LA 4F9CA 3UIBA 5A6NA 5JFVA 1H4LA 3G6HA 2Y7JA 4NSTA 3V51A 4KA3A 2W1HA 3W32A 2VGOA 4FTIA 2R3FA 2VTAA 4YJRA 3EN6A 3EYHA 3IONA 3ZFYA 3QQKA 3EQCA 5E8XA 3PSCA 4MEDA 4C4HA 2Z02A 2PVMA 4ASXA 3FXWA 2IVTA 3KXXA 4YO6A 2UW4A 2WEVA 3HV5A 3GI3A 4DH1A 5I3RA 5KBRA 3DPKA 4M68A 5E4HA 2PE2A 3P86A 3TV7A 4GK3A 4Q9ZA 3QTWA 3C4ZA 4AGDA 1YDRE 3TUCA 3QQLA 5K0KA 5HBEA 3PRIA 1ZMVA 4M7IA 3SOAA 4FTKA 5GJFA 3KN5A 3HEGA 3VO3A 3NIZA 1JLUE 2XBJA 4OT5A 5AAFA 3ZYAA 3QFVA 4PNKA 2OBJA 3I4BA 4XV9A 4FC0A 3QZIA 3V5WA 5ETAA 4H1MA 3KXHA 4RIXB 4BRXA 3Q9ZA 4IM0A 4EQCA 4F09A 5FP6A 2W4JA 3NUNA 4IJPA 3GU6A 3R30A 4RWJA 1KE6A 2W1DA 3DTWA 5IUIA 4AZSA 2VD5A 5TF9A 3AC8A 5BQ0A 2ITOA 3NDMA 3NUYA 5FGKA 4WIHA 5ANGA 3AG9A 3TDVA 2C68A 1OPKA 3GENA 3LIJA 3COMA 5E8YA 4XV2A 3QQFA 2J0IA 2X9FA 3UPXA 1H24A 2WB8A 4KNBA 4U44A 3IECA 4IANA 2B53A 3H0YA 3L1SA 2VWXA 1XH6A 3V8TA 3QALE 4R1VA 5JFXA 3L8SA 4BCMA 4O86A 3IO7A 1FBNA 1FINA 3GBZA 3V8WA 2F57A 5C8KA 3U55A 5JFWA 2ETRA 4FSRA 4A9UA 3QKKA 3G2FA 4LL0A 2FO0A 2ACXA 2R2PA 5BYZA 3KY2A 3FI2A 5CQWA 3Q3BA 3HVCA 3K5UA 4IAKA 4R5YA 5DBXA 5KBQA 4MXXA 4BZOA 5IEXA 3UNKA 4F9BA 2W9FB 4LYNA 1H8FA 2X0QA 3ZEPA 4F1OA 3MTFA 4FG9A 4TWCA 3HMOA 5T6KA 3UOHA 3B2TA 3DY7A 3TIYA 4B8MA 5ANIA 4FZ7A 4DEEA 4DHZA 1FOTA 4NM5A 4HVHA 2B9FA 2OZAA 4MYGA 4NCTA 4DAWA 4Y85A 3TTJA 3ZO4A 4EWQA 5AAEA 3LZBA 4NU1A 4E6QA 2B54A 5H2UA 3BQRA 2QI8A 3Q5IA 4UXLA 2FA2A 3U9NA 3ZRKA 3TUBA 1U5RA 3PZHA 4H3BA 3FI8A 2BZIB 2CGUA 3I79A 3ZCLA 3OWPA 2ZJWA 3C4EA 3UZPA 2X8DA 5EOBA 2YM7A 3PVUA 4YZBA 4MXOA 3PRFA 1WVWA 4ZTNA 5LXMA 2QOFA 4I0TA 4QP7A 4BDBA 4I6LA 4HNIA 2QKWB 1O6KA 4DITA 4DT8A 2F7XE 5KMLA 2XM9A 1UV5A 3SAYA 4PRJA 4UWBA 5HHWA 3VBTA 4DG0E 4OTQA 1MRVA 1U59A 2J51A 2YIRA 2Z7RA 4GG7A 4X2GA 3WZEA 3EWHA 5AR2A 3QC9A 2OIQA 3AMAA 3ORPA 4RVTA 4F4PA 4J71A 4KS7A 5HO8A 4TW9A 4IH8A 5A4QA 4KS8A 3D4QA 3P79A 4XV3A 1G8AA 3QQHA 4CCBA 3COKA 2BRNA 2GS2A 1MQ4A 2WKMA 3C0HA 2OJGA 4L42A 4KKHA 1FGKA 4NTSA 1Q99A 3R2BA 4FNZA 3TZ7A 3B2WA 5GZ8A 2OSCA 5EW9A 2A4LA 3ZUUA 3FPMA 4O2PA 4BGQA 1BI7A 4BKZA 5E9EA 1H0VA 4L68A 4EC9A 4RJ8A 5DLSA 2PHKA 1OL5A 3G5DA 3MH0A 3W18A 4CMOA 3H30A 3NW5A 5FEQA 2CGXA 2WTIA 4UMTA 5B7VA 2ITNA 3ZC5A 2CCHA 4UN0C 4C2VA 5EHOA 4JDJA 2J2IB 3KRRA 4HVGA 2XNPA 2JIUA 2QOKA 3SV0A 3VBXA 4LGGA 2EXMA 4BGGA 3QUEA 4DTKA 4CVAA 3DFAA 5CF8A 1J7LA 4J98A 2A98A 1PKDA 2J9MA 2RGPA 3EQDA 2PZRA 4DFNA 4F64A 5B2KA 4I23A 2DQ7X 3KQ7A 4EH3A 1LPUA 3PJ8A 4IDTA 3TXOA 2QD9A 4CFNA 2IN6A 3BE9A 5DT3A 3QLGA 4R77A 3QQJA 4GYGA 5AP4A 3R7VA 5CXZA 5EKOA 3AMYA 2UZWE 2VUWA 4G16A 2PSQA 3FPQA 1OIUA 2KULA 4BTFA 4Y95A 3VUIA 4O1PA 5KE0A 4ZY4A 2GNLA 3QD0A 1OGUA 4ZLZA 1H07A 3RJCA 4IWOA 3LM5A 5AUYA 4ANLA 4FVQA 1Q8ZA 3MB7A 4QMZA 4IB3A 5E90A 5EG3A 4UXQA 5FWKK 1YOLA 2C0TA 3WF9A 4ACHA 4U0IA 3SXFA 5M44A 3FY0A 3R0TA 4Z16A 1NVQA 5J1VA 4FIIA 5A6OA 4TYJA 4F7LA 1PXKA 4RT7A 2WELA 1PKGA 3BGQA 3H0ZA 2UW8A 2RG5A 3FMJA 4DFLA 4MF1A 5F9EA 5E8UA 4BWXA 3MV5A 2AUHA 5E8TA 5HE2A 5TT7A 3HMNA 2PVRA 4K9YA 4PMSA 3F2AA 4C4EA 3ACKA 4EOPA 3HAMA 2QO7A 5AR4A 4XYFA 4IADA 3IW8A 4Y73A 3KA0A 5I9XA 4TYEA 4B9DA 5HVYA 4LMUA 1WZYA 4X2FA 3VUDA 3QWJA 3ZONA 2NO3A 4IX4A 4R6VA 3HV6A 5IA5A 5C9CA 2WO6A 5IH6A 3PXYA 3O51A 5TOZA 3LFQA 3E8NA 4QMXA 5ACKA 4D4VA 4O4EA 1PJKA 2FUMA 3AOXA 3O0GA 3P0MA 4IEBA 2PWLA 1XO2B 2P2IA 3LJ0A 4ENXA 3BGZA 1PMVA 2UW3A 1YI6A 4HPUE 4DHFA 4F7NA 2XK3A 2I0EA 3BV2A 4U5JA 1W84A 2YM8A 4ZSEA 3LCTA 3V04A 3PXZA 5IQBA 1BKXA 4FTJA 2PUPA 5IQGA 3R01A 3WF8A 3DQWA 3A61A 3R63A 1U54A 3ZZEA 3D5WA 4XP3A 3VUMA 4RJ6A 1GAGA 5HLNA 4O7LA 3SLSA 2YWPA 1Q3DA 1Z5MA 4BDFA 2G2IA 3OBGA 5ANEA 4C4GA 3OP5A 3N4TA 4DTBA 3U51A 1GIHA 2ZMDA 5IQAA 4OR5A 4KKEA 2BUJA 5CNNA 2CGVA 4BDJA 4CMUA 3AKJA 2YITA 5KX8A 1Y8YA 3EQIA 2GU8A 4IWQA 4U9AA 2CNUA 3HZTA 4L53A 2BCJA 3FEGA 4UMQA 4J52A 2E9PA 4D28A 5BNJA 3ELJA 3FMEA 3PA5A 2J6MA 2ZM4A 4C0TA 5J95A 3SRVA 5IA1A 2JKQA 4ANBA 4HCVA 1H26A 1YQJA 1H1QA 4I6QA 3THBA 4I0SA 2B0QA 4FRFA 4QYEA 1SM2A 2ITQA 1J7UA 2ITWA 4YLKA 3POOA 4RIWA 3R9HA 4BDKA 5H8BA 4JBOA 4U3ZA 3ODZX 1G8KA 2CJMA 3UNJA 3KMMA 4TTHB 3NRMA 2G15A 3GFWA 4XLIA 4BCGA 1M52A 4FGRA 4ZK5A 3ALOA 3OCSA 3C0IA 4YC3A 4XS2A 5AUVA 3CGOA 1QPCA 1BX6A 2UVZA 5HEZA 1G8JA 4O7WA 2QOCA 5AR7A 2UZVA 2C3KA 2GDOA 4OTDA 3HV7A 1UWJA 3OROA 5DNRA 4F63A 3WZUA 4YU2A 3Q96A 1ZLTA 3F6XA 3AC3A 3G51A 3GCQA 2VTSA 3PYYA 4IFCA 2IEWA 4IM3A 2OW3A 4BGHA 5DFPA 4FEWA 4DYMA 4YZDA 5CSPA 1UKHA 3EN4A 3TI1A 4USFA 1KE8A 4KWPA 1YXXA 2QOIA 1W2CA 5M51A 3RPOA 2X4ZA 5CAUA 2F7EE 3OTVA 3ID6C 3QKMA 4F0FA 2WOTA 4AUAA 4XMOA 3HX4A 4S34A 2XRWA 2Q0BA 2XIZA 3C0GA 5M57A 4HGSA 4RVMA 2O63A 1P2AA 4CFVA 3VJNA 2C5XA 2WQBA 2WMWA 4P5QA 5CU2A 2ITVA 2XJ2A 3GQLA 2IZTA 3LFAA 4WG4A 3VN9A 2C6MA 4FV5A 1MRYA 1WVYA 3W2PA 2CPKE 5GNKA 2ZV2A 2W06A 3MJ1A 2C4GA 3GP0A 4P7EA 4ZOGA 4GMYA 5EYKA 4EK8A 4AOIA 2X81A 2H34A 1GOLA 2FSTX 3ZBXA