2PMIA

Structure of the pho85-pho80 cdk-cyclin complex of the phosphate-responsive signal transduction pathway with bound atp-gamma-s
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
284
structure length
284
Chain Sequence
ATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKYNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWFAEYYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein,transferase/cell cycle
molecule keywords Cyclin-dependent protein kinase PHO85
publication title Structure of the Pho85-Pho80 CDK-Cyclin Complex of the Phosphate-Responsive Signal Transduction Pathway
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 73
structure length 284
sequence length 284
chains with identical sequence C
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pmiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pmiA01
2W5HA 2HYYA 5B2KA 2C3IB 3AQVA 3LQ8A 4RJ4A 2V7AA 4U40A 3EZVA 3D83A 4G3DA 3PPZA 4EYMA 1I09A 5IQFA 2IO6A 4PMTA 3CS9A 3KRWA 3TL8A 5CZHA 1NVRA 3KVWA 3MJ2A 2OICA 4FIJA 4D2RA 3CY3A 2JAMA 1XH9A 4MKCA 4IX5A 2BROA 5C9CA 1STCE 4IWDA 4LRMA 4ONAA 2UVXA 5ANIA 5FM2A 4A4XA 4DITA 2EXMA 4EOKA 3ZS5A 1PXJA 3GC7A 3UE4A 4CG8A 3UOLA 4LOQA 3DNDA 5CF5A 4AN2A 4RVLA 3RK5A 3SW7A 2WTKC 4I94A 3LFDA 4YC6A 3CEKA 3GI3A 3GVUA 5KO1A 3HX4A 1RJBA 4JDKA 2DYLA 4QMVA 5DE2A 2UZVA 4MBJA 1WMKA 4UWCA 1P4OA 3IECA 4O7SA 4O27B 5AR7A 1FPUA 3CBLA 3SQQA 3FI2A 4HGLA 4CXAA 5JFXA 3PXYA 5D41A 4DTKA 3TNWA 4OT5A 1UA2A 3PTGA 2JFMA 2JITA 5FRIA 3TT0A 1BL7A 5JK3A 2HK5A 4UN0C 4IAKA 2BRHA 1JQHA 4C34A 4IZYA 3WF9A 3AMAA 2XMYA 3W8QA 1Y57A 3BU5A 3FMDA 3LMHA 2VO6A 3LOKA 5JSMA 2C6TA 2C5VA 2QG5A 4ALUA 2CNQA 4A4LA 3OT8A 5FXQA 5T3QA 4QTEA 2JDRA 3A7FA 4RVTA 4FT0A 3B2TA 1KE9A 3VS4A 4OTWA 3AC3A 5AV3A 5IU2A 3DK6A 5I9WA 1WBWA 1CSNA 3ORLA 4JLCA 4O21A 5L6WL 3NUUA 5FXSA 3K2LA 1PKDA 3DKGA 5IA1A 4AX8A 1JLUE 3KXXA 3PJ1A 2QOCA 2UZTA 4S32A 3TG1A 4YTFA 4EHEA 1V0PA 4B8MA 1RQQA 2UZDA 3FMKA 4FL1A 3TZ7A 2CLQA 4OW8A 4C7TA 3LCKA 3O71A 4F7SA 5IZFA 1W8CA 5DA3A 4KKEA 3MY1A 3RK7A 1GNGA 4YSJA 3QALE 1UKIA 4JQ8A 2C1AA 3MB6A 3W32A 5DR6A 3EJ1A 5A6NA 4P7EA 3MB7A 3ZRLA 2ETMA 3O23A 3EQFA 3A7HA 4EOQA 3F5XA 3VWAA 4UMQA 3DKOA 4M97A 3DTWA 4ZS0A 1ZMVA 4TY1A 3UG1A 5DEYA 5EH0A 4ZTMA 5HZNA 3TUDA 4O0TA 3TKUA 3ATSA 4BCJA 2P4IA 3R30A 3DU8A 4FV7A 4AOIA 5K4IA 3V5WA 2JIVA 5HG7A 5LARA 5BVOA 4FYOA 3PVWA 1NA7A 1VR2A 4RX7A 5CY3A 5E7RA 5E4HA 1XKKA 3MVLA 4FEVA 4BDDA 1XBBA 4O0RA 4RC2A 3UOJA 4IAAA 4DCAA 4W4VA 1X8BA 5T68A 4F70A 3CP9A 3PY0A 5ITAA 4IZ5A 4KBKA 4M84A 2JD5A 3A62A 4O82A 5IMXA 3OVVA 4YJVA 4AW2A 4J8NA 4PL3A 4K9YA 4FIIA 4NT4A 4GT3A 4MXAA 2C5XA 4JX7A 4O2PA 4RC3A 2DWBA 3P7BA 4J96A 4J97A 4U41A 4CFWA 3R8LA 3FZSA 4WUNA 3VAPA 4QMQA 3ZFYA 4KRDA 4RIWB 4C59A 1H4LA 1OITA 3BCEA 2WMQA 3GOPA 2QR8A 5CVHA 4EOIA 1LEZA 4ZZOA 4TNBA 1W98A 2G1TA 4BWKA 4D2WA 4HNFA 4HVGA 2H96A 4F65A 2JKKA 3KMUA 1UNGA 3H0ZA 5AP7A 3E93A 4FV0A 5HGIA 3FC2A 3ZSHA 4PTGA 3FMHA 5IA2A 3V5PA 2PZYA 4IANA 4WIHA 5EDPA 5J8IA 5DIAA 5CANA 3GQIA 4XP0A 4G3EA 3QAME 5J7BA 1WVYA 5A4CA 2IJMA 2OKRA 2PHKA 2QNJA 3UZTA 2C6MA 3D4QA 2B0QA 5C4LA 1UU7A 4DH5A 4HCUA 3ZUTA 4CKIA 2C5OA 4DG0E 4CV8A 4U42A 2JBPA 2XBAA 4B9DA 4BICA 4BCMA 3OY1A 1SVEA 2Y6MA 4ZTRA 3E62A 5M4UA 4UYNA 4J52A 2YCSA 3KN6A 4IFGA 4K1BA 5H2UA 3SHEA 3IG7A 4DFLA 1UWJA 3I5ZA 3UG2A 3QX2A 4A06A 1ZOEA 2BDWA 4LYNA 2PE0A 3C13A 5M4FA 1SM2A 2YAAA 4CFFA 3G0EA 5E92A 2ZYBA 2R3IA 2QOLA 3FI3A 2P3GX 4Y73A 2JKMA 2WU6A 3FMNA 4BBFA 3V5LA 3QD0A 3TWJA 5EQEA 3G51A 5A54A 3PE1A 3QX4A 3F9NA 3HECA 5DYJA 3QC4A 5D11A 4YZMA 5DN3A 4EK3A 5F9EA 2R64A 5FEDA 1XQZA 5I9YA 3Q9XA 1PRYA 4OTIA 5D7VA 2XNBA 1Q3WA 5FM3A 4UMRA 3ZMMA 2BRBA 2O8YA 3CTHA 4MXXA 5CWZA 4FV9A 3BGQA 5DT0A 3HMMA 4I6FA 2C6OA 3C9WA 2OW3A 5ANOA 3QFVA 5CU0A 4BVUA 4LGDA 4F0GA 5K5NA 2UVYA 3R9OA 3FXWA 5ETFA 3ZRKA 4RQKA 2R3NA 4QYFA 2A0CX 4QNAA 3BLHA 2QKRA 3NNWA 4DEIA 3ULZA 3PWYA 3L8SA 2GTNA 1M2PA 4RG0A 2BZJA 5CYIA 5FEQA 4L42A 3FI8A 1BI8A 2IZSA 2BZKB 4XG2A 3S3IA 3ZO2A 1YWNA 3DDPA 1YHSA 4G34A 5IF1A 4ZTQA 3HDNA 4OT6A 1VYWA 4BGGA 3O50A 4GJ2A 2RG6A 2WEVA 2C68A 4RC4A 2AUHA 5F4NA 3V6RA 4A9UA 3C0HA 4JBOA 4C35A 1AD5A 1PXPA 2ZVAA 3UVPA 4ZAUA 1H26A 2GQRA 4TYGA 4O96A 2I7QA 2CCIA 3KMMA 3H10A 4LUDA 3PSBA 5J5SA 4AZTA 4D4YA 4FZ6A 1Y8YA 3ORMA 4HZRA 3UQGA 4E8AA 4FI1A 4KIKB 3UNKA 3E8CA 3FLYA 5DVRA 3UO5A 3EN7A 5AJQA 4F9WA 4J95A 4DA5A 4UZDA 2I1MA 1YI4A 4ZEGA 2QVSE 2RGPA 4F7LA 1OL5A 5LOHA 2CLXA 3I1AA 4RFMA 5I9UA 5D1JA 3AD5A 5E8VA 3FKNA 2BR1A 2QONA 4QMXA 1AGWA 3MA6A 4O2ZA 1IEPA 4G5JA 5I4NA 4UV0A 4QTDA 3QQJA 4C36A 2GNJA 3P86A 3ZYAA 3LQ5A 4MCVA 5BVKA 3KRRA 3QUEA 3VW8A 2CNVA 5ANEA 5FQDC 4AF3A 4O0UA 3MTFA 4F1TA 2F7ZE 2A19B 4O7RA 1UU3A 5F95A 3FXXA 3LFQA 3QTRA 1ZAOA 3NEWA 2ONLC 3MY5A 3COHA 2EB3A 2C0OA 5CXHA 2PVRA 4AT3A 5ETAA 4GUEA 2ITPA 2C6KA 3M1SA 1H08A 2ITXA 4QMNA 4KS7A 2C0IA 3VUKA 5HTBA 2GMXA 2W17A 1G8SA 2R3MA 1XBCA 3Q96A 3QTZA 4AGUA 4MWIA 5J87A 3FJQE 3VUGA 1SMHA 3LE6A 4G2FA 3D5UA 5KKRB 2BHEA 2F4JA 4XG3A 4C4JA 5HU3A 5BUIA 5CVGA 3CGFA 2WMTA 4FV1A 3F2AA 2NRYA 2A2AA 4NM5A 5FTQA 3AT2A 4BTFA 1UU8A 2J0LA 3RK9A 3QQFA 5BVFA 4CFXA 4WSYA 4E3CA 5E8XA 3VS5A 3UOHA 3MPMA 3U87A 1PXMA 4ANMA 3PXRA 5CVFA 4D1ZA 5TO8A 5EM8A 3AT4A 3F66A 2VX0A 3ZFMA 2C3LA 4BDHA 3PWDA 4D2PA 2R3LA 3NNVA 3P79A 2HW6A 4BZDA 1H0WA 4ZTLA 5GZ9A 1UV5A 2EXEA 3P08A 3GQLA 3P5KA 2EUFB 3LMIA 4FZAB 3ENHA 4I1ZA 5HICA 4HVIA 4EH8A 5HKMA 4OAUC 3OCGA 4I4FA 5EYMA 2CDZA 3WZUA 1NY3A 3KXGA 4E6CA 4L3LA 4A7CA 1H01A 3R73A 3I6UA 5DMZA 1M17A 4AS0A 4N0SA 4XMOA 2YIQA 4DN5A 4FZFB 2OO8X 1CDKA 4XS2A 3R7VA 2X81A 4PF4A 4BL1A 4CCUA 3D14A 4FKGA 2X4FA 5E8TA 4LL0A 4F9YA 3S1HA 2W1IA 3EQIA 4FSZA 3UC4A 4FK6A 4JQ7A 4QTBA 1OMWA 3ET7A 5M4IA 3HDMA 2FVDA 4BDEA 4FTKA 2XJ0A 3LJ2A 3SXFA 3EQGA 2C6DA 1OGUA 5J9YA 4O7YA 4GFMA 1JAMA 4IDTA 4FIHA 1XH7A 3W18A 1DI8A 3DBQA 3O7LD 4IJ9A 2CHLA 5D12A 4FIEA 3JVSA 3PVGA 4IBMA 4WRGA 5EYCA 5LVNA 3AGMA 4FTCA 3POZA 1PW2A 4BBEA 3O0GA 3G6GA 3LFSA 1WBVA 3GCQA 4O1OA 3FUPA 3BHHA 3QWJA 4ALVA 4YO6A 3UZRA 1MRYA 5E91A 2OXDA 1S9IA 2W5BA 4ENYA 4RIOA 1TKIA 4I93A 1UNLA 4IVBA 4QQTA 3OP5A 4C4HA 3NUSA 1T45A 3GNIB 4V0GB 4NYEA 2OBJA 4CVAA 2FSOX 2R9SA 3OG7A 2KTYA 1WFCA 2HENA 4XUFA 4AG8A 2XB7A 5HO7A 4FT3A 4WRSA 3TNIA 4EZ3A 2O5KA 4R78A 3OC1A 3VJOA 4HCVA 1XH4A 1SVGA 1YWRA 4FSMA 2W4KA 4FKWA 4IB5A 3CIKA 3PSDA 2QU5A 2PK9A 4FSTA 2IW8A 5KZIA 4L01A 4LRKA 4TYEA 2WQBA 4UBAA 3R8ZA 3H9FA 5CT7A 4D1XA 2PYWA 3A7JA 3F3ZA 5AR8A 3IK3A 3RM7A 3WF5A 3ZU7A 2R3GA 3VUTA 2PZ5A 3R01A 4FTRA 1GY3A 4LV8A 2JKOA 3ALOA 5AIKA 3ZFXA 1VYZA 3QGWA 2Z60A 5FDPA 3KKVA 4F9AA 2XP2A 4ZJJA 3U55A 2I0VA 3D7TB 4FVRA 3F2RA 3PP0A 1H1RA 3BHYA 2Y4PA 4TYJA 1Q97A 4I0RA 4WNKA 4FOBA 3T3UA 4YC8A 4RIWA 2C3KA 5JN2A 3U9CA 1PF8A 2VGOA 3RAHA 4EOMA 1CKJA 1E1XA 2HZNA 2RF9A 4N6ZA 4NIFA 1TQMA 5EOBA 4DGLC 5L2WA 3NVMB 3WE8A 2BRGA 1PKGA 3OEZA 4D4VA 5LMBA 3U6JA 3QTXA 4BB4A 4ZLZA 2R0UA 1CKPA 4JDIA 4X2GA 1YXSA 3VUIA 4AWIA 3FZPA 4JX3A 4F6UA 5JGBA 3V51A 2ITOA 2ZV9A 3F88A 3WARA 3BE9A 4U43A 2CN8A 3IGGA 2W96B 3BU3A 3QGYA 4P2KA 4CKJA 3LQ3A 4O6LA 1TVOA 3P0MA 2WIHA 5E8UA 1M7NA 5AFVA 3NSZA 1MRVA 5H8BA 4AZVA 3QRUA 3R9RA 4UMTA 2XJ1A 5HCXA 2E2BA 3IW4A 5DPVA 4W4WA 4LOPA 5FLFA 3Q4CA 5IPJA 3LJ1A 4FV6A 4HVHA 4K11A 5DNRA 2BZHB 2R3QA 5BVDA 2UZUE 2J90A 2HWOA 4ZMFA 1XO2B 3OS3A 4GG5A 1PMVA 2XS0A 4G3FA 4G6NA 1JSUA 4DYMA 1K2PA 2WMSA 4GH2A 3GCPA 3ODYX 5C01A 4O91A 4ALWA 4IWPA 2VTTA 3O7LB 5E1EA 4RVKA 1PMNA 4E5AX 3UNJA 2PUUA 2IVSA 4TXCA 4XG8A 4JBQA 4O83A 4ZK5A 4E73A 2UW0A 4ZZMA 3ROYA 5BYLA 4I92A 4I5MA 4CT1A 2FB8A 5I3RA 1PXLA 4CFNA 4OLIA 3TJDA 1WBSA 4UYAA 3RALA 3OBGA 3C4CA 4ITIA 1H1PA 2V55A 4C4IA 5B2LA 3CGOA 1DI9A 2B53A 3PXFA 2YM6A 3W55A 2J0MB 3HAMA 3F3TA 4AZSA 1A48A 1YDTE 4Z9LA 2UZBA 2QODA 4EK8A 3NAXA 5CQWA 4JOAA 5D9HA 3TJCA 2VX1A 4GEOA 3TKHA 4ZSAA 5CALA 1ZYSA 3ANRA 4OTGA 3R8UA 1E1VA 4OTQA 4CZTA 5KE0A 3MIAA 3VHKA 2OH4A 2XIXA 1GOLA 4FX3A 1OECA 3O8PA 4JIKA 3OXZA 2PL0A 1HOWA 3HL7A 4ZP5A 3DXPA 4FV4A 5EOLA 4YP8A 4FA2A 2F2CB 1JKSA 4R5SA 4I41A 3TUCA 1O6KA 4C61A 3LFEA 4USDA 2FGIA 4CZUA 4QP3A 4X6RA 4FC0A 1ZZ2A 4YJOA 4KIKA 4FEXA 3GU6A 5A9UA 3DT1A 4IDVA 5KMKA 3QQGA 2CGWA 4AN3A 2BRNA 4AN9A 4YJRA 2R3JA 4NU1A 5HCYA 2J0JA 3T8OA 3K3JA 4DEDA 5KBRA 4D0XA 5HIDA 4FKSA 4XV1A 4GFOA 2C47A 4PNIA 4EOLA 4IZAA 3VS1A 5IA5A 4FUYA 2FH9A 2ZB0A 2FO0A 2R5TA 5DEWA 4CT2A 5L8LA 4WUAA 4A9RA 1Z57A 3ZLYA 3TV7A 2QLUA 3C50A 3R83A 2OF2A 1BLXA 2QD9A 3VO3A 5BYYA 4V01A 4BI2A 3B8RA 4YTCA 3D5XA 3DFCB 3L1SA 4DFXE 2Y0AA 4LG4A 3Q04A 4EBVA 4M0YA 3V8TA 5LMKA 4C37A 4GIIA 4M13A 3ZM9A 4H39A 5AA8A 4GYGA 3KQ7A 2F7XE 4FR4A 5DOSA 4XOYA 1SNUA 1KUTA 2QO7A 2J6MA 4XNEA 3CQEA 3G9NA 3THBA 3FAAA 3EN4A 3OT3A 3PYYA 2VRXA 4R7IA 4DFBA 4O7LA 5AM6A 1ERKA 5LXMA 2CKQA 5IH5A 5F1ZA 4NM3A 2W05A 4UY9A 4IFCA 5CT0A 1IAJA 4DCEA 3FBVA 4IVDA 4NFNA 4XG7A 5IUHA 3F7ZA 3R8MA 4RJ8A 2ZJWA 4U8ZA 4UZHA 4YTHA 5HHWA 4ORKA 4C3PA 3AOXA 3MFTA 3MFUA 4ITJA 3W33A 2R7IA 4YZNA 4E6QA 5KBQA 3IDCA 4QTCA 4RX9A 3CKXA 2GQGA 4EJ7A 3AD4A 1OKZA 4ZZNA 4E26A 5AAGA 1KSWA 2R2PA 4PDYA 3DBCA 1H0VA 2XNEA 3Q4TA 4FKVA 4ASZA 5KMJA 1J7UA 3KL8A 1KE7A 4XOZA 3U4UA 2G9XA 4S2ZA 3I79A 3OCBA 4NZWB 3RVGA 5IEXA 4EHZA 5HBJA 1WBTA 3QYZA 5EDRA 1OIRA 2PZIA 3W10A 3R1QA 1YHWA 3TACA 5J95A 4C02A 4AGDA 3S0OA 1OB3A 3GU5A 4JL9A 3TZMA 3ZC5A 4F08A 4ANBA 3MBLA 1LP4A 4FOCA 3EYHA 4HVDA 2XA4A 3ORIA 4NSTA 3OWJA 5FWKK 2G01A 2NPQA 3HV6A 4QP9A 2PVNA 4D5HA 3M11A 1E9HA 5AUZA 2BAKA 3ZONA 2YA9A 3UBDA 5DG5A 4AGCA 3FLQA 3QQUA 2VTPA 4HW7A 2VWIA 4D0WA 1Q62A 3D7ZA 3BV2A 3GFWA 2YIXA 1U4DA 4L45A 5E90A 5CF6A 4L43A 3R6XA 1XH8A 4W8EA 4C62A 4EC8A 5AUTA 3C1XA 4K8AA 4XG6A 2VTAA 4L8MA 2XIKA 4BCFA 5A4QA 3EQCA 3KY2A 2JFLA 3NNXA 2G2HA 2GU8A 3LFNA 4Y85A 4Y5HA 5CU4A 5FG8A 3VF9A 3WF7A 3G90X 4AA0A 2ZM1A 3O17A 3TN8A 1P5EA 4FSNA 4HCTA 3QHWA 2F2UA 4FIGA 3ZHPC 4AT5A 1IA8A 4BDAA 1W84A 3SXRA 1R3CA 3NMUF 5F94A 3GU8A 2W06A 3UIBA 2X6DA 4C4GA 2X39A 1ZYDA 3ETAA 4I21A 3FSKA 5HLWA 4FKJA 1M2QA 5D7AA 3BWJA 4PPCA 4USFA 1PYEA 3FE3A 4BHZA 2O0UA 2WXVA 2AC5A 4FEUA 3AC5A 5EK7A 3MESA 1YXTA 4ERKA 4E20A 2VNWA 2FYSA 3HV5A 2ZV2A 3IQ7A 4MF0A 4X2JA 5DHJA 4BTJA 5C1QB 3DBFA 4V0GA 4ITHA 4RT7A 4MXZA 4AFEA 4FBXA 4IW0A 4BC6A 4DEAA 1CM8A 3OCTA 2ZM3A 5JMSA 4FZ7A 4Y72A 2QHMA 3E8EA 4S31A 4DINA 3DDQA 4RWKA 4GW8A 1ZY4A 3VRZA 5CF8A 4ZSGA 4ACDA 5JQ8A 3LCOA 2UZOA 2YM3A 4GFGA 4LGGA 4QMTA 1ZY5A 2A4LA 4CTBA 2JKQA 3FY2A 4RGJA 2WEIA 3HA6A 3S4QA 4E4XA 2SRCA 2OXXA 3RHXA 2Z02A 5C8NA 2Y4IB 3ZXZA 3Q6WA 2JDSA 2WMAA 4J53A 4WO5A 4XH6A 5J79A 2XCHA 4GK4A 4F63A 4UX9A 2WTWA 3NPCA 4FKOA 5AUYA 2YHVA 2XRUA 3F7WA 2PVYA 3KXZA 3QRTA 4I24A 4L9IA 4RLLA 3R7IA 2QKWB 3D7TA 1YOJA 4YHJA 1OI9A 4ANQA 4DGGA 4RIYB 3SA0A 3BU6A 4C58A 4BR3A 2YFXA 4S33A 3VUMA 2RSVA 4X2KA 2CKOA 1OKVA 3I4BA 5HE2A 3EQDA 4ANNA 5IQGA 3BGPA 3E7VA 4NFMA 3U9NA 4H3QA 3VULA 5AAEA 3FZTA 3HV7A 2OJGA 3EZRA 4FG7A 3DK7A 4V04A 2I0EA 2WQOA 1Y6AA 3R2BA 4MK0A 5C8KA 2ITNA 2W99B 1SYKA 4G16A 3A8XA 4I6BA 3V5JA 4EONA 2E9VA 3GBZA 5CSPA 2BDJA 2QO2A 2UW6A 3VBVA 4CEGA 3SDJA 5IDNA 4IX4A 1KWPA 5GHVA 3NUXA 3ERKA 2OLCA 2J5FA 1J1CA 3QTUA 3L9NA 1Q8YA 3Q53A 4XV3A 3P1AA 4F1MA 4BHNA 2HZ0A 1AQ1A 5HX8A 3CD8A 4UWBA 5IUGA 4KBAA 5HLPA 3PXZA 3MS9A 2XIYA 4XRJA 3DOGA 3W8LA 3KGAA 3K54A 3OWLA 3UYTA 4G6OA 2PWLA 1OM1A 3BRBA 1U59A 3I0OA 2VTNA 2VWZA 3VQHA 3PFQA 2O3PA 3E87A 2OXYA 4PY1A 4YNOA 4JS8A 1UWHA 4JG6A 2JLDA 3BV3A 3BYMA 5AP6A 4ACGA 4AQCA 1PMEA 2B9FA 4PTEA 5AM7A 3NLBA 4YHFA 2B1PA 3OWPA 5CF4A 3G9LX 4WNMA 4JDJA 4HPTE 3KXNA 3BEGA 2GNIA 4ZY5A 4UB7A 1GAGA 1XWSA 3QQLA 4ZY4A 2CNUA 4IQ6A 3JVRA 3FMJA 2OJJA 3DFAA 3IS5A 3RTPA 4AZEA 3I81A 3PXKA 2OIQA 4G9RA 1H8FA 3NYXA 2DUVA 5GIOE 3PSCA 2J4ZA 3Q9YA 4XJ0A 4O0XA 4LI5A 4MTAA 4NWMA 4S30A 5CU2A 3UMXA 4G17A 3TTJA 2P33A 4ZMEA 3R8VA 3NW7A 4UXQA 2XKEA 3C4WA 2WKMA 4E4LA 3RGFA 5HNIX 4GMYA 5AP1A 2QOIA 3I6WA 5IQBA 1WZYA 1A06A 2ITTA 2UZEA 5EI6A 1YW2A 3L8XA 3LFAA 3ZLXA 4QMLA 5TOZA 1NT2A 3G0FA 4ZJIA 4CLJA 1F3MC 3QF9A 4OTHA 4QMUA 5LJJA 4BGQA 4U44A 2OIBA 4X21A 2YN8A 4IVAA 5CASA 3PZEA 4G3CA 3G5DA 5I9ZA 4I5HA 3OUNB 4R6VA 3LHJA 3CCNA 3OY3A 4D4SA 2VWXA 4XYFA 4DGOA 5BPYA 4O7NA 2B52A 2PY3A 4BF2A 4BIBA 3KB7A 4YSMA 3R7UA 4DTAA 1FOTA 2GHMA 4UALA 5AA9A 4J1RA 4C4EA 2X2MA 5HE1A 4AU8A 2J7TA 1TQPA 5AAFA 4DE4A 3QTSA 2WTCA 3H3CA 5HIBA 3WZDA 4PTCA 3ULIA 5CEPA 3IW8A 3OUKA 1YI3A 4MVFA 2PE1A 3ORTA 4P90A 4RJ5A 5AV0A 2X6EA 3UNZA 1Y6BA 1YOLA 2OH0E 4DBXA 2GNHA 5HG9A 3AT3A 4YBJA 3PIYA 3MTLA 4WA9A 2WMWA 5FTOA 2V5QA 4CRLA 4DBNA 3QLGA 2CGUA 3ZBFA 2YITA 3GP0A 3IKAA 3G33A 4M69B 2O64A 1J91A 4KD1A 5FXRA 2GCDA 5BVEA 3SD0A 3NW5A 2BFXA 3K5VA 3PY1A 5CTPA 2PMIA 3EWHA 2HIWA 3JR1A 4D28A 4NK9A 1JWHA 3DV3A 1QPJA 4UWYA 3BHTA 1H27A 3ZLWA 3LAUA 2UW5A 4RRVA 3SX9A 3ZH8A 5BUEA 3LXNA 3FKLA 4TYHB 1OIQA 1ZYLA 4FKTA 2VTLA 3SXSA 2ITZA 3SOCA 3DKFA 1Z5MA 4FTAA 5CAVA 3CXWA 3OW4A 4X3FB 3RBWA 3NDMA 3ZEPA 4EK4A 5FP5A 4KA3A 2NO3A 5K0XA 3M42A 3CTJA 4FG8A 4O84A 3PJ8A 1OL7A 3NUPA 4GYIA 4PDPA 4RJ7A 4YMJA 1MRUA 2OZOA 4ZTNA 2WAJA 5DH3A 4JJRA 2GNLA 2Q0NA 3GOKA 4AW0A 1DAWA 4EYJA 2X2KA 2V62A 4XP3A 5GJFA 2WPAA 4Y46A 2WELA 2VZ6A 4G3GA 2W0JA 1U54B 2YERA 3P4KA 5HD7A 1G8AA 5AUXA 4KB8A 3UIXA 2QG7A 5AUUA 5IA0A 5CU6A 3HUBA 3PIXA 1TQIA 4WSQA 2W4JA 1RDQE 3UOKA 3JXWA 3ROCA 2W1DA 3F6XA 3FHIA 4NJ3A 5KMIA 3UPZA 3VJNA 5FBOA 5FTGA 5LCKA 4F9CA 2G2IA 5J5TA 4HJOA 4ZSEA 5C8MA 5KNJA 4TWOA 5ANGA 5TR6A 4R7BA 3W1FA 3FDNA 5TE0A 1J7LA 3TM0A 1HCLA 4FNXA 2XRWA 2XNNA 2HZ4A 3HNGA 4FTUA 1H28A 5L3AA 3E3PA 2CKEA 5DRDA 1OVEA 3R1YA 4C33A 1P2AA 2ITWA 2YWVA 4QP1A 4GT5A 4AACA 4D58A 3IW6A 4E6DA 2HELA 3DJ6A 2QOFA 2B9IA 4YGAA 5TKDA 4NKAA 3LXLA 4WG5A 2X8EA 4LUEA 4KIQA 2W1FA 4ZSLA 3FQHA 1ZRZA 1Q99A 3UO6A 4BZOA 4YUQA 4B0GA 2CN5A 3OBJA 3ELJA 3L9PA 1WBPA 4L53A 4JI9A 3RPSA 3WF8A 4EEVA 5B2MA 3SVVA 1OKWA 3IDBA 1M52A 1LEWA 3IW7A 4FSRA 1VZOA 2XM8A 3KXMA 4ZXTA 3R7YA 3T3VA 4O38A 4BTMA 1ZOGA 4JAJA 3HVCA 3QTIA 4G1WA 1JSVA 3OXTA 4GIHA 1OL2A 4ANLA 4O0YA 4NJDA 4WHZA 3KF7A 1M14A 3ITZA 3PA4A 2WQNA 4FV3A 3COMA 4HYIA 3IO7A 1KOAA 4AAAA 4XG9A 4NL0A 5IMEA 2PVFA 5K3YA 4CV9A 2WMBA 2C1BA 2X2LA 4QP7A 1ZYCA 4YHTA 5CAUA 1ATPE 2QHNA 5I9XA 4PV0A 1OPKA 2G2FA 4NUSA 5KHWA 4C3FA 2YLFA 1SVHA 4P4CA 2GFCA 3ZUVA 5CAPA 4EOPA 4BCPA 1P4FA 4IACA 4F0FA 4PMMA 1REJA 3ZOSA 5EW8A 2VWUA 1YRPA 3ORNA 2CGVA 4JNWA 5CX9A 5IQHA 4II5A 5LMAA 2WB8A 1JVPP 4IX3A 2UW7A 3BELA 1GJOA 4U9AA 2PU8A 3Q4UA 4ASDA 3HKOA 1R0PA 2YZAA 3EQBA 2UW4A 2YACA 4J8MA 2C6EA 3GUBA 5CQUA 2OIDA 3C5UA 5HBHA 4U5JA 3UQCA 3R7EA 2O63A 4FL3A 4ZSJA 2H34A 4O7VA 4N4SA 5JFWA 4NTSA 4IADA 1GIJA 3G2FA 3C0IA 2YZLA 3HMOA 2GSFA 4HOKA 4JXFA 4QQJA 4HYHA 3JYAA 3BYOA 3EQHA 2JDVA 5M07A 5KHXA 1PHKA 4TWNA 4HNIA 2ZDTA 1G5SA 4C8BA 4DFYA 5H8EA 2PSQA 3RCJA 2F7EE 4DAWA 3HV4A 1L8TA 2BFYA 4FODA 4BGHA 4LFIA 3MA3A 4FT7A 4JIAA 4RVMA 2GHLA 2XYUA 1UKHA 4ZOGA 4MQ1A 3VBTA 5KMOA 1V1KA 2J2IB 1R0EA 4XV9A 3QKMA 5EQPA 4N6YA 5EQYA 4MAOA 1Q8WA 3RINA 3C4ZA 3TIYA 1H1WA 3FZRA 5JGDA 4RIYA 3FKOA 2C3JA 1WAKA 2J51A 1JPAA 2VWYA 3OXIA 5DFPA 4Q5EA 3QRKA 2I40A 3H30A 1P14A 3Q5ZA 2B9JA 5IQAA 2BRMA 3I5NA 3VRYA 4AE9A 3U54A 4JQEA 1JBPE 1V0OA 4TPTA 3OTVA 3TKIA 3MH2A 3TDWA 3WZEA 3UIUA 3GU7A 5HORA 5L4QA 3D2IA 3QZIA 3RPRA 4R3CA 3MPTA 1R39A 2Z7SA 1MP8A 3MFRA 2BMCA 3A4PA 2YAKA 3SC1A 1FQ1B 3R04A 4MQ2A 5J9ZA 2X7FA 3DBEA 2W7XA 1IRKA 2ITYA 4G31A 5HESA 2PVHA 3E5AA 5JH6A 4RZWA 2XUUA 4W4YA 4MBLA 3RPOA 4PRJA 3HYHA 2X8DA 3DJ7A 2YABA 3ZZWA 3RM6A 3VBXA 4ZLOA 3KVXA 2VNYA 3DB8A 3GC0A 3EKKA 4IX6A 4DEEA 1T46A 4F1OA 1ZZLA 3DZOA 2WD1A 5DRBA 4Y8DA 3OOMA 5ANDA 3LM5A 5M44A 5KMNA 4FG9A 4RBLA 5DBXA 4NTTA 5CEQA 4MNEB 4IE9A 4YZBA 4HYUA 5LMKC 4RJ3A 1ND4A 4EQMA 4IM0A 4H58A 1ZLTA 5CSVA 3S95A 4R5YA 3DQXA 3BBTB 1VJYA 4QT1A 2JEDA 2ZV8A 2XNOA 4BI1A 3DKCA 2OI4X 5FEEA 3CPCA 1Q8ZA 1XBAA 2GNGA 2QOBA 2VTRA 3QUDA 5E1SA 4YU2A 5ACBC 5AR4A 3SV0A 4QD6A 4K2RA 4RA4A 5HVKA 2UUEA 3UTOA 3W2OA 4OTRA 1Z9XA 2ZMCA 4PNKA 5LVMA 4TL0A 3V5QA 3HZTA 4DLJA 2B9HA 1U5RA 3KK9A 3UGCA 5I0BA 1OPJA 4FV8A 4EORA 3P7AA 5KKRC 3GXLA 3MDYA 4CFUA 4BBMA 4CG9A 5HU9A 3MIYA 4FZDB 3DQWA 4FT5A 5AV2A 2IW9A 4BDJA 5EI8A 1FBNA 2LGCA 3P78A 4K77A 2BALA 4MD8E 3KN5A 4DH8A 2OK1A 3I7BA 3JY9A 4U97A 4IC7A 2J5EA 5BYZA 3DLZA 1OUKA 4FUXA 2XYNA 2YIYA 2P0CA 4NCTA 4HGTA 1OBDA 1YDRE 4BKYA 2VWWA 5M08A 2BILB 3C51A 3RZBA 2JGZA 2CMWA 3CTQA 4H1JA 4H3PA 1ZMWA 4LL5A 4NW5A 4O6EA 4YJSA 1KE6A 3VUDA 2XM9A 5HVJA 4RX8A 4QMPA 2XK4A 3U6IA 3DA6A 2R3PA 2LAVA 5EHYA 4IB3A 3PRIA 3KMWA 4DFZE 3RJCA 4EC9A 5ACKA 3ZZEA 4JG7A 3LPBA 3DK3A 1YXXA 2J0IA 3R9NA 2C0TA 4AA4A 3V5TA 2VWBA 3MWUA 5BNJA 4PDOA 1OUYA 4LMNA 4OTFA 4V05A 1B6CB 1YI6A 3ORKA 4FIFA 4LQMA 3R9HA 2A1AB 3EIDA 1RW8A 3CKWA 2YJRA 2YLEA 3HLLA 3U4WA 1M7QA 2BKKA 5IQDA 5IKWA 5AWMA 3ZRMA 3C4EA 4AW5A 3EFLA 2W5AA 1DM2A 3JY0A 5CEKA 4M69A 4W9XA 4AA5A 4E6AA 3FLWA 4AUAA 4ENXA 3MH3A 4EH4A 4YZDA 3H4JA 3MVHA 4ID7A 4Y5QA 4FNYA 5AP4A 3LM0A 2OJFE 2W1CA 4TKSA 2EU9A 5DR9A 4YBKA 3TNQB 5JEBA 4IC8A 2OJIA 2X8IA 4C3RA 1BYGA 3GC9A 4O0VA 3QUPA 4TYHA 4O7TA 4ARKA 4FF8A 2XK3A 4FK3A 1B38A 3IONA 3QA0A 4RWLA 4XHKB 3UP2A 5JQ5A 3EH9A 5ANJA 3TTIA 4X3FA 4IB0A 3QBNA 3WZJA 4BCHA 3TV4A 4DEHA 4F0IA 3FC1X 2GPHA 2ERKA 4XRLA 3CE3A 5HG8A 2Y9QA 1KE5A 2PTKA 2VTOA 3BEAA 3OMVA 3RZFA 1FINA 1GIHA 3OCSA 5CAQA 5L2QA 5IG1A 4D2VA 1JNKA 2WTDA 4BFMA 5M06A 5IEVA 4BYIA 3D9VA 4KBCA 5EDQA 5HEZA 3ACKA 3E3BX 4LM5A 3DGKA 1OL6A 2XKDA 3V01A 1U54A 1ZMUA 4D1SA 3JS2A 4XEYA 2WTKB 4PMSA 3W2RA 3LFBA 4TWCA 3SGCA 3ATTA 5BX0A 1H00A 5DI1A 2JC6A 2PUNA 3KULB 2YM4A 3LXPA 3R1SA 3A8WA 2P2HA 4XV2A 4XX9A 3GENA 5CI6A 3DJ5A 4TN6A 3MY0A 4CMUA 2I0HA 3F69A 3L9MA 3OHTA 4GU9A 4RIXB 3I7CA 2B7AA 2OU7A 3Q3BA 3M2WA 4MYGA 3UJGA 4D2SA 2QURA 5FBNC 5M53A 1H1SA 2PULA 5EYKA 4FSYA 4GUBA 3GT8A 2IVUA 5I5ZA 3T9IA 4PDSA 5HTCA 5J1VA 2RL5A 4YLJA 5HOAA 1LUFA 2REIA 4M68A 3SLSA 3DXQA 1H24A 3DAEA 3P23A 3QL8A 5AP3A 4JVGA 3LVPA 3KF4A 1NVSA 4KRCA 2WOUA 2PVKA 4EK5A 3A7IA 3O51A 3RAWA 2EWAA 4Y95A 4EHVA 2C5NA 4GSBA 1PXOA 4EJNA 5IH6A 4L52A 4W8DA 3KRJA 2YCRA 3LZBA 4X0MA 5H8GA 1Q24A 3F82A 4UEUA 2QU6A 2ZMDA 4TNDA 4IAFA 2Z8CA 5EW9A 1XH6A 2IG7A 3ORXA 2PUPA 2Z2WA 4WBOA 4CLIA 3P7CA 4OBQA 4GU6A 2JAVA 4KKHA 1YVJA 4NW6A 4A4OA 3AC1A 3HV3A 3QRIA 5DT4A 4BY9E 5IISA 4JDHA 3GB2A 2IZTA 2IZRA 3HMNA 3KFAA 5M4CA 3QU0A 3EN5A 1YXVA 4M66A 3W2QA 1GIIA 4IAIA 3W2SA 3E8NA 3NW6A 4BCNA 4EL9A 3R63A 4E4MA 4OBPA 1W7HA 3A60A 4AE6A 4QMZA 4CQEA 4CYJA 3PJCA 3BQRA 3MI9A 4KKGA 3VNTA 3E88A 4DG3E 4AXAA 4A07A 5HTIA 3LLTA 5EFQA 3ENMA 3OFMA 1Q4LA 3OZ6A 5AIRA 4QP6A 3PG3A 1QPCA 3F61A 5CI7A 3TI1A 3MW1A 2BZIB 5E8ZA 2NP8A 2R3RA 4QPMA 1K9AA 2P2IA 4RLKA 3ZSIA 3DAJA 3ZCLA 4O86A 3PLAE 2PMNX 2V0DA 5H9BA 3UO4A 4F99A 3G15A 5IA4A 2WQMA 3FV8A 5IH4A 3K3IA 4M15A 1XH5A 2QLQA 2IW6A 1MQ4A 2BDFA 3BGZA 1DAYA 3UPXA 4Q5HA 3NYOA 2XKFA 4FTOA 4FTMA 3D15A 3MJ1A 5A6OA 3BZ3A 4FGBA 4OUCA 3RAKA 4QPAA 3FWQA 3NRMA 3NUYA 4A9YA 5FP6A 2HCKA 4ACMA 4H36A 4X3JA 3EFWA 3TV6A 2VO7A 2XH5A 2F9GA 3UMWA 5HNGA 2IVVA 5BMMA 1H25A 3HRFA 2W1HA 3VS7A 3WYXA 4LGHA 2HY0A 3EMGA 4ZY6A 5EM5A 3RP9A 2CPKE 2QI8A 4C2VA 4U7ZA 2WNTA 1BKXA 4W4XA 1U5QA 1FVTA 2VTHA 3OOGA 3QKKA 4O0SA 4RJ6A 4IIRA 4DC2A 4APPA 1QPDA 4ZTHA 2WOTA 4TRLA 4DT8A 3R2YA 5L8JA 3N9XA 3RHKA 3LLAA 3WIGA 2XIRA 4RA5A 4U81A 1CTPE 1O6LA 4H1MA 1FMKA 4L67A 3QRJA 2BIYA 4L3JA 1EH4A 3HMPA 2ACXA 3WI6A 2O65A 1PYXA 4RWIA 2F57A 3DCVA 3DPKA 1I44A 4QRCA 4AZFA 5JFSA 2VGPA 4PL4A 5AEPA 4X7QA 1IG1A 4WT6A 4D55A 2YCFA 3LCTA 1IA9A 1Q5KA 5DGZA 3QZFA 3NYVA 2ESMA 3II5A 1Q41A 5CZIA 2XK6A 5A4LA 3ORPA 4DF3A 3BQCA 3QQHA 4HZSA 4RSSA 3Q6UA 5LQFA 2FSMX 4GKIA 4GJ3A 4IAYA 3RWPA 4FVQA 5IDPA 4MNEA 2E9OA 3VC4A 5G1XA 4I0TA 1Y91A 2QOHA 3FZOA 2EVAA 4TW9A 4YPSA 5HIEA 4B4LA 2Q83A 3QHRA 4I0SA 1JKLA 2UZWE 1PXKA 5CNNA 5GJGA 3PJ2A 5CSWA 5EW3A 3N51A 2C4GA 1O9UA 5AR5A 2JBOA 5AV4A 3AC2A 3A4OX 5M56A 3OW3A 3MGYA 2WTIA 4FVPA 4HGSA 4DG2E 3RWQA 1KV1A 4GVJA 3RPYA 4GK2A 5I9VA 2YWPA 3JPVA 4H3BA 4FKQA 1L3RE 2R3OA 3FQEA 4D4RA 3CSVA 4EOSA 3Q2JA 1GZ8A 3UP7A 4EZ5A 4Z7HA 4HPUE 4GS6A 5FUTA 3KU2A 1W0XC 3KK8A 4USEA 1URWA 3MV5A 4QPSA 4XLIA 3PE2A 2UV2A 3QCXA 4MXYA 4QO9A 4BYJA 5LCJA 5EM6A 5AADA 2OGVA 4KIOA 2YISA 4FSQA 4FTQA 4DT9A 1YDSE 4PP7A 2J50A 4ANOA 2OJ9A 2VU3A 4YJQA 2GS7A 3HUCA 2QQ7A 4M67A 4OR5A 3I0QA 4QTAA 4KSPA 4B6LA 4EWQA 1QPEA 5HE3A 3V8WA 4EHGA 3V3VA 2YJSA 3QC9A 3MH0A 2YM7A 2XNMA 3TZ8A 3WZKA 2HW7A 3IW5A 4KINA 2VTMA 4RFZA 2GTMA 5J1WA 4YNEA 3EHAA 4FKPA 4JG8A 2Z7QA 4KS8A 5AUWA 3ZDIA 2UW9A 2YM5A 2Y8OA 3B8QA 3QCQA 5CNOA 2OG8A 3FY0A 3PY3A 2ETKA 2RIOA 3FL4A 4BIEA 4QMYA 3UVQA 4IZ7A 3O96A 4QQ5A 2A27A 4PX6A 3TIZA 2EB2A 4YC3A 4I5PA 2WZJA 5JRSA 4WNOA 2I6LA 2IN6A 3AMBA 3BHUA 3HAVA 3R9DA 3ZO1A 3PA3A 4IJPA 3WIKA 4UMUA 3W16A 2XZSA 3F2NA 5A4TA 3TZ9A 4EH2A 5L2TA 2OZAB 4K0YA 3EOCA 4P5QA 2BUJA 5JZNA 1DS5A 2CJMA 2YIWA 5LWNA 4IB1A 4TWPA 2RG5A 3KCKA 4M7IA 1UVRA 3R7GA 3VVHA 4BDCA 4EWHA 4UXLA 2IWIA 1WVXA 2PMOX 4JBPA 3CLYA 3H9OA 2RFNA 4MBIA 4Z55A 2WQEA 2WTVA 4IM3A 2HXLA 2Y7JA 3SOAA 4B7TA 4NIFB 2AYPA 3SKCA 2XIZA 2HZIA 3FHRA 4IWOA 5ETCA 3RNYA 3NGAA 2FSLX 3EFKA 4QMMA 4CKRA 2VTQA 5HNBA 3ALNA 1GZNA 4DH3A 2DS1A 2BVAA 4OTDA 2X1NA 4EH5A 5M09A 1KV2A 5C27A 4O7ZA 2BAQA 4U80A 4IAZA 4K6ZA 4RMZA 3E92A 1SNXA 3PVUA 4YJTA 5CSXA 5K9IA 1YHVA 1LR4A 3O2MA 4L44A 4BCQA 4FKRA 4R7HA 3UVRA 3SRVB 3KULA 4G9CA 5JT2A 2IZUA 4KABA 4DEBA 5E9EA 4BDKA 5CAOA 4ASEA 5HLNA 2Y4IC 2BPMA 4RIXA 1APME 5KCVA 2QOKA 3AD6A 3KRLA 2BIKB 4A9TA 4PMPA 5GNKA 4MNFA 4B8LA 4EUTA 1JKTA 2YM8A 2ZOQA 3FYJX 1V0BA 3QWKA 4IM2A 5I3OA 3WF6A 2ITQA 4M8TA 2HY81 5A4EA 3U6HA 4AFJA 4FTTA 2C5YA 3WILA 4YR8A 2WMVA 4OBOA 4R1YA 3V8SA 4ZJVA 3UIMA 1OIYA 1K3AA 4PPAA 1URCA 5EG3A 1IR3A 3POOA 3ODZX 1FVRA 3BYUA 2PVLA 3DZQA 4DLIA 1WBOA 2QCSA 3PVBA 4FKIA 4MXOA 1BUHA 1CKIA 3U8WA 4C0TA 1XJDA 2XNPA 4FKUA 4FNWA 4RPVA 4CYIA 4NM7A 4Q9ZA 2HXQA 5M57A 3ZXTA 4PWNA 2E9UA 4KAOA 5JRQA 2PUIA 3FMMA 1F5QA 2OF4A 2VWVA 3OF0A 3PZHA 3C4FA 3OEFX 4X2FA 4I6QA 3VHEA 4ANSA 3VS6A 4ACCA 2RFDA 4EQUA 3BWFA 1OIUA 4FTNA 4TT7A 4F7JA 3L8VA 1YQJA 3NZ0A 3A2CA 3MVJA 3QTWA 3KEXA 3IGOA 3NNUA 1QMZA 5AMNA 4ZIMA 3W2CA 4BDIA 4DTBA 2X4ZA 4NM0A 4D5KA 4ASXA 1MQBA 3TEIA 4HVSA 3I60A 3QCYA 5J7HA 3FLNC 4QQCA 5CSHA 5DT3A 3CD3A 4MHAA 1R1WA 5EKNA 3ZC6A 2VX3A 3PXQA 3L8PA 3DAKA 4GK3A 5JGAA 3HEGA 2GS2A 3VS2A 3ZUUA 4F4PA 4CMOA 5JKGA 4RZVA 5ANKA 1JKKA 4IMYA 3N4TA 3FMLA 2PZRA 4YZ9A 2QR7A 2B4SB 2Q0BA 2XVDA 5GZ8A 3UZPA 3PUPA 5HX6A 4GVAA 2C6IA 4CTCA 5AP2A 1BMKA 5E8WA 4N70A 3REPA 2GDOA 4LMUA 2ZM4A 2CSNA 2WMXA 3LFCA 4RFYA 3VBWA 4BN1A 1U46A 3FYKX 4LV5A 2X9EA 2XF0A 4KUJA 4FTJA 4BRXA 3KRXA 3FI4A 4CQGA 2X7OA 5LWMA 2XKCA 5HCZA 3AG9A 3JUHA 5M55A 3FQSA 3MPAA 3IOKA 4BTKA 4MEDA 4EI4A 4AOTA 3MVMA 4DFUA 3GCSA 4BDGA 4ZLYA 2XJ2A 2R3FA 1Q8TA 2WTJA 5C03A 2C69A 2UZNA 4NCTC 3S2PA 2CCHA 5DR2A 1OZ1A 5HO8A 4BCIA 3SAYA 3OD6X 2V22A 1H1QA 2UZLA 4XG4A 2ZB1A 2WU7A 3QZGA 2PZPA 5BVWA 2YDJA 3FL5A 4DH1A 4CSVA 4BIDA 4DFNA 3R22A 2DQ7X 3QA8A 4MD9E 2CGXA 4O7WA 4GT4A 2JDTA 3VBYA 1CMKE 3E8DA 3LIJA 3NAYA 4JAIA 5AUVA 5EHLA 5T6KA 5B7VA 3NUNA 1A9UA 1YXUA 4NH1A 3UYSA 4E1ZA 2XEYA 4FSWA 3DNEA 4X2NA 1PMUA 3FXZA 2AC3A 3LFFA 4J7BA 1ZXEA 4KNBA 5AR3A 4BDBA 1OBGA 2X0GA 5C4KA 4Z16A 1B39A 1VEBA 1REKA 4YZCA 2WIPA 4L7FA 4J71A 5M51A 3R02A 3DTCA 5EM7A 2OSCA 3ZLSA 2KULA 1ZWSA 4F7NA 2NNWB 5BMSA 3COIA 3C7QA 4GCJA 5CU3A 4DH7A 3AMYA 3N4VA 5CXZA 3B2WA 1Q3DA 3PLSA 4Y83A 5HG5A 3NWWA 4TTHB 2PE2A 3PP1A 3HMIA 2OFVA 5IA3A 2G15A 4DHFA 3A99A 3EL7A 3D0EA 3Q2MA 3QYWA 2C6LA 3AXWA 4FYNA 2VTIA 3R71A 3CQUA 1O6YA 4FE2A 4O22A 2B55A 3UDBA 5J9LA 2GS6A 4EOJA 3GU4A 4I20A 2GHGA 5FDXA 1M2RA 3L9LA 2XK7A 3SW4A 2QC6A 3VS0A 4BI0A 3AC8A 1SZMA 4XBUA 3IOPA 5IQEA 2PMLX 3HRBA 4I5CA 4FTIA 1BI7A 3ZDUA 4FKLA 1XR1A 4AP7A 2O2UA 4R3PA 3OTUA 4X3FC 3EQRA 4IH8A 4AOJA 4E7WA 3PDTA 3R28A 3CQWA 2WMUA 3CR0A 2Z7RA 4YJNA 2R3KA 1OKYA 2VTJA 4JT3A 5JFVA 2P55A 5GIPE 4B99A 3R1NA 3DB6A 3FMEA 4O0WA 4QYHA 4U6RA 1PXIA 2V7OA 5HD4A 3NVKI 5IEYA 4BZNA 4C4FA 2QOOA 3F5PA 3VF8A 3BKBA 4EH6A 3QD4A 4PP9A 5A14A 1NW1A 4TZRA 4BKZA 3ZO4A 2XNGA 3CJFA 4GV1A 3ZSGA 2IVTA 2R3HA 4ZTSA 3EB0A 4Q2AA 3W2PA 3F3UA 3ZM4A 3FPQA 4GRBA 3RMFA 4WG3A 3NIZA 4U0IA 4CFVA 2ETRA 3WE4A 5TT7A 5HBEA 3VBQA 3HP2A 1IASA 4I3ZA 4BCGA 3PA5A 4DGNA 4EQCA 3RI1A 3EFJA 4BWPA 4O1PA 4A9SA 4EKKA 4PL5A 3TNHA 3ACJA 4AT4A 5F20A 2JIUA 4D9TA 4DEGA 3H0YA 3AGLA 2C30A 1F0QA 2VD5A 3A61A 4L68A 4NKSA 2UW3A 3H9RA 2VN9A 5CS6A 2JDOA 2H9VA 4APCA 2FA2A 4UMPA 5H3QA 3KCFA 5A3XA 4I22A 4JBVA 4CRSA 4F9BA 4F6WA 4EZ7A 3ZBXA 4YJPA 4FV2A 2E9PA 3MFSA 2R0IA 1H07A 2CKPA 5GINE 4YO4A 3RAIA 3VQUA 3HP5A 1XHAA 3D5WA 1LPUA 4XBRA 2VO0A 3Q4ZA 3LCSA 4F6SA 4O81A 4XCUA 5LVPA 3QD3A 2WO6A 4FEQA 1NXKA 4L00A 4H05A 5IUIA 5KUPA 1ZYJA 2OZAA 4BWXA 3G6HA 4JRVA 4F64A 4BCKA 1WBNA 2ONLA 4AZWA 4L7SA 3CC6A 5DWRA 4XP2A 5L8KA 2EXCX 4MH7A 3GEQA 3R21A 2PVMA 5L2IA 2PVJA 1BL6A 5BUJA 3E63A 3PG1A 2ZDUA 4TYIA 1FGKA 2R4BA 4GG7A 3WOWA 5BQ0A 3R8PA 3KREA 3PPJA 3E7OA 3P9JA 4E4NA 2QO9A 3COKA 1ZOHA 3O8UA 2R7BA 4Q9SA 4M3QA 4WD5A 4BKJA 4M14A 1GZOA 3U51A 2ITUA 3DS6A 3VUHA 4YURA 4PPBA 4MXCA 5KX8A 5KZ0A 5EI2A 2VUWA 4FEWA 3Q9ZA 2BCJA 3PPKA 3TXOA 2HAKA 5FD2A 3D2KA 2FSTX 3CPBA 4FTLA 3C5IA 4FICA 5L6OA 1YOMA 5CEIA 3IDPA 5CEOA 1R78A 3QTQA 3EN9A 4QMOA 2BTRA 1KOBA 4EUUA 3UQFA 5CLPA 5AX3A 4WG4A 3GFEA 3VS3A 3BHVA 4GKHA 1MUOA 4GL9A 4MWHA 3T9TA 2UW8A 3BIZA 4QYGA 2HOGA 3SRVA 5L6PA 2H6DA 4R77A 4PQNA 2B54A 5C26A 2I0YA 2F49A 5LVLA 2W1EA 4ZS4A 5E8YA 4S34A 5K0KA 5GJDA 4L46A 3DLSA 4R3RA 2W9FB 4BDFA 3CY2A 3LMGA 4FMQA 5KMMA 3Q32A 4CFMA 4FNZA 3EL8A 1PJKA 4L6QA 4G6LA 4EOOA 4M12A 1Q8UA 4BCOA 4EH3A 3F3WA 3KXHA 3GCVA 3PRFA 3KA0A 5E8SA 4YTIA 3RPVA 3ID6C 1WVWA 1WCCA 2BKZA 3LXKA 5IQIA 4C57A 4QP2A 1IAHA 1J7IA 3FEGA 4LRJA 4IXPA 2RFEA 2XEZA 3R0TA 4W9WA 4K18A 3F5GA 4P5ZA 4E5WA 2ZV7A 2ERZE 2WGJA 3CJGA 4PUZA 3RCDA 4OGRA 2WFYA 3A7GA 3BX5A 4G5PA 4HGEA 1PXNA 2BHHA 3C4XA 4DGMA 4JR7A 2JIIA 3BPRA 3NCGA 5HQ0A 4MF1A 2E9NA 1QL6A 2UVZA 4QYEA 2GFSA 1ZARA 3LCDA 4QMSA 3WBLA 3FZ1A 5K5XA 3QQKA 5AX9A 3LKMA 2W4OA 3ZEWA 4X6QC 3NX8A 3UC3A 3PJ3A 3BYVA 2IPXA 3PIZA 5EKOA 1BX6A 2YCQA 4IVCA 3GGFA 3V04A 2XK8A 3R00A 5GZAA 3N4UA 4EKLA 5TF9A 3QLFA 3TNPC 3SG9A 2VV9A 3Q9WA 3QCSA 1OPLA 3F3VA 3EKNA 4WOVA 3MYGA 3QXOA 5B0XA 3NIEA 5FGKA 3FLZA 4C38A 4EH7A 3ZO3A 2XBJA 3MH1A 3UODA 1GZKA 2Z7LA 3MN3A 4EK6A 3NYNA 5A46A 4Z7GA 3S00A 4RX5A 2ITVA 3BBWA 2NRUA 1UNHA 5AP5A 5IQCA 4MX9A 4U79A 4D2TA 3TCPA 3VN9A 5KMLA 4K33A 3QZHA 2RFSA 4F09A 5CENA 3RNIA 2BAJA 3BYSA 3FSFA 2YDKA 5L2SA 1W82A 4CZYB 4MD7E 3NCZA 5AR2A 4I6HA 2J0KA 2VTSA 4WNPA 2WMRA 3C0GA 1OL1A 4RQVA 4KSQA 3Q52A 3GCUA 5ETIA 3TUBA 2W1GA 3GC8A 4QNYA 5AV1A 4J99A 4XLVA 3V6SA 4FV5A 4U45A 4CGAA 2J9MA 3IPHA 2YIRA 3DBDA 4QP8A 2Y6OA 2YEXA 1UU9A 3D94A 3QXPA 4D9UA 3OROA 4QYYA 3TDVA 1Q61A 2YDIA 4LOOA 3DY7A 3VW6A 1QCFA 1NVQA 3F5UA 3HRCA 1FVVA 4IEBA 3FPMA 3LW0A 4KWPA 5HI2A 5ICPA 1YKRA 5EHOA 1JOWB 2ZAZA 2VO3A 3BI6A 3Q5IA 1J3HA 4QP4A 4AW1A 3FLSA 5CEMA 5K4JA 4N57A 5G6VA 1KE8A 4NEUA 4AGWA 1S9JA 3ORZA 4U3YA 5EYDA 1W83A 1YWVA 4CCBA 1HCKA 3EN6A 3QKLA 4WBBB 1FGIA 2HWPA 2XCKA 2PPQA 3NUAA 5HE0A 3BLQA 2FUMA 2OWBA 4HYSA 2X9FA 5LVOA 3BE2A 1G3NA 4R8QA 4OAVB 4KIPA 3NS9A 3ANQA 2W9ZB 3BLRA 4FSUA 4QOXA 4I4EA 4ACHA 4CNHA 4YLLA 4E93A 2X7GA 3NR9A 5HO6A 4JR3A 3OWKA 4Z3VA 4QMWA 4FL2A 4EH9A 3R7OA 5D10A 2BTSA 4FT9A 5AP0A 2OFUA 4YPDA 4YJUA 3HGKA 4WKQA 4CD0A 3D5VA 5BVNA 4C2WA 4M0ZA 3RKBA 2H8HA 4I23A 4E5BA 4FGRA 3AC4A 3K5UA 1FMOE 3QD2B 2XK9A 4IWQA 2W1ZA 4YLKA 3WYYA 4CMTA 3O8TA 4JRNA 3HA8A 3SG8A 2GQSA 2VAGA 4ERWA 3MSSA 4R1VA 1JSTA 1Y8GA 4U3ZA 5DLSA 3Q60A 2QOQA 3ZTXA 4L3PA 2GNFA 3EQPA 4OTPA 5HVYA 4J98A 3EYGA 4IHPA 1J1BA 3DXNA 2RKUA 4EBWA 4RWJA 5JZJA 3VIDA 1RE8A 3E64A 3LJ0A 3KC3A 2WHBA 1PY5A
chains in the Genus database with same CATH superfamily
2W5HA 2HYYA 5B2KA 2C3IB 3AQVA 3LQ8A 4RJ4A 2V7AA 4U40A 3EZVA 3D83A 4G3DA 3PPZA 4EYMA 1I09A 5IQFA 2IO6A 4PMTA 3CS9A 3KRWA 3TL8A 5CZHA 1NVRA 3KVWA 3MJ2A 2OICA 4FIJA 4AAYA 4D2RA 3CY3A 2JAMA 1XH9A 4MKCA 4IX5A 2BROA 5C9CA 1STCE 4IWDA 4LRMA 4ONAA 2UVXA 5ANIA 5FM2A 4A4XA 4DITA 2EXMA 4EOKA 3ZS5A 1PXJA 3GC7A 3UE4A 4CG8A 3UOLA 4LOQA 3DNDA 5CF5A 4AN2A 4RVLA 3RK5A 3SW7A 3PUFC 2WTKC 4I94A 4BJJA 3LFDA 4YC6A 3CEKA 3GI3A 3GVUA 5KO1A 3HX4A 1RJBA 4JDKA 2DYLA 4QMVA 5DE2A 2UZVA 4MBJA 1WMKA 4UWCA 1P4OA 3IECA 4O7SA 4O27B 5AR7A 1FPUA 3CBLA 3SQQA 3FI2A 4HGLA 4CXAA 5JFXA 3PXYA 5D41A 4DTKA 3TNWA 4OT5A 1UA2A 3PTGA 2JFMA 2JITA 5FRIA 3TT0A 1BL7A 5JK3A 2HK5A 4UN0C 4IAKA 2BRHA 1JQHA 4C34A 4IZYA 3WF9A 3AMAA 2XMYA 3W8QA 1Y57A 3BU5A 3FMDA 3LMHA 2VO6A 3LOKA 5JSMA 2C6TA 2C5VA 2QG5A 4ALUA 2CNQA 4A4LA 3OT8A 5FXQA 5T3QA 4QTEA 2JDRA 3A7FA 4RVTA 4FT0A 3B2TA 1KE9A 3VS4A 4OTWA 3AC3A 5AV3A 5IU2A 3DK6A 5I9WA 1WBWA 1XMMA 1CSNA 3ORLA 4JLCA 4O21A 5L6WL 3NUUA 4QEBA 5FXSA 3K2LA 1PKDA 3DKGA 5IA1A 4AX8A 1JLUE 3KXXA 3PJ1A 2QOCA 2UZTA 4S32A 3TG1A 4YTFA 4EHEA 1V0PA 4B8MA 1RQQA 2UZDA 3FMKA 4FL1A 3TZ7A 2CLQA 4OW8A 4C7TA 3LCKA 3O71A 4F7SA 5IZFA 1W8CA 5DA3A 4KKEA 3MY1A 3RK7A 1GNGA 4YSJA 3QALE 1UKIA 4JQ8A 2C1AA 3MB6A 3W32A 5DR6A 3EJ1A 5A6NA 4P7EA 3MB7A 3ZRLA 2ETMA 3O23A 3EQFA 3A7HA 4EOQA 3F5XA 3VWAA 4UMQA 3DKOA 4M97A 3DTWA 4ZS0A 2XAOA 1ZMVA 4TY1A 3UG1A 5DEYA 5EH0A 4ZTMA 5HZNA 3TUDA 4O0TA 3TKUA 3ATSA 4BCJA 2P4IA 3R30A 3DU8A 4FV7A 4AOIA 5K4IA 3V5WA 2JIVA 5HG7A 5LARA 5BVOA 4FYOA 3PVWA 1NA7A 1VR2A 4RX7A 5CY3A 5E7RA 5E4HA 1XKKA 3MVLA 4FEVA 4BDDA 1XBBA 4O0RA 4RC2A 3UOJA 4IAAA 4DCAA 4W4VA 1X8BA 5T68A 4F70A 3CP9A 3PY0A 5ITAA 1W2FA 4IZ5A 4KBKA 4M84A 2JD5A 3A62A 4O82A 5IMXA 3OVVA 4YJVA 4AW2A 4J8NA 4PL3A 1W2CA 4K9YA 3AKLA 4FIIA 4NT4A 4GT3A 4MXAA 2C5XA 4JX7A 4O2PA 4RC3A 2DWBA 3P7BA 4J96A 4J97A 4U41A 4CFWA 3R8LA 3FZSA 4WUNA 3VAPA 4QMQA 3ZFYA 4KRDA 4RIWB 4C59A 1H4LA 1OITA 3BCEA 2WMQA 3GOPA 2QR8A 5CVHA 4EOIA 1LEZA 4ZZOA 4TNBA 1W98A 2G1TA 4BWKA 4D2WA 4HNFA 4HVGA 2H96A 4F65A 2JKKA 3KMUA 1UNGA 2XALA 3H0ZA 5AP7A 3E93A 4FV0A 5HGIA 3FC2A 3ZSHA 3BLAA 4PTGA 3FMHA 5IA2A 3V5PA 2PZYA 4IANA 4WIHA 5EDPA 5J8IA 5DIAA 5CANA 3GQIA 4XP0A 4G3EA 3QAME 5J7BA 1WVYA 5A4CA 2IJMA 2OKRA 2PHKA 2QNJA 3UZTA 2C6MA 3D4QA 2B0QA 5C4LA 1UU7A 4DH5A 4HCUA 3ZUTA 4CKIA 2C5OA 4DG0E 4CV8A 4U42A 2JBPA 2XBAA 4B9DA 4BICA 4BCMA 3OY1A 1SVEA 2Y6MA 4ZTRA 3E62A 5M4UA 4UYNA 4J52A 2YCSA 3KN6A 4IFGA 4K1BA 5H2UA 3SHEA 3IG7A 4DFLA 1UWJA 3I5ZA 3UG2A 3QX2A 4A06A 1ZOEA 2BDWA 4LYNA 2PE0A 3C13A 5M4FA 1SM2A 2YAAA 4CFFA 3G0EA 5E92A 2ZYBA 2R3IA 2QOLA 3FI3A 2P3GX 4Y73A 2JKMA 2WU6A 3FMNA 4BBFA 3V5LA 3QD0A 3TWJA 5EQEA 3G51A 5A54A 3PE1A 3QX4A 3F9NA 3HECA 5DYJA 3QC4A 5D11A 4YZMA 5DN3A 4EK3A 5F9EA 2R64A 5FEDA 1XQZA 5I9YA 3Q9XA 1PRYA 4OTIA 5D7VA 2XNBA 1Q3WA 5FM3A 4UMRA 3ZMMA 2BRBA 2O8YA 3CTHA 4MXXA 5CWZA 4FV9A 3BGQA 5DT0A 3HMMA 4I6FA 2C6OA 3C9WA 2OW3A 5ANOA 3QFVA 5CU0A 4BVUA 4LGDA 4F0GA 5K5NA 3W0NA 2UVYA 3R9OA 3FXWA 5ETFA 3ZRKA 4RQKA 2R3NA 4QYFA 2A0CX 4QNAA 3BLHA 2QKRA 3NNWA 4DEIA 3ULZA 3PWYA 3L8SA 2GTNA 1M2PA 4RG0A 2BZJA 5CYIA 5FEQA 4L42A 3FI8A 1BI8A 2IZSA 2BZKB 4XG2A 3S3IA 3ZO2A 1YWNA 3DDPA 1YHSA 4G34A 5IF1A 4ZTQA 3HDNA 4OT6A 1VYWA 4BGGA 3O50A 4GJ2A 2RG6A 2WEVA 2C68A 4RC4A 2AUHA 5F4NA 3V6RA 4A9UA 3C0HA 4JBOA 4C35A 1AD5A 1PXPA 2ZVAA 3UVPA 4ZAUA 1H26A 2GQRA 4TYGA 4O96A 2I7QA 2CCIA 3KMMA 3H10A 4LUDA 3PSBA 5J5SA 4AZTA 4D4YA 4FZ6A 1Y8YA 3ORMA 4HZRA 3UQGA 4E8AA 4FI1A 4KIKB 3UNKA 3E8CA 3FLYA 5DVRA 3UO5A 3EN7A 5AJQA 4F9WA 4J95A 4DA5A 4UZDA 2I1MA 1YI4A 4ZEGA 2QVSE 2RGPA 4F7LA 1OL5A 5LOHA 2CLXA 3I1AA 4RFMA 5I9UA 5D1JA 3AD5A 5E8VA 3FKNA 2BR1A 2QONA 4QMXA 1AGWA 3MA6A 4O2ZA 1IEPA 4G5JA 5I4NA 4UV0A 4QTDA 3QQJA 4C36A 2GNJA 3P86A 3ZYAA 3LQ5A 4MCVA 5BVKA 3KRRA 3QUEA 3VW8A 2CNVA 5ANEA 5FQDC 4AF3A 4O0UA 3MTFA 4F1TA 2F7ZE 2A19B 4O7RA 1UU3A 5F95A 3FXXA 3LFQA 3QTRA 1ZAOA 3NEWA 2ONLC 3MY5A 3COHA 2EB3A 2C0OA 5CXHA 2PVRA 4AT3A 5ETAA 4GUEA 2ITPA 2C6KA 3M1SA 1H08A 2ITXA 4QMNA 4KS7A 2C0IA 3VUKA 5HTBA 4DHIB 2GMXA 2W17A 1G8SA 2R3MA 1XBCA 3Q96A 3QTZA 4AGUA 4MWIA 5J87A 3FJQE 3VUGA 1SMHA 3LE6A 4G2FA 3D5UA 5KKRB 2BHEA 2F4JA 4XG3A 4C4JA 5HU3A 5BUIA 5CVGA 3CGFA 2WMTA 4FV1A 3F2AA 2NRYA 2A2AA 4NM5A 5FTQA 3AT2A 4BTFA 1UU8A 2J0LA 3RK9A 3QQFA 5BVFA 4CFXA 4WSYA 4E3CA 5E8XA 3VS5A 3UOHA 3MPMA 3U87A 1PXMA 4ANMA 3PXRA 5CVFA 4D1ZA 5TO8A 5EM8A 3AT4A 3F66A 2VX0A 3ZFMA 2C3LA 4BDHA 3PWDA 4D2PA 2R3LA 3NNVA 3P79A 2HW6A 4BZDA 1H0WA 4ZTLA 5GZ9A 1UV5A 2EXEA 3P08A 3GQLA 3P5KA 2EUFB 3LMIA 4FZAB 3ENHA 4I1ZA 5HICA 4HVIA 4EH8A 5HKMA 4OAUC 3OCGA 4I4FA 5EYMA 2CDZA 3WZUA 1NY3A 3KXGA 4E6CA 4L3LA 4A7CA 1H01A 3R73A 3I6UA 5DMZA 1M17A 4AS0A 4N0SA 4XMOA 2YIQA 4DN5A 4FZFB 2OO8X 1CDKA 4XS2A 3R7VA 2X81A 4PF4A 4BL1A 4CCUA 3D14A 4FKGA 2X4FA 5E8TA 4LL0A 4F9YA 3S1HA 2W1IA 3EQIA 4FSZA 3UC4A 4FK6A 4JQ7A 4QTBA 1OMWA 3W0QA 3ET7A 5M4IA 3HDMA 2FVDA 4BDEA 4FTKA 2XJ0A 3LJ2A 3SXFA 3EQGA 2C6DA 1OGUA 5J9YA 4O7YA 4GFMA 1JAMA 4IDTA 4FIHA 1XH7A 3W18A 1DI8A 3DBQA 3O7LD 4IJ9A 2CHLA 5D12A 4FIEA 3JVSA 3PVGA 4IBMA 4WRGA 5EYCA 5LVNA 3AGMA 4FTCA 3POZA 1PW2A 4BBEA 3O0GA 3G6GA 3LFSA 1WBVA 3GCQA 4O1OA 3FUPA 3BHHA 3QWJA 4ALVA 4YO6A 3UZRA 1MRYA 5E91A 2OXDA 1S9IA 2W5BA 4ENYA 4RIOA 1TKIA 4I93A 1UNLA 4IVBA 4QQTA 3OP5A 4C4HA 3NUSA 1T45A 3GNIB 4V0GB 4NYEA 4DDIA 2OBJA 4CVAA 2FSOX 2R9SA 3OG7A 2KTYA 1WFCA 2HENA 4XUFA 4AG8A 2XB7A 5HO7A 4FT3A 4WRSA 3TNIA 4EZ3A 2O5KA 4R78A 3OC1A 3VJOA 4HCVA 1XH4A 1SVGA 1YWRA 4FSMA 2W4KA 4FKWA 4IB5A 3CIKA 3PSDA 2QU5A 2PK9A 4FSTA 2IW8A 5KZIA 4L01A 4LRKA 4TYEA 2WQBA 4UBAA 3R8ZA 3H9FA 5CT7A 4D1XA 2PYWA 3A7JA 3F3ZA 5AR8A 3IK3A 3RM7A 3WF5A 3ZU7A 2R3GA 3VUTA 2PZ5A 3R01A 4FTRA 1GY3A 4LV8A 2JKOA 3ALOA 5AIKA 3ZFXA 1VYZA 3QGWA 4AXEA 2Z60A 5FDPA 3KKVA 4F9AA 2XP2A 4ZJJA 3U55A 2I0VA 3D7TB 4FVRA 3F2RA 3PP0A 1H1RA 3BHYA 2Y4PA 4TYJA 1Q97A 4I0RA 4WNKA 4FOBA 3T3UA 4YC8A 4RIWA 2C3KA 5JN2A 3U9CA 1PF8A 2VGOA 3RAHA 4EOMA 1CKJA 1E1XA 2HZNA 2RF9A 4N6ZA 4NIFA 1TQMA 5EOBA 4DGLC 5L2WA 3NVMB 3WE8A 2BRGA 1PKGA 3OEZA 4D4VA 5LMBA 3U6JA 3QTXA 4BB4A 4ZLZA 2R0UA 1CKPA 4JDIA 4X2GA 1YXSA 3VUIA 4AWIA 3FZPA 4JX3A 4F6UA 5JGBA 3V51A 2ITOA 2ZV9A 3F88A 3WARA 3BE9A 4U43A 2CN8A 3IGGA 2W96B 3BU3A 3QGYA 4P2KA 4CKJA 3LQ3A 4O6LA 1TVOA 3P0MA 2WIHA 5E8UA 1M7NA 5AFVA 3NSZA 1MRVA 5H8BA 4AZVA 3QRUA 3R9RA 4UMTA 2XJ1A 5HCXA 2E2BA 3IW4A 5DPVA 4W4WA 4LOPA 5FLFA 3Q4CA 5IPJA 3LJ1A 4FV6A 4HVHA 4K11A 5DNRA 2BZHB 2R3QA 5BVDA 2UZUE 2J90A 2HWOA 4ZMFA 1XO2B 3OS3A 4GG5A 2XS0A 1PMVA 4G3FA 4G6NA 1JSUA 4DYMA 3TMOA 1K2PA 2WMSA 4GH2A 2XANA 3GCPA 3ODYX 5C01A 4O91A 4ALWA 4IWPA 2VTTA 3O7LB 5E1EA 4RVKA 1PMNA 4E5AX 3UNJA 2PUUA 2IVSA 4TXCA 4XG8A 4JBQA 4O83A 4ZK5A 4E73A 2UW0A 4ZZMA 3ROYA 5BYLA 4I92A 4I5MA 4CT1A 2FB8A 5I3RA 1PXLA 4CFNA 4OLIA 3TJDA 1WBSA 4UYAA 3RALA 3OBGA 3C4CA 4ITIA 1H1PA 2V55A 4C4IA 5B2LA 3CGOA 1DI9A 2B53A 3PXFA 2YM6A 3W55A 2J0MB 3HAMA 3F3TA 4AZSA 1A48A 1YDTE 4Z9LA 2UZBA 2QODA 4EK8A 3NAXA 5CQWA 4JOAA 5D9HA 3TJCA 2VX1A 4GEOA 3TKHA 4ZSAA 5CALA 1ZYSA 3ANRA 4OTGA 3R8UA 1E1VA 4OTQA 4CZTA 5KE0A 3MIAA 3VHKA 2OH4A 2XIXA 1GOLA 4FX3A 1OECA 3O8PA 4JIKA 3OXZA 2PL0A 1HOWA 3HL7A 4ZP5A 3DXPA 4FV4A 5EOLA 4YP8A 4FA2A 2XAMA 2F2CB 1JKSA 4R5SA 4I41A 3TUCA 1O6KA 4C61A 3LFEA 4USDA 2FGIA 4CZUA 4QP3A 4X6RA 4FC0A 1ZZ2A 4YJOA 4KIKA 4FEXA 3GU6A 5A9UA 3DT1A 4IDVA 5KMKA 3QQGA 2CGWA 4AN3A 2BRNA 4AN9A 4YJRA 2R3JA 4NU1A 5HCYA 2J0JA 3T8OA 3K3JA 4DEDA 5KBRA 4D0XA 5HIDA 4FKSA 4XV1A 4GFOA 2C47A 4PNIA 4EOLA 4IZAA 3VS1A 5IA5A 4FUYA 2FH9A 2ZB0A 2FO0A 2R5TA 5DEWA 4CT2A 5L8LA 4WUAA 4A9RA 1Z57A 3ZLYA 3TV7A 2QLUA 3C50A 3R83A 2OF2A 1BLXA 2QD9A 3VO3A 5BYYA 4V01A 4BI2A 3B8RA 4YTCA 3D5XA 3DFCB 3L1SA 4DFXE 2Y0AA 4LG4A 3Q04A 4EBVA 4M0YA 3V8TA 5LMKA 4C37A 4GIIA 4M13A 3ZM9A 4H39A 5AA8A 4GYGA 3KQ7A 2F7XE 4FR4A 5DOSA 4XOYA 1SNUA 1KUTA 2QO7A 2J6MA 4XNEA 3CQEA 3G9NA 3THBA 3FAAA 3EN4A 3OT3A 3PYYA 2VRXA 4R7IA 4DFBA 4O7LA 5AM6A 1ERKA 4O4FA 5LXMA 2CKQA 5IH5A 5F1ZA 4NM3A 2W05A 4UY9A 4IFCA 5CT0A 1IAJA 4DCEA 3FBVA 4IVDA 4NFNA 4XG7A 5IUHA 3F7ZA 3R8MA 4RJ8A 2ZJWA 4U8ZA 4UZHA 4YTHA 5HHWA 4ORKA 4C3PA 3AOXA 3MFTA 3MFUA 4ITJA 3W33A 2R7IA 4YZNA 4E6QA 5KBQA 3IDCA 4QTCA 4RX9A 3CKXA 2GQGA 4EJ7A 3AD4A 1OKZA 4ZZNA 4E26A 5AAGA 1KSWA 2R2PA 4PDYA 3DBCA 1H0VA 2XNEA 3Q4TA 4FKVA 4ASZA 5KMJA 1J7UA 3KL8A 1KE7A 4XOZA 3U4UA 2G9XA 4S2ZA 3I79A 3OCBA 4NZWB 3RVGA 5IEXA 3W0SA 4EHZA 5HBJA 1WBTA 3QYZA 5EDRA 1OIRA 2PZIA 3W10A 3R1QA 1YHWA 3TACA 5J95A 4C02A 4AGDA 3S0OA 1OB3A 3GU5A 4JL9A 3TZMA 3UDZA 3ZC5A 4F08A 4ANBA 3MBLA 1LP4A 4FOCA 3EYHA 4HVDA 2XA4A 3ORIA 4NSTA 3OWJA 5FWKK 2G01A 2NPQA 3HV6A 4QP9A 2PVNA 4D5HA 3M11A 1E9HA 5AUZA 2BAKA 3ZONA 2YA9A 3UBDA 2AEGA 5DG5A 4AGCA 3FLQA 3QQUA 2VTPA 4HW7A 2VWIA 4D0WA 1Q62A 3D7ZA 3BV2A 3GFWA 2YIXA 1U4DA 4L45A 5E90A 5CF6A 4L43A 3R6XA 1XH8A 4W8EA 4C62A 4EC8A 5AUTA 3C1XA 4K8AA 4XG6A 4FJVA 2VTAA 4L8MA 2XIKA 4BCFA 5A4QA 3EQCA 3KY2A 2JFLA 3NNXA 2G2HA 2GU8A 3LFNA 4Y85A 4Y5HA 5CU4A 5FG8A 3VF9A 3WF7A 3G90X 4AA0A 2ZM1A 3O17A 3TN8A 1P5EA 4FSNA 4HCTA 3QHWA 2F2UA 4FIGA 3ZHPC 4AT5A 1IA8A 4BDAA 1W84A 3SXRA 4O4BB 1R3CA 3NMUF 5F94A 3GU8A 2W06A 3UIBA 2X6DA 4C4GA 2X39A 1ZYDA 3ETAA 4I21A 3FSKA 5HLWA 4FKJA 1M2QA 5D7AA 3BWJA 4PPCA 4USFA 1PYEA 3FE3A 4BHZA 2O0UA 2WXVA 2AC5A 4FEUA 3AC5A 5EK7A 3MESA 1YXTA 4ERKA 1TFFA 4E20A 2VNWA 2FYSA 3HV5A 2ZV2A 3IQ7A 4MF0A 4X2JA 5DHJA 4BTJA 5C1QB 3DBFA 4V0GA 4ITHA 4RT7A 4MXZA 4AFEA 4FBXA 4IW0A 4BC6A 4DEAA 1CM8A 3OCTA 2ZM3A 5JMSA 4FZ7A 4Y72A 2QHMA 3E8EA 4S31A 4DINA 3DDQA 4RWKA 4GW8A 1ZY4A 3VRZA 5CF8A 4ZSGA 4ACDA 5JQ8A 3LCOA 2UZOA 2YM3A 4GFGA 4LGGA 4QMTA 1ZY5A 2A4LA 4CTBA 2JKQA 3FY2A 4RGJA 2WEIA 3HA6A 3S4QA 4E4XA 2SRCA 2OXXA 3RHXA 2Z02A 5C8NA 2Y4IB 3ZXZA 3Q6WA 2JDSA 2WMAA 4J53A 4WO5A 4XH6A 5J79A 2XCHA 4GK4A 4F63A 4UX9A 2WTWA 3NPCA 4FKOA 5AUYA 2YHVA 2XRUA 3F7WA 2PVYA 3KXZA 3QRTA 4I24A 4L9IA 4RLLA 3R7IA 2QKWB 3D7TA 1YOJA 4YHJA 1OI9A 4ANQA 4DGGA 4RIYB 3SA0A 3BU6A 4C58A 4BR3A 2YFXA 4S33A 3VUMA 2RSVA 4X2KA 2CKOA 1OKVA 3I4BA 5HE2A 3EQDA 4ANNA 5IQGA 3BGPA 3E7VA 4NFMA 3U9NA 4H3QA 3VULA 5AAEA 3FZTA 3HV7A 2OJGA 3EZRA 4FG7A 3DK7A 4V04A 2I0EA 2WQOA 1Y6AA 3R2BA 4MK0A 5C8KA 2ITNA 2W99B 1SYKA 4G16A 3A8XA 4I6BA 3V5JA 4EONA 2E9VA 3GBZA 5CSPA 2BDJA 2QO2A 2UW6A 3VBVA 4CEGA 3SDJA 5IDNA 4IX4A 1KWPA 5GHVA 3NUXA 3ERKA 2OLCA 2J5FA 1J1CA 3QTUA 3AKJA 3L9NA 1Q8YA 3Q53A 4XV3A 3P1AA 4F1MA 4BHNA 2HZ0A 1AQ1A 5HX8A 3CD8A 4UWBA 4FRFA 4KBAA 5HLPA 3PXZA 5IUGA 3MS9A 2XIYA 4XRJA 3DOGA 3W8LA 3KGAA 3K54A 3OWLA 3UYTA 4G6OA 2PWLA 1OM1A 3BRBA 1U59A 3I0OA 2VTNA 2VWZA 3VQHA 3PFQA 1ST4A 2O3PA 3E87A 2OXYA 4PY1A 4YNOA 4JS8A 1UWHA 4JG6A 2JLDA 3BV3A 3BYMA 5AP6A 4ACGA 4AQCA 1PMEA 2B9FA 4PTEA 5AM7A 3NLBA 4YHFA 2B1PA 3OWPA 4LV7A 5CF4A 3G9LX 4WNMA 4JDJA 4HPTE 3KXNA 3BEGA 2GNIA 4ZY5A 4UB7A 1GAGA 1XWSA 3QQLA 4ZY4A 2CNUA 4IQ6A 3JVRA 3FMJA 2OJJA 3DFAA 3IS5A 3RTPA 4AZEA 3I81A 3PXKA 2OIQA 4G9RA 1H8FA 3NYXA 2DUVA 5GIOE 3PSCA 2J4ZA 3Q9YA 4XJ0A 4O0XA 4LI5A 4MTAA 4NWMA 4S30A 5CU2A 3UMXA 4G17A 3TTJA 2P33A 1OGYA 4ZMEA 3R8VA 3NW7A 4UXQA 2XKEA 3C4WA 2WKMA 4E4LA 3RGFA 5HNIX 4GMYA 5AP1A 2QOIA 3I6WA 5IQBA 1WZYA 1A06A 2ITTA 2UZEA 5EI6A 1YW2A 3L8XA 3LFAA 3ZLXA 4QMLA 5TOZA 1NT2A 3G0FA 4ZJIA 4CLJA 1F3MC 3QF9A 4OTHA 4QMUA 5LJJA 4BGQA 4U44A 2OIBA 4X21A 2YN8A 4IVAA 5CASA 3PZEA 4G3CA 3G5DA 5I9ZA 4I5HA 3OUNB 4R6VA 3LHJA 3CCNA 3OY3A 4D4SA 2VWXA 4XYFA 4DGOA 5BPYA 4O7NA 2B52A 2PY3A 4BF2A 4BIBA 3KB7A 4YSMA 3R7UA 4DTAA 1FOTA 2GHMA 4UALA 5AA9A 4J1RA 4C4EA 2X2MA 5HE1A 4AU8A 2J7TA 1TQPA 5AAFA 4DE4A 3QTSA 2WTCA 3H3CA 5HIBA 3WZDA 4PTCA 3ULIA 5CEPA 3IW8A 3OUKA 1YI3A 4MVFA 2PE1A 3ORTA 4P90A 4RJ5A 5AV0A 2X6EA 3UNZA 1Y6BA 1YOLA 2OH0E 4DBXA 2GNHA 5HG9A 3AT3A 4YBJA 3PIYA 3MTLA 4WA9A 2WMWA 5FTOA 2V5QA 4CRLA 4DBNA 3QLGA 2CGUA 3ZBFA 2YITA 3GP0A 3IKAA 3G33A 4M69B 2ZFYA 2O64A 1J91A 4KD1A 5FXRA 2GCDA 5BVEA 3SD0A 3NW5A 1XMLA 2BFXA 3K5VA 3PY1A 5CTPA 2PMIA 3EWHA 2HIWA 3JR1A 4D28A 4NK9A 1JWHA 3DV3A 1QPJA 3O5AA 4UWYA 3BHTA 1H27A 3ZLWA 3LAUA 2UW5A 4RRVA 3SX9A 3ZH8A 5BUEA 3LXNA 3FKLA 4TYHB 1OIQA 1ZYLA 4FKTA 2VTLA 3SXSA 2ITZA 3SOCA 3DKFA 1Z5MA 4FTAA 5CAVA 3CXWA 3OW4A 4X3FB 3RBWA 3NDMA 3ZEPA 4EK4A 5FP5A 4KA3A 2NO3A 5K0XA 3M42A 3CTJA 4FG8A 4O84A 3PJ8A 1OL7A 3NUPA 4GYIA 4PDPA 4RJ7A 4YMJA 1MRUA 2OZOA 4ZTNA 2WAJA 5DH3A 4JJRA 2GNLA 2Q0NA 3GOKA 4AW0A 1DAWA 4EYJA 2X2KA 2V62A 4XP3A 5GJFA 2WPAA 4Y46A 2WELA 2VZ6A 4G3GA 2W0JA 1U54B 2YERA 3P4KA 5HD7A 1G8AA 5AUXA 4KB8A 3UIXA 2QG7A 5AUUA 5IA0A 5CU6A 3HUBA 1ST0A 3PIXA 1TQIA 4WSQA 2W4JA 1RDQE 3UOKA 3JXWA 3ROCA 2W1DA 3F6XA 3FHIA 4NJ3A 5KMIA 3UPZA 3VJNA 5FBOA 5FTGA 5LCKA 4F9CA 2G2IA 5J5TA 4HJOA 4ZSEA 5C8MA 5KNJA 4TWOA 5ANGA 5TR6A 4R7BA 3W1FA 3FDNA 5TE0A 1J7LA 3TM0A 1HCLA 4FNXA 2XRWA 2XNNA 2HZ4A 3HNGA 4FTUA 1H28A 5L3AA 3E3PA 2CKEA 5DRDA 1OVEA 3R1YA 4C33A 1P2AA 2ITWA 2YWVA 4QP1A 4GT5A 4AACA 4D58A 3IW6A 4E6DA 2HELA 3DJ6A 2QOFA 2B9IA 4YGAA 5TKDA 4NKAA 3LXLA 4WG5A 2X8EA 4LUEA 4KIQA 2W1FA 4ZSLA 3FQHA 1ZRZA 1Q99A 3UO6A 4BZOA 4YUQA 4B0GA 2CN5A 3OBJA 3ELJA 3L9PA 1TZDA 1WBPA 4L53A 4JI9A 3RPSA 3WF8A 4EEVA 5B2MA 3SVVA 1OKWA 3IDBA 1M52A 1LEWA 3IW7A 4FSRA 1VZOA 2XM8A 3KXMA 4ZXTA 3R7YA 3T3VA 4O38A 4BTMA 1ZOGA 4JAJA 3HVCA 3QTIA 4G1WA 1JSVA 3OXTA 4GIHA 1OL2A 4ANLA 4O0YA 4NJDA 4WHZA 3KF7A 1M14A 3ITZA 3PA4A 2WQNA 4FV3A 3COMA 4HYIA 3IO7A 1KOAA 4AAAA 4XG9A 4NL0A 5IMEA 2PVFA 5K3YA 4CV9A 2WMBA 2C1BA 2X2LA 4QP7A 1ZYCA 4YHTA 5CAUA 1ATPE 2QHNA 5I9XA 4PV0A 1OPKA 2G2FA 2IEWA 4NUSA 5KHWA 4C3FA 2YLFA 3TYKA 1SVHA 4P4CA 2GFCA 3ZUVA 5CAPA 4EOPA 4BCPA 1P4FA 4IACA 4F0FA 4PMMA 1REJA 3ZOSA 5EW8A 2VWUA 1YRPA 3ORNA 2CGVA 4JNWA 5CX9A 5IQHA 4II5A 5LMAA 2WB8A 1JVPP 4IX3A 2UW7A 3BELA 1GJOA 4U9AA 2PU8A 3Q4UA 4ASDA 3HKOA 1R0PA 2YZAA 3EQBA 2UW4A 2YACA 4J8MA 2C6EA 3GUBA 5CQUA 2OIDA 3C5UA 5HBHA 4U5JA 3UQCA 3R7EA 2O63A 4FL3A 4ZSJA 2H34A