2YACA

Crystal structure of polo-like kinase 1 in complex with nms-p937
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
290
structure length
290
Chain Sequence
b'EIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE PLK1
publication title Nms-P937, a 4,5-Dihydro-1H-Pyrazolo[4,3-H]Quinazoline Derivative as Potent and Selective Polo-Like Kinase 1 Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 290
sequence length 290
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2yacA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yacA01
2YM4A 5E8TA 4LL5A 4P5ZA 3TIZA 3QX2A 3FYKX 2FSOX 4I0RA 4IX6A 4M69B 2GS6A 5T6KA 1ZMWA 3TNQB 2VWVA 4ZAUA 4V04A 3OC1A 5AR2A 2CDZA 5B2LA 4JDHA 4ZP5A 2AC5A 5GHVA 5JT2A 3PXQA 5TOZA 5BVNA 3AT2A 5HIEA 5K4IA 4MNEB 4O83A 2J90A 4C58A 4D1XA 5DEWA 4C0TA 4B9DA 3L8SA 3MI9A 4FUXA 1IR3A 4IB3A 3QRUA 4CFUA 1H4LA 2ETKA 4YTHA 5E9EA 3MJ2A 4FT9A 4QMTA 4ZLZA 3MYGA 3OP5A 3IDCA 4TNBA 2WIHA 4G9RA 2X81A 3QC4A 3ZSHA 4W4XA 2X7OA 3BBWA 3DNEA 3A7IA 2O8YA 2OFVA 4USEA 2XA4A 3HV6A 4L45A 5AV3A 2B52A 4YU2A 5IQFA 3A99A 5K5NA 3BEAA 3D4QA 5IUGA 3MA3A 2BRHA 2IWIA 4NL0A 3PWDA 4KKHA 4JBQA 4Q5HA 5KUPA 4EONA 3NX8A 1OL2A 1RJBA 5HNBA 5HTBA 3PJ1A 4O7NA 4PPBA 4AT3A 4U5JA 1OL1A 1KE5A 4M84A 4G1WA 4AFEA 4O0VA 4DH3A 4RZVA 1I09A 1HOWA 3PY0A 3VRZA 5CEKA 4FKGA 3W2PA 4CMOA 2XP2A 3AC3A 5AV1A 2X7FA 3BYMA 4WNOA 2F7ZE 4D4VA 2W4JA 2W1DA 4OTPA 2DWBA 2BVAA 3BCEA 1FQ1B 2I0YA 2F57A 3HA6A 1FGIA 4BWPA 4FL3A 4E4LA 5J5SA 1W83A 3FMJA 4ZXTA 1FINA 3Q5ZA 1OIYA 4R78A 5E91A 4NCTA 3COHA 4NK9A 1XH9A 4KB8A 4AU8A 4CKIA 4RMZA 1V0OA 4ZTLA 4FGBA 4O21A 2C0IA 3Q9WA 4NTTA 4U45A 4X3FB 5HLPA 3UIBA 3VVHA 4RVKA 3ZCLA 3U54A 3I1AA 5CU3A 3HVCA 3VNTA 3BZ3A 4ZLYA 3E62A 2FA2A 3WF9A 3UYTA 3ULZA 4F1OA 2OO8X 1JKTA 5EH0A 3A60A 1R0PA 4KS7A 2UZEA 4CZYB 4AZSA 4BCMA 4G31A 4EZ7A 4EOIA 2R3IA 5CQUA 4QYEA 1Y8YA 2GFSA 4ANOA 3OROA 1A48A 3MIYA 2E9NA 4GVAA 4MBJA 4JX7A 3VF9A 3LQ3A 4GU6A 2GNLA 4PUZA 5EYDA 4ZTSA 3VS6A 3UO4A 4ZSJA 4GMYA 4IH8A 4NM3A 4YJRA 2IW6A 4HNIA 5CF4A 3BI6A 1ZMUA 5AP2A 4AW5A 3N4VA 3RJCA 3W2RA 2XIRA 2PVRA 3OT3A 4PNIA 3VUDA 3FI8A 5AFVA 2C6OA 2PVHA 2CCHA 2HELA 4RG0A 4EH6A 3Q9ZA 4DGOA 3ATSA 2P33A 5J5TA 5AR8A 5D11A 1PMVA 5EQPA 4AGUA 5EI6A 4JDKA 3P7BA 2VTHA 4ZLOA 3PXFA 3F7WA 4EKKA 4CRLA 4MTAA 3VUHA 4JDIA 2R7IA 3NW5A 2PVFA 3O71A 4PDSA 3KXXA 3RAHA 2WNTA 4I4FA 4FV7A 5ETIA 3H10A 5FG8A 1K2PA 4H58A 4IFCA 4RWJA 5F1ZA 1DI8A 2DUVA 3PZEA 3S3IA 5DT3A 2YEXA 4AA0A 4EOQA 4FYOA 2VTMA 3DDQA 4BIBA 3MVLA 2XJ2A 4JJRA 3CC6A 4G17A 4NH1A 3FY2A 5FRIA 1HCLA 2XZSA 4PPCA 4Y5QA 5FEQA 4IVAA 5M4FA 1J7UA 1ND4A 3DY7A 2YLEA 3PXYA 1QPJA 2QQ7A 1WFCA 3KXMA 4TXCA 4D1ZA 4ZY5A 4HCTA 3TN8A 4EORA 2CGUA 1OVEA 2X39A 3HP5A 5JMSA 5CEOA 5HO6A 2ITUA 4Z9LA 5H2UA 4CFFA 3HECA 4YO6A 3QKLA 1M7QA 4FIIA 2PZ5A 3V8TA 1B6CB 3C4WA 2OZAA 4WBOA 3DCVA 5E8VA 3C5IA 4YPSA 2BFYA 4FKUA 4I41A 1OMWA 4JNWA 4JX3A 2FO0A 4ACGA 2WTCA 4G6NA 4K1BA 3ZUUA 4P7EA 4FC0A 3P86A 4NTSA 5IQHA 4YZNA 4TPTA 3LXPA 4PX6A 2E9UA 1XQZA 2GHLA 2OXXA 4L3LA 3PSCA 3VHEA 3AC4A 5D10A 5L2TA 3IGGA 2UW6A 3DQXA 3E3PA 4X6QC 5D1JA 5HORA 4B0GA 2I40A 5HG7A 2O3PA 1FVTA 4L46A 4N57A 2XJ1A 2XIZA 4WA9A 5HG8A 2O63A 4GG5A 4CFWA 4PP7A 3G33A 3GU4A 3CQUA 5AR7A 3RM7A 2VO7A 3ZTXA 4O82A 3ORZA 1WBNA 4FVPA 3ZHPC 4FV4A 4I23A 3PA4A 4RC3A 2R64A 2WU6A 3PYYA 2B9HA 2XK3A 3D5UA 4RJ4A 5FM2A 5LARA 4OLIA 5CENA 5AAGA 3LLAA 3ITZA 5CLPA 3AMBA 2PUNA 1H26A 2Y6OA 3OF0A 2EWAA 3WF8A 2GU8A 3LM5A 4L42A 4AACA 3F69A 4QMQA 4AA4A 3FPQA 4GU9A 4RVLA 2UVZA 3EN9A 5CF6A 4LGDA 3KU2A 4NFNA 1XBCA 4LGGA 3R1YA 3VUGA 3MDYA 4FSTA 1MRUA 1VR2A 4M69A 4TYEA 4Z7HA 5CZHA 4FTRA 2PMNX 3IKAA 2Y7JA 1YI6A 3FMNA 1OPLA 4PF4A 4U81A 3BGZA 4CTCA 4MNEA 2OIBA 4D1SA 2GNFA 4MD8E 3T8OA 4YMJA 3VHKA 2QR8A 2VWXA 3ORTA 3OEFX 4O0UA 4GS6A 2F49A 1XO2B 3KRJA 5E7RA 5I0BA 4AAAA 3KRRA 4FKJA 5M4IA 3F2NA 4OUCA 4X7QA 3R8VA 2ZM3A 5IKWA 3VS7A 4AZWA 1J1CA 4PWNA 3UGCA 2CN5A 2OGVA 3HV4A 3L9NA 3POOA 3AC2A 3SOCA 2YWVA 3EQCA 2V22A 2YM7A 4PTEA 4KUJA 4BB4A 3CP9A 2BKKA 3WF5A 4U9AA 2YM3A 3AT3A 2NPQA 2ETRA 2UW5A 4EQCA 4HVHA 2F4JA 2X6DA 3TV4A 4QP6A 4BDGA 5B2MA 3KREA 2WIPA 5J79A 4FSZA 3FEGA 1YHWA 2I1MA 2R3RA 2GNHA 2YCSA 3U9NA 2YDIA 4J95A 4EQUA 3P0MA 2ZDUA 3BU5A 3ZM4A 3SXFA 3ZZWA 4BRXA 3U55A 4HYSA 3ZO1A 1WBVA 3PDTA 3F61A 4FR4A 5KMJA 1JVPP 2GTMA 5HHWA 4EK6A 5I9XA 5KMKA 3E7VA 1RW8A 4FKSA 3WI6A 2Z7LA 4IHPA 3PLSA 3LIJA 3RK7A 5DLSA 1PW2A 2CPKE 5AX3A 3Q4CA 1IA9A 2CKOA 2GHMA 5T3QA 3QTWA 5DA3A 3ANQA 5KZIA 4A4LA 2YJRA 3NUSA 5FQDC 4R7IA 3WZJA 3PP1A 4IVCA 5IQBA 4X3FA 3COIA 2XH5A 4BBMA 4UMUA 1H24A 3QFVA 2J0IA 3EOCA 1B39A 3LCOA 2DQ7X 4FV8A 4MBIA 4ZJIA 1GIIA 4O96A 3EKNA 2QOBA 5L2SA 5LOHA 3LCKA 2OXYA 4OAUC 2Q83A 3DT1A 5ANOA 5BVWA 4MF0A 3U8WA 1Q8ZA 3UC3A 2QODA 2VO0A 3GU6A 4ID7A 5G1XA 1E1VA 1XWSA 2ITPA 4JG7A 4BGQA 5CNNA 4OGRA 4RPVA 1UU3A 1GOLA 4BZNA 3RNIA 3ACKA 5DE2A 3QTIA 5E1SA 3I5ZA 5FLFA 5B2KA 3FZSA 3JY9A 1GJOA 2BRNA 3QTSA 4EK8A 3IS5A 4IB1A 2ESMA 4UB7A 2JDOA 3BHTA 4PL4A 1P14A 5CXHA 4MHAA 4AGDA 2XCHA 3ROYA 4UZHA 1PXPA 5IA5A 3SD0A 3A7HA 5AUTA 5AP4A 5KMIA 3G90X 3E88A 4KABA 3W10A 1GY3A 1YI3A 5GINE 4NM7A 1YKRA 4IAFA 4WRGA 4ALWA 1M17A 2QG7A 4F6WA 2W5BA 4DGGA 5GZ8A 4O86A 5EDPA 1MRVA 4ZJVA 3QA0A 4AX8A 5IUIA 5BNJA 1XBAA 3G5DA 2OJ9A 4A9YA 2V0DA 4LQMA 2Y4IB 3FLSA 3F5XA 3KF7A 4BDEA 4DEAA 3CTHA 3HA8A 2XNOA 5EHYA 2ZV7A 3EQPA 3SRVB 3CLYA 2P2IA 2X9EA 3IO7A 3KXHA 3L9MA 4CT2A 5HTIA 4QT1A 2ITZA 3PFQA 2HOGA 3COKA 2FVDA 3HP2A 4KBCA 4D5HA 4IAZA 4O7YA 3RZFA 4GSBA 3KK9A 4M68A 4O7WA 4M0YA 1PF8A 1H25A 3QC9A 4AG8A 2J6MA 2XYNA 3GEQA 2IN6A 3ZMMA 5GNKA 4BGHA 2UZDA 3BLQA 2R3FA 2UV2A 2YIQA 3RPOA 3SA0A 3UZTA 3W33A 4RQVA 4XG2A 5CI7A 3JS2A 4L52A 3FZRA 3OY1A 1UNLA 3F7ZA 4BYIA 3FI2A 4CZTA 2UZNA 2C6DA 5IUHA 4FIFA 2XMYA 4IX3A 4LMUA 4BIEA 3CSVA 3C4EA 2VRXA 3Q96A 3WYXA 3T3UA 2VTRA 4EH4A 2WEVA 4C4JA 4GK4A 5JFWA 4I6HA 4L00A 2BRBA 2UW8A 3FLQA 1PJKA 3R83A 5IEYA 1YDTE 2QLUA 5EM8A 3VBQA 4O0SA 5HX8A 4JG6A 3RAIA 4QMZA 5HZNA 2HENA 3GXLA 3TNIA 4ZEGA 1ZOHA 3I7CA 3GCUA 5FDPA 3UP7A 5HCZA 1U59A 3UOLA 5LVOA 4QMMA 5CAPA 3RWPA 3W2OA 5HVKA 5KE0A 5J1WA 1OL5A 5I3OA 5CSXA 3SC1A 3ZEWA 2A27A 2JIIA 4A7CA 2ACXA 1LR4A 4CGAA 4FI1A 4O1OA 4O91A 4TNDA 3QBNA 1T45A 2ITVA 4M14A 5FTQA 5L2QA 4H3QA 4O0TA 2PZIA 3P79A 2BDWA 4M7IA 3RKBA 4C34A 3F3ZA 1UWJA 2UZVA 2VX1A 3HV7A 4Y95A 3R7OA 2YISA 4ENXA 4E6AA 4IDVA 3HRBA 3OXIA 3VBWA 2QOQA 1URWA 2W1GA 2RFSA 4UWYA 1ZY5A 5FGKA 3SDJA 4CLIA 1W7HA 2JDVA 1TQPA 3MH1A 1H0VA 2Z7SA 2XIYA 3EN6A 3SAYA 3HAVA 1SNXA 4L44A 5I9YA 4XBUA 1ZZ2A 3MH2A 4IWOA 2BTSA 2WMWA 5CEIA 3CGOA 3D5WA 3ACJA 3NCZA 4MK0A 2Z7RA 4OTRA 3CKXA 4DGNA 3TKHA 1V0PA 4B8MA 4WKQA 3R63A 1Y57A 3NNUA 5C27A 5EDQA 4FE2A 2EUFB 2W05A 2XF0A 4IM3A 4B7TA 5M4UA 1XHAA 3TG1A 4EWHA 4QQ5A 3H0YA 4DT9A 4FIGA 4ASXA 4EEVA 4DITA 2ZM4A 3BKBA 4F6SA 4AZVA 2PUPA 2B9FA 4LUEA 5C9CA 2C3LA 4LGHA 1JBPE 3PJCA 4P90A 1V1KA 4RIOA 5HNGA 5JFSA 4NYEA 4O81A 4KIPA 2WB8A 3KXGA 2REIA 3WIGA 4AQCA 3UNKA 3K54A 2O2UA 4RJ5A 4FTNA 3GFWA 4KSQA 3V5WA 4G3EA 3NNWA 4IAIA 4HZRA 3V5JA 3ZFYA 2PE2A 3M11A 3OOMA 2VWYA 3TL8A 5FEDA 3E3BX 2W06A 3JUHA 5AP0A 2PTKA 3G0FA 4RFZA 3ZU7A 3DBDA 4AE6A 3MY0A 4NU1A 3KY2A 2JIVA 2BIKB 3V6SA 3RNYA 4BY9E 5M56A 4S34A 3P23A 2JDSA 3ORIA 2IVSA 4GKIA 4BI0A 3DAKA 2XNEA 3MIAA 5CVGA 3WZDA 3DJ6A 4C8BA 2W9FB 4KBAA 3CD3A 5HG5A 4AA5A 5D7VA 2J2IB 2UVXA 3IK3A 4DG3E 5DR9A 4FZ7A 3ATTA 2W4OA 4ONAA 3PJ8A 5D41A 4BDHA 5KCVA 4BN1A 5M55A 3AD5A 3L9PA 2G2HA 4CNHA 3MPAA 3R7GA 4KD1A 5J8IA 3QYWA 1DS5A 2YAKA 2R9SA 4QRCA 3UMXA 4BYJA 4MQ1A 4CEGA 2BZIB 2C30A 3VULA 4QNAA 3SXSA 3UVPA 1IAJA 3R00A 4FTKA 3HV3A 3P9JA 5D7AA 4CSVA 2XNMA 5IQIA 5M4CA 1MUOA 2X4FA 3UJGA 2QHMA 3UYSA 5HE2A 2WMUA 4WD5A 2UW4A 3FMLA 4FODA 2HW7A 5FD2A 4BFMA 5BVKA 3S00A 1ZRZA 4O0XA 5AJQA 4AT5A 1EH4A 4UEUA 3ZC6A 3I6WA 1ERKA 3HMNA 5CEQA 3EQGA 4QMNA 2BHHA 2AYPA 4JLCA 4B8LA 1OKVA 1QMZA 4JBOA 3EZRA 3Q60A 2R3HA 2PMIA 3ZRLA 3OBJA 4U42A 5FXSA 1R0EA 3BV2A 5FDXA 3DXNA 4BCKA 3VC4A 4I94A 4F70A 1NXKA 4QPAA 3D14A 5E90A 3Q9XA 4I4EA 3R01A 1YDRE 5B0XA 4FL1A 3AGMA 1FMKA 2RFNA 4A9SA 2CNUA 1FBNA 3DBCA 4O2ZA 3RPVA 4BDDA 4WRSA 2OF4A 3DTCA 2X8EA 4GK3A 5JH6A 3SGCA 3KXZA 4K33A 3K5UA 2B9JA 4MQ2A 3FI4A 2A4LA 2IZSA 3Q32A 4G3FA 2JAMA 3HL7A 3P1AA 4P5QA 5CVFA 2ETMA 2YAAA 4DFNA 2PZPA 4FX3A 4TYHA 2YM5A 4HNFA 4PMMA 3TZ7A 4AN2A 3BHHA 4BCIA 2W0JA 4QP7A 4E93A 3F2AA 4G34A 4IACA 4LOPA 5C4LA 2JBOA 3MFRA 3HRFA 1U5QA 4L53A 4YJNA 2PUUA 2QG5A 4OTHA 1OUYA 2QNJA 4TT7A 4MD9E 4C2VA 4H3PA 4WNKA 5H8EA 1YOLA 4I93A 3NYVA 5JZNA 4QP9A 1Z57A 3MTFA 3NW7A 4LMNA 4DLIA 3DKCA 3M1SA 4BDJA 4BCHA 1ZYJA 3ENHA 4ZMFA 3QXOA 3CR0A 4QYFA 3DNDA 3H9RA 2XM9A 2E9OA 3F82A 2HW6A 3FC1X 3VBYA 3S95A 4AZTA 2BDJA 4FTAA 4E7WA 5DH3A 2WTJA 2BAQA 4GH2A 4QP1A 4FNWA 2WQEA 5L6OA 4J53A 3SG8A 1GNGA 5EW8A 3AXWA 1CDKA 3QQHA 3V6RA 3ERKA 2XCKA 3C13A 5HVYA 3DA6A 5AP3A 2VGOA 3CQEA 2UW0A 5ANDA 4A9TA 3IW6A 4CV8A 3MV5A 3ZO3A 5DR2A 4FKQA 3TEIA 4HVIA 2WHBA 4UWBA 4GEOA 4AWIA 5TE0A 3PA5A 3UZPA 4D4RA 5HE3A 3LFNA 3ORMA 4E26A 2QOOA 4RLLA 1UA2A 3K3JA 3OCGA 3JYAA 3QTUA 2NO3A 1XH6A 4NWMA 5DN3A 4G2FA 3EWHA 2CSNA 1IA8A 3HNGA 3LFQA 1SVGA 4I6BA 3RWQA 2XIKA 4ANMA 4C61A 4XG6A 1PXMA 5EHLA 5LMAA 5J1VA 2WU7A 3LLTA 4IAYA 4GYGA 5CF8A 4QMLA 1YQJA 4CV9A 4O7SA 4FV3A 4K18A 5HVJA 4FKPA 2J7TA 2YA9A 1ZLTA 3IOKA 5CZIA 5H3QA 3Q4UA 2ERKA 4H39A 1KOBA 4JR3A 1OBGA 3KK8A 4RX9A 3RAKA 3ZXZA 1ZMVA 3UO5A 3BV3A 2WO6A 4FG7A 3V01A 3PJ2A 3DK6A 3MPMA 4GIHA 5GZ9A 1GZOA 5JFVA 2A1AB 3HMIA 4YTIA 3BU6A 4CMTA 5CF5A 2O5KA 2VN9A 2LGCA 3BELA 3R6XA 4X2FA 4XG3A 3UMWA 3ZLYA 1H08A 3EYHA 3R02A 5EM6A 4EOKA 3F3TA 4G3CA 2J0MB 3QU0A 4JXFA 1UKHA 4YJOA 4BDAA 4E6QA 2I7QA 1VJYA 4BICA 5KBQA 3POZA 4FTLA 5JRQA 3NR9A 5HIBA 2ZAZA 4XOYA 4QMVA 3FUPA 2KULA 5K0KA 3DZOA 4G3DA 5CSPA 1KE6A 4IADA 2CGXA 2FB8A 1QCFA 3NSZA 2XIXA 4PPAA 4UV0A 3TTIA 4ZZOA 2OG8A 2VTQA 3R8LA 4K0YA 3H9OA 2X7GA 5E8WA 2WMTA 5CT7A 4LRJA 2J51A 5CSWA 5TKDA 3CGFA 3TJCA 2PHKA 2F2CB 5LMKC 3ZZEA 4L67A 3FZPA 2ITNA 4N6YA 5AUYA 4DEDA 4GVJA 1Q8WA 3EL8A 3G6HA 3F6XA 2OZOA 3ANRA 1Q4LA 2ZV8A 5EI2A 5HKMA 1Q24A 5EKOA 4DTKA 3BWFA 4CKRA 1Q8UA 3R22A 4BBEA 2XK8A 3BHVA 4NKAA 5KBRA 1WBWA 2UVYA 5L8KA 2OJJA 5I4NA 1RE8A 5IEXA 2VWWA 4P2KA 1DAYA 3PPZA 5JGBA 2XJ0A 3PVGA 4QP4A 1RQQA 3CTQA 4J8MA 4GRBA 5EI8A 4WUNA 1VEBA 5BUIA 4FTJA 3CY3A 2YIRA 3VJNA 4BR3A 4ZOGA 1F3MC 1K3AA 3GU5A 3NUXA 2XKFA 3IDBA 5IDNA 3QD4A 3I6UA 2ZOQA 3EH9A 4PDPA 4RVTA 3PXZA 4F7SA 4UN0C 2OWBA 1YDSE 2R2PA 5HBHA 4AGCA 5AV4A 4I22A 1UU7A 5ETFA 4DFBA 3QYZA 1PHKA 3EQBA 3KFAA 4IXPA 4JVGA 2BPMA 4RIYA 5AUVA 4AFJA 4JQ7A 2BCJA 2YABA 3IGOA 4EK3A 2PPQA 1PMEA 1Q41A 4FG9A 4YTFA 4C3PA 3GVUA 3B2WA 5LWNA 1H1RA 4YBJA 4YC6A 3QLGA 2C6TA 3BGPA 1R39A 3UOJA 4YPDA 2VX3A 2UW9A 3DBQA 2FGIA 4S30A 3TKIA 1LUFA 4FZ6A 2GTNA 3S1HA 1CKJA 3COMA 3PRIA 2VUWA 5AUZA 3SW4A 1PXIA 2WQNA 5FBOA 2BAJA 1YWVA 2GNIA 2JBPA 3UDBA 2WTIA 4N6ZA 2FH9A 3VW8A 5HG9A 1T46A 3FL5A 3FPMA 1RDQE 3LAUA 4TN6A 2I0VA 5HI2A 3C50A 2HAKA 5HESA 2WEIA 2AC3A 3N9XA 3OTVA 4LYNA 4E20A 1U4DA 2A19B 2W1FA 5M09A 1L3RE 4I21A 5HLNA 4UYNA 3SXRA 3WZUA 3H3CA 4O0RA 5LQFA 4OTGA 4FZDB 4BKYA 2WZJA 2C6LA 4JDJA 4CRSA 2VTSA 2W1EA 3PSDA 4RZWA 4D2WA 5CALA 5BYLA 3R9RA 4OW8A 2IVVA 2YFXA 4C2WA 3BYOA 4TWNA 2WTWA 1NA7A 5LWMA 5E8XA 5JZJA 4BDKA 5E8YA 4FSRA 5AMNA 4IW0A 4XP0A 3FZOA 3TNWA 4HVSA 3OWLA 4R5SA 2H96A 3OTUA 1NVSA 4MXZA 4EJNA 4TKSA 3N4UA 2YIYA 5JN2A 1Q3WA 4JBVA 2Z8CA 3BHUA 4PV0A 2ZDTA 3P08A 5HU3A 3FMMA 4YJVA 5J9YA 2GHGA 2PE1A 3W2CA 3ENMA 4UZDA 4ALUA 2VTAA 5IH5A 4ORKA 3DKFA 3HDMA 4FZFB 4PL5A 4BF2A 4AZFA 3EKKA 4FOBA 2OW3A 3VS3A 3LJ2A 4RVMA 3ZDUA 4IZ5A 3LM0A 3TCPA 4PMPA 4DC2A 2VTJA 4WSYA 4L43A 1OIQA 3O7LD 4I24A 3QHRA 1X8BA 3NDMA 3S2PA 2B55A 2CGVA 4Y73A 1XH5A 3ETAA 4BWKA 3IDPA 2WTDA 4XOZA 1Q5KA 3B8QA 1WMKA 4EOJA 2OJIA 4U79A 1JOWB 3LQ5A 2WOTA 5AAEA 2JIUA 2V62A 3FL4A 3M42A 4GK2A 1OGUA 2QOLA 3QCXA 4H36A 5LMKA 3GCVA 3TXOA 3UZRA 3PRFA 4FKRA 2GNJA 2VNYA 4GJ3A 4X0MA 3UQGA 2GFCA 2UZUE 4QPSA 4O38A 3E92A 2OIDA 3QUDA 2YDJA 4BGGA 3KGAA 3FWQA 1AGWA 3DK3A 4TWPA 3RK9A 4AW2A 4BZOA 5H9BA 1J7LA 3TM0A 3CIKA 5HD7A 5HGIA 2C6EA 3D2KA 4D9UA 4IVDA 3G9NA 2JDTA 2QURA 1LEZA 4TYJA 3W55A 4EBWA 3B8RA 3HMOA 3QL8A 3P7AA 3FSFA 4CFNA 5CTPA 4GJ2A 4I5HA 4YLLA 4ITHA 3IW5A 3MH0A 4XUFA 3RVGA 3EZVA 2B0QA 3PE1A 3W2QA 5EG3A 4FV0A 3MWUA 2HZ0A 3NIZA 4OTQA 5AM6A 4XRLA 2OIQA 4NM0A 5HCXA 4F1TA 2OJGA 2Y8OA 3BGQA 4U43A 3R9OA 4APCA 5GZAA 2Y9QA 3H4JA 3UODA 2PZRA 3ZONA 5L3AA 4QPMA 2GQRA 4FT5A 3C7QA 4NUSA 2J9MA 5DT0A 2EXMA 3QZHA 3Q2JA 4IC8A 4A06A 3IW7A 3OT8A 3DAEA 3UE4A 2W99B 5BX0A 2ITTA 3MVJA 3NW6A 2YWPA 3OXZA 4LRKA 5ANKA 5TT7A 4WIHA 3V3VA 2R3KA 1PKGA 3OBGA 3LXNA 4TZRA 3TWJA 4IJ9A 3O8UA 2VTNA 3V5TA 2W1HA 3KEXA 4X2NA 4A4XA 4U80A 3ORNA 4O27B 4UMTA 3OW3A 4FT0A 4O22A 4UXLA 4XHKB 4FL2A 4UY9A 3EFJA 3FI3A 5HTCA 3LCDA 4BCFA 3I7BA 2W1IA 2C4GA 3EFKA 3I0QA 2QONA 2XEYA 3OCSA 4D4YA 2ITYA 4EH3A 2RG5A 3OWKA 5FXQA 4WHZA 4F7NA 4CD0A 3GGFA 5LCJA 3UNZA 3VW6A 4Y72A 3BE9A 2VU3A 3RMFA 2O0UA 2BKZA 4JQEA 5E4HA 3KULA 3I79A 3RHXA 3ZUTA 3BYUA 2JKOA 3FHRA 3Q4ZA 4YZMA 4E73A 4QTBA 4EHEA 3SW7A 3GCQA 3UVQA 4UMQA 4FKLA 4YP8A 4XH6A 4YSMA 3IW4A 4QMWA 2BZKB 3R7EA 3V5QA 4F9CA 3JXWA 4YJUA 2R3LA 5F95A 4FVQA 2YM6A 5HQ0A 3VAPA 4DEGA 1S9JA 2CCIA 4WG4A 4J96A 4D58A 2VZ6A 2J5EA 2ITXA 2DYLA 2PVYA 5FP6A 2ZVAA 3ZRMA 4FTIA 4IE9A 4MKCA 1FGKA 3VS5A 3LXLA 5J95A 2X6EA 1DAWA 1SVEA 5KMOA 3MB7A 3OY3A 3JPVA 2J5FA 5L8JA 4ZIMA 5AX9A 3KC3A 2UUEA 4EC9A 4DFUA 4G6OA 4M66A 4K11A 3BYVA 4J7BA 3F3VA 5TF9A 4FEUA 5KKRC 4MCVA 3CD8A 4WO5A 5BYYA 3FZ1A 5K9IA 5A3XA 2W96B 4EOSA 3U6JA 1L8TA 4BI1A 5AR5A 3DZQA 4Q9SA 3GQIA 1TQMA 4ANBA 3JVSA 5F20A 3EN4A 4QMUA 1G3NA 4M12A 2XKCA 3R04A 2XK6A 1F0QA 2B9IA 3FKNA 4I3ZA 4KIQA 3TIYA 4BCOA 4C4IA 2XKDA 4AF3A 2PZYA 2RIOA 2PVNA 2BMCA 3EN5A 4FV1A 4CMUA 5K3YA 3PY1A 2R3JA 1QPDA 3UBDA 2WMRA 3ELJA 5EW3A 4EHGA 5A9UA 3RBWA 3L1SA 4XV1A 1APME 5CASA 2CNQA 4JT3A 4ZS4A 2X8DA 4KRCA 3BPRA 2F7EE 2QCSA 3IECA 4XG7A 5E92A 1PXLA 4PDOA 3H30A 5HX6A 4RX8A 3MN3A 4O7RA 4GFOA 5C8NA 4E5AX 3UPZA 1R3CA 3OUKA 3A8XA 4X3JA 5HIDA 5ACBC 4FG8A 5D12A 1CKPA 5DR6A 2XK4A 3TJDA 2R5TA 3G2FA 4F63A 2QO7A 3PY3A 3R73A 4I5CA 3LXKA 3DJ7A 4TYHB 2XNNA 5L2WA 4C4HA 5DGZA 4ZTRA 3FMEA 4RIXB 5ETCA 5JQ5A 4FT7A 2P4IA 4C57A 3T9TA 1YXVA 4BZDA 2XK7A 4EOOA 5EKNA 1KV1A 4HZSA 1NVQA 1PYXA 5TR6A 3R28A 5ITAA 4PDYA 3EB0A 4M13A 4MD7E 3IW8A 3Q52A 1KE7A 4F9YA 5CU6A 5L4QA 2JLDA 3QLFA 4O0YA 4HCVA 3H0ZA 3VO3A 4QTEA 3DS6A 3GI3A 3DGKA 1PMNA 3F5UA 5L8LA 3LKMA 3MY1A 2JITA 3Q6WA 2YCRA 3UO6A 5IA0A 5JGAA 4AOJA 4X6RA 5IH4A 1GZ8A 3FQSA 4YZCA 2JKMA 2XK9A 2XEZA 3FZTA 4S31A 4XYFA 2C6MA 5E8UA 4ZK5A 4KA3A 3VBTA 1H1PA 3W8QA 3ZSGA 4OBOA 3P5KA 5AAFA 4YZ9A 2IZTA 1JSUA 5ETAA 3RAWA 2R3GA 2W1ZA 4FEVA 3GC9A 2B4SB 3H9FA 4JL9A 4DH5A 2BUJA 4DT8A 4E4NA 4IFGA 4GKHA 3UIXA 2JKKA 3QCSA 1OPJA 1YXTA 3ALNA 3PXRA 4GYIA 2PVKA 4KBKA 3Q9YA 3NMUF 1JQHA 4F0FA 4UBAA 4GG7A 2AUHA 3VQHA 2VTIA 2ZMDA 3OCBA 4O1PA 4IWDA 3FXXA 2J4ZA 4BBFA 4YJQA 3L8PA 2BRGA 5FM3A 2BFXA 4U0IA 2NNWB 2P0CA 2Q0NA 4QMOA 3PVUA 2QU5A 1H8FA 4J99A 4D9TA 3ORPA 5CY3A 4ASDA 2F9GA 5DIAA 3LFDA 1YWNA 2PY3A 3QZIA 3R71A 2JC6A 3CXWA 3BQCA 2XS0A 5IH6A 2BR1A 3WE8A 4XV2A 4V01A 4QO9A 5H8GA 3TV7A 2YLFA 3NUNA 2B53A 4BWXA 3MY5A 4JS8A 4FBXA 4LM5A 3GP0A 4L01A 4NW6A 4IANA 4AXAA 4YZBA 3DK7A 3GOKA 5GJGA 2I6LA 5FP5A 1K9AA 4U41A 1YOMA 2ZM1A 4LV8A 4WUAA 3HKOA 4MXCA 3C4ZA 4UXQA 1BL7A 4FSWA 1BMKA 2C0TA 4ZJJA 3R30A 3ZFXA 4U40A 2C69A 2H8HA 4YLJA 3DBEA 4B99A 1XH8A 3CBLA 2CJMA 4G16A 2H9VA 3KN6A 3O23A 4PMSA 3VN9A 3WZKA 5I9ZA 5TO8A 4LV5A 4JI9A 5HOAA 3RM6A 1ZYSA 2EVAA 4QD6A 4QQJA 3MW1A 2IZRA 3UPXA 4C7TA 4CFVA 2VWUA 3PVWA 4UWCA 2C5VA 5DBXA 3E63A 4F4PA 3LCSA 4YR8A 1BI7A 4IBMA 3R7UA 3S0OA 5K0XA 3SKCA 5LCKA 2XBJA 1ZOEA 2NRUA 2C1BA 2OXDA 3C1XA 2X2MA 1JNKA 4APPA 4BTMA 2A0CX 4EKLA 2J0JA 2HY0A 3AC1A 3GCPA 4DN5A 1OKYA 3WE4A 4F64A 1YHVA 4USDA 4MXAA 2QKRA 3BIZA 4GV1A 4NSTA 3EFWA 4MEDA 3O2MA 5BPYA 3ZRKA 1G5SA 3KB7A 4F9AA 3Q04A 4FV2A 3DPKA 2V7AA 4RT7A 4I0SA 3LJ0A 3SHEA 4XP3A 2JFLA 3VBVA 4BTKA 5BUEA 5EYKA 5I9VA 3F3UA 4D0XA 1YHSA 3KRWA 4HVDA 4AOIA 5CU2A 1O6LA 3LCTA 4JAJA 5M06A 3HUBA 3IQ7A 3C51A 4FSMA 4KAOA 3DV3A 1XR1A 2OK1A 2WAJA 3ZXTA 4DGMA 1O9UA 3KRLA 5EDRA 5IISA 1YVJA 3EQRA 5FXRA 4O6EA 1KOAA 3NNXA 4EBVA 4X2KA 5EFQA 3PJ3A 2C5YA 5B7VA 4MBLA 5EOLA 4CVAA 4ENYA 2VTOA 4R1VA 5C26A 3ORXA 3UG2A 3HYHA 5HE1A 1WVWA 2OF2A 3GQLA 3BE2A 4GUBA 4E5WA 4CQEA 1IAHA 4RIYB 5DHJA 3KMWA 5DPVA 1CMKE 2ZB1A 3LFAA 4UYAA 5AA8A 2YERA 4EH7A 3GNIB 1Q3DA 2ONLC 3FXWA 1SM2A 1WBTA 2HWPA 3NAYA 4E3CA 2HCKA 2F2UA 5A4EA 5FTGA 3T3VA 4FF8A 3WZEA 3O8TA 3D94A 5H8BA 2WFYA 3QGWA 5CT0A 1REJA 3QRJA 4JR7A 1JKLA 1OB3A 3EYGA 2WTVA 3WARA 2BHEA 2G2IA 3FMHA 4YJTA 2C3IB 5HE0A 4XG8A 4E4MA 3DFCB 3PP0A 4DHFA 3R1QA 3CEKA 1H1WA 1AD5A 4TRLA 4DG2E 4F08A 2W1CA 4JBPA 4MYGA 5CSVA 5IZFA 3RPSA 3ODYX 2ZV9A 3O7LB 5GIOE 5I3RA 2C0OA 4GFGA 5HBJA 5KHXA 3U6HA 5C01A 1BL6A 1W98A 4UALA 4F1MA 3FJQE 5KX8A 5GJFA 3R2BA 3QRTA 2UW7A 1MRYA 5IA2A 4YURA 3BBTB 5ICPA 1O6YA 3UC4A 2WXVA 3CE3A 5J7BA 2XYUA 1GZKA 3O51A 1GZNA 4HGLA 2CKPA 5IF1A 3C0IA 1M2RA 1W82A 2GS2A 2WPAA 3PG3A 4EWQA 3OZ6A 4D28A 4CKJA 1UV5A 4GCJA 3TZ9A 3ZM9A 3REPA 3AMYA 4S32A 3C9WA 4EH5A 3ODZX 3QGYA 3Q53A 4DH1A 4W4WA 4WT6A 2CLXA 2XUUA 4UMPA 5KMLA 3QUEA 2NRYA 4RIXA 3MVMA 3ORKA 2RF9A 5IMEA 4O84A 4NKSA 2GS7A 3RALA 1A9UA 3GU7A 4M15A 4FV5A 3RTPA 4J1RA 2EXEA 3KRXA 5DNRA 5CAVA 4EZ5A 5IU2A 2WMXA 4IM0A 4GT5A 1UWHA 3DXQA 5I9UA 2E9VA 5HNIX 4FTMA 4XMOA 4IWPA 3ZO4A 4BCQA 3SV0A 4IIRA 5T68A 4OT6A 4C4EA 3OOGA 5DEYA 5LVMA 2VWIA 1W84A 4QQTA 4DFYA 5DT4A 5AA9A 3OFMA 5IA1A 2ZV2A 2UZOA 3A7JA 3I60A 2OICA 3I4BA 4NCTC 4B4LA 3UOKA 4TWOA 3ZOSA 3E87A 4D2SA 2G2FA 3R21A 4EH2A 3RHKA 3MGYA 2X8IA 3PSBA 2R0IA 4BCNA 4CZUA 3HAMA 5IQEA 4QYYA 4AW0A 3GT8A 2HK5A 3FKOA 4W4YA 4ASZA 3LHJA 4DF3A 3QWJA 3AC5A 5IDPA 1M14A 4F0IA 2VD5A 3FLWA 3LZBA 5A4QA 4ACDA 3AD4A 3C4FA 3NYXA 3WBLA 5L2IA 4QP8A 1PXOA 3BX5A 4ZTHA 3HX4A 2R3QA 3U4WA 4EOMA 1G8SA 2UZWE 3LVPA 5BQ0A 3EQDA 3GENA 3NYOA 2FSLX 3V8WA 1JKKA 3VRYA 2Y4PA 4JQ8A 4K2RA 4OBQA 2R3OA 3HMPA 4EL9A 2IG7A 5A4LA 2RKUA 3DXPA 3MSSA 1TVOA 1TQIA 2HY81 3SLSA 3L8XA 5HBEA 4K9YA 5AP6A 3EIDA 3PIXA 4RX7A 1OIRA 4W8DA 4DFXE 2R4BA 3MS9A 4HYUA 4ZTQA 3PVBA 3NUYA 4KRDA 2FSMX 3QZFA 3TNPC 4U3ZA 3U87A 4ZTNA 3QRKA 2E9PA 4FKIA 5A6OA 4ERWA 4RSSA 4MXYA 4CFXA 4OTFA 2WTKC 3QQLA 1J7IA 1JLUE 1UNGA 5E8ZA 4BCJA 4R7HA 5HO7A 3PPJA 3OG7A 3QUPA 3W16A 1IASA 3O8PA 3OWPA 3I5NA 3DU8A 3FBVA 4F99A 2PWLA 2YZAA 5HICA 1UNHA 5DYJA 3AMAA 4Y8DA 2QLQA 2VO6A 3TUDA 4AE9A 2ZYBA 3PZHA 2YIXA 4EJ7A 3KKVA 4XJ0A 4YJSA 4Q9ZA 5C8MA 5CEPA 4ACHA 4EH8A 2XB7A 2RGPA 2IW8A 1WBSA 4U44A 4RIWB 2C68A 1MQ4A 4FSNA 3F5GA 5E1EA 2VX0A 5A4CA 4FV6A 3FDNA 1Q99A 4IDTA 2PE0A 5CNOA 1ZARA 4CG8A 4ITJA 1BKXA 2QOIA 3KXNA 3UP2A 2VAGA 4Y83A 5FUTA 1Q97A 4ZSAA 2QHNA 4FUYA 1QL6A 4HJOA 2JD5A 2RSVA 5HLWA 5JSMA 4IWQA 4FNZA 4AT4A 2VO3A 5BMMA 4DAWA 1PY5A 3GC0A 3MA6A 2ITWA 4Y46A 4Z16A 3FE3A 4ALVA 3D7ZA 5KMMA 3GCSA 2VGPA 3MB6A 4IZAA 4YUQA 1Q61A 4IM2A 1SMHA 2PMLX 1YXSA 3KULB 4DA5A 5DOSA 3ORLA 5HEZA 2J0LA 1Q8YA 3V51A 5EOBA 1WAKA 5J7HA 4FKWA 3R1NA 4KKGA 3E93A 2NP8A 4IZ7A 5I9WA 4I1ZA 1GIJA 4FZAB 5L6WL 4HOKA 2ERZE 4YHTA 3TT0A 2GPHA 4EC8A 4TWCA 4WOVA 3CJFA 5JK3A 3WF7A 3DJ5A 4TTHB 2UW3A 4YHJA 3C4XA 4IB0A 1CSNA 4MH7A 4K8AA 4R3RA 2HIWA 1OIUA 3KA0A 3OCTA 1I44A 1YOJA 3LOKA 3Q2MA 5FTOA 5G6VA 4OR5A 2C5OA 2UZLA 3BRBA 4JIAA 3UIUA 4A4OA 4DFZE 2C6KA 3NIEA 5J9LA 1IEPA 4UMRA 1PRYA 3NWWA 4WSQA 3DFAA 3UG1A 4TL0A 1TKIA 4G5PA 3V04A 4DTAA 2YACA 4FTTA 4L8MA 2YZLA 1WCCA 2JAVA 4C3FA 3DB8A 4IZYA 5M57A 5KMNA 2FUMA 4BL1A 3A7FA 3NZ0A 5EYMA 3WF6A 1OECA 4XRJA 3I81A 4R3PA 4RWIA 1FOTA 3UQFA 4YSJA 2BILB 3W8LA 2RL5A 3KCKA 4CCUA 4R3CA 4YTCA 2OKRA 5EW9A 2PL0A 3KF4A 1U46A 4QYGA 2W17A 2JDRA 3LFCA 4WNMA 2XRWA 4M67A 2EU9A 2QOHA 3C4CA 4NT4A 4X2GA 4FSQA 4CQGA 4N70A 1KV2A 4ASEA 3NCGA 3D9VA 2OH4A 4I92A 4V05A 4I6FA 2WMSA 4ZMEA 2ITOA 4ZSEA 4RRVA 5J87A 5AWMA 3GBZA 2HYYA 3D7TB 4U97A 2ITQA 1OKWA 3R9HA 4ZSLA 3FSKA 2CKQA 5FBNC 3KL8A 3THBA 4C33A 1WBOA 2GCDA 3FC2A 2HXQA 4FICA 5IQGA 2EXCX 4EOLA 4FGRA 3ZYAA 4ACMA 2Z2WA 4RLKA 3I0OA 3N51A 3TUBA 4K77A 3SVVA 4J52A 3KMUA 1VYWA 2GDOA 4FYNA 4I5MA 3K5VA 4A9UA 4G3GA 1Z5MA 1M2QA 2VTTA 1NT2A 4USFA 3MFUA 5ANEA 3VS2A 5A46A 3EN7A 1SNUA 3R8PA 4F09A 4F7JA 5JGDA 1Q62A 5F94A 4KWPA 3PUPA 3RZBA 2QI8A 2YITA 1OITA 3FLYA 4PTCA 3AGLA 3F5PA 2GQGA 4YO4A 2WMQA 1H00A 4XP2A 1NY3A 4XV3A 3WYYA 5CAOA 3RINA 3SG9A 3ID6C 2E2BA 2XM8A 4H1MA 5CWZA 1JAMA 2P2HA 4FV9A 3CPCA 3S4QA 4CYIA 4O7LA 2W7XA 2PVMA 3TTJA 2YCQA 4J71A 5IQDA 3OXTA 3PTGA 3BLHA 2CMWA 2QD9A 4BC6A 2PULA 4F7LA 4FSYA 4X3FC 1B38A 2YN8A 2H34A 3Q4TA 3ZFMA 2XRUA 5J9ZA 3U51A 1FVVA 3C5UA 3MBLA 1WBPA 1P4OA 2OLCA 2UZTA 4DCAA 5K5XA 1MP8A 2R3PA 4CLJA 3B2TA 4BCPA 3LFFA 4QP3A 4YGAA 5FEEA 2G01A 5CU0A 1DM2A 3CY2A 4BDFA 2WGJA 5C03A 4FK3A 1ZYDA 1Y91A 5AIRA 5DWRA 4FOCA 5IA4A 4YHFA 4XX9A 1XKKA 4EYMA 4D2TA 1ZAOA 4LUDA 3GU8A 3U9CA 4AW1A 3EMGA 3FAAA 3UOHA 3C0HA 3KVXA 4X2JA 4I0TA 2PU8A 3VS4A 4C35A 2BZJA 5AP7A 1Z9XA 4D2VA 4FVRA 4EQMA 3VUTA 4EHVA 5IQAA 3WOWA 5CSHA 2C5NA 4V0GB 3EQHA 2VV9A 4ANSA 4DH8A 4BDBA 1OL6A 5AM7A 2W9ZB 5AUWA 3D5XA 1P5EA 5AUXA 3IOPA 4GW8A 3TV6A 3VS0A 3JR1A 3NVMB 3VWAA 5ANGA 4NZWB 3V5LA 3E8DA 2G1TA 4M97A 4RJ3A 4GIIA 3ZSIA 1A06A 2V55A 2X2KA 3K2LA 3MPTA 4AN3A 3MJ1A 4D2RA 5HU9A 1UU8A 5LVPA 4OTWA 1CTPE 2OBJA 4HCUA 5CYIA 4PMTA 3LMIA 3QWKA 3QALE 3PE2A 4RJ7A 4RGJA 2WD1A 1H01A 2W5AA 3EQIA 3UTOA 1PXNA 3HGKA 5KKRB 2PYWA 3RGFA 4Z3VA 3F3WA 5IPJA 4L68A 4ZTMA 5LVNA 3FY0A 2BDFA 1ZXEA 4LRMA 3TZ8A 3W2SA 4O7TA 3AOXA 3F88A 3A8WA 4D2PA 3G9LX 3RCJA 1VYZA 2ZJWA 4C4FA 5L6PA 4RIWA 2CGWA 4AOTA 2C3JA 2YJSA 1G8AA 1YXXA 3QD0A 5IA3A 3P4KA 3TACA 1SYKA 4S33A 3CCNA 2BRMA 1FVRA 1ZWSA 3FMKA 3O50A 4TW9A 3T9IA 4J8NA 4I5PA 4RA4A 3HZTA 4EI4A 2BIYA 5CAUA 3E5AA 4DLJA 1XBBA 4NJ3A 1BI8A 2WELA 5F9EA 4I6QA 3TZMA 4BTFA 3NUPA 2HZIA 3ZH8A 4O7ZA 2WQBA 4TYGA 3NGAA 4ZS0A 4O7VA 4XS2A 1P2AA 3AT4A 1LP4A 5M07A 1OBDA 4E8AA 2UZBA 5AP1A 2X9FA 3E8CA 1J91A 3MTLA 4KIKB 1OZ1A 1E9HA 1E1XA 2DS1A 3MFSA 3QF9A 5I5ZA 4NM5A 5EYCA 5A6NA 4OT5A 4S2ZA 4FIHA 1J1BA 5C1QB 2R3NA 3IG7A 4R77A 3D15A 3EJ1A 4IEBA 1YW2A 3QTXA 2EB2A 5F4NA 3A4OX 1BYGA 2ZB0A 3VF8A 4BDCA 3R8ZA 3HMMA 4RJ6A 3M2WA 2O64A 4YJPA 4O6LA 3PA3A 4QP2A 4QOXA 5BYZA 4C3RA 3GC8A 5LVLA 3GOPA 3HRCA 4DINA 3U4UA 3LW0A 2R0UA 1UKIA 3DKOA 3VIDA 2SRCA 3GB2A 4DEBA 4FTQA 3ALOA 2JEDA 2WOUA 3BLRA 4J98A 3SOAA 4LOQA 4IX4A 3FMDA 1WVYA 4TY1A 2X4ZA 1R78A 5BVFA 2JKQA 5LMBA 3KVWA 2CLQA 2OJFE 5AR4A 1H07A 2QOFA 1KWPA 1Q8TA 3NAXA 3DLZA 3LPBA 1NVRA 1JPAA 5EK7A 4EUUA 4G9CA 3OMVA 4Y5HA 2QC6A 5M53A 2BTRA 5E8SA 3D2IA 3UIMA 2Z60A 1SZMA 1GIHA 2VTPA 3A2CA 3V5PA 3ZBXA 5KO1A 4HPTE 4RBLA 4XNEA 4QNYA 4ERKA 1MQBA 1ZY4A 4ZZNA 2O65A 4I20A 1ZYLA 3FQHA 2OSCA 3PG1A 1IG1A 4JOAA 3R8MA 1PXJA 3G0EA 4BI2A 3F9NA 4C02A 3BU3A 4RC2A 1U54B 3CPBA 3DKGA 4Q5EA 4D55A 4RC4A 1H0WA 4C62A 1XJDA 2RFDA 3BWJA 1YI4A 4G5JA 3BHYA 4M3QA 4YC8A 5DFPA 5AP5A 1J3HA 1OKZA 1WZYA 3A61A 3D7TA 3FYJX 5BMSA 4IB5A 4XLVA 4AZEA 1REKA 2CHLA 2ZMCA 3IONA 2V7OA 3MH3A 4LOOA 2GSFA 3UVRA 3ZS5A 1KSWA 3RPRA 1KUTA 4K6ZA 4F65A 2RG6A 4HGTA 4YZDA 4KIOA 4BIDA 4JRVA 3NVKI 3Q6UA 4IX5A 5AADA 1M7NA 1PMUA 4LFIA 3QCQA 5JFXA 4OBPA 2YDKA 3FV8A 2G9XA 4PRJA 5BVOA 4D0WA 5CEMA 4FNYA 4ZZMA 1PXKA 3LFEA 4CCBA 3L9LA 4A9RA 4EH9A 4AGWA 1ZYCA 3QTRA 3LFBA 4FMQA 4WBBB 3NRMA 3DDPA 4L3PA 2WQOA 4M8TA 4RQKA 1OL7A 4U3YA 4L9IA 3GC7A 4RJ8A 2VTLA 3ZUVA 4MNFA 4E6DA 4PY1A 3Q3BA 2PVLA 4GT4A 2PSQA 4ANQA 2CN8A 4KKEA 4O2PA 3QTZA 4IQ6A 3DAJA 4PTGA 3HLLA 3LQ8A 4RFYA 4C59A 4H05A 4E4XA 3NUUA 4KS8A 1OPKA 3K3IA 3KCFA 2IPXA 5KNJA 3VUKA 4MAOA 5DMZA 2W4KA 3V8SA 2PUIA 3BYSA 4FSUA 5AV0A 3E64A 5M08A 4II5A 3ET7A 2XNGA 4Y85A 3RI1A 4N4SA 3CS9A 3NUAA 3QXPA 1NW1A 4WNPA 2I0HA 1YWRA 3KQ7A 3WILA 3ZLWA 2G15A 5BVEA 3O96A 3QQKA 2C5XA 4NIFB 1SVHA 4U6RA 4W9WA 3R7VA 3E7OA 3R8UA 3A7GA 4L7SA 2IVTA 4MWHA 3U6IA 3R9DA 2VWBA 2Y6MA 2GNGA 2WMVA 4DTBA 4FNXA 4FT3A 4XG4A 3TNHA 3EFLA 4EZ3A 3D83A 4YC3A 2WQMA 3NPCA 3ZLXA 4CTBA 4TYIA 4V0GA 3GFEA 2WKMA 3EQFA 1DI9A 3JVRA 3PWYA 1FPUA 4ITIA 4ACCA 2WMAA 2Y0AA 4O0WA 4DBNA 4HGSA 4ANNA 4PL3A 4FIJA 4DFLA 4H1JA 4GUEA 2GQSA 4CG9A 1STCE 2BALA 1JSTA 1VZOA 4FTCA 4WG3A 4DBXA 4XG9A 2Y4IC 3OUNB 3R0TA 3HEGA 1LPUA 4FKOA 3FKLA 3FLZA 3VUMA 1ZOGA 5CI6A 2XBAA 3ZC5A 4GL9A 4OTDA 3VS1A 3ZBFA 3PLAE 2R7BA 1YRPA 3UQCA 4ANLA 1YXUA 3SQQA 4ZY4A 4BDIA 4HVGA 4XBRA 4OAVB 3TDWA 4B6LA 5CANA 2IO6A 2P3GX 1PYEA 3AC8A 4HPUE 4F9WA 5FWKK 4QMYA 2BROA 5K4JA 4E6CA 1R1WA 2PVJA 2QOKA 1ZZLA 3LE6A 3QRIA 5KZ0A 1JKSA 3FHIA 4M0ZA 4QTDA 3FXZA 4X21A 3W1FA 5M51A 3DTWA 3EHAA 3G51A 2IZUA 2RFEA 3P7CA 3QKKA 4PNKA 4BTJA 3NLBA 4J97A 1HCKA 4FTUA 5A4TA 2LAVA 3F2RA 1P4FA 1LEWA 4QMSA 5CXZA 5IMXA 3KN5A 4MF1A 3G6GA 2C47A 5AIKA 5JRSA 1BX6A 4RFMA 3MESA 4RA5A 2OI4X 4KIKA 3ZEPA 3R2YA 5HD4A 4MVFA 3QTQA 1KE9A 2A2AA 4Z7GA 4AN9A 2Q0BA 5C4KA 3QHWA 4ZSGA 3R9NA 2B7AA 4NEUA 4JRNA 4YLKA 5CVHA 4BKJA 2VNWA 4KSPA 5DRDA 5M44A 5DI1A 4FKVA 2VWZA 5EM5A 2XVDA 4LI5A 2C1AA 4PP9A 4Q2AA 4L3JA 2WMBA 5JKGA 3NYNA 3OWJA 1UVRA 4FTOA 5ACKA 1O6KA 4FEWA 4HYIA 3RK5A 3PIYA 4HYHA 4R6VA 4DEHA 4IVBA 3DLSA 4A07A 2J50A 4FEXA 4FA2A 2J0KA 3CKWA 4AS0A 4DCEA 2QO2A 3QX4A 1V0BA 4EK4A 4F9BA 5IEVA 3UNJA 1M52A 5C8KA 3O17A 5CS6A 1H1SA 3RCDA 2C6IA 2BAKA 3VQUA 1GAGA 2YHVA 3NNVA 4LG4A 4DEIA 2CNVA 2JFMA 3E8NA 4IJPA 4OTIA 1AQ1A 4XLIA 5EHOA 4BCGA 4C4GA 4D5KA 4DEEA 4EOPA 5AV2A 2W5HA 3VUIA 2X0GA 4L7FA 4HGEA 5CX9A 5BUJA 2QVSE 4R5YA 4LL0A 4PQNA 2QOCA 4JIKA 3HUCA 5EM7A 5HCYA 3R1SA 2Z7QA 2Z02A 2XNBA 5AEPA 4IC7A 4H3BA 3P78A 3CJGA 3Q5IA 2B1PA 5KHWA 5DG5A 2R3MA 3MVHA 1U54A 3D0EA 1CKIA 5GJDA 4CFMA 4RX5A 3ULIA 2QO9A 4YNEA 5LJJA 3OVVA 5IQCA 4GT3A 2FYSA 3TI1A 4G6LA 5A54A 4DH7A 5EQYA 4DE4A 5DVRA 3A4PA 2V5QA 4U8ZA 4EHZA 3QQUA 4QMPA 5LXMA 3II5A 4AP7A 3R7IA 3QCYA 4FKTA 3ROCA 4BHZA 3D5VA 4ZY6A 1IRKA 3R7YA 2QU6A 3RPYA 3PXKA 4RWKA 3AG9A 3FQEA 1BLXA 4EUTA 4HW7A 3N4TA 4DG0E 4F0GA 4QMXA 1S9IA 1UU9A 2CKEA 3LJ1A 1W8CA 3OW4A 5CQWA 1XH7A 4BHNA 2WTKB 3CQWA 2OFUA 3LFSA 3RP9A 5ANJA 2HZ4A 1OM1A 2PK9A 5IG1A 4QTAA 1H27A 3QD3A 2JGZA 3DB6A 3F66A 3DOGA 2P55A 3KMMA 1Y6AA 3QQFA 4Z55A 3LMHA 3C0GA 2OU7A 2B54A 3QD2B 2GMXA 3OHTA 2IW9A 3WIKA 4R7BA 1FMOE 1PKDA 5A14A 1JSVA 3QZGA 3SRVA 3PPKA 4CT1A 2PMOX 1XH4A 4IMYA 3QQJA 4CXAA 4W9XA 1QPEA 4FK6A 3EL7A 4FIEA 4MXXA 3SX9A 4CYJA 2HXLA 4YNOA 4EK5A 4F6UA 2C3KA 1Y8GA 3MFTA 2F7XE 5BVDA 4XCUA 3LMGA 2X1NA 2HZNA 3FLNC 2BZHB 4XV9A 4W8EA 3ZLSA 5DRBA 4NW5A 1W0XC 2H6DA 4BVUA 2YIWA 2I0EA 2QR7A 1CM8A 3NS9A 4IAKA 4N0SA 4KNBA 4XEYA 4E1ZA 2YM8A 3DQWA 5AR3A 5HO8A 4FEQA 4JAIA 4MXOA 4QQCA 3IPHA 3AQVA 5EQEA 1H28A 1Y6BA 3E8EA 3O0GA 4WG5A 1OUKA 4MWIA 4E5BA 2OZAB 4NIFA 1H1QA 5JEBA 2HWOA 3OEZA 3HV5A 3BQRA 2YCFA 1OI9A 2EB3A 4RWLA 4U7ZA 5CAQA 3ZDIA 2FSTX 3OD6X 3TKUA 5ANIA 4C37A 4DGLC 2KTYA 1F5QA 3W32A 3BEGA 5CU4A 2OH0E 1ATPE 4KINA 4ARKA 4IAAA 3HDNA 2XKEA 4C38A 3QQGA 1URCA 1M2PA 1KE8A 3DBFA 3W18A 1U5RA 5JQ8A 3AD6A 4MX9A 4R1YA 4AUAA 4D4SA 3JY0A 3TUCA 4QTCA 4YBKA 3A62A 1BUHA 4UX9A 2QKWB 3VBXA 3CTJA 4GFMA 3OS3A 4QYHA 3TDVA 3ZO2A 5D9HA 3NEWA 5AUUA 3QA8A 4L6QA 3PIZA 3VJOA 4C36A 2XNPA 2IVUA 4P4CA 4R8QA 1QPCA 3QAME 2IJMA 3QKMA 1JWHA 2ONLA 4W4VA 4BKZA 3L8VA 3G15A 1WVXA 4DYMA 5GIPE 4EYJA 4NJDA 2X2LA 3GUBA 4NFMA 4JG8A
chains in the Genus database with same CATH superfamily
2YM4A 5E8TA 4LL5A 4P5ZA 3TIZA 3QX2A 3FYKX 2FSOX 4I0RA 4IX6A 4M69B 2GS6A 5T6KA 1ZMWA 3TNQB 2VWVA 4ZAUA 4V04A 3OC1A 5AR2A 2CDZA 5B2LA 4JDHA 4ZP5A 2AC5A 5GHVA 5JT2A 3PXQA 5TOZA 5BVNA 3AT2A 5HIEA 5K4IA 4MNEB 4O83A 2J90A 4C58A 4D1XA 5DEWA 4C0TA 4B9DA 3L8SA 3MI9A 4FUXA 1IR3A 4IB3A 3QRUA 4CFUA 1H4LA 2ETKA 4YTHA 5E9EA 3MJ2A 4FT9A 4QMTA 4ZLZA 3MYGA 3OP5A 3IDCA 4TNBA 2WIHA 4G9RA 2X81A 3QC4A 3ZSHA 4W4XA 2X7OA 3BBWA 3DNEA 3A7IA 2O8YA 3UDTA 2OFVA 4USEA 2XA4A 3HV6A 4L45A 5AV3A 2B52A 4YU2A 5IQFA 3A99A 5K5NA 3BEAA 3D4QA 5IUGA 3MA3A 2BRHA 2IWIA 4NL0A 3PWDA 4KKHA 4JBQA 4Q5HA 5KUPA 4EONA 3NX8A 1OL2A 1RJBA 5HNBA 5HTBA 3PJ1A 4O7NA 4PPBA 4AT3A 4U5JA 1OL1A 1KE5A 4M84A 4G1WA 4AFEA 4O0VA 4DH3A 4RZVA 1I09A 1HOWA 3PY0A 3VRZA 5CEKA 4FKGA 3W2PA 4CMOA 2XP2A 3AC3A 5AV1A 2X7FA 3BYMA 4WNOA 2F7ZE 4D4VA 2W4JA 2W1DA 4OTPA 2DWBA 2BVAA 3BCEA 1FQ1B 2I0YA 2F57A 3HA6A 1FGIA 4BWPA 4FL3A 4E4LA 5J5SA 1W83A 3FMJA 4ZXTA 1FINA 3Q5ZA 1OIYA 4R78A 5E91A 4NCTA 3COHA 2A98A 3UDZA 4NK9A 1XH9A 4KB8A 4AU8A 4CKIA 4RMZA 1V0OA 4ZTLA 4FGBA 4O21A 2C0IA 3Q9WA 4NTTA 4U45A 4X3FB 5HLPA 3UIBA 3VVHA 4RVKA 3ZCLA 3U54A 3I1AA 5CU3A 3HVCA 3VNTA 3BZ3A 4ZLYA 3E62A 2FA2A 3WF9A 3UYTA 3ULZA 4F1OA 2OO8X 1JKTA 5EH0A 3A60A 1R0PA 4KS7A 2UZEA 4CZYB 4AZSA 4BCMA 4G31A 4EZ7A 4EOIA 2R3IA 5CQUA 4QYEA 1Y8YA 2GFSA 4ANOA 3OROA 1A48A 3MIYA 2E9NA 4GVAA 4MBJA 4JX7A 3VF9A 3LQ3A 4GU6A 2GNLA 4PUZA 5EYDA 4ZTSA 3VS6A 3UO4A 4ZSJA 4GMYA 4IH8A 4NM3A 4YJRA 2IW6A 2X0QA 4HNIA 5CF4A 3BI6A 1ZMUA 5AP2A 4AW5A 3N4VA 3RJCA 3W2RA 2XIRA 2PVRA 3OT3A 4PNIA 3VUDA 3FI8A 5AFVA 2C6OA 2PVHA 2CCHA 2HELA 4RG0A 4EH6A 3Q9ZA 4DGOA 3ATSA 2P33A 5J5TA 5AR8A 5D11A 1PMVA 5EQPA 4QEBA 4AGUA 5EI6A 4JDKA 3P7BA 2VTHA 4ZLOA 3PXFA 3F7WA 4EKKA 4CRLA 4MTAA 3VUHA 4JDIA 2R7IA 3NW5A 2PVFA 3O71A 4PDSA 3KXXA 3RAHA 2WNTA 4I4FA 1OGYA 4FV7A 4O4BB 5ETIA 3H10A 5FG8A 1K2PA 4H58A 4IFCA 4RWJA 5F1ZA 1DI8A 2DUVA 3PZEA 3S3IA 5DT3A 2YEXA 4AA0A 4EOQA 4FYOA 2VTMA 3DDQA 4BIBA 3MVLA 2XJ2A 4JJRA 3CC6A 4G17A 4NH1A 3FY2A 5FRIA 1HCLA 2XZSA 4PPCA 4Y5QA 5FEQA 4IVAA 5M4FA 1J7UA 1ND4A 3DY7A 2YLEA 3PXYA 1QPJA 2QQ7A 1WFCA 3KXMA 4TXCA 4D1ZA 4ZY5A 4HCTA 3TN8A 4EORA 2CGUA 1OVEA 2X39A 3HP5A 5JMSA 5CEOA 5HO6A 2ITUA 4Z9LA 5H2UA 4CFFA 3HECA 3AKLA 4YO6A 3QKLA 1M7QA 4FIIA 2PZ5A 3V8TA 1B6CB 3C4WA 2OZAA 4WBOA 1G8JA 3DCVA 5E8VA 3C5IA 4YPSA 2BFYA 4FKUA 4I41A 1OMWA 4JNWA 4JX3A 2FO0A 4ACGA 2WTCA 4G6NA 4K1BA 3ZUUA 4P7EA 4FC0A 3P86A 4NTSA 5IQHA 4YZNA 4TPTA 3LXPA 4PX6A 2E9UA 1XQZA 2GHLA 2OXXA 4L3LA 3PSCA 3VHEA 3AC4A 5D10A 5L2TA 3IGGA 2UW6A 3DQXA 3E3PA 4X6QC 5D1JA 5HORA 3O5AA 4B0GA 2I40A 5HG7A 2O3PA 1FVTA 4L46A 4N57A 2XJ1A 2XIZA 4WA9A 5HG8A 2O63A 4GG5A 4CFWA 4PP7A 3G33A 3GU4A 3CQUA 5AR7A 3RM7A 4LV7A 2VO7A 3ZTXA 3P5JC 3ORZA 4O82A 1WBNA 4FVPA 3ZHPC 4FV4A 4I23A 3PA4A 4RC3A 2R64A 2WU6A 3PYYA 2B9HA 2XK3A 3D5UA 4RJ4A 5FM2A 5LARA 4OLIA 5CENA 5AAGA 3LLAA 3ITZA 5CLPA 3AMBA 2PUNA 1H26A 2Y6OA 3OF0A 2EWAA 3WF8A 2GU8A 3LM5A 4L42A 4AACA 3F69A 4QMQA 4AA4A 3FPQA 4GU9A 4O4DA 4RVLA 2UVZA 3EN9A 5CF6A 4LGDA 3KU2A 4NFNA 1XBCA 4LGGA 3R1YA 3VUGA 3MDYA 4FSTA 1MRUA 1VR2A 4M69A 4TYEA 4Z7HA 1XMLA 5CZHA 4FTRA 2PMNX 3IKAA 2Y7JA 1YI6A 3FMNA 1OPLA 4PF4A 4U81A 3BGZA 4CTCA 4MNEA 2OIBA 4D1SA 2GNFA 4MD8E 3T8OA 4YMJA 3VHKA 2QR8A 2VWXA 3UDSA 3ORTA 3OEFX 4O0UA 4GS6A 2F49A 1XO2B 3KRJA 5E7RA 5I0BA 4AAAA 3KRRA 4FKJA 5M4IA 3F2NA 4OUCA 4X7QA 3R8VA 2ZM3A 5IKWA 3VS7A 4AZWA 4AQKA 1J1CA 4PWNA 3UGCA 2CN5A 2OGVA 3HV4A 3L9NA 3POOA 3AC2A 3SOCA 2YWVA 3EQCA 2V22A 2YM7A 4PTEA 4KUJA 4BB4A 3CP9A 2BKKA 3WF5A 4U9AA 2YM3A 3AT3A 2NPQA 2ETRA 2UW5A 4EQCA 4HVHA 2F4JA 2X6DA 3TV4A 4QP6A 4BDGA 5B2MA 3KREA 2WIPA 5J79A 4FSZA 3FEGA 1YHWA 2I1MA 2R3RA 2GNHA 2YCSA 3U9NA 2YDIA 4J95A 4EQUA 2XAMA 3P0MA 2ZDUA 3BU5A 3ZM4A 3SXFA 3ZZWA 4BRXA 3U55A 4HYSA 3ZO1A 1WBVA 3PDTA 3F61A 4FR4A 5KMJA 1JVPP 2GTMA 5HHWA 4EK6A 5I9XA 5KMKA 3E7VA 1RW8A 4FKSA 3WI6A 2Z7LA 4IHPA 3PLSA 3LIJA 3RK7A 5DLSA 1PW2A 2CPKE 5AX3A 3Q4CA 1IA9A 2CKOA 2GHMA 5T3QA 3W0OA 3QTWA 5DA3A 3ANQA 5KZIA 4A4LA 2YJRA 3NUSA 5FQDC 4R7IA 3WZJA 3PP1A 4IVCA 5IQBA 4X3FA 3COIA 2XH5A 4BBMA 4UMUA 1H24A 3QFVA 2J0IA 3EOCA 1B39A 3LCOA 2DQ7X 4FV8A 4MBIA 4ZJIA 1GIIA 4O96A 3EKNA 2QOBA 5L2SA 5LOHA 3LCKA 2OXYA 4OAUC 2Q83A 3DT1A 5ANOA 5BVWA 4MF0A 3U8WA 1Q8ZA 3UC3A 2QODA 2VO0A 3GU6A 4ID7A 5G1XA 1E1VA 1XWSA 2ITPA 4JG7A 4BGQA 5CNNA 4OGRA 4RPVA 4F78A 1UU3A 1GOLA 4BZNA 3RNIA 3ACKA 5DE2A 3QTIA 5E1SA 3I5ZA 5FLFA 5B2KA 3PFYA 3FZSA 3JY9A 1GJOA 2BRNA 3QTSA 4EK8A 3IS5A 4IB1A 2ESMA 4UB7A 2JDOA 3BHTA 4PL4A 1P14A 5CXHA 4MHAA 4AGDA 2XCHA 3ROYA 4UZHA 1PXPA 5IA5A 3SD0A 3A7HA 5AUTA 5AP4A 5KMIA 3G90X 3E88A 4KABA 3W10A 3BL9A 1GY3A 1YI3A 5GINE 4NM7A 1YKRA 4IAFA 4WRGA 4ALWA 1M17A 2QG7A 4F6WA 2W5BA 4DGGA 5GZ8A 4O86A 5EDPA 1MRVA 4ZJVA 3QA0A 4AX8A 5IUIA 5BNJA 1XBAA 3G5DA 2OJ9A 4A9YA 2V0DA 4LQMA 2Y4IB 3FLSA 3F5XA 3KF7A 4BDEA 4DEAA 3CTHA 3HA8A 2XNOA 5EHYA 2ZV7A 3EQPA 3SRVB 3CLYA 2P2IA 2X9EA 3IO7A 3KXHA 3L9MA 4CT2A 5HTIA 4QT1A 2ITZA 4DHJA 3PFQA 2HOGA 3COKA 2FVDA 3HP2A 4KBCA 4D5HA 4IAZA 4O7YA 3RZFA 4GSBA 3KK9A 4M68A 4O7WA 4M0YA 1PF8A 1H25A 3QC9A 4AG8A 2J6MA 2XYNA 1W2DA 3GEQA 2IN6A 3ZMMA 5GNKA 4BGHA 2UZDA 3BLQA 2R3FA 2UV2A 2YIQA 3RPOA 3SA0A 3UZTA 3W33A 4RQVA 4XG2A 5CI7A 3JS2A 4L52A 3FZRA 3OY1A 1UNLA 3F7ZA 4BYIA 3FI2A 4CZTA 2UZNA 2C6DA 5IUHA 4FIFA 2XMYA 4IX3A 4LMUA 4BIEA 3CSVA 3C4EA 2VRXA 3Q96A 3WYXA 3T3UA 2VTRA 4EH4A 2WEVA 4C4JA 4GK4A 5JFWA 4I6HA 4L00A 2BRBA 2UW8A 3FLQA 1PJKA 3R83A 5IEYA 1YDTE 2QLUA 5EM8A 3VBQA 4O0SA 5HX8A 4JG6A 3RAIA 4QMZA 5HZNA 2HENA 3GXLA 3TNIA 4ZEGA 1ZOHA 3I7CA 3GCUA 5FDPA 3UP7A 5HCZA 1U59A 3UOLA 5LVOA 4QMMA 5CAPA 3RWPA 3W2OA 5HVKA 5KE0A 5J1WA 1OL5A 5I3OA 5CSXA 3SC1A 3ZEWA 2A27A 2JIIA 4A7CA 2ACXA 1LR4A 4CGAA 4FI1A 4O1OA 4O91A 4TNDA 3QBNA 1T45A 2ITVA 4M14A 5FTQA 5L2QA 4H3QA 4O0TA 2PZIA 3P79A 2BDWA 4M7IA 3RKBA 4C34A 3F3ZA 3BL7A 1UWJA 2UZVA 2VX1A 3HV7A 4Y95A 3R7OA 2YISA 4ENXA 4E6AA 4IDVA 3HRBA 3OXIA 3VBWA 2QOQA 1URWA 2W1GA 3TYKA 2RFSA 4UWYA 1ZY5A 5FGKA 3SDJA 4CLIA 1W7HA 2JDVA 1TQPA 3MH1A 1H0VA 2Z7SA 2XIYA 3EN6A 3SAYA 3HAVA 1SNXA 4L44A 5I9YA 3AKKA 4XBUA 1ZZ2A 3MH2A 4IWOA 2BTSA 2WMWA 5CEIA 3CGOA 3D5WA 3ACJA 3NCZA 4MK0A 1TFFA 2Z7RA 4OTRA 3CKXA 4DGNA 3TKHA 1V0PA 4B8MA 4WKQA 3R63A 1Y57A 3NNUA 5C27A 2IF8A 5EDQA 4FE2A 2EUFB 2W05A 2XF0A 4IM3A 4B7TA 5M4UA 1XHAA 3TG1A 4EWHA 4QQ5A 3H0YA 4DT9A 4FIGA 4ASXA 4EEVA 4DITA 2ZM4A 3BKBA 4F6SA 4AZVA 2PUPA 2B9FA 4LUEA 5C9CA 2C3LA 4LGHA 1JBPE 3PJCA 4P90A 1V1KA 4RIOA 5HNGA 5JFSA 4NYEA 4O81A 4KIPA 2WB8A 3KXGA 2REIA 3WIGA 4AQCA 3UNKA 3K54A 2O2UA 4RJ5A 4FTNA 3GFWA 4KSQA 3V5WA 4G3EA 3NNWA 4IAIA 4HZRA 3V5JA 3ZFYA 2PE2A 3M11A 3OOMA 2VWYA 3TL8A 5FEDA 3E3BX 2W06A 3JUHA 5AP0A 2PTKA 3G0FA 4RFZA 3ZU7A 3DBDA 4AE6A 3MY0A 4NU1A 3KY2A 2JIVA 2BIKB 3V6SA 3RNYA 4BY9E 5M56A 4S34A 3P23A 2JDSA 3ORIA 2XAOA 2IVSA 4GKIA 4BI0A 3DAKA 2XNEA 3MIAA 5CVGA 3WZDA 3DJ6A 4C8BA 2W9FB 4KBAA 3CD3A 5HG5A 4AA5A 5D7VA 2J2IB 2UVXA 3IK3A 4DG3E 5DR9A 4FZ7A 3ATTA 2W4OA 4ONAA 3PJ8A 5D41A 4BDHA 5KCVA 4BN1A 5M55A 3AD5A 3L9PA 2G2HA 4CNHA 3MPAA 3R7GA 4KD1A 5J8IA 3QYWA 1DS5A 2YAKA 2R9SA 4QRCA 3UMXA 4BYJA 4MQ1A 4CEGA 2BZIB 2C30A 3VULA 4QNAA 3SXSA 3UVPA 1IAJA 3R00A 4FTKA 3HV3A 3P9JA 5D7AA 4CSVA 2XNMA 5IQIA 5M4CA 1MUOA 2X4FA 3UJGA 2QHMA 3UYSA 5HE2A 2WMUA 4WD5A 2UW4A 3FMLA 4FODA 2HW7A 5FD2A 4BFMA 5BVKA 3S00A 1ZRZA 4O0XA 5AJQA 4AT5A 1EH4A 4UEUA 3ZC6A 3I6WA 1ERKA 3HMNA 5CEQA 3EQGA 4QMNA 2BHHA 2AYPA 4JLCA 4B8LA 1OKVA 1QMZA 4JBOA 3EZRA 1G8KA 3Q60A 2R3HA 2PMIA 3ZRLA 3OBJA 4U42A 5FXSA 1R0EA 3BV2A 5FDXA 3DXNA 4BCKA 3VC4A 4I94A 1W2CA 4F70A 1NXKA 4QPAA 3D14A 5E90A 3Q9XA 4I4EA 3R01A 1YDRE 5B0XA 4FL1A 3AGMA 1FMKA 2RFNA 4A9SA 2CNUA 1FBNA 3DBCA 4O2ZA 3RPVA 4BDDA 4WRSA 2OF4A 3DTCA 2X8EA 4GK3A 5JH6A 3SGCA 3KXZA 4K33A 3K5UA 2B9JA 4MQ2A 3FI4A 2A4LA 2IZSA 3Q32A 4G3FA 2JAMA 3HL7A 3P1AA 4P5QA 5CVFA 2ETMA 2YAAA 4DFNA 2PZPA 4FX3A 4TYHA 2YM5A 4HNFA 4PMMA 3TZ7A 4AN2A 3BHHA 4BCIA 2W0JA 4QP7A 4E93A 3F2AA 4G34A 4IACA 4LOPA 5C4LA 2JBOA 3MFRA 3HRFA 1U5QA 4L53A 4YJNA 2PUUA 2QG5A 4OTHA 1OUYA 2QNJA 4TT7A 4MD9E 4C2VA 4H3PA 2XANA 4WNKA 5H8EA 1YOLA 4I93A 3NYVA 5JZNA 4QP9A 1Z57A 3MTFA 3NW7A 4LMNA 4DLIA 3DKCA 3M1SA 4BDJA 4BCHA 1ZYJA 3ENHA 4ZMFA 3QXOA 3CR0A 4QYFA 3DNDA 3H9RA 2XM9A 2E9OA 3F82A 2HW6A 3FC1X 3VBYA 3S95A 4AZTA 2BDJA 4FTAA 4E7WA 5DH3A 2WTJA 2BAQA 4QDVA 4GH2A 4QP1A 4FNWA 2WQEA 5L6OA 4J53A 3SG8A 1GNGA 5EW8A 3AXWA 1CDKA 3QQHA 3V6RA 3ERKA 2XCKA 3C13A 5HVYA 3DA6A 5AP3A 2VGOA 3CQEA 2UW0A 5ANDA 4A9TA 3IW6A 4CV8A 3MV5A 3ZO3A 5DR2A 4FKQA 3TEIA 4HVIA 2WHBA 4UWBA 4GEOA 4AWIA 4AXFA 5TE0A 3PA5A 3UZPA 4D4RA 5HE3A 3LFNA 3ORMA 4E26A 2IEWA 2QOOA 4RLLA 1UA2A 3K3JA 3OCGA 3JYAA 3QTUA 2NO3A 1XH6A 4NWMA 5DN3A 4G2FA 3EWHA 2CSNA 3NFGB 1IA8A 3HNGA 3LFQA 1SVGA 4I6BA 3RWQA 2XIKA 4ANMA 4C61A 4XG6A 1PXMA 5EHLA 5LMAA 5J1VA 2WU7A 3LLTA 4IAYA 4GYGA 5CF8A 4QMLA 1YQJA 4CV9A 4O7SA 4FV3A 4K18A 5HVJA 4FKPA 2J7TA 2YA9A 1ZLTA 3IOKA 5CZIA 5H3QA 3Q4UA 2ERKA 4H39A 1KOBA 4JR3A 1OBGA 3KK8A 4RX9A 3RAKA 3ZXZA 1ZMVA 3UO5A 3BV3A 2WO6A 4FG7A 3V01A 3PJ2A 3DK6A 3MPMA 4GIHA 5GZ9A 1GZOA 5JFVA 2A1AB 3HMIA 4YTIA 3BU6A 4CMTA 5CF5A 2O5KA 2VN9A 2LGCA 3BELA 3R6XA 4X2FA 4XG3A 3UMWA 3ZLYA 1H08A 3EYHA 3R02A 5EM6A 4EOKA 3F3TA 4G3CA 2J0MB 3QU0A 4JXFA 1UKHA 4YJOA 4BDAA 4E6QA 2I7QA 1VJYA 4BICA 5KBQA 3POZA 4FTLA 5JRQA 3NR9A 5HIBA 2ZAZA 1TZDA 4QMVA 4XOYA 3FUPA 2KULA 5K0KA 3DZOA 4G3DA 5CSPA 1KE6A 4IADA 2CGXA 2FB8A 1QCFA 3NSZA 2XIXA 4PPAA 4UV0A 3TTIA 4ZZOA 2OG8A 2VTQA 3R8LA 4K0YA 3H9OA 2X7GA 5E8WA 2WMTA 5CT7A 4LRJA 2J51A 5CSWA 5TKDA 3CGFA 3TJCA 2PHKA 2F2CB 5LMKC 3ZZEA 4L67A 3FZPA 2ITNA 4N6YA 5AUYA 4DEDA 4GVJA 1Q8WA 3EL8A 3G6HA 3F6XA 2OZOA 3ANRA 1Q4LA 2ZV8A 5EI2A 5HKMA 1Q24A 5EKOA 4DTKA 3BWFA 4CKRA 1Q8UA 3ML1A 3R22A 4BBEA 2XK8A 3BHVA 4NKAA 5KBRA 1WBWA 4DHZA 3W0NA 2UVYA 5L8KA 2OJJA 5I4NA 1RE8A 5IEXA 2VWWA 4P2KA 1DAYA 3PPZA 5JGBA 2XJ0A 3PVGA 4QP4A 1RQQA 3CTQA 4J8MA 4GRBA 5EI8A 4WUNA 1VEBA 5BUIA 4FTJA 3CY3A 2YIRA 3VJNA 4BR3A 4ZOGA 1F3MC 1K3AA 3GU5A 3NUXA 2XKFA 3IDBA 5IDNA 3QD4A 3I6UA 2ZOQA 3EH9A 4PDPA 4RVTA 3PXZA 4F7SA 4UN0C 2OWBA 1YDSE 2R2PA 5HBHA 4AGCA 5AV4A 4I22A 1UU7A 5ETFA 4DFBA 3QYZA 1PHKA 3EQBA 3KFAA 4IXPA 4JVGA 2BPMA 4RIYA 5AUVA 4AFJA 4JQ7A 2BCJA 2YABA 3IGOA 4EK3A 2PPQA 1PMEA 1Q41A 4FG9A 4YTFA 4C3PA 3GVUA 3B2WA 5LWNA 1H1RA 4YBJA 4YC6A 3QLGA 2C6TA 3BGPA 4MUQA 1R39A 3UOJA 4YPDA 2VX3A 2UW9A 3DBQA 2FGIA 4S30A 3TKIA 5BV3A 1LUFA 4FZ6A 2GTNA 3S1HA 1CKJA 3COMA 3PRIA 2VUWA 5AUZA 3SW4A 1PXIA 2WQNA 5FBOA 2BAJA 1YWVA 2GNIA 2JBPA 3UDBA 2WTIA 4N6ZA 2FH9A 3VW8A 5HG9A 1T46A 3FL5A 3FPMA 1RDQE 3LAUA 4TN6A 2I0VA 5HI2A 3C50A 2HAKA 5HESA 2WEIA 2AC3A 3N9XA 3OTVA 4LYNA 4E20A 1U4DA 2A19B 2W1FA 5M09A 1L3RE 4I21A 5HLNA 4UYNA 3SXRA 3WZUA 3H3CA 4O0RA 5LQFA 4OTGA 4FZDB 4BKYA 2WZJA 2C6LA 4JDJA 4CRSA 2VTSA 2W1EA 3PSDA 4RZWA 4D2WA 5CALA 5BYLA 3R9RA 4OW8A 2IVVA 2YFXA 4C2WA 3BYOA 4TWNA 2WTWA 1NA7A 5LWMA 5E8XA 5JZJA 4BDKA 5E8YA 4FSRA 5AMNA 4IW0A 4XP0A 3FZOA 3TNWA 4HVSA 3OWLA 4R5SA 2H96A 3OTUA 1NVSA 4MXZA 4EJNA 4TKSA 3N4UA 2YIYA 5JN2A 1Q3WA 4JBVA 2Z8CA 3BHUA 4PV0A 2ZDTA 3P08A 5HU3A 3FMMA 4YJVA 5J9YA 2GHGA 2PE1A 3W2CA 3ENMA 4UZDA 4ALUA 2VTAA 5IH5A 4ORKA 3DKFA 3HDMA 4FZFB 4PL5A 4BF2A 4AZFA 3EKKA 4FOBA 2OW3A 3VS3A 3LJ2A 4RVMA 3ZDUA 4IZ5A 3LM0A 3TCPA 4PMPA 4DC2A 2VTJA 4FJVA 4WSYA 4L43A 1OIQA 3O7LD 4I24A 3QHRA 1X8BA 3NDMA 3S2PA 2B55A 2CGVA 4Y73A 1XH5A 3ETAA 4BWKA 3IDPA 2WTDA 4XOZA 1Q5KA 3B8QA 1WMKA 4EOJA 2OJIA 4U79A 1JOWB 3LQ5A 2WOTA 3W0QA 5AAEA 2JIUA 2V62A 3FL4A 3M42A 4GK2A 1OGUA 2QOLA 3QCXA 4H36A 5LMKA 3GCVA 3TXOA 3UZRA 3PRFA 4FKRA 2GNJA 2VNYA 4GJ3A 4X0MA 3UQGA 2GFCA 2UZUE 4QPSA 4O38A 3E92A 2OIDA 3QUDA 2YDJA 4BGGA 3KGAA 3FWQA 1AGWA 3DK3A 4TWPA 3RK9A 4AW2A 4BZOA 5H9BA 1J7LA 3TM0A 3CIKA 5HD7A 5HGIA 2C6EA 3D2KA 4D9UA 4IVDA 3G9NA 2JDTA 2QURA 1LEZA 4TYJA 3W55A 4EBWA 3B8RA 3HMOA 3QL8A 3P7AA 3FSFA 4CFNA 5CTPA 4GJ2A 4I5HA 4YLLA 4ITHA 3IW5A 3MH0A 4XUFA 3RVGA 3EZVA 2B0QA 3PE1A 3W2QA 5EG3A 4FV0A 3MWUA 2HZ0A 3NIZA 4OTQA 5AM6A 4XRLA 2OIQA 4NM0A 5HCXA 4F1TA 2OJGA 2Y8OA 3BGQA 4U43A 3R9OA 4APCA 5GZAA 2Y9QA 3H4JA 3UODA 2PZRA 3ZONA 5L3AA 4QPMA 2GQRA 4FT5A 3C7QA 4NUSA 2J9MA 5DT0A 2EXMA 3QZHA 3Q2JA 3VONA 4IC8A 4A06A 3IW7A 3OT8A 3DAEA 3UE4A 2W99B 5BX0A 2ITTA 3MVJA 3NW6A 2YWPA 3OXZA 4LRKA 5ANKA 5TT7A 4WIHA 3V3VA 2R3KA 1PKGA 3OBGA 3LXNA 4TZRA 3TWJA 4IJ9A 3O8UA 2VTNA 3V5TA 2W1HA 3KEXA 4X2NA 4A4XA 4U80A 3ORNA 4O27B 4UMTA 3OW3A 4FT0A 4O22A 4UXLA 4XHKB 4FL2A 4UY9A 3EFJA 3FI3A 5HTCA 3LCDA 4BCFA 3I7BA 2W1IA 2C4GA 3EFKA 3I0QA 2QONA 2XEYA 3OCSA 4D4YA 2ITYA 4EH3A 2RG5A 3OWKA 5FXQA 4WHZA 4F7NA 4CD0A 3W0RA 3GGFA 5LCJA 1W2FA 3UNZA 3VW6A 4Y72A 3BE9A 2VU3A 3RMFA 2O0UA 2BKZA 4JQEA 5E4HA 3KULA 3I79A 3RHXA 3ZUTA 3BYUA 2JKOA 3FHRA 3Q4ZA 4YZMA 4E73A 4QTBA 4EHEA 3SW7A 3GCQA 3UVQA 4UMQA 4FKLA 4YP8A 4XH6A 4YSMA 3IW4A 4AXEA 4QMWA 2BZKB 3R7EA 3V5QA 4F9CA 3JXWA 4YJUA 2R3LA 5F95A 4FVQA 2YM6A 5HQ0A 3VAPA 4DEGA 1S9JA 2CCIA 4WG4A 4J96A 4D58A 2VZ6A 2J5EA 2ITXA 2DYLA 2PVYA 5FP6A 2ZVAA 3ZRMA 4FTIA 4IE9A 4MKCA 1FGKA 3VS5A 3LXLA 5J95A 2X6EA 1DAWA 1SVEA 5KMOA 3MB7A 3OY3A 3JPVA 2J5FA 5L8JA 4ZIMA 5AX9A 3KC3A 2UUEA 4EC9A 4DFUA 4G6OA 4M66A 4K11A 3BYVA 4J7BA 3F3VA 5TF9A 4FEUA 5KKRC 4MCVA 3CD8A 4WO5A 5BYYA 3FZ1A 5K9IA 5A3XA 2W96B 4EOSA 3U6JA 1L8TA 4BI1A 5AR5A 3DZQA 4Q9SA 3GQIA 1TQMA 4ANBA 3JVSA 5F20A 3EN4A 4QMUA 1G3NA 4M12A 2XKCA 3R04A 2XK6A 1F0QA 2B9IA 3FKNA 4I3ZA 4KIQA 3TIYA 4BCOA 4C4IA 2XKDA 4AF3A 2PZYA 2RIOA 2PVNA 2BMCA 3EN5A 4FV1A 4CMUA 5K3YA 3PY1A 2R3JA 1QPDA 3UBDA 2WMRA 3ELJA 5EW3A 4EHGA 5A9UA 3RBWA 3L1SA 4XV1A 1APME 5CASA 2CNQA 4JT3A 4AAYA 4ZS4A 2X8DA 4KRCA 3BPRA 2F7EE 2QCSA 3IECA 4XG7A 5E92A 1PXLA 4PDOA 3H30A 5HX6A 4RX8A 3MN3A 4O7RA 4GFOA 5C8NA 4E5AX 3UPZA 1R3CA 3OUKA 3A8XA 4X3JA 5HIDA 5ACBC 4FG8A 5D12A 1CKPA 5DR6A 2XK4A 3TJDA 2R5TA 3G2FA 4F63A 2QO7A 3PY3A