4OTHA

Crystal structure of prk1 catalytic domain in complex with ro-31-8220
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
335
structure length
305
Chain Sequence
RKSPLTLEDFKFLAVLGRGHFGKVLLSEFRPSGELFAIKALKKGDIVARDEVESLMCEKRILAAVTSAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAIFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSAEAIGIMRRLLRRNPERRLGSSERDAEDVKKQPFFRTLGWEALLARRLPPPFVPTLSGRTDVSNFDEEFTGEAPTLPPRDARPLTAAEQAAFLDFDFVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase N1
publication title Crystal Structures of PRK1 in Complex with the Clinical Compounds Lestaurtinib and Tofacitinib Reveal Ligand Induced Conformational Changes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 87
structure length 305
sequence length 335
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4othA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4othA01
3HP2A 4K6ZA 4E6CA 3HEGA 3MW1A 4AZEA 5DEWA 1YOJA 3H0ZA 3QTZA 3KVXA 2XM9A 2HYYA 2V5QA 2R5TA 2W5BA 2FO0A 3EQFA 4QYYA 5FQDC 4DGLC 1UU7A 1UU9A 2PWLA 2ZJWA 4HNIA 2R2PA 2XNPA 4XG8A 4QMXA 3BBTB 3OZ6A 5A6OA 4DFBA 1XKKA 3D2IA 2C3IB 5IA2A 4WRSA 2UZDA 3IDCA 5J9YA 4FTJA 1ZRZA 4ZSAA 3EWHA 4C4HA 2QURA 3R7UA 4O0RA 4U80A 4TT7A 3IW8A 1UVRA 4RFYA 3NW5A 5FDXA 3QTUA 4LUDA 3ITZA 4O7ZA 5CWZA 2W5AA 1Y6AA 3DAEA 4QYFA 5L4QA 3OBJA 2V7OA 1FVVA 5E91A 3I4BA 5JRQA 2JIUA 5LMBA 1CMKE 4PV0A 3RWQA 4H3BA 2OXDA 4KRCA 4MXCA 4RFZA 2YEXA 3AC5A 4YBKA 5DR9A 2JKMA 3DK7A 4RX5A 3UIBA 4EZ7A 3LFFA 4TW9A 3TV4A 3UO4A 5DG5A 2QR8A 5EG3A 4ZXTA 4ZLZA 3MTFA 3KY2A 2PZIA 4UMTA 4JQEA 3P23A 3A8XA 3R28A 4E8AA 1AQ1A 3A61A 4N6YA 5IMXA 4I22A 4IW0A 3R01A 3R22A 4FSUA 2DUVA 1TQIA 1FVTA 1NA7A 3TEIA 5EHOA 3GENA 1W7HA 4J52A 2IN6A 4J95A 4NM0A 3R8UA 2VTHA 3VUGA 2WMXA 1PY5A 2I0VA 4IMYA 4MF1A 5HZNA 3OXIA 4IH8A 4ZK5A 1JOWB 2B54A 5IKWA 3DOGA 5F9EA 4W4YA 1OIRA 4CSVA 3FZTA 2A0CX 1OMWA 4OLIA 2ESMA 5KMNA 4C38A 2X6DA 3E8CA 3G9NA 2GNHA 3LMHA 4PMTA 3OEFX 4C57A 3HYHA 5CLPA 5CAUA 1LR4A 4JT3A 1OIQA 4UEUA 3UZPA 4D1ZA 2IZRA 4FNWA 4YHFA 4M69B 2BAJA 4WBBB 3D5XA 4BZNA 2PMOX 3NX8A 4EZ5A 2CKQA 4E4NA 3RM7A 2FSOX 3WE8A 3LFAA 4PTGA 4J1RA 2VTMA 4HCUA 4YSMA 3ZO2A 1M7NA 3GEQA 4UN0C 1JNKA 4HGSA 2C3KA 3UG2A 1G8SA 5E8SA 4I3ZA 4BI0A 4N57A 4YP8A 4DFYA 3LLAA 2C6DA 3MESA 5DEYA 5G1XA 4TTHB 2OZAB 2UVXA 3DS6A 3HL7A 2WOUA 4MNFA 2KULA 4W9WA 3Q4TA 2O65A 3SRVA 4CTBA 5IUGA 1UU8A 4JL9A 4RA4A 3OTUA 4B6LA 5K4JA 3PG3A 4LGGA 4AW1A 2YIXA 5J9LA 2CLXA 3KEXA 3F2NA 4KIKA 2EXCX 4O38A 4BHNA 4XG3A 5FTGA 3O7LD 4FYNA 4BKYA 4Q9ZA 3IOKA 3W16A 3C0HA 3NS9A 5IF1A 3MN3A 2B53A 4I4EA 1BLXA 5HD7A 5HO8A 3V5QA 4BF2A 4BTJA 4CD0A 4YJRA 2PUUA 3O7LB 5F94A 3RTPA 3Q6WA 4YJPA 3U87A 4J71A 4AW2A 1OM1A 3ENMA 2F4JA 4JBPA 1GZNA 4NZWB 3BZ3A 4D4YA 2WEVA 4TYHB 4L67A 5CVFA 3ATTA 3PJ8A 5AR3A 3WILA 2YM7A 3QALE 1W83A 3ZONA 5GHVA 1W82A 2J0MB 3NUSA 4QRCA 2FGIA 3C7QA 3ET7A 2C30A 3MPAA 4ASXA 3KRWA 4UMQA 5BUEA 4J8MA 5CF6A 1XQZA 3F7ZA 1AD5A 1GZKA 5GJFA 3UPZA 1A06A 4QPMA 1E1XA 3VW8A 4I5PA 5CT7A 5EDPA 1UNHA 4D5KA 4O7WA 5JFXA 1IAHA 2F49A 1CM8A 2CHLA 2WQBA 3BYUA 4HYUA 5E8WA 5FTOA 4EC9A 5EQYA 3BLQA 5M51A 3RK7A 2W4OA 4Y83A 3PY3A 2A19B 4GU6A 3LQ8A 4Y5HA 1H0VA 4D1XA 3IECA 5DBXA 2ZV9A 3Q52A 3KULB 1FVRA 2C6MA 1SVHA 3QFVA 4YJSA 4QTAA 1KE7A 4FNZA 3PXKA 5CF4A 1PRYA 4M7IA 5HNIX 5CU2A 4A9RA 4ZS4A 5ANOA 1OKYA 3UMXA 3HRFA 2BRMA 1URCA 4KS8A 1MQBA 3VN9A 4A4LA 4CRSA 4U9AA 1FGKA 4F70A 4K11A 5HVJA 1E9HA 1OVEA 2UZOA 2IZTA 5KCVA 3LKMA 2PMNX 3CQEA 3PDTA 4MEDA 4DFLA 3JR1A 3DKOA 3ELJA 2GQGA 5J8IA 3G2FA 4EL9A 5L8KA 3D7TA 3PVWA 4FIJA 3HDMA 4WNMA 4FEUA 3PSBA 4GKHA 3I7CA 4V0GA 3AC1A 3MH0A 3QWKA 4PWNA 3EFLA 2JDVA 3MY1A 4L6QA 5CEQA 2XJ0A 4JR7A 4E73A 2E9NA 2J4ZA 2QLQA 3FMKA 1GNGA 4MD9E 4PDOA 2YLFA 2GS2A 3UMWA 4PMPA 2PZRA 2WGJA 3SD0A 2J2IB 3P4KA 4JLCA 1OUKA 4O83A 3KL8A 5EHLA 1R78A 4NTTA 5E4HA 2VAGA 3HMOA 4YC3A 3UE4A 2J0IA 2F7XE 4BWKA 4BWPA 4JVGA 3WE4A 2C5YA 1WAKA 5CU4A 2HW6A 3DBFA 4M84A 2C5NA 2I40A 3EQIA 5ETIA 3RK9A 4H39A 2VNWA 1QMZA 3EN4A 4BC6A 4IC7A 5AR5A 3R7YA 4RIWA 4RQVA 3D2KA 3KMWA 4AGWA 4C3PA 4EK5A 2PUNA 4CFXA 4BFMA 1YHWA 4KBKA 4L9IA 4YZ9A 3SGCA 3NIEA 5AR8A 3EFWA 4N4SA 2JBPA 4C3FA 5ANIA 3R7OA 3S4QA 4FSYA 3TWJA 1IR3A 3CY2A 5L2IA 2VWBA 3MH1A 5BYLA 2ZV7A 3L8SA 4IB0A 3MJ2A 5IA1A 4FZAB 1PKGA 3MGYA 3LLTA 1Q99A 1HCLA 3KMUA 4YZMA 4DG3E 3E8NA 4L8MA 3QTSA 3SX9A 5CX9A 3VJOA 4A4OA 4FEQA 4ZSJA 5I3RA 3UC4A 2XK6A 4RLKA 2C3LA 3TUCA 4LG4A 4BDJA 3ANQA 3TZ7A 2W4KA 4DA5A 2WTDA 5JH6A 2YABA 5M4CA 2YM4A 4G17A 1WVYA 3KN6A 3R1QA 3U8WA 5IQEA 3DLZA 2YM8A 4AA5A 2X8IA 2ERZE 2OIQA 2XRWA 3BIZA 4X3FA 3SAYA 2C4GA 4CG8A 4BICA 5A4QA 3BGQA 4Y5QA 3UOJA 3QF9A 5GIOE 2B9HA 4NK9A 1OKWA 2HZ4A 4A9TA 5GZAA 2C47A 3NYNA 1ZOGA 3KRLA 4KIPA 2CKEA 2FUMA 2VTTA 2XNOA 3SC1A 3HMNA 4GUBA 3PSCA 4IQ6A 3ZH8A 4F9AA 4O91A 3IQ7A 4DC2A 4EOLA 4GT5A 3WYYA 3Q3BA 5KMOA 1J1BA 4BYJA 4IDTA 5CAVA 4C59A 2IW8A 5A4CA 3NEWA 4EYJA 4Z3VA 2H8HA 2X7OA 5ICPA 3FJQE 3QQHA 5CQWA 2YLEA 3POZA 3ORXA 4I0SA 4HVHA 4GFGA 5CY3A 2ZB0A 4L7FA 3QA0A 2QOBA 3R73A 5CNOA 4PMSA 3CTQA 2OBJA 2OJGA 4H3PA 1TQPA 4BKZA 4DITA 5HG5A 4GL9A 4YZNA 3F5XA 3CJFA 4WG3A 3KCKA 3IGGA 5HE1A 5KMMA 4UZDA 3LVPA 3CD3A 3OCGA 5J1VA 4GVJA 4ZS0A 5A46A 5IQHA 4AG8A 3PUPA 1VEBA 3P79A 3ZSHA 2XNGA 4F09A 2YAAA 5IDPA 4BN1A 4AWIA 3O8PA 4CCBA 3FE3A 5K0KA 5IISA 3DQWA 3QXOA 5L2WA 3NYOA 1OBGA 4USEA 4HZRA 4R1VA 5KMJA 5C4KA 2QI8A 4KINA 2YA9A 4HOKA 3K3IA 4ZZMA 1UNGA 1YHVA 2YFXA 4FIGA 3RAIA 3TDVA 3QKMA 3ZBFA 2X2MA 3FZRA 5CU6A 4QMZA 4DH5A 3GBZA 4KSQA 2IPXA 2XKFA 4S32A 3VHKA 3Q9ZA 2CGXA 3RI1A 3KRJA 3ZC6A 3GC9A 4XEYA 4ZEGA 5LCKA 4JIKA 3PYYA 3FAAA 4E3CA 2WMTA 3GXLA 2Z7SA 5HHWA 3VUKA 1J7IA 4FVRA 5EW8A 3VBVA 3N4UA 4R7HA 4GG5A 5B0XA 3GCUA 1APME 4AW5A 3TUDA 4LGDA 3R63A 4WA9A 4FSMA 3SRVB 4U3YA 4QP8A 4Y95A 4A07A 4EORA 3VBWA 1U5RA 3FMLA 3KK8A 1U46A 3OD6X 3OWKA 1YVJA 2JAVA 4E5BA 1KSWA 4YTFA 2J51A 3GQLA 4PF4A 4KIKB 5D9HA 1Q8WA 3D4QA 3DZOA 4AU8A 4J99A 3RWPA 4E6AA 2LGCA 4FV1A 4IAZA 3CD8A 4MWIA 3UTOA 4EOSA 3JY9A 1KUTA 3EQPA 3GVUA 2YCSA 4ZLYA 3R8LA 3LJ1A 1CTPE 5CEKA 1XJDA 2CN8A 5HBJA 3HMPA 4QNAA 4FUXA 1S9IA 3LXNA 3PZHA 2JGZA 3QYZA 3WBLA 3QZHA 3ZU7A 4D5HA 3GOPA 3RMFA 4OT6A 3TNWA 5HIBA 4CFWA 4GW8A 2IWIA 3BV2A 3OEZA 4FTAA 4XP0A 3FMMA 4IX4A 2LAVA 3UZTA 3DY7A 4MXXA 4D4SA 4FIHA 3W2RA 4XRJA 1WCCA 4R5YA 2QKWB 4EK4A 2ETRA 1J1CA 2VTIA 4BDKA 2R4BA 2RFSA 2YISA 3NDMA 4DCAA 4DH8A 3TI1A 3TNHA 4I21A 3PJCA 2GTMA 4D58A 1PXIA 3QXPA 2IZSA 1Q61A 4O0XA 5HO7A 4ZJVA 5TT7A 3HVCA 5IA4A 4DG0E 2C5VA 4PQNA 5CEIA 2YWPA 3COMA 4G6LA 3F3TA 4QMOA 3U6IA 4C36A 2Z60A 3OWPA 5EKNA 4O27B 4QYHA 4YJVA 2B55A 5DH3A 4G31A 1M17A 3QTXA 3NRMA 3V3VA 3W8LA 4BWXA 1OL1A 3WIGA 3EN5A 3HZTA 4OAVB 3L8VA 1ERKA 3L8PA 1O6YA 3N9XA 3FSKA 4L44A 4RZWA 5CSWA 4AA0A 3U55A 4ANMA 3TIZA 1A48A 5C03A 5IQIA 2JKQA 3CKXA 2XP2A 3ZOSA 4BIBA 4EUTA 5CAQA 4GVAA 3BWFA 4HCTA 5K5NA 5HCXA 1HOWA 4MH7A 4YC6A 2Y4PA 3OT8A 2C1AA 5CAOA 3EN7A 2NRYA 1FGIA 2GS6A 5EYMA 1IRKA 1B38A 4AN9A 2VTAA 2VTLA 4CV9A 3IW6A 2IVTA 3KN5A 3D7TB 1M2QA 2CJMA 5IEVA 4YZBA 4V0GB 4FT7A 4U43A 2QOFA 2XBJA 4D55A 3T8OA 5JGDA 4QMUA 2B4SB 3AT2A 4U81A 3ZO3A 2UUEA 4RC3A 5AP0A 4BDBA 5M57A 2G2HA 2A27A 4UY9A 2OWBA 3LW0A 4JDHA 1UKHA 2YCRA 2XNMA 4O7TA 3DDQA 3HV7A 4DINA 2AUHA 4O0VA 3FDNA 5TOZA 1DI8A 3KMMA 3QD4A 3A7GA 2WFYA 3SXRA 4ZY6A 5AEPA 1PMEA 3SVVA 1QPDA 2OJ9A 3PRIA 5D7VA 3H9OA 2PE2A 3BU3A 4GFOA 4AZSA 4YTIA 4N6ZA 4NW6A 2QG7A 4QP4A 5LXMA 3S3IA 4IACA 2CN5A 2WOTA 4EOQA 2F57A 2R3KA 1K2PA 1RDQE 4UX9A 3ZLWA 1UKIA 3Q4UA 4WRGA 1GJOA 4FIIA 3ZFYA 4F0IA 4PL5A 4RIWB 4Y85A 1RE8A 4EWQA 3DZQA 4IBMA 5CVGA 5JK3A 1YI4A 5J87A 5AP6A 3DBDA 1YWNA 5BYZA 3NPCA 5E9EA 2VWYA 1YWVA 1WBOA 2Z7RA 1ATPE 4EK3A 3V8TA 2CLQA 2FSLX 2WTIA 4L46A 4GEOA 1K9AA 4XHKB 3AQVA 2BUJA 3UJGA 1LP4A 2UW8A 2OF4A 4ZJJA 2XEZA 4IVAA 4RJ5A 5HORA 4NU1A 3AC8A 4QMSA 2ZM4A 2OZOA 4MK0A 4FZ6A 4IHPA 5CXHA 4AN3A 4ZTRA 3P1AA 4XG6A 1CDKA 1KWPA 3H30A 3ZO4A 4AF3A 2R9SA 4BHZA 4CFVA 5JKGA 3U4UA 2RL5A 4EJ7A 4PL4A 4IX6A 1GZOA 2WMBA 1J91A 3AC4A 4FKWA 4HNFA 3BYSA 5K5XA 4X3FB 4R7BA 1OKZA 3BU5A 2CPKE 1P2AA 4EHGA 4MNEA 2X7GA 3EL8A 5LQFA 3FBVA 3KRXA 3R7EA 4KD1A 5B2MA 3OXTA 2G1TA 4A4XA 4Q5HA 2CNUA 3FZSA 2Y4IB 4RJ3A 5EM6A 4XG4A 1VZOA 1JSTA 2UZEA 5F20A 3R8MA 1E1VA 1XH4A 3S95A 2OO8X 3UODA 5I9XA 4RGJA 5FP6A 1JKKA 1UA2A 1KE8A 5BPYA 4MHAA 5LMKA 4WT6A 3PA4A 3BLRA 4ANOA 3R9RA 3NW6A 3CS9A 5AJQA 5M06A 4WSQA 4QP9A 4BCQA 2WO6A 2JLDA 3QQGA 4QO9A 2BKKA 2VGOA 4OW8A 3O17A 3QCYA 2VN9A 4AW0A 3UZRA 4CFFA 4NFMA 4G6OA 3F61A 4BTMA 2ITPA 3G5DA 5LVLA 4EH8A 3PP1A 3PG1A 4CMOA 3ULIA 5GIPE 3MIYA 4HGLA 5IQCA 2B9IA 1Q8YA 3G6HA 2IW6A 3O50A 4M15A 4QTEA 2EB2A 1ZYSA 2OG8A 2P4IA 3GUBA 3MH3A 3NUAA 3R7GA 3HV3A 3AD6A 3GU4A 2WB8A 4I5MA 5EHYA 2WPAA 4FOBA 5CVHA 3O96A 3EB0A 1BYGA 4GT3A 1I09A 3LM0A 3HV5A 2ITZA 3QC9A 3UNJA 5DVRA 4ZTQA 3TNIA 3AD5A 5K3YA 3VF9A 3UVQA 2XK3A 4F7LA 5C4LA 4GU9A 5I9ZA 3FXXA 4FTMA 1WVWA 2YDKA 4DYMA 3AG9A 5LJJA 2O8YA 1LUFA 2WQMA 4AQCA 3V8WA 5DNRA 1O6LA 1IA8A 4DFXE 2YZAA 3VWAA 3JVSA 5DLSA 3BX5A 1YXTA 4BTKA 3CE3A 4TRLA 3UVPA 2IVVA 3AGLA 3KXXA 2G01A 4FL1A 2PULA 2JFMA 5C8KA 3QHWA 3QUEA 5FTQA 2JAMA 1R0PA 2YIQA 3AC3A 4HYIA 1V0PA 4QQJA 4RLLA 4XLIA 4HVGA 3WZUA 5HG9A 3BI6A 4IM3A 4IXPA 4ZTLA 3PPZA 3P86A 1YOMA 4U5JA 4CEGA 1IG1A 2XJ1A 4WNKA 3HRBA 1XBAA 3FLWA 3D94A 3HP5A 1URWA 3LHJA 4JDIA 4WSYA 4QQCA 3ZDIA 4EQCA 2JIIA 2X39A 4X7QA 2CGUA 3H3CA 2KTYA 4C37A 4PP7A 2WQNA 4YU2A 4YZCA 1PHKA 2E9PA 4QMYA 5DI1A 5HTBA 4LI5A 4UBAA 5CSPA 4XJ0A 1ZOEA 5ANGA 3AMBA 3IO7A 2VTOA 5M44A 3QL8A 3LPBA 4DEAA 4YMJA 4RT7A 2WIPA 3GB2A 4YHJA 2BMCA 5HVYA 4NWMA 4I41A 4OTIA 3HUBA 3MJ1A 4TN6A 5ETCA 4EH9A 1Z57A 2X7FA 1Q24A 3FQEA 4I1ZA 3WI6A 5BMSA 3QQJA 5HESA 1Q62A 3VS5A 4CZTA 5FXRA 2VRXA 4QP2A 5AM7A 2FVDA 4G9RA 4FC0A 3B8RA 1OBDA 3FPMA 2OSCA 5DRBA 2PYWA 4RWIA 2X81A 3REPA 1GIHA 3MV5A 4HGEA 4FKSA 3JXWA 5A9UA 3BCEA 3UOKA 3DDPA 2X0GA 1Q8ZA 3TT0A 3OCBA 3TZ9A 5GZ8A 4M67A 5HVKA 3CCNA 5AP2A 4P2KA 3POOA 1HCKA 4CZYB 4L45A 1BMKA 3IDBA 1YKRA 3TNQB 3O8TA 2W1EA 4FKIA 1L8TA 3KREA 1JLUE 3SW7A 4ACGA 4DTAA 3OHTA 2HXLA 2AC5A 2OH0E 2ZVAA 3CGOA 1QL6A 2VUWA 2QCSA 1CSNA 3ACKA 3DFAA 3NAXA 3ORTA 3VBQA 3ZCLA 3MB6A 1SZMA 2R3PA 4MXOA 3W18A 4DGGA 3UQGA 3P08A 4ALVA 3UGCA 4AGDA 4DN5A 2ONLA 3C4CA 4JI9A 2V7AA 4W4XA 4Y72A 3PXZA 1OB3A 2DYLA 3LJ2A 3E3BX 4QTCA 4OTDA 4DG2E 2PU8A 4L42A 4YBJA 3Q4ZA 4IWPA 1MRVA 4WD5A 2I0EA 3R1NA 4FUYA 4EH5A 1S9JA 3F3VA 3PIXA 2V22A 3E8DA 3E93A 3A99A 5L2TA 3QQLA 5HNBA 4ID7A 1GIJA 3DK6A 1H1WA 5EQPA 4FA2A 3TTJA 2YITA 2WMWA 3VBYA 3CEKA 4FI1A 2XKCA 2JFLA 4YLJA 4ENXA 3BHUA 4H1JA 2VV9A 2WD1A 3NNUA 3NYXA 3SV0A 2PVJA 2PZYA 3FI4A 4BY9E 4U0IA 5EM5A 1PYXA 1CKIA 3K54A 3G6GA 4O0UA 4ACHA 3QCSA 3FLSA 5LOHA 3OUNB 2QOKA 3U6HA 1I44A 2WKMA 1BI8A 3NWWA 2WQEA 5M4IA 5LVOA 2VZ6A 5HE2A 1A9UA 3R0TA 1BX6A 5AP1A 3COHA 3DJ5A 4B4LA 2RG6A 3COIA 2ITOA 4Q5EA 2XBAA 3F69A 4TKSA 3M42A 2VD5A 3M2WA 4EK8A 4O7RA 4XBRA 4DEEA 2NNWB 3G33A 1PW2A 4R3CA 1CKJA 3EHAA 4J8NA 5ANKA 3ZS5A 2Y0AA 4MTAA 2BVAA 3RP9A 4FEXA 5D7AA 5IQFA 1DAWA 3MVHA 2A2AA 3GC7A 3QWJA 4AGUA 3LMIA 4C35A 3EL7A 3DKCA 3ORZA 2BHHA 3KXZA 4TYIA 3R7IA 2BCJA 4FV6A 4C4GA 4ZY4A 3MBLA 3UC3A 4IX3A 4ZMFA 5KNJA 1KE9A 2WTKB 3Q9WA 2R3FA 4GG7A 4GKIA 3FMNA 2GTNA 4UMRA 1F5QA 1XH6A 2ACXA 2J90A 4LMNA 5CEPA 2BRHA 4NKAA 4BDIA 1MRYA 1PXOA 4QP3A 3HNGA 1OZ1A 3OVVA 4XG7A 3ZFMA 2WZJA 1H1RA 3BEGA 4FBXA 3QTIA 5AA8A 3IW4A 2ETKA 4IM2A 4A9UA 2PY3A 2XVDA 3BE2A 1WBPA 3LAUA 4WHZA 4RIOA 2ITTA 3UIUA 4YC8A 4MNEB 3PTGA 4I5HA 5DR6A 5HX8A 3HX4A 4EHZA 5AV4A 4EUUA 4KBCA 4WNOA 3PZEA 2H9VA 3UOLA 5A4TA 2O5KA 3DAKA 4J97A 4TZRA 5HCYA 4EKKA 3FMJA 3FI3A 5FXSA 2QOQA 4XCUA 3RPSA 3RCDA 5CSHA 4KRDA 5ITAA 4Q9SA 3FY2A 3RPVA 4AE9A 4J96A 3ZUVA 1M2RA 3FKNA 4L68A 3U9CA 5HU9A 2ZM1A 4DLIA 3QD0A 4XH6A 3MS9A 4APPA 4EI4A 4DHFA 5CQUA 3KU2A 2OF2A 1OL2A 4FT5A 3RVGA 3ZZEA 5CAPA 4G3GA 1OUYA 1Q3DA 5KMLA 5ETFA 3DXQA 4HVDA 1STCE 4JX3A 2JKOA 4R78A 3R21A 3LQ3A 4RIXA 3PA5A 2ZDTA 2ZM3A 3TKUA 4I92A 4ITHA 1H08A 4LL0A 3FHIA 3FL4A 3QUDA 1W0XC 4II5A 4LV5A 4R6VA 2YM6A 4UALA 5DT4A 3EOCA 5AUWA 5I3OA 4E6DA 4DT9A 3W2CA 3SA0A 4LRMA 3HA6A 4F65A 5FDPA 4W8DA 2C3JA 2OH4A 5AV2A 3O8UA 2C0TA 2QLUA 5LWMA 5JFSA 5GZ9A 5CI6A 4CLIA 3L9LA 4BIDA 1PJKA 3IGOA 5HX6A 4K2RA 3MVJA 3R2YA 4YTCA 3F2RA 4FF8A 4KSPA 4PP9A 4IZYA 1WVXA 4XMOA 3NW7A 1V0BA 3K5UA 3VUTA 3VW6A 4EHVA 2F2CB 5FEDA 4RZVA 4E7WA 4E6QA 2FSTX 2B7AA 4FGBA 5E8UA 3ENHA 4CQEA 4R7IA 3GOKA 4P90A 4C58A 4FT0A 2O64A 2QHMA 5JEBA 4DFUA 3NCZA 3P0MA 2R3MA 2QOIA 2ZYBA 3DBEA 3CY3A 3NR9A 4FZDB 3VQHA 4BIEA 3UO6A 3NZ0A 5FEQA 4BCIA 1YI3A 4EH2A 3HUCA 3QGWA 4L7SA 4UZHA 4QMNA 1KOBA 4KAOA 4H05A 2HZIA 2O63A 3ZM4A 4JDJA 1OL6A 4G3DA 3V5LA 3NUNA 4NJ3A 1YDRE 4FGRA 2HZ0A 2X8DA 4RRVA 4E5WA 2BFYA 5CU3A 5HBHA 4QYGA 3TJDA 3QQUA 1NT2A 5CALA 4RMZA 3QKKA 1WFCA 3C5UA 2IVSA 4HGTA 3UO5A 1WBTA 3QTRA 3EH9A 4W8EA 5E8VA 1OIYA 4ANQA 2QC6A 3AMYA 4QOXA 4U79A 5T68A 1P4OA 3Q4CA 4X2KA 5JQ8A 2XEYA 3I79A 4R3RA 5IDNA 2R3LA 3RPOA 4I6QA 3O23A 4WUNA 5FXQA 5J79A 5KBRA 3MY0A 3SXFA 3PIYA 3GU5A 2PVRA 3H9RA 4FV0A 4LOQA 4CT1A 5J5TA 4F7SA 4BBEA 3ORLA 4FTOA 4C02A 3LFQA 3DTWA 1Q4LA 3ORNA 4XYFA 1ZWSA 3PIZA 5E8TA 2E9UA 4BVUA 3AC2A 3Q2JA 1RQQA 2PVLA 1XH8A 3LM5A 4GMYA 4ITIA 3VRZA 3G15A 3PWYA 1ZLTA 3OROA 4K1BA 4C33A 5M55A 4KNBA 2XJ2A 4JRVA 3R9DA 4RX7A 5JFWA 4V04A 4NM3A 3PPJA 5H9BA 4AT5A 1H01A 3DB8A 3LFCA 3ZFXA 4PTEA 3P78A 4O1PA 3ZSGA 4MX9A 3ORMA 5KX8A 3VS7A 2QOHA 5FM2A 3VUHA 3A7FA 1ZZLA 2YCQA 4BGHA 2W96B 3BRBA 4I6BA 1ZY4A 4HPTE 2XZSA 4DE4A 2GNLA 3NVKI 3HRCA 4NM5A 3UYTA 5H8BA 4H1MA 4NM7A 4FE2A 2E9VA 2E9OA 2BRGA 3ORIA 4EOJA 2C5OA 1SVEA 4M12A 2C0IA 5FLFA 4ZJIA 1ZMUA 3TV6A 5HE3A 1B39A 2EXMA 4G3FA 3PXFA 4JRNA 5DT3A 3CTJA 3KKVA 3CGFA 2UZBA 3AD4A 4N70A 4O7YA 5HQ0A 4O0YA 3R00A 2RSVA 3VJNA 1UU3A 3IK3A 2XCKA 4FV8A 4D4VA 5A4EA 5L6PA 4EH4A 1SNUA 3LE6A 3QAME 4CKJA 1F0QA 3LIJA 2Z7QA 1L3RE 2C69A 3ORPA 4KKGA 1R39A 2W4JA 3II5A 4M66A 4X21A 2UZNA 5GNKA 2HW7A 4BI1A 4O81A 4X2GA 5EM7A 4PMMA 5IUHA 1Y8YA 4RSSA 3GCQA 3V04A 3GQIA 4DGOA 4FZ7A 3D15A 1SYKA 5DE2A 3VF8A 2AC3A 3QZIA 4WOVA 3SOAA 1BKXA 4JG7A 3TV7A 4IJPA 2B9JA 3FQSA 1ZOHA 3FY0A 2R3NA 2GFSA 4ONAA 3WOWA 2HOGA 3F3WA 2GHMA 1V0OA 3IONA 3RBWA 3OW3A 4M3QA 4ASEA 1H1QA 3QZFA 2E2BA 4QTBA 4NCTC 2WMSA 4EEVA 3LQ5A 1RJBA 3HKOA 4EYMA 5IZFA 2F2UA 3CXWA 4W9XA 3WZEA 4FV3A 5IPJA 1H4LA 2ITUA 2BDWA 2XNBA 1FPUA 3RZFA 4BGGA 3EMGA 2JBOA 4WG4A 4MVFA 4O0TA 5EYKA 2X2LA 3BPRA 3GI3A 3LFBA 5L8JA 4F08A 1QCFA 3E63A 3OWJA 2RF9A 2WTCA 3PE2A 4APCA 4OGRA 3NNWA 4GRBA 3U9NA 3PXRA 2PVYA 4OR5A 3SG8A 5FWKK 3MSSA 4M0ZA 5M56A 5EW3A 1SMHA 5CTPA 1GOLA 1H27A 4RQKA 2W1DA 4OTFA 4DEIA 4AP7A 5IQDA 4X2NA 5B2LA 3DA6A 3SHEA 4FKVA 3CTHA 2FA2A 1KV1A 2GCDA 3Q6UA 4LOPA 4TYEA 3WZKA 4YLLA 3RAWA 2ZV2A 3VVHA 4C0TA 5BVDA 2V62A 4G2FA 2XK4A 4KIQA 4ZOGA 4YNEA 3H9FA 2H96A 4NSTA 3ZXTA 3EN9A 3QQFA 2BFXA 4O96A 4E4LA 1ZYCA 2YM3A 2P2HA 5AV3A 5J1WA 2VTPA 3LCOA 3S1HA 2OFUA 3NCGA 3VC4A 5GJDA 3D9VA 4RBLA 2JEDA 5EI6A 4KS7A 3AT4A 5BVOA 2ZDUA 1IEPA 2J50A 3Q2MA 3TJCA 3S00A 2Q83A 2R0UA 3A7IA 4FG9A 4XX9A 5EH0A 4D4RA 3GGFA 1H00A 1OL7A 3FZOA 1Q8TA 3C1XA 4NCTA 4G6NA 2PE1A 3EYHA 4K77A 5HLPA 4WBOA 4FIEA 3SXSA 3VUDA 3MTLA 3M1SA 4CFNA 2O0UA 3ZUTA 2HWOA 4B9DA 4IAAA 3CKWA 3MFSA 3QRKA 5AR7A 5H2UA 3PLAE 1PXPA 3TNPC 4UYAA 2EXEA 3NUPA 3BQCA 4QMLA 4QT1A 4AZVA 5BYYA 4BDAA 4G34A 3CSVA 2XB7A 5B7VA 3NYVA 2P2IA 4AX8A 3R8PA 3HGKA 3ERKA 3I0OA 4MD8E 1OPKA 1TKIA 4CNHA 4D0WA 2BPMA 4BGQA 1F3MC 4JR3A 1B6CB 2C6OA 4PL3A 3IKAA 3B2WA 5AAEA 2WXVA 1XO2B 3TKHA 2CDZA 2OXYA 4D0XA 4ZMEA 2QONA 4EH3A 1OITA 3PSDA 4L43A 2Z02A 4K0YA 4GJ3A 5ETAA 5A3XA 3DB6A 3R9NA 3DAJA 2C6KA 4LRJA 3QZGA 4RIXB 5AUUA 2PVMA 2QOLA 3Q5ZA 1JKSA 2UW0A 1PKDA 2XK7A 4HZSA 4RC2A 3QUPA 3D5WA 4TNBA 3W8QA 2XF0A 1RW8A 5I9YA 3T3UA 2XIRA 5E92A 1H07A 3NUUA 4E20A 2R64A 3OUKA 3V8SA 3JYAA 2XKEA 4Y73A 3GT8A 3FYJX 3ULZA 3RNIA 5HCZA 5L6OA 1YXUA 4RVMA 4RWKA 4U42A 3T9IA 3MY5A 5HTCA 3F82A 3FI8A 1T46A 2GSFA 3DBCA 3PJ3A 4WUAA 2I7QA 3LCSA 2PL0A 4D9TA 3W55A 4DEBA 4KABA 1YWRA 1Y91A 2I1MA 2UZVA 2DQ7X 4GV1A 5FP5A 4G5PA 4FTIA 3E62A 3MFTA 4QYEA 1Q5KA 4OBOA 4GS6A 1PYEA 4FTLA 3HAVA 4EC8A 5AV0A 1VR2A 3OOMA 1XH5A 2W1FA 1SVGA 2XA4A 4NT4A 3KF7A 3DNEA 4OTGA 4BBMA 4IC8A 2UW5A 2WMVA 3OF0A 1WBSA 3I81A 3PY0A 5AIKA 4BCNA 4PNKA 2P3GX 5E8YA 5HG7A 3VQUA 2JITA 3BGZA 4GYIA 5AMNA 3R9HA 1OL5A 5CXZA 3N4TA 5G6VA 2VWWA 2PSQA 4HPUE 2PUIA 3QX2A 4F6WA 2HELA 2VO7A 3PA3A 3WF8A 2JD5A 3DXPA 2R7BA 5IH4A 5FEEA 3RJCA 1Q8UA 3CP9A 3QRTA 4FKQA 2C6LA 3GU6A 5E7RA 3I1AA 3I5ZA 1GY3A 3OXZA 5JQ5A 4P7EA 5FBOA 5KBQA 4FKPA 1SNXA 3R9OA 3PVBA 4I93A 3NVMB 2R3GA 1O9UA 2RKUA 3HDNA 4LGHA 4ZP5A 3NNXA 3OP5A 4MD7E 4U3ZA 3QBNA 2QODA 4D2VA 3EQDA 3MA3A 4L01A 3EYGA 5ANEA 1VYZA 3R2BA 4YJUA 2Y8OA 4EJNA 1ZYLA 4ZSGA 3COKA 2YIWA 5C01A 4TWOA 3UP2A 4C4JA 4D2SA 4PDPA 3MB7A 4AS0A 1X8BA 5AP4A 4TL0A 4QPSA 4FSWA 4BCFA 4EK6A 3OFMA 4OUCA 2ZMDA 4CMUA 4FV9A 5EDQA 5IH5A 4AOTA 4P4CA 4YPSA 4RWJA 3H4JA 4DGMA 4FV4A 4QD6A 4JQ8A 4JNWA 4FVPA 4USDA 3G0EA 1GIIA 4RJ6A 4S30A 1G3NA 4UWCA 4XG9A 4YLKA 4BYIA 3ZBXA 3KXHA 4GUEA 3ZXZA 4RFMA 2ITNA 2ZB1A 5DOSA 3KFAA 5E1SA 4HW7A 5LVPA 3ZRMA 2C68A 4QMWA 4C7TA 1YXVA 4MF0A 3F3ZA 3ODZX 5AAFA 4NH1A 2W99B 2GHGA 5HE0A 4ANLA 3GCSA 4C4EA 2XIXA 2OIDA 5HGIA 3QKLA 3R1YA 1Q41A 5BVEA 1O6KA 1JKTA 2VO0A 2XCHA 5CI7A 3Q32A 4NL0A 2CNVA 2VTRA 3D83A 2X2KA 3L8XA 1M52A 5JMSA 5AUTA 3BE9A 3E5AA 1BL7A 4FTQA 2BRBA 3GC0A 4ZY5A 2O3PA 5F95A 2EUFB 1DI9A 4JIAA 2VWZA 3O2MA 3ZHPC 4RX9A 1OPLA 4Y8DA 1KOAA 5H8EA 5TR6A 3ZC5A 4ALUA 4BDCA 4ZZOA 3GFEA 5AR4A 1Z9XA 3IW5A 3LMGA 4IB3A 4MQ2A 5AP7A 3T9TA 2JIVA 4CZUA 1CKPA 3F5GA 5IA3A 2RIOA 2SRCA 3KK9A 3W1FA 3WYXA 4R1YA 3Q53A 4XOYA 3C4FA 3VBTA 5D1JA 3C0GA 2J0LA 2QU6A 2JDOA 4XUFA 4NFNA 4QP6A 1PXLA 3P7AA 1GAGA 4O2PA 2B9FA 3CBLA 2ZAZA 3W2OA 3QX4A 1KE6A 5K9IA 4O7NA 3V5TA 2I0YA 4ACMA 3AOXA 2QOOA 4I23A 4TYGA 4BR3A 5C9CA 1H28A 1FOTA 1XH7A 2BIKB 2BZIB 4GK4A 4B7TA 4GFMA 5CS6A 4EQMA 4GIHA 3EFJA 3U4WA 1ND4A 5D10A 3PLSA 1U59A 3D7ZA 5CENA 4RVKA 5E90A 1T45A 3V01A 4PNIA 4CVAA 4FKJA 4ZZNA 1XHAA 2EWAA 3ZEWA 2GQSA 4KKEA 3DV3A 4IAFA 4BCJA 4YJNA 3DLSA 4Z9LA 2HWPA 4IE9A 2PHKA 5LWNA 3IW7A 2NP8A 4M13A 5DMZA 2BZHB 3DPKA 4K18A 2QHNA 4OTHA 4IZ5A 3C0IA 4G16A 4MBIA 5T3QA 2GNFA 2I0HA 4F9WA 3DJ6A 5KHXA 3JS2A 5CF5A 3BBWA 3ZEPA 2C6TA 4FODA 3ZLYA 3ROCA 4AZTA 4FL3A 4R5SA 5EYDA 4IADA 4NYEA 3GU8A 4HJOA 3FPQA 3O0GA 2CCIA 2OKRA 2P0CA 4I0TA 1H8FA 4M14A 3RK5A 3W2QA 4E26A 3OC1A 2BAKA 2PMIA 4IWQA 3LCKA 3V51A 1EH4A 5EK7A 2PVKA 3QD2B 2XIZA 3BLHA 4K9YA 4KIOA 5AUVA 4AZFA 4YO4A 2DWBA 5CASA 3C4EA 2NRUA 4U44A 4BDFA 2YDJA 4P5ZA 1H1SA 4AT3A 3ZZWA 4FKTA 5DT0A 5HICA 3SLSA 3SQQA 5IMEA 3FXWA 4U41A 1REKA 2W9ZB 4LL5A 1U5QA 3T3VA 4YUQA 2R3HA 3KXMA 4O0WA 3VO3A 4YNOA 3P7BA 4H3QA 5FGKA 4BDEA 4CRLA 3CJGA 3EZRA 1WZYA 2BRNA 4EBWA 3VS6A 3LCDA 4KWPA 2GQRA 3D5VA 2OJIA 3SDJA 4N0SA 4JX7A 3PWDA 4M97A 1NVSA 2G2IA 4YJTA 4EONA 4QMMA 2HXQA 4FSTA 5DYJA 1OI9A 3TKIA 4BRXA 2W9FB 4ITJA 4MXZA 4IFCA 5L2SA 3Q96A 3RALA 4Z16A 4EOOA 4FTKA 3QCQA 3GU7A 3BKBA 3ZDUA 4IWDA 1P4FA 3OWLA 4YO6A 4M0YA 1J3HA 4BCPA 5DA3A 4FV7A 3FUPA 3B2TA 4U6RA 4RVTA 3R8ZA 5KMIA 5CYIA 4B0GA 5HU3A 3TDWA 1K3AA 3BQRA 5D41A 3HAMA 4KKHA 4BTFA 3NIZA 3OY1A 2PZ5A 4LRKA 3O51A 4NJDA 3VULA 2IVUA 3NGAA 3NLBA 4GT4A 4AT4A 1MUOA 3F88A 3NUYA 4K33A 4F1MA 4C61A 3F9NA 4FV5A 2ITQA 4JQ7A 2H6DA 1DAYA 2BKZA 4PPBA 1NY3A 4UMPA 2FSMX 2PVHA 3OCTA 4YGAA 5DFPA 3U51A 1JWHA 4EH6A 2B0QA 1PXKA 3FMDA 5ACKA 5C26A 4O1OA 3UOHA 3JVRA 4ZLOA 4HYSA 4IB5A 4O2ZA 2F7ZE 4QMTA 3GCVA 3FSFA 2XUUA 3BHYA 4YTHA 5C8MA 5JZJA 2XIYA 4FT3A 5M4UA 1R0EA 2GS7A 4F6SA 5J9ZA 2BDJA 5M4FA 2R3QA 3R04A 4QMQA 2YJSA 3OT3A 4M68A 3LZBA 3R7VA 2FH9A 4XV9A 2W06A 5EOBA 4FX3A 1OECA 4QQTA 2GHLA 3TXOA 3OBGA 3RHXA 4CG9A 3RAHA 4OTQA 4BI2A 4TWCA 5BX0A 4IVDA 5AUXA 4KUJA 4I4FA 4IB1A 3RZBA 4AFEA 2VNYA 4CXAA 1IAJA 3TIYA 2Y9QA 4FV2A 4FTUA 4DGNA 3NMUF 3WZDA 1MRUA 1OGUA 4DLJA 5A54A 3R83A 5AAGA 4IAIA 2HY0A 5I9WA 2IZUA 4PDSA 1GZ8A 2XYNA 4R8QA 5BQ0A 1JSUA 3ORKA 5AX3A 4FTNA 3BEAA 4X6RA 2QD9A 5BNJA 2PVNA 4DAWA 4P5QA 2V55A 2OXXA 4XRLA 2HAKA 4MYGA 3BELA 3H10A 4MXYA 4TWPA 4RJ7A 3PY1A 4I5CA 3HMMA 4AE6A 4ZTMA 3UP7A 1W8CA 1UWJA 3QA8A 3KGAA 2ZOQA 2RFDA 4YZDA 3AT3A 2WIHA 1W84A 4W4WA 4PUZA 4RA5A 4TWNA 3W33A 3HV6A 3UPXA 3IS5A 4JAIA 3WIKA 3MVLA 2VTSA 4EH7A 4A9YA 3THBA 5I0BA 5AUYA 5FBNC 2R3OA 4YHTA 4CKIA 1YXXA 4X2FA 5CU0A 2YDIA 4IX5A 2UZWE 5EYCA 2NPQA 5KHWA 2OI4X 3E92A 4ERKA 2W1IA 3FHRA 5I4NA 5AX9A 3IPHA 3SKCA 3C5IA 1YQJA 5A4LA 2JKKA 1WBNA 5KZIA 5KKRC 4UV0A 4MXAA 3HV4A 1PMUA 3R30A 5AR2A 4OTPA 3FLZA 5ANJA 5HIEA 2JC6A 5C27A 3HMIA 4PRJA 4UXQA 4F4PA 2YJRA 4LUEA 4RIYA 4FYOA 3RNYA 3RPRA 1J7UA 3KB7A 3FWQA 4CT2A 3RGFA 3ZTXA 2HIWA 2F7EE 4J98A 2HK5A 5IQBA 3FLNC 4CLJA 2CNQA 2UZUE 3GC8A 2C5XA 3LXKA 2VO3A 5EDRA 2HZNA 3UVRA 3OG7A 3SW4A 4AA4A 4EOPA 5B2KA 4BL1A 2A1AB 4Q2AA 3PJ2A 2VWXA 3DU8A 4FT9A 3TM0A 3D0EA 5IU2A 4KBAA 3UNKA 2UZLA 5LARA 5FM3A 4JBQA 2Z7LA 3CLYA 4L00A 4ANBA 4B99A 4CFMA 3D5UA 2GU8A 4LMUA 3AXWA 3QRJA 4PX6A 1MQ4A 4TPTA 3EFKA 2VGPA 2XS0A 3FMHA 4QMVA 4YSJA 4O0SA 5D12A 2W1HA 3OW4A 2WTVA 2RFNA 4HYHA 5HOAA 2X6EA 4L53A 2YIYA 4ORKA 4FEVA 2X9FA 3BYVA 4WKQA 1JVPP 5A6NA 5AA9A 2HCKA 2WAJA 5CNNA 4ZTNA 3ZUUA 4X3JA 5DHJA 1U54A 3ALOA 3PVUA 1PMVA 3QCXA 3BU6A 2YIRA 5JGBA 3UQFA 2BIYA 3LFSA 4R77A 4WG5A 3TUBA 2ITWA 5AUZA 2W17A 4S34A 2OICA 5EM8A 3DKGA 1UWHA 5J5SA 2C6EA 2QNJA 3I6UA 3PXYA 3Q60A 4IVBA 3S2PA 4A9SA 4ANNA 4DF3A 4FKOA 4X0MA 4BCGA 1LEWA 2VTQA 3FZ1A 4IAKA 5GINE 2WU6A 4CYJA 3UIXA 4FG7A 4I24A 4O6LA 4ERWA 3W2PA 5LMAA 2R7IA 4QTDA 2XNEA 1H24A 4FVQA 4S2ZA 4E1ZA 5ANDA 4KB8A 1JBPE 3C4XA 5TKDA 2PVFA 3OMVA 5BVWA 5JFVA 4RPVA 1Y57A 5HLWA 4FKUA 4C62A 1G5SA 4F1TA 3U54A 4DT8A 3ANRA 4FTCA 5CSXA 4Z7HA 2BROA 4G5JA 3I0QA 5J7HA 4I94A 4AOIA 3MPTA 3ZRKA 4A7CA 2G15A 3VUIA 2Q0BA 3BV3A 3KXNA 3VAPA 5EQEA 1JQHA 2UW4A 4A06A 5KMKA 4X3FC 3LJ0A 3E8EA 4C2WA 2Z2WA 1NVRA 2BHEA 5IEXA 2WTWA 3EQBA 4MBJA 4FSRA 3SG9A 2XM8A 3QQKA 4UXLA 5T6KA 3ZYAA 5E8XA 1DM2A 3PP0A 5AFVA 3RINA 4AFJA 3F2AA 4D28A 4D1SA 2Y4IC 2YCFA 1YI6A 1Q97A 3LCTA 3FC2A 4JOAA 2W05A 4ALWA 2OGVA 5DR2A 1ZMVA 2I6LA 3F5PA 5AIRA 3C13A 3WF6A 3ZLSA 2OJJA 4IJ9A 4RVLA 3QTQA 5E1EA 4GK2A 4UYNA 3L9PA 1V1KA 3DT1A 4IAYA 5D11A 4XV1A 5KZ0A 4XS2A 4IFGA 3NUXA 2GDOA 4C3RA 4JG6A 2XYUA 3CQUA 2B52A 2J5FA 1VYWA 3V5JA 4O86A 2QQ7A 3QTWA 4LFIA 2QOCA 3GP0A 2VO6A 4ACDA 4TY1A 4R3PA 5DWRA 1J7LA 1BI7A 4JS8A 3VBXA 4ZAUA 5DN3A 2VTJA 3L1SA 2XRUA 4CGAA 3L9NA 3VNTA 4PPCA 4FTTA 3EQGA 2V0DA 3LFEA 4RG0A 4F7NA 1XBBA 5LCJA 4ZSEA 2YWVA 4USFA 2Q0NA 3VHEA 4AAAA 4L52A 2OLCA 4U45A 3EKKA 3VS3A 3A8WA 4C8BA 3F5UA 3V6RA 4DEDA 3C9WA 4F7JA 4GIIA 2QR7A 3A4OX 3CIKA 3HECA 5F4NA 4DH7A 1FMOE 4GH2A 1Y8GA 3FMEA 2C6IA 3OOGA 3V6SA 4O7LA 4I6FA 4PY1A 2YAKA 4UB7A 2GFCA 3TL8A 3N51A 2UW7A 2XK9A 4MWHA 3MH2A 3E7VA 3G51A 3OS3A 4CFUA 5AM6A 2ERKA 3CR0A 4QMPA 3C50A 3PPKA 3QU0A 4JXFA 4XLVA 3MVMA 3PFQA 1DS5A 5IA5A 2YN8A 4OBPA 4NEUA 2PMLX 2WQOA 3NSZA 4L3JA 4JDKA 4O82A 5CZIA 2ITVA 3FQHA 3K5VA 4F64A 2JDRA 3FV8A 4YR8A 5AADA 4XP3A 4DBXA 3F6XA 5A14A 4O6EA 3E88A 2CGVA 1IASA 4XV2A 5JN2A 4V01A 3FKOA 3FXZA 1XH9A 2WMQA 1ZXEA 4QNYA 4ANSA 1QPJA 3C4ZA 3PJ1A 4U97A 4C34A 3TZMA 2UV2A 3CC6A 4ZTHA 3UIMA 2O2UA 2R3RA 3FI2A 2XH5A 4FMQA 4AACA 2B1PA 4AN2A 5BUIA 5L2QA 3U6JA 3VS0A 3ATSA 4WNPA 3F7WA 4XG2A 1LEZA 4IANA 4JBVA 2R3IA 1OIUA 2QO9A 3QLGA 4CYIA 3EKNA 4F9BA 3HA8A 2GNIA 2RFEA 4XBUA 5CANA 3FKLA 4O7VA 2JDTA 3Q9XA 5HNGA 4OTWA 5M09A 3LXPA 1JPAA 3DBQA 4H58A 4YJOA 3KRRA 4RC4A 5JRSA 3V5PA 4DCEA 4QPAA 1FINA 1REJA 4D2WA 3P5KA 4AUAA 4CKRA 3OCSA 4PTCA 5IEYA 4E4XA 5M08A 2WELA 3RCJA 2WNTA 2W5HA 3UYSA 1QPCA 3JY0A 1PXMA 2F9GA 4FICA 3VUMA 2UZTA 3VS1A 1Z5MA 3DKFA 4TNDA 3ZO1A 2WTJA 3Q9YA 4PPAA 5FRIA 4U7ZA 1YW2A 3C51A 5I5ZA 2UW6A 4DBNA 1W98A 2VX0A 3CQWA 5K0XA 4E4MA 5HEZA 4F0GA 3ROYA 4B8LA 3UQCA 4TYJA 5CT0A 4GJ2A 5EFQA 4IZAA 4DTBA 4DEGA 3W10A 4BCKA 4RWLA 2UW9A 4UWBA 5ACBC 1H1PA 2OIBA 3KQ7A 4UMUA 3R02A 4EOKA 2VWIA 3GFWA 3MI9A 3I7BA 4EOIA 3IOPA 4I6HA 1PXJA 3IDPA 3A2CA 5I9UA 4RIYB 4MKCA 4V05A 4L3PA 5CEMA 1H26A 2RGPA 3P7CA 4LOOA 4F0FA 4AGCA 4EBVA 1FMKA 4YURA 3ACJA 4D2RA 4NIFA 3WARA 3CPBA 4S33A 4CTCA 2WU7A 3QGYA 3FLQA 2WEIA 2HY81 4YJQA 4EQUA 4FK3A 4NTSA 3EZVA 4IM0A 3VS4A 5I9VA 5AWMA 2H34A 2P55A 2OU7A 2VX3A 2YZLA 4MAOA 1MP8A 3VRYA 2YACA 3UNZA 4JBOA 2OK1A 3BHTA 3F3UA 3LFDA 2XIKA 5E8ZA 2XKDA 5F1ZA 1NVQA 3FC1X 3KF4A 4G3CA 4NW5A 4Y46A 5TF9A 4BZOA 2BAQA 3UG1A 3WZJA 5TO8A 4F9CA 1BL6A 2C1BA 1TQMA 5HI2A 2G9XA 5EKOA 4O7SA 5EI2A 1R1WA 4X2JA 3DK3A 5EOLA 4BDHA 3ZSIA 5KKRB 2PUPA 3VIDA 2R3JA 2VTNA 3GNIB 5BUJA 4CV8A 3FZPA 1U54B 3GCPA 4XOZA 2GMXA 4RJ4A 4W4VA 2GNGA 4BCMA 4C4FA 3W2SA 2WMUA 3NAYA 2OW3A 2IO6A 3FEGA 1BUHA 1XBCA 3R71A 2REIA 3BHHA 3B8QA 2BDFA 4HVIA 3ODYX 1PMNA 1UNLA 3JUHA 3EN6A 4FKGA 4FEWA 2YHVA 4FSNA 4ZSLA 2J0KA 3KA0A 3KCFA 3CPCA 4QQ5A 1WBWA 1G8AA 4F63A 5BVNA 5AV1A 3VS2A 1ZY5A 2W1CA 3I6WA 4OTRA 4IEBA 1OKVA 4JG8A 5KUPA 3S0OA 1NXKA 4ACCA 1ZAOA 3W32A 4Z7GA 5FUTA 4EOMA 4O21A 4F6UA 5JSMA 4D9UA 1P5EA 2JDSA 2WTKC 3ZRLA 2BTSA 3WF5A 2X4ZA 1U4DA 4EZ3A 2ZV8A 3PE1A 4WO5A 5HO6A 2Y7JA 2EU9A 1M7QA 1WMKA 3G90X 1YDSE 3MIAA 2Z8CA 3LXLA 3MFUA 3P9JA 1PXNA 4FG8A 5IQGA 4OBQA 4F99A 3A7JA 3QD3A 3O71A 2WHBA 5JZNA 2X4FA 3FLYA 4J53A 5FD2A 2OJFE 2G2FA 4IDVA 2GPHA 4FIFA 4DH3A 3RM6A 2PE0A 2BTRA 3QLFA 4E5AX 2FYSA 2W7XA 4RJ8A 2XMYA 3WF7A 4GK3A 2W1GA 4FOCA 1ZYDA 4GSBA 5FG8A 4BDGA 2CSNA 4FSZA 2QKRA 2W1ZA 3ETAA 4MBLA 4DFNA 4M69A 1YHSA 4I20A 4S31A 2Y6MA 4K8AA 2RG5A 5LMKC 4X6QC 3UDBA 4D2PA 2OFVA 3D14A 4TXCA 2PPQA 5IA0A 2IJMA 4ZIMA 2HENA 4L3LA 4JJRA 2J6MA 5L6WL 4GCJA 3OY3A 3TN8A 3DNDA 4G3EA 3RPYA 4BCHA 1IA9A 5IQAA 2BZJA 4PDYA 1XR1A 3BGPA 5H8GA 3R8VA 1H0WA 2YERA 3A60A 3RHKA 4D2TA 3KC3A 2OZAA 2PZPA 3DJ7A 3DQXA 3PXQA 4MCVA 2X8EA 5KE0A 3DCVA 4ASDA 4FKLA 3RAKA 3IG7A 5BVKA 4BBFA 3M11A 4F1OA 2QO7A 3KVWA 5JGAA 2ITXA 1YRPA 4G9CA 1YXSA 4O22A 3RKBA 2CKPA 5IUIA 4I0RA 5CSVA 4OT5A 3MYGA 3AMAA 3JPVA 5IH6A 3G9LX 4IVCA 5HD4A 4BCOA 1NW1A 3L9MA 2QO2A 2WMRA 3AGMA 1JKLA 3A62A 3MPMA 2YM5A 3QRUA 1ZMWA 5J7BA 1WBVA 3UBDA 5HIDA 5EI8A 4G1WA 5J95A 2VU3A 4U40A 4U8ZA 4KA3A 3WF9A 3A7HA 2P33A 4Z55A 4FL2A 3DFCB 5DRDA 2GNJA 4BB4A 5C1QB 5TE0A 2J9MA 4TYHA 4EHEA 2FB8A 3Q04A 3QRIA 2AYPA 4DEHA 4DH1A 2DS1A 2C0OA 3EQRA 4C4IA 4XV3A 5L3AA 3MA6A 4FZFB 1QPEA 4EKLA 5LVNA 5KO1A 1AGWA 1H25A 4CMTA 4IZ7A 1FBNA 3KXGA 2VWVA 1LPUA 1ZZ2A 4JAJA 4XP2A 4F9YA 2BR1A 3H0YA 3I60A 3TTIA 3PVGA 5HKMA 5K4IA 5HG8A 3E64A 4UWYA 2EB3A 3K2LA 3R6XA 1TVOA 3QYWA 4ARKA 1ZYJA 4BZDA 3DTCA 5HBEA 2CMWA 4LQMA 3ALNA 4XNEA 4HVSA 5AP3A 4FNYA 3ZM9A 5BMMA 2QVSE 1XWSA 3Q5IA 5DGZA 2PTKA 4LM5A 3BYMA 2J5EA 1KV2A 3KULA 4IIRA 5JT2A 2W0JA 2Y6OA 2CCHA 5DIAA 3TZ8A 3A4PA 2X9EA 4AXAA 3HLLA 3E3PA 5HLNA 4EWHA 4GYGA 3PRFA 4CCUA 2CKOA 4BDDA 3EQHA 4FR4A 4AOJA 2XK8A 4ENYA 5IG1A 4DTKA 2UVZA 4IWOA 4BKJA 4M8TA 1SM2A 5L8LA 1M2PA 1OPJA 3EIDA 3I5NA 4WIHA 2VX1A 1YOLA 3EJ1A 5CZHA 3N4VA 2WMAA 4J7BA 3TACA 5H3QA 2J7TA 3SOCA 1M14A 3MFRA 5LVMA 3DGKA 4FNXA 2R0IA 2NO3A 3E7OA 4NKSA 5C8NA 1R3CA 2IW9A 3OTVA 3TG1A 4O84A 4ASZA 3BWJA 1Q3WA 2VWUA 3F66A 1PF8A 1ZARA 3FYKX 3QC4A 4NUSA 4C2VA 5HTIA 2EVAA 5EW9A 3BHVA 3ID6C 2XNNA 3LFNA 5GJGA 3NNVA 5M53A 2IG7A 2ZMCA 4LV8A 1P14A 1YDTE 4E93A 4QP7A 1VJYA 3TCPA 1KE5A 2QU5A 3G0FA 4FSQA 4HCVA 4ZTSA 5AP5A 2QG5A 4RX8A 2X1NA 4FKRA 4MQ1A 4YPDA 3C4WA 2A4LA 1UV5A 3FL5A 4NIFB 3E87A 4FK6A 3BYOA 5M07A 1JAMA 4FTRA 4QP1A 4OAUC 3ZMMA 2CGWA 2UVYA 3EQCA 4B8MA 2ITYA 5CF8A 3DXNA 1Y6BA 3LOKA 2ONLC 2BALA 1JSVA 4AZWA 2J0JA 5DPVA 5BVFA 2ETMA 4H36A 3QHRA 2UW3A 3MDYA 2PK9A 4LYNA 5CEOA 3K3JA 3MWUA 4CQGA 3ZLXA 2BZKB 4DFZE 2BILB 3V5WA 3R1SA 1FQ1B
chains in the Genus database with same CATH superfamily
3HP2A 4K6ZA 4E6CA 4MUQA 3HEGA 3MW1A 4AZEA 5DEWA 1YOJA 3H0ZA 3QTZA 3KVXA 2XM9A 2HYYA 2V5QA 2R5TA 2W5BA 2FO0A 3EQFA 4QYYA 5FQDC 4DGLC 1UU7A 1UU9A 2PWLA 2ZJWA 4HNIA 2R2PA 2XNPA 4XG8A 4QMXA 3BBTB 3OZ6A 5A6OA 4DFBA 1XKKA 3D2IA 2C3IB 5IA2A 2X0OA 4WRSA 2UZDA 3IDCA 5J9YA 4FTJA 1ZRZA 4ZSAA 3EWHA 4C4HA 2QURA 3R7UA 4O0RA 4U80A 4TT7A 3IW8A 1UVRA 4RFYA 3NW5A 5FDXA 3QTUA 4LUDA 3ITZA 4O7ZA 5CWZA 2W5AA 1Y6AA 3DAEA 4QYFA 5L4QA 3OBJA 2V7OA 1FVVA 5E91A 3I4BA 5JRQA 2JIUA 5LMBA 1CMKE 4PV0A 4BJJA 3RWQA 4H3BA 2OXDA 4KRCA 4MXCA 4RFZA 2YEXA 3AC5A 4YBKA 5DR9A 2JKMA 3DK7A 4RX5A 3UIBA 4EZ7A 3LFFA 4TW9A 3TV4A 3UO4A 2IEWA 2QR8A 5DG5A 5EG3A 4ZXTA 3MTFA 3KY2A 4ZLZA 2PZIA 4UMTA 4JQEA 3P23A 3A8XA 3R28A 4E8AA 1AQ1A 3A61A 4N6YA 5IMXA 4I22A 4IW0A 3R01A 3R22A 4FSUA 2DUVA 1TQIA 1FVTA 1NA7A 3TEIA 5EHOA 3GENA 1W7HA 4J52A 2IN6A 4J95A 4NM0A 3R8UA 2VTHA 3VUGA 2WMXA 1PY5A 2I0VA 4IMYA 4MF1A 5HZNA 3OXIA 4IH8A 4ZK5A 1JOWB 2B54A 5IKWA 3DOGA 5F9EA 4W4YA 1OIRA 4CSVA 3FZTA 2A0CX 1OMWA 4OLIA 2ESMA 5KMNA 4C38A 2X6DA 3E8CA 3G9NA 2GNHA 3LMHA 4PMTA 3OEFX 1OGYA 4C57A 3HYHA 5CLPA 5CAUA 1LR4A 4JT3A 1OIQA 4UEUA 3UZPA 4D1ZA 2IZRA 4FNWA 4YHFA 4M69B 2BAJA 4WBBB 3D5XA 4BZNA 2PMOX 3NX8A 4EZ5A 2CKQA 4E4NA 4DHJA 3RM7A 2FSOX 3WE8A 3LFAA 4PTGA 4J1RA 2VTMA 4HCUA 4YSMA 3ZO2A 1M7NA 3GEQA 4UN0C 1JNKA 4HGSA 2C3KA 3UG2A 1G8SA 5E8SA 4I3ZA 4BI0A 4N57A 4YP8A 4DFYA 3LLAA 2C6DA 3MESA 5DEYA 5G1XA 4TTHB 2IF8A 2OZAB 2UVXA 3DS6A 3HL7A 2WOUA 4MNFA 2KULA 4W9WA 3Q4TA 2O65A 3SRVA 4CTBA 5IUGA 1UU8A 4JL9A 4RA4A 3OTUA 4B6LA 5K4JA 3PG3A 4LGGA 4AW1A 2YIXA 5J9LA 2CLXA 3KEXA 3F2NA 4KIKA 2EXCX 4O38A 4BHNA 4XG3A 5FTGA 3O7LD 4FYNA 4BKYA 4Q9ZA 3IOKA 3W16A 3C0HA 3NS9A 5IF1A 3MN3A 2B53A 4I4EA 1BLXA 5HD7A 5HO8A 3V5QA 4BF2A 4BTJA 4CD0A 4YJRA 2PUUA 3O7LB 5F94A 3RTPA 3Q6WA 4YJPA 3U87A 4J71A 4AW2A 1OM1A 3ENMA 2F4JA 4JBPA 1GZNA 4NZWB 3BZ3A 4D4YA 2WEVA 4TYHB 4L67A 5CVFA 3ATTA 3PJ8A 5AR3A 3WILA 2YM7A 3QALE 1W83A 3ZONA 5GHVA 1W82A 2J0MB 3NUSA 4QRCA 2FGIA 3C7QA 3ET7A 2C30A 3MPAA 4ASXA 3KRWA 4UMQA 5BUEA 4J8MA 5CF6A 1XQZA 3F7ZA 1AD5A 1GZKA 5GJFA 3UPZA 1A06A 4QPMA 1E1XA 3VW8A 4I5PA 5CT7A 5EDPA 1UNHA 4D5KA 4O7WA 4O4DA 5JFXA 1IAHA 2F49A 1CM8A 2CHLA 2WQBA 3BYUA 4HYUA 5E8WA 5FTOA 4EC9A 5EQYA 3BLQA 5M51A 3RK7A 2W4OA 4Y83A 3PY3A 2A19B 4GU6A 3LQ8A 4Y5HA 1H0VA 4D1XA 3IECA 5DBXA 1ST0A 2ZV9A 3Q52A 3KULB 1FVRA 2C6MA 1SVHA 3QFVA 4YJSA 4QTAA 1KE7A 4FNZA 3PXKA 5CF4A 1PRYA 4M7IA 5HNIX 5CU2A 4A9RA 4ZS4A 5ANOA 1OKYA 3UMXA 3HRFA 2BRMA 1URCA 4KS8A 1MQBA 3VN9A 4A4LA 4CRSA 4U9AA 1FGKA 4F70A 4K11A 5HVJA 1E9HA 1OVEA 2UZOA 2IZTA 5KCVA 3LKMA 2PMNX 3CQEA 3PDTA 4MEDA 4DFLA 3JR1A 3DKOA 3ELJA 2GQGA 5J8IA 3G2FA 4EL9A 5L8KA 3D7TA 3PVWA 4FIJA 3HDMA 4WNMA 4FEUA 3PSBA 4GKHA 3I7CA 4V0GA 3AC1A 3MH0A 3QWKA 4PWNA 3EFLA 2JDVA 3MY1A 4L6QA 5CEQA 2XJ0A 4JR7A 4E73A 2E9NA 2J4ZA 2QLQA 3FMKA 1GNGA 4MD9E 4PDOA 2YLFA 2GS2A 3UMWA 4PMPA 2PZRA 2WGJA 3SD0A 2J2IB 3P4KA 4JLCA 1OUKA 4O83A 3KL8A 5EHLA 1R78A 4NTTA 5E4HA 3P5JC 2VAGA 3HMOA 4YC3A 3UE4A 2J0IA 2F7XE 4BWKA 4BWPA 4JVGA 3WE4A 2C5YA 1WAKA 5CU4A 2HW6A 3DBFA 4M84A 2C5NA 2I40A 3EQIA 5ETIA 3RK9A 4H39A 2VNWA 1QMZA 3EN4A 4BC6A 4IC7A 5AR5A 3R7YA 4RIWA 4RQVA 3D2KA 3KMWA 4AGWA 4C3PA 4EK5A 2PUNA 4CFXA 4BFMA 1YHWA 4KBKA 4L9IA 4YZ9A 3SGCA 3NIEA 5AR8A 3EFWA 4N4SA 2JBPA 4C3FA 5ANIA 3R7OA 3S4QA 4FSYA 3TWJA 1IR3A 3CY2A 5L2IA 2VWBA 3MH1A 5BYLA 2ZV7A 3L8SA 4IB0A 3MJ2A 5IA1A 4FZAB 1PKGA 3MGYA 3LLTA 1Q99A 1HCLA 3KMUA 4YZMA 4DG3E 3E8NA 4L8MA 3QTSA 3SX9A 5CX9A 3VJOA 4A4OA 4FEQA 4ZSJA 5I3RA 3UC4A 2XK6A 4RLKA 2C3LA 3TUCA 4LG4A 4BDJA 3ANQA 3TZ7A 2W4KA 4DA5A 2WTDA 5JH6A 2YABA 5M4CA 3NFFB 2YM4A 4G17A 1WVYA 3KN6A 3R1QA 3U8WA 3W0PA 5IQEA 3DLZA 2YM8A 4AA5A 2X8IA 2ERZE 2OIQA 2XRWA 3BIZA 4X3FA 3SAYA 3AKJA 2C4GA 4CG8A 4BICA 5A4QA 3BGQA 4Y5QA 3UOJA 3QF9A 5GIOE 2B9HA 4NK9A 1OKWA 2HZ4A 4A9TA 5GZAA 2C47A 3NYNA 1ZOGA 3KRLA 4KIPA 2CKEA 2FUMA 2VTTA 2XNOA 3SC1A 3HMNA 4GUBA 3PSCA 4IQ6A 3ZH8A 4F9AA 4O91A 3IQ7A 4DC2A 4AXDA 4EOLA 4GT5A 3WYYA 3Q3BA 5KMOA 1J1BA 4BYJA 4IDTA 5CAVA 4C59A 2IW8A 5A4CA 3NEWA 4EYJA 4Z3VA 2H8HA 2X7OA 5ICPA 3FJQE 3QQHA 5CQWA 4LV7A 2YLEA 3POZA 3ORXA 4I0SA 4HVHA 4GFGA 5CY3A 2ZB0A 4L7FA 3QA0A 2QOBA 3R73A 5CNOA 4PMSA 3CTQA 2OBJA 2OJGA 4H3PA 1TQPA 4BKZA 4DITA 5HG5A 4GL9A 4YZNA 3F5XA 3CJFA 4WG3A 3KCKA 3IGGA 5HE1A 5KMMA 4UZDA 3LVPA 3CD3A 3OCGA 5J1VA 4GVJA 4ZS0A 5A46A 5IQHA 4AG8A 3PUPA 1VEBA 3P79A 3ZSHA 2XNGA 4F09A 2YAAA 5IDPA 4BN1A 4AWIA 3O8PA 4CCBA 3FE3A 5K0KA 5IISA 3DQWA 3QXOA 5L2WA 3NYOA 1OBGA 4USEA 4HZRA 4R1VA 5KMJA 5C4KA 2QI8A 4KINA 2YA9A 4HOKA 3K3IA 4ZZMA 1UNGA 1YHVA 2YFXA 4FIGA 3RAIA 3TDVA 3QKMA 3ZBFA 2X2MA 3FZRA 5CU6A 4QMZA 4DH5A 3GBZA 4KSQA 2IPXA 2XKFA 4S32A 3VHKA 3Q9ZA 2CGXA 3RI1A 3KRJA 3ZC6A 3GC9A 4XEYA 4ZEGA 5LCKA 4JIKA 3PYYA 3FAAA 4E3CA 2WMTA 3GXLA 2Z7SA 5HHWA 3VUKA 1J7IA 4FVRA 5EW8A 3VBVA 3N4UA 4R7HA 4GG5A 5B0XA 3GCUA 1APME 4AW5A 3TUDA 4LGDA 3R63A 4WA9A 4FSMA 3SRVB 4U3YA 4QP8A 4Y95A 4A07A 4EORA 3VBWA 1U5RA 3FMLA 3KK8A 1U46A 3OD6X 3OWKA 1YVJA 2JAVA 4E5BA 1KSWA 4YTFA 2J51A 3GQLA 1G8JA 4PF4A 4KIKB 5D9HA 1Q8WA 3D4QA 3DZOA 4AU8A 4J99A 3RWPA 4E6AA 2LGCA 4FV1A 4IAZA 3CD8A 4MWIA 3UTOA 4EOSA 3JY9A 1KUTA 3EQPA 3GVUA 2YCSA 4ZLYA 3R8LA 3LJ1A 1CTPE 5CEKA 1XJDA 2CN8A 5HBJA 3HMPA 4QNAA 4FUXA 1S9IA 3LXNA 3PZHA 2JGZA 3QYZA 3WBLA 3QZHA 3ZU7A 4D5HA 3TYKA 3GOPA 3RMFA 4OT6A 3TNWA 5HIBA 4CFWA 4GW8A 2IWIA 3BV2A 3OEZA 4FTAA 4XP0A 3FMMA 4IX4A 2LAVA 3UZTA 3DY7A 4MXXA 4D4SA 4FIHA 3W2RA 4XRJA 1WCCA 4R5YA 2QKWB 4EK4A 2ETRA 1J1CA 2VTIA 4BDKA 2R4BA 2RFSA 2YISA 3NDMA 4DCAA 4DH8A 3TI1A 3TNHA 4I21A 3PJCA 2GTMA 4D58A 1PXIA 3QXPA 2IZSA 1Q61A 4O0XA 5HO7A 4ZJVA 5TT7A 3HVCA 5IA4A 4DG0E 2C5VA 4PQNA 5CEIA 2YWPA 3COMA 4G6LA 3F3TA 4QMOA 3U6IA 4C36A 2Z60A 3OWPA 5EKNA 4O27B 4QYHA 4YJVA 3W0NA 2B55A 5DH3A 4G31A 1M17A 3QTXA 3NRMA 3V3VA 3W8LA 4BWXA 1OL1A 3WIGA 3EN5A 3HZTA 4OAVB 3L8VA 1ERKA 3L8PA 1O6YA 3N9XA 3FSKA 4L44A 4RZWA 5CSWA 4AA0A 3U55A 4ANMA 3TIZA 1A48A 5C03A 5IQIA 2JKQA 3CKXA 2XP2A 3ZOSA 4BIBA 4EUTA 5CAQA 4GVAA 3BWFA 4HCTA 5K5NA 5HCXA 1HOWA 4MH7A 4YC6A 2Y4PA 3OT8A 2C1AA 5CAOA 3EN7A 2NRYA 1FGIA 2GS6A 5EYMA 1IRKA 1B38A 4AN9A 2VTAA 2VTLA 4CV9A 3IW6A 2IVTA 3KN5A 3D7TB 1M2QA 2CJMA 5IEVA 4YZBA 4V0GB 4FT7A 4U43A 2QOFA 2XBJA 4D55A 3T8OA 5JGDA 4QMUA 2B4SB 3AT2A 4U81A 3ZO3A 2UUEA 4RC3A 5AP0A 4BDBA 5M57A 2G2HA 2A27A 4UY9A 2OWBA 3LW0A 4JDHA 1UKHA 2YCRA 2XNMA 4O7TA 3DDQA 3HV7A 4DINA 2AUHA 4O0VA 3FDNA 5TOZA 1DI8A 3KMMA 3QD4A 3A7GA 2WFYA 3SXRA 4ZY6A 5AEPA 1PMEA 3SVVA 1QPDA 2OJ9A 3PRIA 5D7VA 3H9OA 2PE2A 3BU3A 4GFOA 4AZSA 4YTIA 4N6ZA 4NW6A 2QG7A 4QP4A 5LXMA 3S3IA 4IACA 2CN5A 2WOTA 4EOQA 2F57A 2R3KA 1K2PA 1RDQE 4UX9A 3ZLWA 1UKIA 3Q4UA 4WRGA 1GJOA 4FIIA 3ZFYA 4F0IA 4PL5A 4RIWB 4Y85A 1RE8A 4EWQA 3DZQA 4IBMA 5CVGA 5JK3A 1YI4A 5J87A 5AP6A 3DBDA 1YWNA 5BYZA 3NPCA 4QDEA 5E9EA 2VWYA 1YWVA 1WBOA 2Z7RA 1ATPE 4EK3A 3V8TA 2CLQA 2FSLX 2WTIA 4L46A 4GEOA 1K9AA 4XHKB 3AQVA 2BUJA 3UJGA 1LP4A 2UW8A 2OF4A 4ZJJA 2XEZA 4IVAA 4RJ5A 5HORA 4NU1A 3AC8A 4QMSA 2ZM4A 2OZOA 4MK0A 4FZ6A 4IHPA 5CXHA 4AN3A 4ZTRA 3P1AA 4XG6A 1CDKA 1KWPA 3H30A 3ZO4A 4AF3A 2R9SA 4BHZA 4CFVA 5JKGA 3U4UA 2RL5A 4EJ7A 4PL4A 4IX6A 1GZOA 2WMBA 1J91A 3AC4A 4FKWA 4HNFA 3BYSA 5K5XA 1XMLA 4X3FB 4R7BA 1OKZA 3BU5A 2CPKE 1P2AA 4EHGA 4MNEA 2X7GA 3EL8A 5LQFA 3FBVA 3KRXA 3R7EA 4KD1A 5B2MA 3OXTA 2G1TA 4A4XA 4Q5HA 2CNUA 3FZSA 2Y4IB 4RJ3A 5EM6A 4XG4A 1VZOA 1JSTA 2UZEA 5F20A 3R8MA 1E1VA 1XH4A 3S95A 2OO8X 3UODA 5I9XA 4RGJA 5FP6A 1JKKA 1UA2A 1KE8A 5BPYA 4MHAA 5LMKA 4WT6A 3PA4A 3BLRA 4ANOA 3R9RA 3NW6A 3CS9A 5AJQA 5M06A 4WSQA 4QP9A 4BCQA 2WO6A 2JLDA 3QQGA 4QO9A 2BKKA 2VGOA 4OW8A 3O17A 3QCYA 2VN9A 4AW0A 3UZRA 4CFFA 4NFMA 4G6OA 3F61A 2XANA 4BTMA 2ITPA 3G5DA 5LVLA 4EH8A 3PP1A 3PG1A 4CMOA 3ULIA 5GIPE 3MIYA 4HGLA 5IQCA 2B9IA 1Q8YA 3G6HA 2IW6A 3O50A 4M15A 4QTEA 2EB2A 1ZYSA 2OG8A 2P4IA 3GUBA 3MH3A 3NUAA 3R7GA 3HV3A 3AD6A 3GU4A 2WB8A 4I5MA 5EHYA 2WPAA 4FOBA 5CVHA 3O96A 3EB0A 1BYGA 4GT3A 1I09A 3LM0A 3HV5A 2ITZA 3QC9A 3UNJA 5DVRA 4ZTQA 3TNIA 3AD5A 5K3YA 3VF9A 3UVQA 2XK3A 4F7LA 5C4LA 4GU9A 5I9ZA 3FXXA 4FTMA 1WVWA 2YDKA 4DYMA 3AG9A 5LJJA 2O8YA 1LUFA 2WQMA 4AQCA 3V8WA 5DNRA 1O6LA 1IA8A 4DFXE 2YZAA 3VWAA 3JVSA 5DLSA 3BX5A 1YXTA 4BTKA 3CE3A 4TRLA 3UVPA 2IVVA 3AGLA 3KXXA 2G01A 4FL1A 2PULA 2JFMA 5C8KA 3QHWA 3QUEA 5FTQA 2JAMA 1R0PA 3UDZA 2YIQA 3AC3A 4HYIA 1V0PA 4QQJA 4RLLA 4XLIA 4HVGA 3WZUA 5HG9A 3BI6A 4IM3A 4IXPA 4ZTLA 3PPZA 3P86A 1YOMA 4U5JA 4CEGA 1IG1A 2XJ1A 4WNKA 3HRBA 1XBAA 3FLWA 3D94A 3HP5A 1URWA 3LHJA 4JDIA 4WSYA 4QQCA 3ZDIA 4EQCA 2JIIA 2X39A 4X7QA 2CGUA 3H3CA 2KTYA 4C37A 4PP7A 2WQNA 4YU2A 4YZCA 1PHKA 2E9PA 4QMYA 5DI1A 5HTBA 4LI5A 4UBAA 5CSPA 4XJ0A 1ZOEA 5ANGA 3AMBA 3IO7A 2VTOA 5M44A 3QL8A 3LPBA 4DEAA 4YMJA 4RT7A 2WIPA 3GB2A 4YHJA 2BMCA 5HVYA 4NWMA 4I41A 4OTIA 3HUBA 3MJ1A 4TN6A 5ETCA 4EH9A 1Z57A 2X7FA 1Q24A 3FQEA 4I1ZA 3WI6A 5BMSA 3QQJA 5HESA 1Q62A 3VS5A 4CZTA 5FXRA 2VRXA 4QP2A 5AM7A 2FVDA 4G9RA 4FC0A 3B8RA 1OBDA 3FPMA 2OSCA 5DRBA 2PYWA 4RWIA 2X81A 3REPA 1GIHA 3MV5A 4HGEA 4FKSA 3JXWA 5A9UA 1ST4A 3BCEA 3UOKA 3DDPA 2X0GA 1Q8ZA 3TT0A 3OCBA 3TZ9A 5GZ8A 4M67A 5HVKA 3CCNA 5AP2A 4P2KA 3POOA 1HCKA 4CZYB 4L45A 1BMKA 3IDBA 1YKRA 3TNQB 3O8TA 2W1EA 4FKIA 1L8TA 3KREA 1JLUE 3SW7A 4ACGA 4DTAA 3OHTA 2HXLA 2AC5A 2OH0E 2ZVAA 3CGOA 1QL6A 2VUWA 2QCSA 1CSNA 3ACKA 3DFAA 3NAXA 3ORTA 3VBQA 3ZCLA 4AXEA 3MB6A 1SZMA 2R3PA 4MXOA 3W18A 4DGGA 3UQGA 3P08A 4ALVA 3UGCA 4AGDA 4DN5A 2ONLA 3C4CA 4JI9A 2V7AA 4W4XA 4Y72A 3PXZA 1OB3A 2DYLA 3LJ2A 3E3BX 4QTCA 4OTDA 4DG2E 2PU8A 4L42A 4YBJA 3Q4ZA 4IWPA 1MRVA 4WD5A 2I0EA 3R1NA 4FUYA 4EH5A 1S9JA 3PFYA 3F3VA 3PIXA 2V22A 3E8DA 3E93A 3A99A 5L2TA 3QQLA 5HNBA 4ID7A 1GIJA 3DK6A 1H1WA 5EQPA 4FA2A 3TTJA 2YITA 2WMWA 3VBYA 3CEKA 4FI1A 2XKCA 2JFLA 4YLJA 4ENXA 3BHUA 4H1JA 2VV9A 2WD1A 3NNUA 3NYXA 3SV0A 2PVJA 2PZYA 3FI4A 4BY9E 4U0IA 5EM5A 1PYXA 1CKIA 3K54A 3G6GA 4O0UA 2XAMA 4FRFA 3QCSA 3FLSA 4ACHA 5LOHA 3OUNB 2QOKA 3U6HA 1I44A 2WKMA 1BI8A 3NWWA 2WQEA 5M4IA 5LVOA 2VZ6A 5HE2A 1A9UA 3R0TA 1BX6A 5AP1A 3COHA 3DJ5A 4B4LA 2RG6A 3COIA 2ITOA 4Q5EA 2XBAA 3F69A 4TKSA 3M42A 2VD5A 3M2WA 4EK8A 4O7RA 4XBRA 4DEEA 3BLAA 2NNWB 3G33A 1PW2A 4R3CA 1CKJA 3W0QA 3EHAA 4J8NA 5ANKA 3ZS5A 2Y0AA 4MTAA 2BVAA 1XMMA 3RP9A 4FEXA 5D7AA 5IQFA 1DAWA 3MVHA 2A2AA 3GC7A 3QWJA 4AGUA 3LMIA 4C35A 3EL7A 3DKCA 3ORZA 2BHHA 3KXZA 4TYIA 3R7IA 2BCJA 4FV6A 4C4GA 4ZY4A 3MBLA 3UC3A 4IX3A 4ZMFA 5KNJA 1KE9A 2WTKB 3Q9WA 2R3FA 4GG7A 4GKIA 3FMNA 2GTNA 4UMRA 1F5QA 1XH6A 2ACXA 2J90A 4LMNA 5CEPA 2BRHA 4NKAA 4BDIA 1MRYA 1PXOA 4QP3A 3HNGA 1OZ1A 3OVVA 4XG7A 3ZFMA 2WZJA 1H1RA 3BEGA 4FBXA 3QTIA 5AA8A 3IW4A 2ETKA 4IM2A 4A9UA 2PY3A 2XVDA 1W2FA 3BE2A 1WBPA 3LAUA 4WHZA 4RIOA 3VONA 2ITTA 3UIUA 4YC8A 4MNEB 3PTGA 4I5HA 5DR6A 5HX8A 3HX4A 3BL9A 4EHZA 5AV4A 4EUUA 4KBCA 4WNOA 3PZEA 4F78A 2H9VA 3UOLA 5A4TA 2O5KA 3DAKA 4J97A 4TZRA 5HCYA 4EKKA 3FMJA 3FI3A 5FXSA 2QOQA 4XCUA 3RPSA 3RCDA 5CSHA 4KRDA 5ITAA 4Q9SA 3FY2A 3RPVA 4AE9A 4J96A 3ZUVA 1M2RA 3FKNA 4L68A 3U9CA 5HU9A 2ZM1A 4DLIA 3QD0A 4XH6A 3MS9A 4APPA 4EI4A 4DHFA 5CQUA 3KU2A 2OF2A 1OL2A 4FT5A 3RVGA 3ZZEA 5CAPA 4G3GA 1OUYA 1Q3DA 5KMLA 5ETFA 3DXQA 4HVDA 1STCE 4JX3A 2JKOA 4R78A 3R21A 3LQ3A 4RIXA 3PA5A 2ZDTA 2ZM3A 3TKUA 4I92A 4ITHA 1H08A 4LL0A 3FHIA 3FL4A 3QUDA 1W0XC 4II5A 4LV5A 4R6VA 2YM6A 4UALA 5DT4A 3EOCA 5AUWA 5I3OA 4E6DA 4DT9A 3W2CA 3SA0A 4LRMA 3HA6A 4F65A 5FDPA 4W8DA 2C3JA 2OH4A 5AV2A 3O8UA 2C0TA 2QLUA 5LWMA 5JFSA 5GZ9A 5CI6A 4CLIA 3L9LA 4BIDA 1PJKA 3IGOA 5HX6A 4K2RA 3MVJA 3R2YA 4YTCA 3F2RA 4FF8A 4KSPA 4PP9A 4IZYA 1WVXA 4XMOA 3NW7A 1V0BA 3K5UA 3VUTA 3VW6A 4EHVA 2F2CB 5FEDA 4RZVA 4E7WA 4E6QA 2FSTX 2B7AA 4FGBA 5E8UA 3ENHA 4CQEA 4R7IA 3GOKA 4P90A 4C58A 4FT0A 2O64A 2QHMA 5JEBA 4DFUA 3NCZA 3P0MA 2R3MA 2QOIA 2ZYBA 3DBEA 3CY3A 3NR9A 4FZDB 3VQHA 4BIEA 3UO6A 3NZ0A 5FEQA 4BCIA 1YI3A 4EH2A 3HUCA 3QGWA 4L7SA 4UZHA 4QMNA 1KOBA 4KAOA 4H05A 2HZIA 2O63A 3ZM4A 4JDJA 1OL6A 4G3DA 3V5LA 3NUNA 4NJ3A 1YDRE 4FGRA 2HZ0A 2X8DA 4RRVA 4E5WA 2BFYA 5CU3A 5HBHA 4QYGA 3TJDA 3QQUA 1NT2A 5CALA 4RMZA 3QKKA 1WFCA 3C5UA 2IVSA 4HGTA 3UO5A 3W0RA 1WBTA 3QTRA 3EH9A 4W8EA 5E8VA 1OIYA 4ANQA 2QC6A 3AMYA 4QOXA 1W2DA 4U79A 5T68A 1P4OA 3Q4CA 4X2KA 5JQ8A 2XEYA 3I79A 4R3RA 5IDNA 2R3LA 3RPOA 4I6QA 3O23A 4WUNA 5FXQA 5J79A 5KBRA 3MY0A 3SXFA 3PIYA 3GU5A 2PVRA 3H9RA 4FV0A 4LOQA 4CT1A 5J5TA 4F7SA 4BBEA 3ORLA 4FTOA 4C02A 3LFQA 3DTWA 1Q4LA 3ORNA 4XYFA 1ZWSA 3PIZA 5E8TA 2E9UA 4BVUA 3AC2A 3Q2JA 1RQQA 2PVLA 1XH8A 3LM5A 4GMYA 4ITIA 3VRZA 3G15A 3PWYA 1ZLTA 3OROA 4K1BA 4C33A 5M55A 4KNBA 2XJ2A 4JRVA 3R9DA 4RX7A 5JFWA 4V04A 4NM3A 3PPJA 5H9BA 4AT5A 1H01A 3DB8A 3LFCA 3ZFXA 4PTEA 3P78A 4O1PA 3ZSGA 4MX9A 3ORMA 5KX8A 3VS7A 2QOHA 5FM2A 3VUHA 3A7FA 1ZZLA 2YCQA 4BGHA 2W96B 3BRBA 4I6BA 1ZY4A 4HPTE 2XZSA 4DE4A 2GNLA 3NVKI 3HRCA 4NM5A 3UYTA 5H8BA 4H1MA 4NM7A 4FE2A 2E9VA 2E9OA 2BRGA 3ORIA 4EOJA 2C5OA 1SVEA 4M12A 2C0IA 5FLFA 4ZJIA 1ZMUA 3TV6A 5HE3A 1B39A 2EXMA 4G3FA 3PXFA 4JRNA 5DT3A 3CTJA 3KKVA 3CGFA 2UZBA 3W0SA 3AD4A 4N70A 4O7YA 5HQ0A 4O0YA 3R00A 2RSVA 3VJNA 1UU3A 3IK3A 2XCKA 4FV8A 4D4VA 5A4EA 5L6PA 4EH4A 2AQXA 1SNUA 3LE6A 4BJJB 3QAME 3NFGB 4CKJA 1F0QA 3LIJA 2Z7QA 1L3RE 2C69A 3ORPA 4KKGA 1R39A 2W4JA 3II5A 4M66A 4X21A 2UZNA 5GNKA 2HW7A 4BI1A 4O81A 4X2GA 5EM7A 4PMMA 5IUHA 1Y8YA 4RSSA 3GCQA 3V04A 3GQIA 4DGOA 4FZ7A 3D15A 1SYKA 5DE2A 3VF8A 2AC3A 3QZIA 4WOVA 3SOAA 1BKXA 4JG7A 3TV7A 4IJPA 2B9JA 3FQSA 1ZOHA 3FY0A 2R3NA 2GFSA 4ONAA 3WOWA 2HOGA 3F3WA 2GHMA 1V0OA 3IONA 3RBWA 3OW3A 4M3QA 4ASEA 1H1QA 3QZFA 2E2BA 4QTBA 4NCTC 2WMSA 4EEVA 3LQ5A 1RJBA 3HKOA 4EYMA 5IZFA 2F2UA 3CXWA 4W9XA 3WZEA 4FV3A 5IPJA 1H4LA 2ITUA 2BDWA 4AQKA 2XNBA 1FPUA 3RZFA 4BGGA 3EMGA 2JBOA 4WG4A 4MVFA 4O0TA 5EYKA 2X2LA 3BPRA 3GI3A 3LFBA 5L8JA 4F08A 1QCFA 3E63A 3OWJA 2RF9A 2WTCA 3PE2A 4APCA 4OGRA 4DDGA 3NNWA 4GRBA 3U9NA 3PXRA 2PVYA 4OR5A 3SG8A 5FWKK 3MSSA 4M0ZA 5M56A 5EW3A 1SMHA 5CTPA