4OTHA

Crystal structure of prk1 catalytic domain in complex with ro-31-8220
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
335
structure length
305
Chain Sequence
RKSPLTLEDFKFLAVLGRGHFGKVLLSEFRPSGELFAIKALKKGDIVARDEVESLMCEKRILAAVTSAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAIFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSAEAIGIMRRLLRRNPERRLGSSERDAEDVKKQPFFRTLGWEALLARRLPPPFVPTLSGRTDVSNFDEEFTGEAPTLPPRDARPLTAAEQAAFLDFDFVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase N1
publication title Crystal Structures of PRK1 in Complex with the Clinical Compounds Lestaurtinib and Tofacitinib Reveal Ligand Induced Conformational Changes.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 305
sequence length 335
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4othA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4othA01
3DDPA 4ZSEA 5IMEA 2HXLA 3H9FA 2XB7A 4BDCA 3EQIA 2VTNA 4B4LA 4B8MA 3G9LX 5EH0A 2YFXA 3BGQA 4JQ8A 4D2WA 4YJTA 4JIKA 5J5TA 3TKUA 4R3CA 3DNDA 2O0UA 3OG7A 4O0TA 3PFQA 3NWWA 1IAHA 1H1PA 5IQHA 4JX3A 1KOBA 3MH1A 3Q9YA 5EKNA 1YXSA 4FSUA 4MXYA 4TWCA 4O86A 1IEPA 3I7CA 4D1ZA 3EWHA 2JKOA 3OFMA 5CEIA 3LKMA 2BR1A 2JAMA 3R01A 3OD6X 1ZYLA 2WMRA 4Z7GA 3D94A 3QFVA 3ANQA 1NVQA 2R7IA 3GENA 2XH5A 3B2WA 1FGIA 3IDCA 2QOCA 3MB7A 2OZOA 3OVVA 3QTRA 5DLSA 4EQUA 4YBJA 4P7EA 3GOKA 4PUZA 4BN1A 1CKPA 4TZRA 3TJCA 3D4QA 3R7OA 4PPCA 5B2LA 3HDNA 4I6BA 3C51A 3IK3A 3K5UA 5FEDA 1ZRZA 2RGPA 3LMHA 4C4GA 2ZAZA 3ZLWA 3Q4UA 4G31A 4A07A 4QYEA 5BUEA 4LRMA 5AP1A 3VS1A 2CNUA 5LVNA 5CAOA 4I6HA 4HZRA 3ZCLA 4BKYA 4CLIA 3SW7A 2OKRA 4RG0A 5FXSA 4MQ1A 4APCA 2ZV7A 2IVSA 1KOAA 5JN2A 5CQWA 2JD5A 3CSVA 1LEWA 4GFMA 3HV6A 2OJJA 3D14A 2IN6A 3P08A 3GU7A 3QTWA 5EM7A 4YJRA 4ANQA 5B0XA 4KIPA 5FM2A 4YTFA 4FEUA 3FYKX 4N57A 3K3JA 4QP6A 2YITA 2HOGA 3AGMA 2EB3A 4EORA 4DH3A 5D41A 2QO9A 3G51A 2YM6A 3QX2A 2XNMA 5IPJA 5AUWA 4NJ3A 4RT7A 5E91A 4JVGA 5H8GA 4IE9A 4OTRA 3H10A 3R1NA 2PHKA 4RIWA 2UVXA 4D4YA 5E8WA 2JIVA 3O8UA 4DEBA 3PYYA 4EOLA 2CKQA 4QPSA 3WARA 4D2PA 1OPLA 3WI6A 3D5WA 3HX4A 2W1EA 1JSTA 3AQVA 3UYTA 2PZRA 1Z57A 1RJBA 3BYOA 2JIUA 2WMQA 4JQEA 5CSVA 3NUXA 4FV3A 5HOAA 1Y6BA 2OZAA 2R9SA 4E5BA 2CKOA 3RPVA 2YM8A 4FZ7A 3LLTA 4FZDB 4O2ZA 4X2KA 5JZNA 4DH8A 4GKIA 4ZTRA 5AAFA 4FIJA 3P1AA 3ORZA 4X2JA 5EI8A 4TKSA 1ERKA 4U40A 4KKEA 5AV2A 3AG9A 5IU2A 4EHVA 2Q83A 4E73A 5HORA 4X3FB 5KE0A 3RTPA 1MP8A 2GQRA 4KAOA 5AV1A 3D7ZA 3IGGA 4RC3A 4XV9A 2WQNA 4FUXA 4BTJA 3F3ZA 2XKFA 5HO6A 2PMIA 2PZ5A 2C3JA 2CNVA 5GZ9A 5ACBC 5KMKA 5BVKA 4WKQA 5A6OA 3F3TA 3GC7A 5DPVA 2C5XA 2C6LA 2PU8A 5TO8A 3HAMA 2VO0A 5A46A 4ZTMA 4AZTA 4FKVA 1UNLA 2YIQA 3C5UA 5HZNA 3EQGA 2WEIA 2VV9A 2WHBA 4F0GA 2BRBA 2HWOA 4FVRA 3VUIA 3MVMA 2A0CX 3EHAA 3QWKA 5HLNA 4O6LA 4PNIA 2UW7A 2CGWA 4O0WA 4DEEA 3F66A 3PG3A 5EQPA 2B52A 2IW6A 3EQRA 4BCNA 3BU6A 2W5HA 3EH9A 2XNOA 3DFCB 4UYNA 4AS0A 4BFMA 4D0XA 5I9VA 4DCAA 4GFOA 4TY1A 3V5WA 1DI9A 4C3RA 2W4KA 3HMMA 3QL8A 3GFEA 2A1AB 5CSHA 4FA2A 4M0YA 4O6EA 4ASXA 1APME 4R1YA 4RFYA 3WZEA 3EFJA 1TQMA 4BDGA 5CEKA 3G33A 3P23A 4IANA 4WIHA 3JYAA 3ZYAA 3R83A 5C27A 4PL5A 1B6CB 1ZZ2A 2XRUA 3AD6A 3TUCA 4BTFA 3C5IA 2VTLA 3I0QA 3SOAA 2VGOA 4G2FA 4UWCA 3PPZA 5L8LA 4RJ7A 2CGUA 3KB7A 4FG7A 3RPOA 5FP5A 4BZNA 4E5WA 2HY81 2GHGA 2OIQA 2YLFA 2W06A 4BWXA 5CF8A 3KREA 2YCFA 3M1SA 3UP2A 4TYHB 2FSTX 3BBTB 4E1ZA 3WZKA 1UWHA 3BX5A 3NDMA 3HNGA 3L9NA 5AP0A 4L9IA 3R71A 1AD5A 3BHUA 2QOBA 4OTIA 4X2GA 3PA5A 4OTFA 3FMNA 4GUBA 4RVLA 5BUIA 1WBWA 2ESMA 3WBLA 3VVHA 5IQEA 3R9RA 2X7OA 3QQUA 2XUUA 5AV3A 4AGWA 5BVDA 5IQDA 2H8HA 2I0VA 3FI3A 3FUPA 4I92A 4Y72A 5FG8A 3D0EA 4I6FA 4CMOA 2F57A 4YLLA 3SKCA 4XEYA 4MVFA 4QPAA 2E9PA 1QL6A 2VNWA 4WRGA 2HWPA 3BRBA 4Z9LA 4DFZE 3F2RA 5ACKA 2FSMX 2X8DA 4YJPA 4II5A 2GNHA 2P33A 4G9CA 2QVSE 4LYNA 3EIDA 4XV1A 4FV4A 3T9IA 1MUOA 3KF4A 3LZBA 2BTSA 3OCSA 5AUUA 1ZYDA 3F7ZA 2XCHA 2J5EA 3QTUA 5J5SA 3TI1A 2GHLA 3WE4A 3QHWA 3FE3A 4FTTA 4NW5A 5IA5A 3BHYA 2IJMA 4QMTA 1CTPE 3QD0A 4B7TA 4TYIA 4FZ6A 2BRGA 3Q2JA 4L44A 4DF3A 2CLQA 3W2SA 2W0JA 4ASDA 2VGPA 3B8QA 3HL7A 3NUSA 4ZTQA 2JLDA 3A2CA 5AR7A 2X4ZA 5LWNA 5IH4A 2E9OA 4C59A 1YXUA 3RK7A 1P2AA 4O21A 5T6KA 5L2WA 2PUNA 5C4LA 3P5KA 2C1AA 2ONLA 2W5AA 1JLUE 2W17A 1LP4A 4OBOA 5DNRA 3W10A 3SVVA 4GH2A 5JK3A 1UVRA 1OL7A 2XM9A 3F3VA 2RIOA 3EKNA 3GB2A 3LCTA 5FTQA 2SRCA 3DT1A 3DXNA 4R5SA 4KSPA 5H2UA 4EK6A 2VRXA 3G90X 4FICA 4BHNA 2UW9A 2PE2A 3LE6A 2OWBA 2WU6A 1XH8A 5AR8A 3FZTA 1QPJA 2XIRA 2PZYA 5FTGA 3LXPA 4ZTSA 3IW4A 4CFUA 3UOJA 4KIKB 5J1VA 4IM0A 1H08A 5ETCA 3AGLA 4TRLA 1ZYSA 1PKDA 2BRNA 2GS7A 3CLYA 1J91A 4RJ3A 1XWSA 1VYWA 5C9CA 5FXRA 5HI2A 2OJ9A 4HW7A 1PXOA 4ANBA 5TF9A 3FDNA 3NUAA 3TZ7A 4JL9A 5HG5A 4O1OA 5DR6A 5HQ0A 3PJ1A 5L6OA 5D7VA 5GINE 1Q8TA 3L8SA 4OGRA 3RPSA 2C47A 2QU5A 3TXOA 5HGIA 4DHFA 4HNIA 4DH7A 5BUJA 2B53A 4Y5QA 5IA2A 3FYJX 3IOKA 4YR8A 2PUPA 3IW8A 4L43A 4U42A 5CU3A 3ZBFA 2UZVA 2HW6A 4F9CA 2B9FA 2BFYA 3FC1X 5AX9A 4LQMA 4QMOA 4XYFA 3RM6A 4FSMA 3KN5A 2DUVA 2XK4A 4XP2A 4I20A 2ZM4A 1L8TA 5AR4A 5L6PA 2PVRA 4LG4A 4MD7E 4U9AA 4JIAA 2YZAA 4DH1A 4PTEA 5EW3A 5HHWA 5JEBA 3OWLA 3W16A 1H1WA 4CFWA 4D2TA 1OIQA 1OKWA 5TE0A 4EH5A 4AE6A 3L8VA 3C0GA 1VJYA 4YTIA 5ANOA 2UZEA 3SRVB 4QTEA 3DA6A 2F9GA 3CQUA 4EI4A 3V8WA 3RNYA 2ZVAA 1I09A 1WBVA 4ANOA 4F6UA 5M53A 3FMLA 3FZOA 3LFFA 5CU2A 3BWFA 3RI1A 2W4OA 4E4NA 4Z16A 5AEPA 3QRKA 4MXXA 3R63A 2QNJA 4I4EA 2WMTA 1IASA 4EQCA 5CF5A 3U55A 3S2PA 3BLRA 3DKOA 4CRLA 5TR6A 1JQHA 4CFXA 3IS5A 3QCQA 2C6DA 3KCFA 3HGKA 4IB0A 5E1SA 5KZ0A 2YLEA 4KUJA 1Q8WA 3UIUA 3FI2A 1WBOA 1O9UA 3LFSA 5CALA 2QOFA 4LOOA 4RIYB 3LXNA 4QQCA 3KULB 3GCVA 3PVWA 3BV3A 1V0BA 2UZWE 4ZLYA 5EG3A 3A7FA 3Q3BA 2X7GA 3DQXA 4CCBA 2C68A 3E64A 2GS6A 3SD0A 1R0EA 5C1QB 5EFQA 3PZHA 4EC8A 3K5VA 3PZEA 3UOLA 3GC9A 4UZDA 1WVYA 4QYGA 4JDKA 4X6QC 5D1JA 4RX7A 2HZ0A 2UZNA 4PDPA 4RX8A 2B1PA 3ETAA 3QD3A 3LHJA 3QHRA 4ZTHA 3FEGA 3BYMA 3NNUA 3FLQA 4UWBA 4EK4A 4HGSA 3G15A 3I6WA 1ZOHA 5FD2A 2XMYA 5FGKA 3Q5ZA 5EI2A 5HIDA 4GL9A 1Q3DA 2IVTA 2VTHA 3SOCA 3V01A 5EYKA 4FKRA 3IKAA 3FMDA 4M3QA 4BCOA 3MIYA 3G2FA 3UIMA 4D58A 4ZEGA 1MQBA 3R2BA 3LJ1A 4HGTA 3PLSA 1H1QA 3AC4A 4G3GA 4X2FA 5DH3A 4BIDA 2R5TA 3F2AA 2A27A 3LXKA 3RM7A 3UIXA 3UNZA 4WBOA 3SA0A 4KBKA 2J50A 3DBQA 1Q8YA 3NAYA 3A4OX 5BYYA 5KKRB 2E9UA 4FF8A 1CKIA 4IQ6A 4YC8A 3UVRA 5KMJA 5C8KA 4ZIMA 4A06A 3QCYA 4M97A 5CAUA 3DAKA 4F0IA 4M68A 1OZ1A 5HO7A 2PE1A 2X9FA 4NKSA 2VO7A 4S32A 1YI6A 3CR0A 5KCVA 2IVVA 2F4JA 4B6LA 4BDEA 2VO3A 3A62A 4I93A 5LCKA 1YI4A 5EQEA 5DMZA 4XG7A 4ZSGA 4GT4A 3DXQA 4EOQA 2BIKB 4K77A 2XIXA 3HA8A 2BDWA 4G3EA 5EHLA 5AM7A 2AYPA 2BDFA 2BMCA 4C3FA 2IZUA 2GQSA 3GCSA 2J5FA 3T9TA 1UKHA 4AGDA 4EUTA 3CD8A 2WIPA 3NR9A 4DTAA 2G01A 2XYUA 3PXRA 4FOBA 4W4WA 4EZ3A 3NVKI 2BAKA 1ZOEA 4NZWB 5EW9A 4N0SA 4TTHB 5AA8A 2OJFE 4J98A 3O2MA 3C4WA 2XNEA 3LMIA 2J0KA 3QLGA 4JOAA 4B9DA 4I0TA 1H24A 3RINA 2O5KA 3EMGA 4O1PA 4ORKA 1ZOGA 4EOKA 4CG9A 3MJ2A 3R7YA 1EH4A 1Y8YA 2QOKA 3PSCA 3QTZA 2X4FA 4O2PA 3KCKA 4OT5A 5BQ0A 4K9YA 3GXLA 5IG1A 2W1DA 2WNTA 4ACDA 4I1ZA 2PULA 2XZSA 3ZUVA 5JQ5A 1O6LA 2V0DA 3MW1A 4O0XA 4BI2A 3QA8A 4WSQA 2BZJA 2ETRA 2B9IA 2J4ZA 3RAIA 4E3CA 1G8SA 5K5XA 4O7ZA 4MYGA 4UMPA 4Y85A 3R7EA 5I0BA 3KGAA 4Q2AA 3BGPA 1AQ1A 3NW6A 4O81A 4QYHA 1YHSA 4ZLOA 2WIHA 4GVAA 3ZO4A 1V0PA 2R3FA 1CM8A 3ANRA 3HMNA 3FKLA 4JX7A 2YDJA 3KMWA 3OBGA 4MXZA 4UEUA 4BYJA 3R9HA 4YJSA 3ZUUA 3CGOA 2W1ZA 2XKDA 3P7CA 3II5A 4IZAA 4BCQA 4JJRA 3QQHA 4NM5A 2X1NA 2F2UA 4M84A 3THBA 3WZDA 4O82A 3PA4A 3CXWA 3R22A 2YISA 2Z7LA 4PDYA 1LPUA 2JC6A 4HGLA 5ANIA 3HRCA 2XCKA 3GVUA 2EXCX 4UV0A 2UVZA 5HKMA 4I94A 4NWMA 5IISA 1KE6A 1XR1A 2B55A 4E6DA 2BKZA 2C6TA 4G5PA 4NUSA 3U54A 3QBNA 1YWNA 3RGFA 5M4IA 3P7BA 2HW7A 5CNNA 3F69A 4ZXTA 4XMOA 3VC4A 3QA0A 2OBJA 4MXCA 4PNKA 4IW0A 4AT3A 3DS6A 4HCTA 2UW3A 4WBBB 4CLJA 1CMKE 2JFLA 3LVPA 5HG8A 3VHEA 3GCPA 4D28A 1PHKA 5IMXA 4IAAA 4MNEB 1JKSA 5DN3A 4X3JA 3EJ1A 5AUVA 2H96A 2IZSA 3A99A 1YXXA 3QQJA 3PTGA 4H3QA 3R8PA 2BFXA 2NO3A 4GYIA 4JS8A 4MX9A 3ZH8A 5HTBA 1FBNA 4WA9A 2LAVA 1ZXEA 3H0ZA 3DAEA 5C8MA 4IVCA 3PJ8A 4U80A 3HVCA 3FKNA 3PY1A 3ZONA 3S0OA 3UO5A 2CJMA 5DHJA 4A4XA 2JDOA 3HMOA 4ZJVA 2YJRA 3R00A 1GIIA 1OL2A 4NL0A 4NCTA 4O22A 4YNOA 3PDTA 4FV7A 5GHVA 2Z8CA 3HMIA 3PWDA 3AC5A 3D2KA 3L9LA 4OW8A 4BWKA 3MFTA 4I6QA 5GNKA 1SZMA 3WILA 4ARKA 1DS5A 1U5QA 4QMSA 1J7LA 2Y4IC 4L46A 2PL0A 2BCJA 5EHYA 3A7GA 1IRKA 3RPRA 5FUTA 1H0VA 1CDKA 5HX8A 3RP9A 3SG9A 3F5XA 4L7SA 5FLFA 3ZZEA 3PRFA 2W99B 2ZV2A 2XA4A 4YGAA 1H26A 1PMEA 3FLZA 4ACMA 4F7NA 1PYXA 2Z7RA 4B0GA 2E2BA 2WMAA 2XM8A 4DFNA 1S9JA 1OUKA 2YHVA 1ZY5A 4V05A 4EKKA 4M8TA 4F6SA 5H3QA 4B99A 3IG7A 5AAEA 4FSWA 4TT7A 2PVNA 4YUQA 2HZIA 1M52A 4J52A 4O0UA 4RJ5A 3GEQA 4YHFA 5ETIA 5IA1A 1ZLTA 5D12A 3WE8A 2XRWA 3CEKA 3C9WA 4LV8A 2XVDA 4HNFA 4F99A 2CN8A 1UU9A 4LGHA 3FWQA 3NRMA 5CVFA 3UO6A 4DG2E 4YO4A 4IDVA 5IQCA 2FSLX 4JNWA 4J8MA 2VWVA 1XO2B 5H9BA 5AP7A 4G34A 5CTPA 3DLZA 2BPMA 3FZRA 1TQPA 3E92A 4BZOA 5AP4A 5DOSA 5JZJA 4U8ZA 4R8QA 4PF4A 5EK7A 4FNYA 3S1HA 1QPEA 4PDSA 1SYKA 4F1OA 1OIYA 1U54A 2V55A 5L6WL 4GG5A 2R64A 4EC9A 4F64A 2OXYA 4FKPA 4BDIA 3AC2A 4TYJA 4M69A 5IF1A 2YWVA 3Q53A 1FOTA 3Q6WA 2PMLX 5EYMA 4W4YA 4I0SA 5BVOA 4FZFB 2UV2A 4ALVA 3G0FA 3W1FA 4D9TA 4M14A 4QP4A 4FTOA 2QI8A 3E3BX 1ZMUA 4WNOA 1HCLA 3ZBXA 5FEEA 3GP0A 3GT8A 4G3FA 4EWHA 3F9NA 2PPQA 5L8JA 1YOLA 4JBOA 4MAOA 3F82A 5HICA 4ERWA 4ZTLA 4C7TA 3H3CA 5LVOA 1KUTA 3NNWA 2OFVA 4D55A 3DKFA 5IDNA 5ICPA 2C5NA 4I0RA 4V0GA 4PTGA 4AA0A 1PXJA 3HZTA 2C3KA 2W7XA 4QMWA 3CQEA 4KINA 2PMOX 4IJPA 4YSMA 3VS6A 4BDJA 2F2CB 3N4UA 3NEWA 3TKIA 4L8MA 3C4FA 3B8RA 3H9OA 3HV4A 5A3XA 2WOUA 3DBCA 3IW7A 3MJ1A 4IVAA 4XCUA 1PW2A 2PWLA 3EN9A 4XX9A 3UTOA 4AGUA 4CZTA 3KVXA 1SNXA 3GCUA 4RBLA 4E93A 2O65A 3D2IA 4BICA 1QCFA 5LOHA 2XK9A 3CE3A 3FSFA 3F7WA 4U45A 2ONLC 4RIXB 4NJDA 2WQEA 5EM5A 5KHXA 5HD4A 2QURA 5FEQA 3HV5A 4DEDA 5M4UA 3NVMB 3IQ7A 3LQ5A 4WOVA 2X7FA 3EQBA 3MPMA 3OOMA 5E8XA 3TWJA 4BTKA 4GJ2A 4ZZMA 3SXRA 4A9UA 4L00A 4ZLZA 2UW4A 4PPAA 3V51A 4CTBA 3CPBA 4FSTA 4UBAA 3LLAA 3C13A 3CJGA 3RWQA 3LFQA 1YXTA 3VQHA 3AT4A 2WEVA 3SGCA 3S95A 2FVDA 2HY0A 5F4NA 5A6NA 4FG9A 4EOPA 1B38A 3LOKA 3PRIA 1NA7A 4D4VA 5DWRA 2HZ4A 5LARA 4BCIA 4BGGA 4WSYA 3ZTXA 4EZ5A 4OTDA 5T3QA 2W1IA 4IAKA 3NAXA 3TIYA 4FODA 4GV1A 4MXOA 3WF7A 2UW6A 2PVLA 5LWMA 4ITIA 2R3GA 3R9DA 3VW6A 3PP0A 3ZLXA 3A8XA 5IEVA 4IAIA 3Q4CA 4C35A 4BR3A 3HAVA 4XV2A 1WVXA 1YDSE 2C0IA 3DLSA 5J87A 1YWVA 2RFDA 3VWAA 5JT2A 3VUHA 3BI6A 5E92A 3NYVA 4JG6A 4O0SA 4QPMA 5ITAA 3ODZX 4G16A 3FLNC 2WQMA 3OXIA 2VTIA 3KFAA 4F9YA 2YEXA 1MRYA 3QAME 1VZOA 4O0RA 5DGZA 1Q41A 3LQ3A 4O83A 4N70A 2WTIA 3VUKA 2VN9A 4FV8A 1KE5A 3U6IA 3V8TA 2QONA 4D2SA 5I3RA 5IA0A 4O96A 4D5HA 3DFAA 1XH9A 3I60A 5L4QA 3A7JA 4AACA 5CANA 4WNMA 4IACA 3I5NA 3QKLA 2RFEA 3FPMA 2B54A 4H39A 4OR5A 5HCXA 3RAWA 2WMSA 1W84A 4FT5A 4UWYA 4QYFA 4WRSA 3FLSA 3NPCA 3PPJA 3W32A 3UC3A 4PMPA 4Z55A 5CAPA 3CJFA 3POOA 3C4CA 4L7FA 2YM4A 1R1WA 1P14A 2W1FA 4XS2A 4F7SA 2X2MA 3QZGA 5KBQA 3QD4A 3EB0A 3OEZA 3QALE 3OOGA 3VBXA 5BVFA 3VBVA 4BTMA 3OC1A 4DE4A 4UALA 3BHTA 2R3QA 4QMVA 4NIFB 2OXXA 5E8YA 5CEPA 4R6VA 1G3NA 3D7TB 5CX9A 4F9AA 3NYXA 4CGAA 2ZJWA 4E6AA 4ZMEA 2GDOA 3EL8A 1J1BA 4QYYA 1GAGA 4EH7A 1Q8ZA 4RC2A 2XF0A 3QGWA 3MWUA 3BV2A 4KS7A 2OU7A 2WQBA 5DRDA 3CTJA 4ANMA 3HYHA 2YAKA 3TUBA 4ANNA 3R1QA 1OM1A 4R1VA 3BHHA 4EHEA 4O7TA 3ZC5A 3S4QA 3AT2A 4D2RA 5IH6A 3OZ6A 4J8NA 3VS4A 4PP7A 4Y8DA 2V7AA 5AFVA 1E1VA 4FG8A 5AIKA 4BDAA 4IZYA 4ZS0A 5FRIA 4KRCA 3ZU7A 4ENYA 2JBOA 4MQ2A 1UNGA 4YU2A 4DBXA 3MPAA 4RJ8A 4Z3VA 5AUZA 3L8XA 4L53A 2FH9A 5DEWA 3TZ9A 2I40A 1IG1A 3IGOA 4ZZOA 4RVKA 3E7VA 1JSUA 3PSBA 3NGAA 5IUIA 3JXWA 2VNYA 3KF7A 1ND4A 3A60A 4DT8A 4UYAA 5HNGA 4YTHA 2EU9A 3ROCA 4E4LA 3QC9A 3EQHA 4GK2A 3RZBA 4TL0A 4ZJIA 4QQTA 2GTNA 2W5BA 2CCIA 5F20A 4DLIA 3ALOA 1OMWA 3FY0A 3W2QA 1YHWA 2ITTA 3F3WA 3QCSA 4FKOA 4IM3A 3LFBA 3GUBA 3ATTA 5KHWA 1UU7A 4YHJA 2OJIA 2R7BA 1OIRA 4AG8A 2CLXA 3QC4A 4GCJA 4CYIA 2BUJA 2G2IA 3L9PA 3PE1A 1QPDA 4X21A 4CSVA 5IUHA 4OAUC 4U81A 3MSSA 1A48A 5DG5A 3ZS5A 1OBDA 2PVKA 4C57A 2IWIA 2XP2A 4OTHA 1GJOA 4QMPA 2IW8A 1WCCA 3OMVA 4RRVA 2CGXA 4DN5A 4W8DA 3ZEPA 2C5YA 3COIA 1OUYA 2PE0A 5DA3A 3W8QA 3AD5A 3RNIA 4Y73A 1KE8A 4DLJA 5KBRA 3FL4A 5E7RA 4G6NA 4FIEA 4BDFA 2VTPA 5FDXA 2R3JA 5CNOA 5HCZA 1DAYA 3MPTA 4O0VA 4AT4A 4AZVA 4EK8A 1W98A 1OL5A 3QYZA 3VNTA 1OGUA 2BAJA 3KRRA 3R28A 3N51A 2WELA 3PPKA 5E8UA 4C37A 3MGYA 2FYSA 3UIBA 3VBTA 4XOZA 4HYSA 2W96B 4NK9A 5CQUA 2PTKA 4CMTA 5CVGA 2WOTA 4WNPA 3EQPA 3FQHA 4C3PA 4JT3A 4HPUE 4RWIA 4E6CA 5IA4A 2P2HA 3EQCA 4EZ7A 3BZ3A 3KEXA 2Y8OA 4QMYA 3HUCA 1FVRA 3HA6A 3B2TA 4O7SA 4KD1A 2NRYA 2WAJA 3RHXA 2YM5A 3U4UA 4I22A 4JG8A 4AOTA 4F1TA 5M57A 4AZSA 4FUYA 3U87A 5HD7A 4G6OA 4BDHA 4OTPA 3HMPA 4RGJA 2YCSA 1BI7A 2VTJA 2VWWA 4ZJJA 3ULZA 2P0CA 3QX4A 2Z60A 4QP1A 2QR8A 3BYSA 4HZSA 5L3AA 2CKPA 4CKRA 3UBDA 3ULIA 4FSZA 5EDPA 1XQZA 4MCVA 4I5MA 3RBWA 2R2PA 2NRUA 3BELA 4RA4A 3BQRA 1PXMA 3W2OA 2Y4PA 3DDQA 4TWOA 4KS8A 3KN6A 4ZAUA 3EN4A 4JG7A 4ACGA 2X6DA 3UDBA 1XHAA 4C4IA 4W9WA 3TDVA 3V5TA 4YJUA 4Y95A 3DU8A 2OW3A 3NYNA 5J9ZA 4F7LA 3LXLA 5CF6A 4CKIA 1FPUA 4UY9A 2HIWA 1E9HA 3C0HA 3KA0A 4RVTA 3EN7A 3LMGA 4RQKA 1OPJA 1L3RE 4HVDA 3O7LB 3K3IA 3PIYA 1WMKA 4KRDA 4QP2A 4ZSJA 4EL9A 4FSRA 2Z7QA 4HYHA 2QKWB 4UMQA 4S34A 2I7QA 3HUBA 3EZRA 5KUPA 5ANDA 4M69B 3OTUA 4FKUA 3ERKA 4XG9A 4ACHA 3IW5A 3LFAA 2CN5A 3LJ0A 1Q8UA 2ZV8A 5TKDA 1YWRA 3UJGA 2GTMA 3ZO1A 5BMMA 4EEVA 3MV5A 4IWPA 5CZHA 3VBQA 4CZYB 3DBDA 2BVAA 4EK3A 1X8BA 2I0HA 5AP5A 4AW5A 3BEGA 3V5LA 2PZPA 1ZARA 4H36A 3TT0A 2QCSA 3PIXA 2XKCA 4PL3A 3VS0A 5J7BA 4FT3A 3Q4TA 4GUEA 5CY3A 3V5QA 1OECA 4JR3A 4USEA 2HYYA 1B39A 4QQ5A 4R3PA 1P4OA 3OEFX 4O7WA 4QMLA 2G15A 2I6LA 4S2ZA 1PKGA 4BGQA 1JKLA 5DT0A 5LMBA 5GJFA 2C4GA 4MEDA 2GNIA 4FEQA 4GK4A 1WBPA 3DBFA 4FVPA 4NCTC 5CEQA 2QO2A 4N4SA 1OI9A 4U41A 3I81A 3D5VA 1WVWA 3LCSA 5IDPA 3QQKA 4JDJA 3E87A 3ZLSA 1SVEA 5IKWA 2C5OA 3Q32A 2WMBA 3PJCA 2BHEA 2VO6A 2WFYA 2PMNX 2NPQA 2X2LA 3OY1A 3Q52A 5JFSA 1IAJA 3PJ3A 4A4OA 4FT7A 4DT9A 1BYGA 4FKWA 3ZFYA 4HVGA 4A9SA 3WIGA 4A4LA 2ITOA 5A4QA 4P4CA 1XJDA 3TL8A 4JR7A 2QOQA 2B0QA 3PXZA 2R3HA 3W2PA 4YJQA 1SNUA 3FMJA 4FGRA 3IONA 3ZLYA 5AADA 5ETAA 4FL1A 3CY2A 4YP8A 5LVLA 5G1XA 1PMVA 4DTKA 2O63A 3FQSA 4CT2A 3IDBA 4RJ6A 3W2RA 3VUMA 4AWIA 2DWBA 4R7IA 4DINA 2ZMCA 4HCVA 4MWIA 4PQNA 5DFPA 5HE2A 4IWDA 2Q0BA 4E26A 4RWLA 4E6QA 4YLJA 1H00A 3CY3A 4V04A 4QTAA 3R9NA 2QHMA 2ZDTA 2VZ6A 1IR3A 5AMNA 2WTJA 5GZAA 5GJDA 4C58A 1XBBA 1GNGA 3O8TA 1W83A 3PXFA 3AC1A 4FKIA 4YC3A 1IA9A 3SG8A 4JBQA 3NS9A 3GC8A 2PUUA 1BUHA 5HNIX 3OXZA 1H27A 4OTQA 4BKJA 3ZSHA 5E4HA 5HNBA 3CGFA 3C7QA 4OBPA 1F3MC 4BCFA 2OLCA 2ITZA 3PUPA 2YAAA 5TOZA 4U7ZA 2FGIA 1UWJA 1OL1A 3ENMA 4AA4A 4JDIA 5GIPE 1AGWA 2OH0E 2J6MA 5M4CA 1XH5A 4RC4A 4TPTA 4LM5A 4YJOA 3UMXA 4RIWB 3DKCA 3RCJA 2XJ2A 4TWNA 3BPRA 3QTIA 3E3PA 3GGFA 4YNEA 4QQJA 4CNHA 1NY3A 3COMA 3DXPA 2ZB0A 4EONA 4FTLA 5A14A 4AQCA 4DG0E 3N4VA 3E8EA 4XG8A 2BZKB 2XK3A 4IHPA 1KWPA 4G3DA 4J71A 4Q5HA 3NNXA 4UMTA 4RJ4A 2OZAB 4QP9A 3SLSA 5HVKA 3ET7A 3UNKA 2GPHA 5HBEA 3TCPA 1YKRA 3BE9A 3QGYA 3TNPC 3L1SA 4CFMA 3GU8A 5J79A 4PWNA 3ITZA 4QRCA 3ACKA 3C4EA 4GRBA 4KWPA 3QCXA 2C3IB 3COHA 5CSWA 3ALNA 4Q5EA 4K18A 4WHZA 2PVYA 3GNIB 2UUEA 4L45A 4YZ9A 2J2IB 2OH4A 3P7AA 2PZIA 2ERZE 4UB7A 1ZZLA 3TNIA 2PUIA 4BF2A 3COKA 4O7RA 3OWJA 3BHVA 1TVOA 4FNWA 2GNLA 2QD9A 4XV3A 4A9TA 5L2TA 3VS2A 4FTNA 3TIZA 2OO8X 3SW4A 5M07A 4FV9A 2CHLA 3KY2A 2OICA 3EKKA 4U3YA 2LGCA 4KKGA 4JBVA 5K0KA 4BCHA 4PMTA 3ORXA 4P5ZA 4UXLA 3OWPA 4IB3A 3ZZWA 1QPCA 3BWJA 4BRXA 2O2UA 4EOJA 3VBYA 4LOQA 3R8UA 2V22A 5CASA 4DEGA 2EB2A 2OJGA 4ENXA 2Y4IB 4QP3A 3OWKA 4BCGA 3RPYA 2A2AA 4MH7A 2YJSA 5J9LA 2CCHA 2GQGA 2WD1A 5F94A 3R1YA 2YA9A 3HP5A 4OAVB 4BL1A 3FMEA 3UZRA 4CXAA 2G1TA 4FK3A 4H58A 1R39A 3PXQA 4IB5A 4EH6A 4CG8A 3NCGA 4YBKA 4LMNA 2WKMA 4FIGA 4P5QA 2AC5A 3AC3A 3GQIA 3ZFMA 3ZM4A 4FV0A 5HE0A 1FVVA 5BVEA 4X3FA 3TZMA 4CZUA 3O96A 5GIOE 2B4SB 3Q2MA 5EQYA 4I3ZA 4H3BA 2ITNA 3HDMA 4TYGA 4CQGA 3R73A 4DGLC 1YRPA 3LM5A 2VX0A 4JRNA 1H25A 5AJQA 5LXMA 4I5HA 4HJOA 3LFDA 5LVMA 3VUTA 5CAVA 1BLXA 3RWPA 2OIBA 3CD3A 2IZTA 3PVUA 4RIOA 1XBCA 4FTUA 3CIKA 1G5SA 3ZXTA 4DFUA 3R7GA 4F7JA 5CF4A 5L8KA 1YQJA 5IA3A 2JGZA 1YDTE 4ZY5A 4GG7A 1SMHA 1UNHA 4F63A 5LQFA 1A9UA 1WBNA 4WO5A 5C26A 3VO3A 4GK3A 4FKLA 4A9YA 3LAUA 5IQGA 3UMWA 3I5ZA 4IAFA 4QMXA 2R3RA 1E1XA 4NM7A 4CV8A 4WG3A 3VF9A 3FZPA 3BBWA 5EDRA 3JR1A 5IUGA 3WIKA 4W4XA 1F5QA 3MFRA 2BALA 2W1CA 3A8WA 5A4TA 4LUDA 3NYOA 4H1JA 4PMMA 5A4CA 4BY9E 5M4FA 3E88A 3VHKA 1Y57A 4KIOA 4DGNA 1VYZA 2JDVA 3LCOA 3AC8A 2XS0A 2OG8A 4M7IA 4MF0A 3CPCA 4OLIA 5EM8A 5JKGA 4EH9A 4GSBA 3CTQA 2QKRA 4YZMA 4EBWA 4L52A 4H1MA 3RCDA 3BU5A 3ZFXA 4MTAA 4TYEA 4OUCA 3A7HA 5BMSA 2XIKA 3D9VA 3DK7A 2QODA 4TYHA 4OTGA 1FVTA 5HE1A 3R7IA 1Q99A 3U8WA 5FDPA 2WMUA 3BLHA 4YTCA 2J0LA 2JDTA 2JEDA 4RZWA 4HGEA 3WF8A 3UO4A 2PY3A 5HCYA 3VIDA 4F65A 2V5QA 4ITHA 3VJOA 4CFNA 3M2WA 3QUDA 3L9MA 1MRUA 3D5XA 3TTIA 3UQCA 5FP6A 3P0MA 4QTDA 3NIEA 2XNBA 3RHKA 5BVWA 5DE2A 4AF3A 1H0WA 5K3YA 3NZ0A 3KC3A 5L2QA 3EN6A 4AN9A 2WQOA 3R8LA 3QYWA 3HECA 4CVAA 2Y7JA 3ZC6A 2QR7A 3GU6A 3KXXA 3FXZA 4LFIA 4TXCA 4FL2A 4LRKA 1RQQA 2OI4X 4W8EA 1ZMVA 3FI4A 4R78A 3U9CA 2GSFA 4AAAA 1A06A 3DK3A 5HU3A 3VQUA 3ELJA 4TNBA 1JNKA 2C69A 3U4WA 4GT5A 3U51A 4CFFA 4D4SA 3M11A 4CQEA 2XBAA 5DI1A 5BPYA 2C0OA 3H9RA 2BRMA 5B2MA 2RL5A 2XBJA 1KE7A 5J95A 5CSXA 3FBVA 2PVHA 2WTKC 1YOMA 3OCGA 3SC1A 3TJDA 1H07A 3DPKA 4ITJA 4U44A 4BI0A 3ZEWA 1PY5A 3BGZA 4J99A 1Q62A 4LI5A 1J7IA 3WF6A 4W4VA 3ROYA 1JOWB 2CNQA 3R02A 2IPXA 4BDBA 3TV4A 2VD5A 4S30A 3C1XA 4QMQA 4IIRA 2BILB 4NFMA 4I23A 1Q97A 5JGAA 5M44A 2C6MA 4DFYA 4HVIA 2ITQA 1GIHA 3M42A 3QKMA 1GOLA 2UW5A 4BHZA 3UZPA 2VWBA 3BYUA 5CI7A 3JS2A 5HG9A 4UMRA 3ORKA 1JAMA 3R30A 4YO6A 5KMLA 4XP3A 3UZTA 4Y46A 1PXNA 4IC8A 1DAWA 2XKEA 4PDOA 4YZBA 1JSVA 2YN8A 2JKQA 3LPBA 3QQGA 4USDA 3MH3A 3R9OA 5IZFA 5HIEA 1YI3A 3LFCA 4AFJA 3CP9A 3FZSA 4KIKA 3BIZA 3P78A 4K2RA 3FXXA 4L3LA 1TKIA 1YVJA 4M66A 3R7UA 4EBVA 4RLLA 3GFWA 1Q24A 5K9IA 5AUTA 4L42A 2ITXA 3D83A 4D0WA 4EHZA 4R7HA 4O91A 3DCVA 4YPSA 5ANEA 3ZRLA 4IZ5A 2C30A 4K33A 1U46A 4WUNA 1UU3A 3OCTA 3KK9A 4EYMA 1FQ1B 3PXKA 3OT3A 3VS3A 1JVPP 3EQDA 1GZOA 4FTQA 4C34A 3AXWA 3DOGA 4JAJA 4XBRA 4FIIA 3KQ7A 3TKHA 3WOWA 4AXAA 4E8AA 5DT4A 2Z2WA 4ZY6A 2YZLA 4OTWA 3DQWA 5E1EA 1KV1A 3U9NA 3IO7A 2YERA 5G6VA 1GZ8A 4NW6A 4FTJA 2J90A 5CT0A 5LVPA 3I4BA 4XUFA 3KRXA 4M15A 4YJVA 2VTTA 1T45A 4MD9E 3SXFA 3EFLA 3EFKA 4BI1A 5JFWA 3S3IA 3NW5A 3VUDA 3MTLA 3UP7A 3FI8A 3PG1A 5I9WA 2XNGA 4AZWA 3MVHA 3LQ8A 4C4JA 5E8TA 2BKKA 3EOCA 4PP9A 4IX6A 4ZP5A 2HAKA 3LFNA 2R3NA 3RK5A 2ITUA 3VUGA 4DEAA 4IBMA 5EDQA 2GFCA 2X81A 3ORIA 3D5UA 3I7BA 5KO1A 4NYEA 2QLUA 4K11A 2UZOA 4QO9A 4NFNA 3TV7A 3SRVA 3ZO2A 4HPTE 4C0TA 3ZO3A 1PJKA 4E4MA 3AT3A 4OT6A 5B7VA 2VWZA 2YM7A 5AP2A 3N9XA 5C01A 3UVQA 3AMBA 3PLAE 3MYGA 3POZA 3FQEA 2BZHB 4XG2A 3TACA 4L68A 1SVGA 1TQIA 4DFXE 2GS2A 5LJJA 3ACJA 3QZHA 2EXMA 2BTRA 2J0JA 3KK8A 3O0GA 4RIYA 1Z5MA 4NEUA 3T3UA 3QKKA 3KULA 4YC6A 2X8EA 4MK0A 4QOXA 3ZMMA 3A61A 5AUYA 1NVSA 5E8VA 3AOXA 3E63A 1Y91A 2ZV9A 4DEIA 4EJNA 1VR2A 3FHIA 4EJ7A 4AE9A 1DM2A 1JKKA 4APPA 3ORMA 1OKVA 4I4FA 4FIFA 2C3LA 3NW7A 5KMNA 5F9EA 3CBLA 1YHVA 2XJ0A 4GU6A 4C62A 1J1CA 3MN3A 4J97A 3QXPA 2R0IA 4TWPA 4YPDA 4CFVA 4D2VA 3V8SA 3R21A 3KRJA 4RFZA 2GNJA 3PWYA 5AV0A 4FEXA 3E8DA 4XNEA 4FI1A 5FBOA 4L6QA 4O84A 1VEBA 2VX1A 3Q5IA 4F0FA 4YSJA 5DT3A 4OBQA 3WZUA 2C6OA 4GYGA 5HG7A 2G2HA 3UGCA 1Q3WA 2XJ1A 3DTCA 1UA2A 1M14A 2QC6A 2GNGA 4F9WA 4CYJA 4BBFA 5GJGA 3ZDIA 3F61A 4AA5A 3ZUTA 4Q9SA 4S31A 3UOKA 3QRIA 4MBJA 5DEYA 3Q9WA 5BNJA 3RJCA 2ZYBA 2W1HA 3E7OA 4U43A 4XG3A 4O7VA 3LCDA 2XIZA 3MDYA 4XG4A 5IQAA 2UZTA 3FV8A 1XH4A 4U3ZA 3BQCA 2ERKA 4NM3A 3GQLA 4FT9A 4FTRA 2JKMA 3V3VA 1Y8GA 2F7ZE 5CVHA 2BROA 2IW9A 1PYEA 3QD2B 3S00A 2IVUA 3MY0A 2YIXA 1UU8A 4GJ3A 2ZMDA 5L2SA 1XBAA 4Y5HA 3ZDUA 5A54A 3VN9A 3N4TA 5CU4A 2EWAA 3FMKA 4GU9A 5T68A 5CT7A 3OUKA 2HXQA 3H0YA 5IQBA 2JKKA 3CKXA 4I41A 4PY1A 5JGDA 3U6HA 3U6JA 3QQLA 2BDJA 3FY2A 4O27B 2VWUA 3KU2A 3ZSGA 3PY3A 2WMXA 3MI9A 2VAGA 1G8AA 2HELA 3UQFA 3EYHA 3NLBA 4EH3A 2PVFA 3QRTA 2XK8A 3FAAA 4MWHA 5EOLA 3EYGA 4GKHA 3IECA 5HESA 4FK6A 3NUYA 2KULA 3Q6UA 4O7LA 5JRQA 2C1BA 3DGKA 2ETKA 2QO7A 2V7OA 3IOPA 5AP3A 2ITVA 4RX9A 5F1ZA 3RALA 2ITWA 4LGGA 5JSMA 4C36A 2C0TA 4AP7A 3EN5A 5FQDC 4DGGA 2Q0NA 3KXGA 4A9RA 2WTCA 4EWQA 2VTSA 1S9IA 2W1GA 5ANJA 1OB3A 3QTXA 5TT7A 3O51A 3KXZA 4FTAA 5C8NA 4QMZA 3C0IA 4J7BA 4J53A 5JFXA 4ASEA 2EUFB 5BYLA 5CEMA 3O8PA 3OXTA 4IMYA 5I9XA 4IX3A 4Q9ZA 3WF9A 3D15A 2QQ7A 3F5UA 5FM3A 3MH2A 4L3JA 5HEZA 3VF8A 2QG7A 4PX6A 1ZWSA 5LCJA 3NNVA 4CKJA 1Y6AA 4G5JA 3FC2A 5J1WA 3LIJA 5CZIA 4PV0A 5E8SA 4BCPA 2OXDA 3TDWA 2UVYA 3QTSA 4C4FA 4FTKA 3V6SA 3Q60A 3BU3A 4F1MA 4W9XA 3NUUA 3NX8A 1V0OA 3DJ6A 4KKHA 4AFEA 2PYWA 2VWIA 3SV0A 3VRYA 4RMZA 4YZDA 4EK5A 2Z7SA 2F7EE 3BE2A 4FBXA 4F6WA 3HV3A 2RFNA 4FKQA 4B8LA 2BIYA 2Y0AA 3EFWA 3I0OA 5IQFA 4EOOA 5HIBA 2ZDUA 2PSQA 1PXLA 1FMOE 2R3MA 2QOIA 2H9VA 3GC0A 4WG4A 3SQQA 4IZ7A 4M67A 2F49A 5CXHA 2R3OA 1BI8A 1R78A 4AN2A 5HVYA 1PRYA 3CQWA 1BKXA 2REIA 3AMYA 3RKBA 4FYNA 4IADA 2VTQA 1WZYA 4MBLA 1UV5A 4RA5A 3RVGA 3RK9A 3SDJA 2IO6A 3WYXA 4FR4A 3A7IA 4MKCA 3ZRMA 1JKTA 1NXKA 4GW8A 3ZOSA 3FL5A 3JPVA 4DH5A 2BAQA 3O17A 2GHMA 1HOWA 2ZB1A 2E9VA 3ORPA 4LOPA 4ZK5A 2YIRA 4MNFA 3T3VA 3MY5A 2C6KA 1H8FA 4AX8A 4RX5A 4UMUA 3QLFA 3REPA 4P2KA 2FB8A 2WXVA 1WFCA 1OITA 4J95A 4MNEA 3GOPA 4EQMA 5A4EA 4O7NA 4DITA 4ZZNA 1STCE 2DQ7X 4X3FC 4ANLA 4BYIA 3OW3A 3UNJA 4AUAA 1LEZA 4HOKA 3FLWA 3KKVA 4RQVA 5AM6A 4U79A 4EOIA 1JWHA 1BX6A 3TM0A 4JLCA 1PF8A 1P5EA 4AW2A 2OF2A 1YW2A 3CTHA 3DBEA 1NVRA 3Q96A 3ORLA 4KNBA 3DKGA 2X8IA 2VTOA 4UZHA 5HTCA 4FV5A 1O6YA 4EH4A 3BEAA 5LMKA 2WZJA 4QMUA 4EH2A 4IC7A 3PY0A 3RZFA 3MB6A 2YIWA 3QZFA 4DCEA 4CT1A 1U54B 2I1MA 2H6DA 4FVQA 2YCRA 3QQFA 3JVRA 1OKZA 2XEZA 4XRJA 4U97A 4BKZA 3MFSA 2VTRA 1H01A 3OY3A 5HBJA 2XK7A 3I6UA 1BL6A 3KXHA 3KMMA 2CSNA 3LCKA 1P4FA 3ORTA 3MBLA 4PRJA 4J96A 4C02A 2CGVA 4FZAB 2PK9A 3KMUA 2EVAA 2C5VA 2CKEA 5CU0A 2YIYA 3G9NA 3T8OA 3TV6A 1U5RA 2AC3A 3C4ZA 4JQ7A 5DR9A 5FXQA 2IG7A 3UE4A 3QTQA 5J9YA 4WG5A 3LM0A 4BCJA 4EKLA 2ZM3A 4BWPA 3DY7A 5HO8A 1M2RA 1W7HA 5EKOA 3KRLA 5IEYA 2WGJA 3JUHA 2UW8A 3MA3A 2GNFA 3GI3A 4MXAA 4V0GB 2IZRA 5I9YA 4ERKA 4DAWA 3RMFA 4ALWA 2Z02A 3CKWA 3O7LD 4JI9A 3OF0A 3VBWA 1K3AA 4YZCA 3R0TA 4ASZA 5HLWA 4NTSA 2RSVA 3SX9A 3BKBA 3PE2A 4LGDA 5JH6A 4P90A 4IWQA 4LL5A 3PJ2A 5H8BA 1H4LA 4DA5A 3L8PA 1GZNA 4DG3E 3K54A 3P79A 4FV1A 4LUEA 5AR2A 1XKKA 3R6XA 1FMKA 1BMKA 4FT0A 4PTCA 5DIAA 2GMXA 3VS5A 4FX3A 3TZ8A 4JDHA 4C2VA 4Z7HA 5AUXA 2XK6A 2JITA 4CCUA 5KNJA 2B9JA 4AN3A 5AX3A 4NTTA 2B7AA 2P55A 4XHKB 3G6HA 1CKJA 4CV9A 1J3HA 5HLPA 2X9EA 3QRJA 3FZ1A 1IA8A 3C4XA 3MTFA 5CEOA 4ACCA 3R8MA 3TTJA 2HK5A 2WTVA 2QHNA 3DZOA 3FSKA 3Q04A 4NT4A 4M13A 1ZY4A 4AT5A 4USFA 2BZIB 3ID6C 3K2LA 4ANSA 4MF1A 5KMOA 2O3PA 3HEGA 4ID7A 3GCQA 4LL0A 4GEOA 2P4IA 2UZDA 2VWYA 4R7BA 3Q4ZA 4CEGA 5LMAA 5I9UA 2VWXA 1H1RA 4E7WA 3FXWA 4FNZA 5F95A 4QP7A 5CAQA 4F9BA 2UW0A 3ZXZA 3IPHA 2VU3A 2O64A 2Y6MA 4FOCA 3VULA 3R2YA 4GS6A 4KA3A 5EM6A 5K0XA 5CSPA 4ZS4A 3QU0A 2DYLA 1M2PA 5DVRA 5I9ZA 2R4BA 4S33A 3TNQB 3WZJA 4IX5A 5JQ8A 2YDKA 4KBAA 3P86A 3AD4A 3UC4A 3MY1A 5HE3A 5JFVA 3ZRKA 2NNWB 3DB8A 4RIXA 4YLKA 2OFUA 3FMHA 4U0IA 4BBEA 3TN8A 1RE8A 3ZSIA 1OVEA 3HP2A 1O6KA 3QZIA 3F5GA 4O38A 2CPKE 3HRFA 4G6LA 3F3UA 4ZSLA 4KBCA 4C4EA 4F4PA 2WTWA 4JRVA 3TUDA 2NP8A 1YXVA 4RVMA 5CXZA 4DTBA 5KMMA 5C4KA 3OHTA 2ITPA 4JAIA 4YURA 3UPZA 2J0IA 4EOMA 2A4LA 3WF5A 4TW9A 1OIUA 4FSYA 3FJQE 4FGBA 4QTCA 2OSCA 2ZM1A 1LR4A 4K6ZA 1PXPA 4AZFA 3BYVA 4BBMA 4UN0C 1PXIA 5KMIA 2PVMA 4XRLA 4FTCA 3OROA 5M51A 3KVWA 4QMMA 1F0QA 5KZIA 5ANKA 3E8NA 4HCUA 4M0ZA 3JY0A 3FPQA 3VJNA 4M12A 4KABA 3ENHA 3OW4A 3BCEA 4XJ0A 4IWOA 4FSNA 4WT6A 3MFUA 1UKIA 3OT8A 1MQ4A 4WUAA 4XLVA 4C61A 3OP5A 4GT3A 2G9XA 4PL4A 4RFMA 2RF9A 1PMUA 1H1SA 4FKJA 3MH0A 4GIIA 3FLYA 5AR3A 2R0UA 4L3PA 3NMUF 2I0EA 4FV6A 4D1XA 2EXEA 1PMNA 3F88A 5I5ZA 4I24A 4HVHA 2GCDA 3DNEA 4DGMA 3OS3A 4FSQA 3V04A 4RSSA 2C6EA 4IEBA 3KL8A 5HVJA 3I79A 4EHGA 3DTWA 4N6YA 3TNWA 3MA6A 4IAZA 5D9HA 4CTCA 3FKOA 4D1SA 5A4LA 3R04A 4DBNA 2JDRA 5E8ZA 4D4RA 1KSWA 2WMWA 2YM3A 4DC2A 3G6GA 3CC6A 3E8CA 3O50A 2C6IA 4XOYA 1Q4LA 4IAYA 3QXOA 3NUNA 1M17A 2KTYA 2QU6A 4H3PA 5AV4A 1BL7A 4AW0A 5EI6A 4FEVA 2QLQA 2ZOQA 3PXYA 4IVBA 5EHOA 4BCMA 4C38A 1KV2A 3DJ7A 4K0YA 5KX8A 1FINA 4NIFA 3ORNA 3D7TA 3UYSA 4WD5A 1V1KA 1REJA 3IDPA 5CWZA 2FO0A 2J51A 1WAKA 4IB1A 3TG1A 4MBIA 4K8AA 3DZQA 3PIZA 4FKSA 3SAYA 4BCKA 2DS1A 2JDSA 4MHAA 3IW6A 3HV7A 4X7QA 4GIHA 1QMZA 4DFLA 4G17A 4EOSA 2VTMA 4BZDA 3W33A 2YWPA 5CI6A 3QWJA 3UOHA 1OPKA 3QF9A 4X6RA 2BRHA 2B9HA 3UPXA 4PMSA 1K2PA 3P9JA 5IH5A 4GVJA 2H34A 1PXKA 2J0MB 1YOJA 2OGVA 4AGCA 2JBPA 1SVHA 2V62A 4IFGA 4FIHA 3DJ5A 5EW8A 3TNHA 1ZYJA 1YDRE 2G2FA 3VW8A 3A4PA 5EYCA 1NW1A 4J1RA 1WBTA 5L2IA 4R5YA 4U5JA 3P4KA 3LFEA 4E20A 2WTKB 1ZYCA 4L67A 3RAHA 3F6XA 4F09A 2YACA 2UZBA 4I5CA 5EYDA 1Q5KA 5CYIA 2RG5A 5AR5A 5M09A 1GIJA 4PPBA 4XBUA 4KIQA 3E93A 4UXQA 3GBZA 4QNYA 5A9UA 3EZVA 4FV2A 4C33A 5ANGA 5EOBA 5IQIA 4E4XA 4KB8A 5AAGA 4D9UA 1J7UA 1OKYA 2XNPA 3PA3A 4RZVA 4IX4A 4C2WA 4DFBA 4JBPA 2ITYA 1SM2A 2X39A 2ACXA 3O23A 3OCBA 3PVBA 4A7CA 4NH1A 4N6ZA 5DRBA 2PVJA 3E5AA 4X2NA 3R8VA 1RW8A 1ZMWA 3DB6A 4IXPA 4NU1A 5I3OA 4XG6A 2OK1A 5C03A 2UZLA 3W8LA 4IM2A 4TN6A 4IJ9A 4ZTNA 2W9ZB 3QUPA 3VS7A 4R77A 2RG6A 2R3PA 4G3CA 3KXMA 3ATSA 4FEWA 3TEIA 5D7AA 1OBGA 4ZSAA 3FHRA 5JRSA 3MVLA 5KKRC 4IH8A 1XH6A 4AOJA 3Q9XA 4XLIA 4CMUA 4DEHA 4BGHA 5JGBA 5JMSA 2WO6A 5D11A 4QMNA 4FTMA 4FE2A 4BC6A 4DYMA 2WMVA 3GU5A 4AOIA 2J7TA 2I0YA 4ONAA 1K9AA 5M56A 4ZMFA 3JY9A 3JVSA 4FKTA 4HVSA 2X6EA 3NIZA 1W8CA 3SXSA 3DK6A 3VRZA 3MESA 3ZM9A 3NCZA 2JAVA 3NSZA 3OBJA 3ODYX 3KXNA 2BHHA 4MD8E 4ALUA 2AUHA 5K5NA 1XH7A 5J7HA 4O7YA 2WTDA 5M06A 2A19B 2YCQA 1W0XC 1CSNA 2FUMA 2JFMA 3HRBA 3DAJA 5DR2A 4LV5A 5CS6A 5HU9A 5FTOA 2HCKA 3UG1A 1R3CA 5J8IA 4FNXA 2O8YA 4LRJA 2FA2A 4G1WA 1OL6A 3WYYA 1DI8A 2Y9QA 1M2QA 1HCKA 1GY3A 1I44A 2W9FB 3R8ZA 3PSDA 4X0MA 2CMWA 2E9NA 3H4JA 4EYJA 4NKAA 3V5PA 3O71A 3Q9ZA 2UZUE 3MVJA 5DBXA 4RPVA 3UODA 3E62A 4CRSA 4FC0A 4YJNA 2YABA 3F5PA 1T46A 5DYJA 5FWKK 2JIIA 3NUPA 1Z9XA 3OUNB 4FTIA 2X2KA 3QRUA 4Y83A 5HTIA 3DV3A 2X0GA 2XYNA 5FBNC 4UX9A 2Y6OA 2VTAA 2VUWA 4AZEA 2RFSA 3C50A 3QUEA 3HLLA 4QNAA 4NM0A 4FYOA 5IEXA 4RLKA 5K4IA 5ETFA 5CU6A 1URCA 2WU7A 5B2KA 4GFGA 4QT1A 5CLPA 3RAKA 3UVPA 3W18A 4C4HA 4HYIA 4H05A 4RWKA 3R1SA 1M7QA 5M55A 5HBHA 4ZOGA 5HX6A 3AMAA 2J9MA 4AU8A 3F2NA 4HYUA 4D5KA 3LW0A 1M7NA 1URWA 1Q61A 3UQGA 4IVDA 3H30A 3BLQA 1MRVA 4I21A 2WB8A 3EQFA 3OTVA 4U6RA 3G0EA 4BDDA 5E90A 4F08A 2OF4A 4G9RA 2FSOX 2RKUA 5H8EA 2W4JA 4XP0A 1NT2A 2R3LA 2HENA 4BDKA 5D10A 5BVNA 2QOLA 1WBSA 3CCNA 5I4NA 4QTBA 4F70A 4WNKA 3V6RA 2XNNA 3V5JA 3MS9A 2VX3A 4I5PA 4IFCA 5GZ8A 2GFSA 1R0PA 4V01A 1REKA 3EL7A 3R7VA 2YDIA 1ZAOA 4XH6A 5AIRA 3PP1A 4KSQA 2XEYA 1KE9A 4TNDA 4GMYA 5M08A 4JXFA 4NSTA 4QP8A 2F7XE 2XIYA 4IDTA 5AP6A 2R3IA 3CS9A 3FMMA 3W2CA 4YMJA 1U59A 2P2IA 3KRWA 3UG2A 4CD0A 2WPAA 4E5AX 4YZNA 2GU8A 1RDQE 4YHTA 2W05A 5E9EA 3G5DA 1GZKA 2R3KA 3LJ2A 4FMQA 2ETMA 2QOHA 5BYZA 5BX0A 1FGKA 2OIDA 4RWJA 4ZY4A 4EUUA 3SHEA 5AWMA 4K1BA 4C8BA 4AW1A 4DGOA 1W82A 3VAPA 3ZHPC 2QG5A 3I1AA 3W55A 4FKGA 4FL3A 5AA9A 1JPAA 4O0YA 5LMKC 3MIAA 1U4DA 3HKOA 4EH8A 2CDZA 1JBPE 2HZNA 3GU4A 3PVGA 4QD6A 1H28A 1LUFA 4R3RA 1ATPE 4LMUA 4BIEA 2QOOA 5CENA 4BIBA 4BVUA 4L01A 4BB4A 2P3GX 5K4JA
chains in the Genus database with same CATH superfamily
4QDVA 3DDPA 4ZSEA 5IMEA 2HXLA 3H9FA 2XB7A 4BDCA 3EQIA 2VTNA 4B4LA 4BJJA 4B8MA 3G9LX 5EH0A 2YFXA 3BGQA 4JQ8A 4D2WA 4YJTA 4JIKA 5J5TA 3TKUA 4R3CA 3DNDA 2O0UA 3OG7A 4O0TA 3PFQA 4O4CA 3NWWA 1IAHA 1H1PA 5IQHA 4JX3A 1KOBA 3MH1A 3Q9YA 5EKNA 1YXSA 4FSUA 4MXYA 4TWCA 4O86A 1IEPA 3I7CA 4D1ZA 3EWHA 2JKOA 3OFMA 5CEIA 3LKMA 2BR1A 2JAMA 3R01A 3OD6X 1ZYLA 2WMRA 4Z7GA 3D94A 3QFVA 3ANQA 1NVQA 2R7IA 3GENA 2XH5A 3B2WA 1FGIA 3IDCA 2QOCA 3MB7A 2OZOA 3OVVA 3QTRA 5DLSA 4EQUA 4YBJA 4P7EA 3GOKA 4PUZA 4BN1A 1CKPA 4TZRA 3TJCA 3D4QA 3R7OA 4PPCA 3O5AA 5B2LA 3HDNA 4I6BA 3C51A 3IK3A 3K5UA 5FEDA 1ZRZA 2RGPA 3LMHA 4C4GA 2ZAZA 3ZLWA 3Q4UA 4G31A 4A07A 4QYEA 5BUEA 4LRMA 5AP1A 3VS1A 2CNUA 5LVNA 5CAOA 4I6HA 4HZRA 3ZCLA 4BKYA 4CLIA 3SW7A 2OKRA 4RG0A 5FXSA 4MQ1A 4APCA 2ZV7A 2IVSA 1KOAA 5JN2A 5CQWA 2JD5A 3CSVA 1LEWA 4GFMA 3HV6A 2OJJA 3D14A 2IN6A 3P08A 3GU7A 3QTWA 5EM7A 4YJRA 4ANQA 5B0XA 4KIPA 5FM2A 4YTFA 4FEUA 3FYKX 4N57A 3K3JA 4QP6A 2YITA 2HOGA 3AGMA 2EB3A 4EORA 4DH3A 5D41A 2QO9A 3G51A 2YM6A 3QX2A 2XNMA 5IPJA 5AUWA 4NJ3A 4RT7A 5E91A 4JVGA 5H8GA 4IE9A 4OTRA 3H10A 3R1NA 2PHKA 4RIWA 2UVXA 4D4YA 5E8WA 2JIVA 3O8UA 4DEBA 3PYYA 4EOLA 2CKQA 4QPSA 3WARA 4D2PA 1OPLA 3WI6A 3D5WA 3HX4A 2W1EA 1JSTA 3AQVA 3UYTA 2PZRA 1Z57A 1RJBA 3BYOA 2JIUA 2WMQA 4JQEA 5CSVA 3NUXA 4FV3A 5HOAA 3UDSA 1Y6BA 2OZAA 2R9SA 4E5BA 2CKOA 3RPVA 2YM8A 4FZ7A 3LLTA 4FZDB 4O2ZA 4X2KA 5JZNA 4DH8A 4GKIA 4ZTRA 5AAFA 4FIJA 3P1AA 3ORZA 4X2JA 5EI8A 4TKSA 1ERKA 4U40A 4KKEA 5AV2A 3AG9A 5IU2A 4EHVA 2Q83A 4E73A 5HORA 4X3FB 5KE0A 3RTPA 1MP8A 2GQRA 4KAOA 5AV1A 3D7ZA 3IGGA 4RC3A 4XV9A 2WQNA 4FUXA 4BTJA 3F3ZA 2XKFA 5HO6A 2PMIA 2PZ5A 2C3JA 2CNVA 3AKKA 5GZ9A 5ACBC 5KMKA 5BVKA 4WKQA 5A6OA 3F3TA 3GC7A 5DPVA 2C5XA 2C6LA 2PU8A 5TO8A 3HAMA 2VO0A 4F78A 5A46A 4ZTMA 4AZTA 4FKVA 1UNLA 2YIQA 3C5UA 4FRFA 5HZNA 3EQGA 2WEIA 2VV9A 2WHBA 4F0GA 2BRBA 2HWOA 4FVRA 3VUIA 3MVMA 2A0CX 3EHAA 3QWKA 5HLNA 4O6LA 4PNIA 2UW7A 2CGWA 4O0WA 4DEEA 3F66A 3PG3A 5EQPA 2B52A 2IW6A 3EQRA 4BCNA 3BU6A 2W5HA 3EH9A 2XNOA 3DFCB 4UYNA 4AS0A 4BFMA 4D0XA 5I9VA 4DCAA 4GFOA 4TY1A 3V5WA 1DI9A 4C3RA 2W4KA 3HMMA 3QL8A 3GFEA 2A1AB 5CSHA 4FA2A 4M0YA 4O6EA 4ASXA 1APME 4R1YA 4RFYA 3WZEA 3EFJA 1TQMA 4BDGA 5CEKA 3G33A 3P23A 4IANA 4WIHA 3JYAA 3ZYAA 3R83A 5C27A 4PL5A 1B6CB 1ZZ2A 2XRUA 3AD6A 3TUCA 4BTFA 3C5IA 2VTLA 3I0QA 3SOAA 2VGOA 4G2FA 4UWCA 3PPZA 5L8LA 4RJ7A 2CGUA 3KB7A 4FG7A 3RPOA 5FP5A 4BZNA 4E5WA 2HY81 2GHGA 2OIQA 2YLFA 2W06A 4BWXA 5CF8A 3KREA 2YCFA 3M1SA 3UP2A 4TYHB 2FSTX 3BBTB 4E1ZA 3WZKA 1UWHA 3BX5A 3NDMA 3HNGA 3L9NA 5AP0A 4L9IA 3R71A 1AD5A 3BHUA 2QOBA 4OTIA 4X2GA 3PA5A 4OTFA 3FMNA 4GUBA 4RVLA 5BUIA 1WBWA 2ESMA 3WBLA 3VVHA 5IQEA 3R9RA 2X7OA 3QQUA 2XUUA 5AV3A 4AGWA 5BVDA 5IQDA 2H8HA 2I0VA 3FI3A 3FUPA 4I92A 4Y72A 5FG8A 3D0EA 4I6FA 3AKLA 4CMOA 2F57A 4YLLA 3SKCA 4XEYA 4MVFA 4QPAA 2E9PA 1QL6A 2VNWA 4WRGA 2HWPA 3BRBA 4Z9LA 4DFZE 3F2RA 5ACKA 2FSMX 2X8DA 4YJPA 4II5A 2GNHA 2P33A 4G9CA 2QVSE 4LYNA 3EIDA 3NFGB 4XV1A 4FV4A 3T9IA 1MUOA 3KF4A 3LZBA 2BTSA 3OCSA 5AUUA 1ZYDA 3F7ZA 2XCHA 2J5EA 3QTUA 5J5SA 3TI1A 2GHLA 3WE4A 3QHWA 3FE3A 4FTTA 4NW5A 5IA5A 3BHYA 2IJMA 4QMTA 1CTPE 3QD0A 4B7TA 4TYIA 4FZ6A 2BRGA 3Q2JA 4L44A 4DF3A 2CLQA 3W2SA 2W0JA 4ASDA 2VGPA 3B8QA 3HL7A 2XANA 3NUSA 4ZTQA 2JLDA 3A2CA 5AR7A 2X4ZA 5LWNA 5IH4A 2E9OA 4C59A 1YXUA 3RK7A 1P2AA 4O21A 5T6KA 5L2WA 2PUNA 5C4LA 3P5KA 2C1AA 2ONLA 2W5AA 1JLUE 2W17A 1LP4A 4OBOA 5DNRA 3W10A 3SVVA 4GH2A 5JK3A 1UVRA 1OL7A 2XM9A 3F3VA 2RIOA 3EKNA 3GB2A 3LCTA 5FTQA 2SRCA 3DT1A 3DXNA 4R5SA 4KSPA 5H2UA 4EK6A 2VRXA 3G90X 4FICA 4BHNA 2UW9A 2PE2A 3LE6A 2OWBA 2WU6A 1XH8A 5AR8A 3FZTA 1QPJA 2XIRA 2PZYA 5FTGA 3LXPA 4ZTSA 3IW4A 4CFUA 3UOJA 4KIKB 5J1VA 4IM0A 1H08A 5ETCA 3AGLA 4TRLA 1ZYSA 1PKDA 2BRNA 2GS7A 3CLYA 1J91A 4RJ3A 1XWSA 1VYWA 5C9CA 5FXRA 5HI2A 2OJ9A 4HW7A 1PXOA 4ANBA 5TF9A 3FDNA 3NUAA 3TZ7A 4JL9A 5HG5A 4O1OA 5DR6A 5HQ0A 3PJ1A 5L6OA 5D7VA 5GINE 1Q8TA 3L8SA 4OGRA 3RPSA 2C47A 2QU5A 3TXOA 5HGIA 4DHFA 4HNIA 4DH7A 5BUJA 2B53A 4Y5QA 5IA2A 3FYJX 3IOKA 4YR8A 2PUPA 3IW8A 4L43A 4U42A 5CU3A 3ZBFA 2UZVA 2HW6A 4F9CA 2B9FA 2BFYA 3FC1X 5AX9A 4LQMA 4QMOA 4XYFA 3RM6A 4FSMA 3KN5A 2DUVA 2XK4A 4XP2A 4I20A 2ZM4A 1L8TA 5AR4A 5L6PA 2PVRA 4LG4A 4MD7E 4U9AA 4JIAA 2YZAA 4DH1A 4PTEA 5EW3A 5HHWA 5JEBA 3OWLA 3W16A 1H1WA 4CFWA 4D2TA 1OIQA 1OKWA 5TE0A 4EH5A 4AE6A 3L8VA 3C0GA 1VJYA 4YTIA 5ANOA 2UZEA 3SRVB 2XAOA 4QTEA 3DA6A 2F9GA 3CQUA 4EI4A 3V8WA 3RNYA 2ZVAA 1I09A 1WBVA 4ANOA 4F6UA 5M53A 3FMLA 3FZOA 3LFFA 5CU2A 3BWFA 3RI1A 2W4OA 4E4NA 4Z16A 5AEPA 3QRKA 4MXXA 3R63A 2QNJA 4I4EA 2WMTA 1IASA 4EQCA 5CF5A 3U55A 3S2PA 3BLRA 3DKOA 4CRLA 5TR6A 1JQHA 4CFXA 3IS5A 3QCQA 2C6DA 3KCFA 3HGKA 4IB0A 5E1SA 5KZ0A 2YLEA 4KUJA 1Q8WA 3UIUA 1W2CA 3FI2A 1WBOA 1O9UA 3LFSA 5CALA 2QOFA 4LOOA 4RIYB 3LXNA 4QQCA 3KULB 3GCVA 3PVWA 3BV3A 1V0BA 2UZWE 4ZLYA 5EG3A 3A7FA 3Q3BA 2X7GA 3DQXA 4CCBA 2C68A 3E64A 2GS6A 3SD0A 1R0EA 5C1QB 5EFQA 3PZHA 4EC8A 3K5VA 3PZEA 3UOLA 3GC9A 4UZDA 1WVYA 4QYGA 4JDKA 4X6QC 5D1JA 4RX7A 2HZ0A 2UZNA 4PDPA 4RX8A 2B1PA 3ETAA 3QD3A 3LHJA 3QHRA 4ZTHA 3FEGA 3BYMA 3NNUA 3FLQA 4UWBA 4EK4A 4HGSA 3G15A 3I6WA 1ZOHA 5FD2A 2XMYA 5FGKA 3Q5ZA 5EI2A 5HIDA 4GL9A 1Q3DA 2IVTA 2VTHA 3SOCA 3V01A 5EYKA 4FKRA 3IKAA 3FMDA 4M3QA 4BCOA 3MIYA 3G2FA 3UIMA 4D58A 4ZEGA 1MQBA 3R2BA 3LJ1A 4HGTA 3PLSA 1H1QA 3AC4A 4G3GA 4X2FA 5DH3A 4BIDA 2R5TA 3F2AA 2A27A 3LXKA 3RM7A 3UIXA 3UNZA 4WBOA 3SA0A 4KBKA 2J50A 3DBQA 1Q8YA 3NAYA 3A4OX 5BYYA 5KKRB 2E9UA 4FF8A 1CKIA 4IQ6A 4YC8A 3UVRA 5KMJA 5C8KA 4ZIMA 4A06A 3QCYA 4M97A 5CAUA 3DAKA 4F0IA 4M68A 1OZ1A 5HO7A 2PE1A 2X9FA 4NKSA 2VO7A 4S32A 1YI6A 3CR0A 5KCVA 2IVVA 2F4JA 4B6LA 4BDEA 2VO3A 3A62A 4I93A 5LCKA 1YI4A 5EQEA 5DMZA 4XG7A 4ZSGA 4GT4A 3DXQA 4EOQA 2BIKB 4K77A 2XIXA 3HA8A 2BDWA 4G3EA 5EHLA 5AM7A 2AYPA 2BDFA 2BMCA 4C3FA 2IZUA 2GQSA 3GCSA 2J5FA 3T9TA 1UKHA 4AGDA 4EUTA 3CD8A 2WIPA 3NR9A 4DTAA 2G01A 2XYUA 3PXRA 4FOBA 4W4WA 4EZ3A 3NVKI 2BAKA 1ZOEA 4NZWB 5EW9A 4N0SA 4TTHB 5AA8A 1G8KA 2OJFE 4J98A 3O2MA 3C4WA 2XNEA 3LMIA 2J0KA 3QLGA 4JOAA 4B9DA 4I0TA 1H24A 3RINA 2O5KA 3EMGA 4O1PA 4ORKA 1ZOGA 4EOKA 4CG9A 3MJ2A 3R7YA 1EH4A 1Y8YA 2QOKA 3PSCA 3QTZA 2X4FA 4O2PA 3KCKA 4OT5A 5BQ0A 4K9YA 3GXLA 5IG1A 2W1DA 2WNTA 4ACDA 4I1ZA 2PULA 2XZSA 3ZUVA 5JQ5A 1O6LA 2V0DA 3MW1A 3UDZA 4O0XA 4BI2A 3QA8A 4WSQA 2BZJA 2ETRA 2B9IA 2J4ZA 3RAIA 4E3CA 1G8SA 5K5XA 4O7ZA 4MYGA 4UMPA 4Y85A 3R7EA 5I0BA 3KGAA 4Q2AA 3BGPA 1AQ1A 3NW6A 4MUQA 4O81A 4QYHA 1YHSA 4ZLOA 2WIHA 4GVAA 3ZO4A 1V0PA 2R3FA 1CM8A 3ANRA 4O4FA 3HMNA 3FKLA 4JX7A 2YDJA 3KMWA 3OBGA 4MXZA 1G8JA 4UEUA 4BYJA 3R9HA 4YJSA 3ZUUA 3CGOA 2W1ZA 2XKDA 3P7CA 3II5A 4IZAA 4BCQA 4JJRA 3QQHA 4NM5A 2X1NA 2F2UA 4M84A 3THBA 3WZDA 4O82A 3PA4A 3CXWA 3R22A 2YISA 2Z7LA 4PDYA 1LPUA 2JC6A 4HGLA 5ANIA 3HRCA 2XCKA 3GVUA 2EXCX 4UV0A 2UVZA 5HKMA 4I94A 4NWMA 5IISA 1KE6A 1XR1A 2B55A 4E6DA 2BKZA 2C6TA 4G5PA 4NUSA 3U54A 3QBNA 1YWNA 3RGFA 5M4IA 3P7BA 2HW7A 5CNNA 3F69A 2AQXA 4ZXTA 4XMOA 3VC4A 3QA0A 2OBJA 4MXCA 4PNKA 4IW0A 4AT3A 3DS6A 4HCTA 2UW3A 4WBBB 4CLJA 1CMKE 2JFLA 3LVPA 5HG8A 3VHEA 3GCPA 4D28A 1PHKA 5IMXA 4IAAA 4MNEB 1JKSA 5DN3A 4X3JA 3EJ1A 5AUVA 2H96A 2IZSA 3A99A 1YXXA 3QQJA 3PTGA 4H3QA 3R8PA 2BFXA 2NO3A 4GYIA 4JS8A 4MX9A 3ZH8A 5HTBA 1FBNA 4WA9A 2LAVA 1ZXEA 3H0ZA 3DAEA 5C8MA 4IVCA 3PJ8A 4U80A 3HVCA 3FKNA 3PY1A 3ZONA 3S0OA 3UO5A 2CJMA 5DHJA 4A4XA 2JDOA 3HMOA 4ZJVA 2YJRA 3R00A 1GIIA 1OL2A 4NL0A 4NCTA 4O22A 4YNOA 3PDTA 4FV7A 5GHVA 2Z8CA 3HMIA 4DDIA 3PWDA 3AC5A 3D2KA 3L9LA 4OW8A 4BWKA 3MFTA 4I6QA 5GNKA 1SZMA 3WILA 4ARKA 1DS5A 1U5QA 4QMSA 1J7LA 2Y4IC 4L46A 2PL0A 2BCJA 5EHYA 3A7GA 1IRKA 3RPRA 5FUTA 1H0VA 4QDEA 1CDKA 5HX8A 3RP9A 3SG9A 3F5XA 4L7SA 5FLFA 3ZZEA 3PRFA 2W99B 2ZV2A 2XA4A 4YGAA 1H26A 1PMEA 3FLZA 4ACMA 4F7NA 1PYXA 2Z7RA 4B0GA 2E2BA 2WMAA 2XM8A 4DFNA 1S9JA 1OUKA 2YHVA 1ZY5A 4V05A 4EKKA 4M8TA 4F6SA 5H3QA 4B99A 3IG7A 5AAEA 4FSWA 4TT7A 2PVNA 4YUQA 2HZIA 1M52A 4J52A 4O0UA 4RJ5A 3GEQA 4YHFA 5ETIA 5IA1A 1ZLTA 5D12A 3WE8A 2XRWA 3CEKA 3C9WA 4LV8A 2XVDA 4HNFA 4F99A 2CN8A 1UU9A 4LGHA 3FWQA 3NRMA 5CVFA 3UO6A 4DG2E 4YO4A 4IDVA 5IQCA 2FSLX 4JNWA 4J8MA 2VWVA 1XO2B 5H9BA 5AP7A 4G34A 5CTPA 3DLZA 2BPMA 3FZRA 1TQPA 3E92A 4BZOA 3NFFB 5AP4A 5DOSA 5JZJA 4U8ZA 4R8QA 4PF4A 5EK7A 4FNYA 3S1HA 1QPEA 4PDSA 1SYKA 4F1OA 1OIYA 1U54A 2V55A 5L6WL 4GG5A 2R64A 4EC9A 4F64A 2OXYA 4FKPA 4BDIA 3AC2A 4TYJA 4M69A 5IF1A 2YWVA 3Q53A 1FOTA 3Q6WA 2PMLX 5EYMA 4W4YA 4I0SA 5BVOA 4FZFB 2UV2A 4ALVA 3G0FA 3W1FA 4D9TA 4M14A 4QP4A 4FTOA 2QI8A 3E3BX 1ZMUA 4WNOA 1HCLA 3ZBXA 5FEEA 3GP0A 3GT8A 3KIOC 4G3FA 4EWHA 3F9NA 2PPQA 5L8JA 1YOLA 4JBOA 4MAOA 3F82A 5HICA 4ERWA 4ZTLA 4C7TA 3H3CA 5LVOA 1KUTA 3NNWA 2OFVA 4D55A 3DKFA 5IDNA 5ICPA 2C5NA 4I0RA 4V0GA 4PTGA 4AA0A 1PXJA 3HZTA 2C3KA 2W7XA 4QMWA 3CQEA 4KINA 2PMOX 4IJPA 4YSMA 3VS6A 4BDJA 2F2CB 3N4UA 3NEWA 3TKIA 4L8MA 3BL7A 3C4FA 3B8RA 3H9OA 3HV4A 5A3XA 2WOUA 3DBCA 3IW7A 3MJ1A 4IVAA 4XCUA 1PW2A 2PWLA 3EN9A 4XX9A 3UTOA 4AGUA 4CZTA 3KVXA 1SNXA 3GCUA 4RBLA 4E93A 2O65A 3D2IA 4BICA 1QCFA 5LOHA 2XK9A 3CE3A 3FSFA 3F7WA 4U45A 2ONLC 4RIXB 4NJDA 2WQEA 5EM5A 5KHXA 5HD4A 2QURA 5FEQA 3HV5A 4DEDA 5M4UA 3NVMB 3IQ7A 3LQ5A 4WOVA 2X7FA 3EQBA 3MPMA 3OOMA 5E8XA 3TWJA 4BTKA 4GJ2A 4ZZMA 3SXRA 4A9UA 4L00A 4ZLZA 2UW4A 4PPAA 3V51A 4CTBA 3CPBA 4FSTA 4UBAA 3LLAA 3C13A 3CJGA 3RWQA 3LFQA 1YXTA 3VQHA 3AT4A 2WEVA 3SGCA 3S95A 2FVDA 2HY0A 5F4NA 5A6NA 4FG9A 3ML1A 4EOPA 1B38A 3LOKA 3PRIA 1NA7A 4D4VA 5DWRA 2HZ4A 5LARA 4BCIA 4BGGA 4WSYA 3ZTXA 4EZ5A 4OTDA 5T3QA 2W1IA 4IAKA 3NAXA 3TIYA 4FODA 1ST4A 4GV1A 4MXOA 3WF7A 2UW6A 2PVLA 5LWMA 4ITIA 2R3GA 3R9DA 3VW6A 3PP0A 3ZLXA 3A8XA 5IEVA 4IAIA 3Q4CA 4C35A 4BR3A 3HAVA 4XV2A 1WVXA 1YDSE 2C0IA 3DLSA 5J87A 1YWVA 2RFDA 3VWAA 5JT2A 3VUHA 3BI6A 5E92A 3NYVA 4JG6A 4O0SA 4QPMA 5ITAA 3ODZX 4G16A 3FLNC 2WQMA 3OXIA 2VTIA 3KFAA 4F9YA 2YEXA 1MRYA 3QAME 1VZOA 4O0RA 5DGZA 1Q41A 3LQ3A 4O83A 4N70A 2WTIA 3VUKA 2VN9A 4FV8A 3UDTA 1KE5A 3U6IA 3V8TA 2QONA 4D2SA 5I3RA 5IA0A 4O96A 4D5HA 3DFAA 1XH9A 3I60A 5L4QA 3A7JA 4AACA 5CANA 4WNMA 4IACA 3I5NA 3QKLA 2RFEA 3FPMA 2B54A 4H39A 4OR5A 5HCXA 3RAWA 2WMSA 1W84A 4FT5A 4UWYA 4QYFA 4WRSA 3FLSA 3NPCA 3PPJA 3W32A 3UC3A 4PMPA 4Z55A 5CAPA 3CJFA 3POOA 3C4CA 4L7FA 2NYAA 2YM4A 1R1WA 1P14A 2W1FA 4XS2A 4F7SA 2X2MA 3QZGA 5KBQA 3QD4A 3EB0A 3OEZA 3QALE 3OOGA 3VBXA 5BVFA 3VBVA 4BTMA 3OC1A 4DE4A 4UALA 3BHTA 2R3QA 4QMVA 4NIFB 2OXXA 5E8YA 5CEPA 4R6VA 1G3NA 3D7TB 3W0RA 5CX9A 4F9AA 3NYXA 4CGAA 2IEWA 2ZJWA 4E6AA 4ZMEA 2GDOA 3EL8A 1J1BA 4QYYA 1GAGA 4EH7A 1Q8ZA 4RC2A 2XF0A 3QGWA 3MWUA 3BV2A 4KS7A 2OU7A 2WQBA 5DRDA 3CTJA 4ANMA 3HYHA 2YAKA 3TUBA 4ANNA 3R1QA 1OM1A 4R1VA 3BHHA 4EHEA 4O7TA 3ZC5A 3S4QA 3AT2A 4D2RA 5IH6A 3OZ6A 4J8NA 3VS4A 4PP7A 4Y8DA 2V7AA 5AFVA 1E1VA 4FG8A 5AIKA 4BDAA 4IZYA 4ZS0A 5FRIA 4KRCA 3ZU7A 4ENYA 2JBOA 4MQ2A 1UNGA 4YU2A 4DBXA 3MPAA 4RJ8A 4Z3VA 5AUZA 3L8XA 4L53A 2FH9A 5DEWA 3TZ9A 2I40A 1IG1A 3IGOA 4ZZOA 4RVKA 3E7VA 1JSUA 3PSBA 3NGAA 5IUIA 3JXWA 2VNYA 3KF7A 1ND4A 3A60A 4DT8A 4UYAA 5HNGA 4YTHA 2EU9A 3ROCA 4E4LA 3QC9A 3EQHA 4GK2A 3RZBA 4TL0A 4ZJIA 4QQTA 2GTNA 2W5BA 2CCIA 5F20A 4DLIA 3ALOA 1OMWA 3FY0A 3W2QA 1YHWA 2ITTA 3F3WA 3QCSA 4FKOA 4IM3A 3P5JC 3LFBA 3GUBA 3ATTA 5KHWA 1UU7A 4YHJA 2OJIA 2R7BA 1OIRA 4AG8A 2CLXA 3QC4A 4GCJA 4CYIA 2BUJA 2G2IA 3L9PA 3PE1A 1QPDA 4X21A 4CSVA 5IUHA 4OAUC 4U81A 3MSSA 1A48A 5DG5A 3ZS5A 1OBDA 2PVKA 4C57A 2IWIA 2XP2A 4OTHA 1GJOA 4QMPA 2IW8A 1WCCA 3OMVA 4RRVA 2CGXA 4DN5A 4W8DA 3ZEPA 2C5YA 3COIA 1OUYA 2PE0A 5DA3A 3W8QA 3AD5A 3RNIA 4Y73A 1KE8A 4DLJA 5KBRA 3FL4A 5E7RA 4G6NA 4FIEA 4BDFA 2VTPA 5FDXA 2R3JA 5CNOA 5HCZA 1DAYA 3MPTA 4O0VA 4AT4A 4AZVA 4EK8A 1W98A 1OL5A 3QYZA 3VNTA 1OGUA 2BAJA 3KRRA 3TMOA 3R28A 3N51A 2WELA 3PPKA 5E8UA 4C37A 3MGYA 2FYSA 3UIBA 3VBTA 4XOZA 4HYSA 2W96B 4NK9A 5CQUA 2PTKA 4CMTA 5CVGA 1W2FA 2WOTA 4WNPA 3EQPA 3FQHA 4C3PA 3W0QA 4JT3A 4HPUE 4RWIA 4E6CA 5IA4A 2P2HA 3EQCA 4EZ7A 3BZ3A 3KEXA 2Y8OA 4QMYA 3HUCA 1FVRA 3HA6A 3B2TA 4O7SA 4KD1A 2NRYA 2WAJA 3RHXA 2YM5A 3U4UA 4I22A 4JG8A 4AOTA 4F1TA 5M57A 4AZSA 4FUYA 3U87A 5HD7A 4G6OA 4BDHA 4OTPA 3HMPA 4RGJA 2YCSA 1BI7A 2VTJA 2VWWA 4ZJJA 3ULZA 2P0CA 3QX4A 2Z60A 4QP1A 2QR8A 3BYSA 4HZSA 5L3AA 2CKPA 4CKRA 3UBDA 3ULIA 4FSZA 5EDPA 1XQZA 4MCVA 4I5MA 3RBWA 2R2PA 2NRUA 3BELA 4RA4A 3BQRA 1PXMA 3W2OA 2Y4PA 3DDQA 4TWOA 4KS8A 3KN6A 4ZAUA 3EN4A 4JG7A 4ACGA 2X6DA 3UDBA 1XHAA 4C4IA 4W9WA 3TDVA 3V5TA 4YJUA 4Y95A 3DU8A 2OW3A 3NYNA 5J9ZA 4F7LA 3LXLA 5CF6A 4CKIA 1FPUA 4UY9A 2HIWA 1E9HA 3C0HA 3KA0A 4RVTA 3EN7A 3LMGA 4RQKA 1OPJA 1L3RE 4HVDA 3O7LB 3K3IA 3PIYA 1WMKA 4KRDA 4QP2A 4ZSJA 4EL9A 4FSRA 2Z7QA 4HYHA 2QKWB 4UMQA 4S34A 2I7QA 3HUBA 3EZRA 5KUPA 5ANDA 4M69B 3OTUA 4FKUA 3ERKA 4DHZA 4XG9A 4ACHA 3IW5A 3LFAA 2CN5A 3LJ0A 1Q8UA 2ZV8A 5TKDA 1YWRA 3UJGA 2GTMA 3ZO1A 5BMMA 4EEVA 3MV5A 4IWPA 5CZHA 3VBQA 4CZYB 3DBDA 2BVAA 4EK3A 1X8BA 4AQKA 2I0HA 5AP5A 4AW5A 3BEGA 3V5LA 2PZPA 1ZARA 4H36A 3TT0A 2QCSA 3PIXA 2XKCA 4PL3A 3VS0A 5J7BA 4FT3A 3Q4TA 4GUEA 5CY3A 3V5QA 1OECA 4JR3A 4USEA 2HYYA 1B39A 4QQ5A 4R3PA 1P4OA 3OEFX 4O7WA 4QMLA 2G15A 2I6LA 4S2ZA 1PKGA 4BGQA 1JKLA 5DT0A 5LMBA 5GJFA 2C4GA 4MEDA 2GNIA 4FEQA 4GK4A 1WBPA 3DBFA 4FVPA 4NCTC 5CEQA 2QO2A 4N4SA 1OI9A 4U41A 3I81A 3D5VA 1WVWA 3LCSA 5IDPA 3QQKA 4JDJA 3E87A 3ZLSA 1SVEA 5IKWA 2C5OA 3Q32A 2WMBA 3PJCA 2BHEA 2VO6A 2WFYA 2PMNX 2NPQA 2X2LA 3OY1A 3Q52A 5JFSA 1IAJA 3PJ3A 4A4OA 4BJJB 4FT7A 4DT9A 1BYGA 4FKWA 3ZFYA 4HVGA 4A9SA 3WIGA 4A4LA 2ITOA 5A4QA 4P4CA 1XJDA 3TL8A 4JR7A 2QOQA 2B0QA 3PXZA 2R3HA 3W2PA 4YJQA 1SNUA 3FMJA 4FGRA 3IONA 3ZLYA 5AADA 5ETAA 4FL1A 3CY2A 4YP8A 5LVLA 5G1XA 1PMVA 4DTKA 2O63A 3FQSA 4CT2A 3IDBA 4RJ6A 3W2RA 1XMMA 3VUMA 4AWIA 2DWBA 4R7IA 4DINA 2ZMCA 4HCVA 4MWIA 4PQNA 5DFPA 5HE2A 4IWDA 2Q0BA 4E26A 4RWLA 4E6QA 4YLJA 1H00A 3CY3A 4V04A 4QTAA 3R9NA 2QHMA 1VLRA 2ZDTA 2VZ6A 1IR3A 5AMNA 2WTJA 5GZAA 5GJDA 4C58A 1XBBA 1GNGA 3O8TA 1W83A 3PXFA 3AC1A 4FKIA 4YC3A