4HCTA

Crystal structure of itk in complex with compound 52
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
265
structure length
265
Chain Sequence
GKWVIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWRERPEDRPAFSRLLRQLAEIAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Covalent inhibitors of interleukin-2 inducible T cell kinase (itk) with nanomolar potency in a whole-blood assay.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 265
sequence length 265
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4hctA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4hctA01
3OD6X 3QA0A 4DTKA 3Q4ZA 3QCQA 1PMVA 1DS5A 4M69B 3QTUA 4L3PA 4ZIMA 4IFCA 3RHKA 4O21A 4KABA 3BU6A 2YCRA 3B8RA 4L42A 4PNIA 4DTBA 4APCA 1GZOA 4N6ZA 4ZLOA 3ALNA 4RQVA 3HA6A 3E7VA 4FL3A 4RVLA 2XKDA 3PG1A 3QZIA 4MXCA 3NPCA 4U7ZA 4JQ7A 2YAKA 3OTUA 4FKTA 5J7HA 2HW7A 1UU9A 5CXHA 2X9EA 2GQGA 4BF2A 2HZ4A 4FKOA 4BIEA 3LFEA 5EQEA 3BYVA 4QMWA 2W1IA 3ACJA 2ZM4A 4ANBA 4HCUA 2BILB 2PVRA 1FOTA 2IZTA 4NK9A 3E88A 4X3FA 4QYYA 4ENXA 3EN9A 1IR3A 2OG8A 3U8WA 1H1QA 3VUDA 3FZ1A 3AC5A 1BI7A 3RHXA 4OBQA 1GZ8A 4RIXB 3G0EA 4TT7A 2ETKA 2GTNA 5BVNA 4BKYA 4HZRA 4CTCA 4ZTRA 4EHEA 5C1QB 2QR7A 4PPCA 3AGLA 2X2LA 3LQ5A 4C35A 5T68A 2KTYA 3HKOA 1BI8A 5IMEA 3BBWA 5CVFA 1E9HA 2VTLA 2ONLC 2R7IA 3LCKA 1TKIA 5AA8A 4FEVA 3PG3A 2EXEA 4DEGA 5I9YA 3GU7A 3Q96A 1XBBA 2BDWA 1OIUA 2R3FA 3CKXA 3GQLA 4RA5A 3C4CA 3HAMA 3L8SA 4WNMA 3COMA 1CTPE 2C0IA 3N4UA 3QYZA 2BUJA 1A06A 4IVBA 3NS9A 4KKHA 3I0OA 4BCFA 3IOPA 3RKBA 4QMNA 2VAGA 1SYKA 4D0XA 4FSUA 5K4JA 3DJ6A 1CMKE 4ZTQA 3B2TA 4QP6A 4Q9SA 2FSOX 1ZLTA 2WGJA 2B4SB 3M42A 1BX6A 4FKIA 4ANOA 3DU8A 4KIQA 4CMTA 3TKUA 1GZKA 1H24A 4BY9E 4YZ9A 2H6DA 4ARKA 2VNWA 2O3PA 1M7QA 2DYLA 2VU3A 4IANA 2GS2A 4U79A 4E6QA 1UKHA 5A4EA 5CSWA 5IUGA 3BV2A 3SG9A 2X4ZA 3RJCA 3MIYA 3LW0A 3NYXA 4HJOA 3C0IA 5JRSA 2PZYA 4M15A 4U43A 4U80A 3MA6A 3RPOA 3I6WA 2O63A 2XNBA 2OO8X 3BV3A 4XOZA 4BIDA 4BN1A 2XP2A 4WD5A 5BYZA 3T9TA 4FYOA 3VRZA 2R3GA 4K2RA 4QMSA 2RGPA 4DH7A 1YOMA 4XRLA 2XIYA 2GNGA 3IOKA 3OW3A 4J8MA 5FEEA 2FGIA 3IK3A 3I81A 3E8EA 1SVEA 1L8TA 2CPKE 2OBJA 1O6LA 1SVGA 5HE2A 3PZHA 5IA4A 1YDTE 5HTIA 3A8XA 1RDQE 3PVGA 5EOBA 3I7CA 5AUZA 3MH2A 4C3PA 3PJ1A 5EYKA 1PF8A 4CKIA 2W4JA 4F65A 3HP5A 1NY3A 3E62A 3GCUA 3ORKA 3OTVA 5EKOA 1SMHA 2H96A 4TKSA 4CYJA 3DT1A 4LG4A 3KY2A 4JAJA 2R9SA 2I6LA 2Y4IB 5ETAA 4GYGA 1T45A 2WQBA 4IW0A 1GJOA 1DI8A 4HGTA 3THBA 4NIFA 4IZ7A 2HELA 4XNEA 4XV3A 3CPCA 5IU2A 4DG2E 4QPSA 3VQUA 3JVRA 3F3VA 4QTAA 4FV4A 1JSUA 4I41A 4FSYA 3VAPA 2C69A 4IFGA 4HVGA 3COHA 2UW4A 2QHMA 3HMOA 4BDCA 2HXLA 3H0ZA 2CNVA 1Z9XA 3NR9A 4QP7A 3HRFA 2F57A 3CP9A 2BZJA 4GT4A 4C4FA 4DFZE 5BUIA 5HNIX 1JKSA 2IO6A 3OXTA 3DPKA 4E93A 3NIZA 3P78A 4GIHA 4ENYA 4ANNA 4PUZA 5IQHA 1W0XC 4CMOA 2X7GA 3FLYA 3O2MA 3VW8A 3GXLA 2VWUA 2CCHA 2C5VA 4XHKB 4CCBA 4OAVB 2ITPA 3WF9A 4PDYA 2FVDA 3OOGA 2JKMA 3MFTA 2YDJA 2WB8A 4F1TA 4O0WA 4V0GA 4GJ3A 4AOJA 2W0JA 5HQ0A 2UW0A 4FMQA 5K0KA 1GIJA 3QWJA 3HV5A 1WAKA 3R9HA 4QMUA 3V6RA 2P4IA 5HU9A 2R3IA 3H4JA 2XEZA 3ORTA 5KMLA 1U5QA 4GSBA 1V1KA 1FGIA 2XUUA 2ZAZA 3FBVA 3QU0A 3RCDA 5HLWA 5AR5A 3EQDA 1UU3A 3G0FA 2R3OA 4NM3A 5B2KA 3WF6A 3WE4A 4NM7A 5AV2A 2UZBA 3LCTA 4X3FB 3QD2B 3WIGA 4JQEA 5M53A 2QODA 5HEZA 5M55A 4AX8A 2YIRA 4CGAA 5EM5A 2BROA 2XIKA 3LCOA 5ANEA 5BVEA 4FT9A 5JGAA 4QTBA 4LRJA 3TZ9A 3R7IA 5HIBA 4DGGA 5KMNA 2CN8A 3OWJA 3SGCA 3Q6UA 1YKRA 5EDPA 4EWHA 5CU2A 5AUXA 3PY0A 1CKIA 3W1FA 2QKRA 4BGQA 4E4NA 1FPUA 2WAJA 3AC8A 3C4EA 5CENA 1NVSA 5HVYA 1RJBA 2I1MA 2C47A 3LJ2A 3EFWA 4FNYA 1HCLA 1M52A 2WTJA 3UE4A 3QLFA 2CNQA 3VW6A 4BKJA 4X3FC 5HD4A 2XZSA 4MXOA 3FPQA 1FMOE 3BLHA 4LV5A 3P86A 3UPXA 1NT2A 3GVUA 3EH9A 3R1YA 4BYJA 4NCTA 1KE5A 2X8EA 4DGOA 4MYGA 1YI4A 3OT3A 1ZZLA 4DFUA 1P4OA 3G9LX 3RALA 3QF9A 2BIKB 4IZYA 4RWKA 4Y83A 4O7NA 4NW6A 3QL8A 2YZLA 4KSQA 4XLIA 3R2BA 1UNLA 5AR3A 5HLPA 3T9IA 4C7TA 3BI6A 1OITA 2R3NA 3R9DA 1F5QA 2HYYA 3G6HA 3QRIA 5H2UA 4R77A 2V0DA 2H34A 3OS3A 4ZSGA 1OL5A 2GFSA 4UV0A 2UVZA 3GC8A 3QX4A 4NJ3A 5CVHA 1PXIA 5DH3A 4BZOA 5I9XA 4IZ5A 3SD0A 2HXQA 4YHJA 3F7WA 3PVWA 2OLCA 4O83A 3DXPA 4D1SA 2JKOA 4FKVA 1ZOEA 4DFYA 2ZYBA 2XK8A 1R0EA 4MXAA 1R39A 2YIYA 5AUWA 3C9WA 4AZTA 4D1XA 4BYIA 3POZA 2OIDA 1M2QA 4B0GA 5L8KA 5M06A 4FK6A 3R1NA 3R30A 4L67A 2UW5A 2Z2WA 4BZNA 4GYIA 4XBRA 4XBUA 2E9PA 2JIIA 2YEXA 3GT8A 2QOHA 4P90A 3W2PA 4G6OA 4U45A 4BB4A 5CU0A 3RAHA 1BKXA 4ZEGA 3H0YA 1OL1A 4OGRA 4AACA 3EKKA 3OBGA 3HRCA 2V7OA 4BDEA 4F7JA 5BYYA 2PYWA 3Q2JA 3TTJA 4FNWA 4EOMA 5ANKA 4K77A 5FRIA 4D28A 3OG7A 3C1XA 4GVJA 2QHNA 1Q24A 3IW5A 3DFCB 2PY3A 2C5OA 4GCJA 4Y5QA 4NJDA 5ACBC 3FXZA 4CZYB 3QD3A 4F70A 3RMFA 4BI1A 5AP5A 5CF5A 5IQIA 3TZMA 3MA3A 5E90A 5CF4A 5KKRC 3ZEWA 2UW7A 1YWNA 4O91A 5FXRA 3L8VA 3RM7A 3GNIB 1M2RA 4LL0A 4NIFB 2P3GX 4A07A 3POOA 3NYNA 1STCE 4E20A 2ERZE 2EXMA 5DR6A 4UWYA 2XK9A 3QXOA 3H30A 4BDIA 3ZC6A 5FXQA 4G17A 4AT3A 4AZWA 2WQEA 2BHHA 4XS2A 4O7YA 4LUDA 3L8XA 4FTQA 3QTZA 3RPSA 3NIEA 2RF9A 5AAGA 4AW1A 3PPZA 3KREA 4JBPA 5ANGA 2ZV2A 5L8JA 1B6CB 1URWA 1M17A 1XH4A 4I24A 1Q8YA 3E8DA 5IH4A 5CANA 1U4DA 2OH0E 2Y6MA 3QZGA 4MKCA 1O6YA 3U55A 3PLAE 3VHEA 5LVLA 4KBAA 3UP7A 4DHFA 3IPHA 3O7LD 5IF1A 3R71A 3UIXA 3KXNA 2BAQA 4TYJA 1JSTA 4EL9A 2C6DA 3CTQA 5CZHA 2CNUA 4D5HA 4L52A 5JQ8A 1XHAA 4B9DA 4FV0A 5FM3A 4RWJA 3UOLA 2J51A 3AT2A 3EQGA 4M13A 4Z16A 4XV1A 2C0TA 4BHNA 4FZFB 4YTHA 4K6ZA 2B9FA 4H36A 2XYUA 4G34A 1MQBA 2V55A 2IZSA 1OKZA 4YJRA 2Q0BA 4LOPA 3UODA 1REJA 2IG7A 3ID6C 4OTGA 5IH6A 3FLQA 3W8QA 4O0RA 2PULA 3UPZA 5JEBA 4IEBA 4EOLA 3ZCLA 4EUUA 2XB7A 3P79A 4E73A 5GHVA 4F9CA 5EFQA 5AP0A 2WIHA 3FWQA 3F69A 2RFEA 4E26A 1H27A 3OCSA 3ACKA 1ZZ2A 4ERKA 4G1WA 4ASDA 4KD1A 2W1ZA 3C4XA 4D2PA 3LMIA 3C5IA 4W9WA 4FIGA 4NWMA 4DT8A 3LFFA 4AZEA 2OKRA 3HLLA 3PJ3A 5IDNA 4QMYA 5AUUA 4O6EA 4EOJA 4EHVA 2XK3A 2YIQA 2J0JA 4FTKA 3G5DA 1UU8A 1W82A 3Q53A 2OZAB 3PLSA 4FTIA 2W4KA 5IQGA 3GCPA 3GGFA 4R3CA 4MEDA 1DAYA 2IJMA 4R3RA 3ZDUA 1YQJA 3HDMA 2VGPA 4C36A 4JG7A 1H08A 3NAYA 5AR8A 4P5QA 1QPCA 2QOFA 4WIHA 3G90X 2QOCA 2YCQA 3UDBA 4TL0A 5E8ZA 5L2IA 4DC2A 5FLFA 4R78A 4HVIA 3T3VA 3ZM4A 3FHIA 3AMBA 4L01A 3UVRA 3SG8A 3WF5A 2YFXA 3L9MA 4P7EA 4DEHA 2HOGA 2QO9A 3UIMA 2WQMA 3NCZA 4JS8A 4U8ZA 4EH5A 1PXOA 5EYDA 2VTQA 1ZWSA 3CD3A 3FZPA 3R9RA 2BZKB 3D5UA 5EQYA 1GZNA 2X39A 4XG8A 3I5NA 4YURA 3CS9A 4FT7A 4J96A 3H9FA 3KU2A 3VBXA 3IS5A 4NCTC 3WZUA 2JBOA 4W4YA 3VUMA 3V6SA 5A54A 5DR2A 2VTSA 3ORPA 4CZTA 2BFXA 4IC7A 3D5WA 5HBJA 5CWZA 2RFDA 5DLSA 1AQ1A 4C61A 4C2WA 4MWIA 3CBLA 3U9CA 4L45A 3NNVA 4L3LA 1TVOA 4D55A 4FX3A 4GK2A 1JBPE 1PYEA 2AYPA 5E8VA 1IEPA 3MY1A 4NTTA 1CKJA 4C59A 5EW9A 3PSDA 2C3LA 5EKNA 3NYOA 3P08A 5LQFA 4AE6A 2XNOA 4BDDA 3QKKA 5F1ZA 3KRRA 3TNIA 4RLKA 4CVAA 2VTTA 2BRGA 2PVFA 4IE9A 4X21A 1UKIA 4HVHA 4CYIA 4MXZA 5CT0A 3UG1A 3QD4A 3KRXA 2XKFA 5BUEA 3IDBA 4FG7A 2HENA 1YW2A 4F1MA 3BQCA 1PXJA 5J79A 5L6OA 3MVJA 3PIZA 3OP5A 3QALE 2CN5A 3KFAA 3NNUA 4BWPA 3CEKA 3KXXA 4RJ6A 3ZEPA 4C0TA 3V3VA 2CJMA 4OBOA 3UYTA 1T46A 3W8LA 5HX6A 3P4KA 2FYSA 3C13A 2PSQA 2ZM3A 2F7XE 2YZAA 3FKLA 3LVPA 1H8FA 4XCUA 5EW3A 4AA4A 4TWOA 2W1CA 3GENA 3SRVA 4MD8E 3K5VA 4I6HA 5HG7A 4A9UA 4Z9LA 1OIYA 2CLXA 4O7ZA 5IISA 5IEXA 4FSWA 4FUYA 5H9BA 5BVDA 3RP9A 3A60A 4B4LA 5J87A 4BKZA 3A4OX 3JR1A 3HZTA 1ZAOA 4PDPA 2C1AA 3IQ7A 5E8WA 4ACHA 4C38A 5ACKA 4L9IA 3CR0A 3G51A 4TYHA 5DT0A 3FAAA 3TACA 4NFNA 1VEBA 4U5JA 1NA7A 3SOCA 4A4LA 2G2FA 2BRMA 2RSVA 4MK0A 4EKLA 4BCIA 5CYIA 3F5XA 3SW4A 4PPBA 4M69A 3OFMA 1Q8ZA 5DI1A 4KIPA 3UO5A 2FA2A 4FIHA 2R0UA 3KXZA 4CFMA 3UC4A 4JI9A 2J4ZA 2O64A 2PVKA 3AT3A 3Q3BA 1JQHA 1YHSA 4Y46A 3KVWA 4GEOA 2PUNA 3W2OA 5EYCA 3V5LA 2XBJA 1Q97A 2VUWA 4KUJA 1A48A 4HYIA 4B99A 1QL6A 2FSMX 2VWYA 3NX8A 4JNWA 2ITNA 2Q83A 2JBPA 3ELJA 3UJGA 5AAFA 4I5HA 5FQDC 4ASEA 5KMIA 4PRJA 2C5XA 2E2BA 3QGYA 2FSLX 2BAJA 4FTMA 4AXAA 2J0KA 2OF4A 3QRUA 4O2ZA 4YTCA 4ZAUA 4YBKA 2DS1A 3D15A 3QUEA 4IAKA 4RIXA 3JUHA 4QMLA 2VWBA 2XCHA 2XIRA 3GFWA 3R0TA 3EQPA 3F9NA 4X2KA 3W2SA 3WE8A 4QNAA 5TR6A 4O0TA 4BBEA 1WFCA 3EZRA 2WU7A 2FO0A 5IA1A 4LRMA 1APME 4RZVA 5CZIA 3IKAA 4JAIA 4YC6A 2JD5A 2WIPA 2WMWA 4MD7E 5GNKA 5DMZA 4EHGA 5IH5A 3QRTA 3VNTA 4U0IA 5I5ZA 5IKWA 3V5JA 1WBNA 4W4XA 5G6VA 3EN4A 4FOCA 4QNYA 1CSNA 1OIQA 5FG8A 2ZM1A 4O7RA 4BR3A 4F0FA 3FMEA 2IN6A 4FL1A 4BWXA 4G3EA 4C2VA 5IA2A 2VWVA 5CQWA 4YJUA 3GCQA 5D1JA 3ZM9A 3TXOA 4AFJA 2IW8A 1URCA 2QURA 2O0UA 3DY7A 2ZJWA 2WZJA 2WU6A 3AG9A 3O7LB 4PMSA 4L68A 4ZP5A 4FF8A 4EOIA 2C3KA 4O0YA 4DE4A 3PSBA 3ZUTA 2ETMA 2VWZA 4H3BA 4ZJVA 1OGUA 3CC6A 3NW5A 4RMZA 4BGHA 5BVWA 2UW6A 2I0EA 2JDTA 4I3ZA 4YLKA 4I21A 4CT1A 3Q9WA 2GHGA 4LOQA 4YZMA 3REPA 5DNRA 3ENMA 3UTOA 2DUVA 5L2SA 1AD5A 4FIIA 1NXKA 4PX6A 4RFZA 4XUFA 5JGDA 4DCAA 2WEVA 4WRSA 3FL5A 3TTIA 3TT0A 4ZTSA 3NUXA 2WTKB 5LWNA 5J8IA 5GIOE 2B53A 4DFBA 4TYGA 1LEWA 1PJKA 1H07A 3EZVA 3VUKA 4RJ4A 4NL0A 3GFEA 3PXYA 4BICA 1R0PA 3BYMA 5KMOA 1Y8GA 3KQ7A 2VWIA 4FKRA 4J7BA 3MH1A 5C4LA 2QOQA 5DBXA 4Q9ZA 4KNBA 2JDVA 3IGGA 3JXWA 4PTEA 1ZYSA 4YU2A 1VZOA 4FG8A 4FKUA 4PWNA 4AF3A 4ASZA 4TRLA 1OPJA 5HIDA 3Q9YA 3SA0A 3AGMA 3UZTA 2W1HA 4W4WA 3QTQA 3I60A 4E5BA 3C50A 2GQRA 4YZNA 3H10A 2RG6A 3ZRKA 4RGJA 2BR1A 2J0LA 4GMYA 5AR7A 4X2JA 5TKDA 4PTGA 3Q5IA 4XRJA 1XH9A 4EK8A 1OKVA 2B9JA 1Q8TA 4HNFA 4BRXA 4IAZA 2I0HA 5J95A 1QMZA 5TE0A 3AOXA 3HMMA 3OCGA 2YM7A 4LOOA 3DBDA 3UOKA 5T3QA 5EM6A 4GV1A 2RFSA 3DAKA 1KSWA 4IB1A 4KBKA 2HAKA 4FT5A 2VTRA 3BX5A 2BFYA 3FYKX 3PXZA 2ZOQA 1ZMUA 2Q0NA 4GJ2A 4R1VA 2YA9A 2XM9A 3CQWA 2WMXA 1Y6BA 3TV4A 3VN9A 3QQKA 3RTPA 4JLCA 4IVCA 4UXLA 3ZUVA 2HY0A 4FL2A 4R8QA 4AGCA 3C7QA 4CEGA 3OWPA 1OZ1A 4D2TA 5CSHA 5TO8A 3DLZA 3R7OA 2C6LA 4IM3A 2VD5A 3PPKA 4F0IA 5AAEA 5DYJA 5A6OA 4NUSA 3ORLA 4D2VA 3V5QA 3DAJA 4UXQA 4YSJA 4RJ7A 1XH8A 1HOWA 4M0ZA 5IA0A 3Q2MA 4RC2A 4ORKA 3R6XA 4OLIA 2YJSA 3NCGA 5G1XA 3L9LA 4HPUE 2XIXA 3O51A 5KMJA 1LUFA 3OUNB 1ZYCA 5FP6A 1L3RE 2GPHA 1PMNA 4FKGA 4FNXA 3A7IA 5CNNA 1OVEA 5KBQA 2V22A 3W2RA 4EORA 3MGYA 5E1SA 3FXXA 4FNZA 3F6XA 5EHOA 3RGFA 2BRNA 4QTEA 1OBGA 5HORA 3CGFA 5KE0A 2YCFA 4LGGA 2EU9A 3F5UA 4U44A 5CF6A 1PMEA 4U41A 2NP8A 3ZRMA 4RLLA 5FDXA 4IJPA 3PTGA 2W4OA 4O38A 1KOAA 3NZ0A 5KBRA 3TKIA 1U54A 3ZSIA 4YUQA 3KRJA 4FYNA 2X2MA 2C3IB 3PVUA 4HGSA 4EK3A 5IEVA 5A4CA 3EKNA 3MESA 5EI2A 4GIIA 1SNUA 1XO2B 4FBXA 5BMMA 5H8BA 4MXYA 5K9IA 3UQCA 4M84A 4OT6A 3ROYA 4BCNA 1JKKA 3FY0A 4KWPA 3CY3A 5GJFA 1GOLA 3DTWA 3UG2A 3CQUA 2VO3A 1BL6A 2FB8A 4FKSA 2HWPA 1YI6A 2J7TA 4RX8A 5ETIA 3DNEA 1YXUA 2QOBA 2W1FA 5D9HA 3HV7A 3VBTA 5AV3A 2UW9A 2JFLA 1WBVA 3BWJA 1OL6A 2ETRA 3R00A 3F2NA 3I7BA 4RRVA 4TW9A 3V5WA 2W1EA 2C5NA 3FC1X 1K2PA 2XM8A 4E5WA 4M8TA 3GC9A 3PPJA 5AV0A 3WF7A 2QKWB 2XKCA 4NM5A 4RZWA 5CF8A 4EBVA 1WZYA 3V51A 4FKQA 4L44A 1QPJA 3ZFXA 4BHZA 4C58A 2P2IA 1Z57A 4QMMA 1KOBA 2UZWE 2WMVA 3Q4TA 4ALWA 2F7ZE 2C6OA 1W7HA 4M97A 4UEUA 5A4QA 5IMXA 3DBFA 5LVOA 3FZSA 3TEIA 5M07A 1BLXA 2RG5A 4TXCA 4FIEA 4G3DA 2JGZA 4E6AA 1LPUA 4FSZA 4I5CA 1Y91A 4K33A 3QQHA 4A9YA 4BWKA 3DJ7A 4QO9A 5ETFA 5CEMA 3DBQA 3E8NA 4QQCA 3FSKA 4CLIA 4I6FA 2QOLA 5JKGA 4QP2A 5C03A 4YPDA 3COKA 1LR4A 3NUPA 2XJ2A 4K8AA 2YN8A 1JNKA 3F5GA 3FLZA 2OICA 2OJFE 2UZOA 3R1QA 4RIOA 2R3LA 3SXSA 4AT5A 3CKWA 1PMUA 2X6EA 5LVNA 4XV2A 4O7TA 4I6QA 3R8MA 4BTKA 4FV7A 5DHJA 4HYUA 3CCNA 3L1SA 4FTLA 4TYIA 3RWPA 4DEDA 3ITZA 2JC6A 4RVMA 2J9MA 3BBTB 2OU7A 4OTFA 4ACMA 3WI6A 3KN5A 4S30A 3GOKA 3BLRA 1A9UA 5ANIA 5BVOA 2OZOA 2UV2A 4YO4A 4E3CA 4MVFA 1OMWA 4K9YA 4A06A 2YIXA 3VS1A 1J7LA 1QPDA 4AW2A 3BPRA 5M4FA 3O8UA 4G9RA 5TT7A 5FGKA 2G01A 4AN9A 4C4IA 2R5TA 4ERWA 5A4TA 4WNOA 4LQMA 4D2WA 4CRSA 5HVKA 5AWMA 4E8AA 4W8EA 3CJFA 2ZV8A 4DLJA 2B55A 3Q04A 4R7HA 4ONAA 3OOMA 4ZTLA 4S32A 1TQIA 3EWHA 1R1WA 4YP8A 4ZZOA 3ETAA 3OHTA 3VUHA 3WOWA 2QG5A 4MTAA 2UVYA 4C4HA 4F1OA 3VS3A 3CJGA 2LAVA 2F4JA 3QQFA 4NKSA 2PMOX 4EZ5A 5B2MA 4IADA 5HKMA 4N70A 4DYMA 1SVHA 2Y4IC 4J98A 4PNKA 1YXTA 2OJIA 4GS6A 2UZLA 4ZMEA 3MPAA 3SXFA 3G6GA 3OC1A 4CV9A 2O8YA 4R1YA 1PRYA 5LJJA 4QMPA 3W55A 3RAKA 3EQFA 5F4NA 2OXDA 3BIZA 4I5MA 1MUOA 5AP4A 4E6CA 3C4WA 3ZO4A 5J1VA 4R7IA 3QLGA 4J53A 5HIEA 2WTDA 5DRBA 4UMUA 5AM6A 2Z8CA 3D2KA 3ODZX 2C6KA 3R73A 4AE9A 4IZAA 4BI0A 2OXXA 3FI3A 2W06A 4IX4A 4JX3A 3SQQA 3DA6A 3QCXA 2WELA 2Y0AA 3HV4A 2BHEA 2QVSE 2XH5A 3VIDA 2PK9A 1Z5MA 5DG5A 2BKKA 5L3AA 3CQEA 3H9RA 5M44A 3R8LA 5M4UA 2CCIA 4PMMA 4PL4A 3NUYA 4UWCA 4FODA 5L6PA 3FXWA 2QOIA 3KVXA 5GJGA 3G2FA 3VBYA 5D7VA 2C3JA 2LGCA 3VBWA 1U54B 1WVXA 3MVHA 4GW8A 3LPBA 1PXLA 2XRWA 2YCSA 3ZOSA 3MB6A 3DLSA 3MWUA 4FKJA 4FVPA 5TF9A 4C37A 3QX2A 1KE7A 3BYOA 4IHPA 1XKKA 5LMAA 3VS5A 4YJQA 1Q62A 3FI8A 3UZPA 3HEGA 3MPMA 4WO5A 3OBJA 2OZAA 2EB3A 4O82A 1YWRA 3ZFYA 3WARA 4BCKA 4HNIA 4CFFA 5AV4A 4UZDA 3VS0A 3ZLYA 1YVJA 5D11A 4KRCA 4QT1A 5GZ9A 1IAHA 3S1HA 1YWVA 5AJQA 4ZS0A 4Z3VA 2JDSA 5DOSA 4IM0A 4D2SA 4YPSA 4LMUA 4TY1A 4BCJA 5HBHA 3SLSA 4ZY4A 3TUCA 3MYGA 3QQLA 2RFNA 3BRBA 4ZSJA 3GI3A 5IPJA 2IWIA 3HGKA 3WZDA 3AC4A 4PL5A 4DG3E 4FKLA 3ZLSA 4YJNA 3BHVA 1WBTA 4RBLA 3R7VA 4KKEA 2QQ7A 4I94A 4XG4A 2PPQA 3TDVA 2OFUA 4JQ8A 3ZYAA 2CGXA 5DA3A 5DEWA 3NMUF 3V8SA 2PHKA 4RWIA 2E9NA 2GS6A 1Q3WA 2JLDA 2X9FA 4CMUA 4LGDA 4Z7HA 2OI4X 3DDQA 5DRDA 4UMPA 3PE2A 3ORNA 5HCXA 5HU3A 3KL8A 3QGWA 3CY2A 3NW6A 4II5A 4WG3A 3U6HA 2W5AA 3S2PA 1R78A 3PZEA 4Y72A 4N0SA 2X4FA 4EYJA 2QG7A 3DB8A 5CSVA 4MX9A 3KULB 4JR7A 2PZRA 4XP2A 2WO6A 1PKGA 5CU3A 4IDTA 4ZZNA 5LMBA 5CY3A 4RQKA 1LEZA 3UOJA 4ANMA 4RWLA 4LV8A 5EDQA 2Y6OA 5AP2A 1G8SA 1ZY5A 3FZRA 3GQIA 4TZRA 4H39A 3MVMA 2C5YA 2OFVA 4IWQA 4J97A 3FMDA 1YRPA 3FKNA 5ETCA 4AS0A 4EH3A 5IZFA 4HVSA 1UA2A 1JOWB 1KWPA 1Y6AA 3NUNA 4DEAA 3TNHA 4ZTNA 1Y8YA 1M2PA 3G9NA 3NNXA 5FM2A 3MY5A 5HE1A 4A4XA 2I40A 3A8WA 1XWSA 2BCJA 4R6VA 3VF8A 5J1WA 4MQ1A 2EWAA 1V0PA 3PDTA 3ZO1A 4EJNA 3EQBA 4FZAB 3DQXA 4RIYB 1NVRA 3RWQA 3VULA 4J99A 1XQZA 4MF1A 1KUTA 1PKDA 4U40A 2GNFA 3BU5A 3DK6A 4J71A 4G5PA 2GHLA 3BHUA 3D7ZA 1UV5A 3K54A 2OF2A 3OZ6A 2SRCA 2G2HA 1YHVA 3GU8A 2QO2A 4QP1A 2HZNA 2VX1A 5FDPA 3LHJA 2ZV9A 3KGAA 4M7IA 2JFMA 3JYAA 3OCTA 2WEIA 3F2RA 4FE2A 2OIQA 1Q41A 1UVRA 1FGKA 1XH5A 4BVUA 4RX5A 4YNOA 4QOXA 4O7LA 4CFUA 5K3YA 3R02A 4WBBB 1REKA 3R7GA 1IRKA 4ZSLA 1XH6A 2PVYA 3JY0A 3NYVA 2ITWA 4MH7A 4USDA 5HVJA 2VTOA 4CQGA 5HO6A 4ANQA 3HV6A 3QTSA 5EHYA 4BDFA 5CI6A 4WUAA 1XH7A 2J5FA 4LMNA 3LFDA 3P1AA 2YISA 4AFEA 2O5KA 4YHFA 4BCQA 2G9XA 4FGBA 4D9TA 2R3KA 3I79A 3VS4A 2HWOA 2OWBA 5E8XA 3EQRA 2Y8OA 3DBCA 1WBOA 4IX3A 2XKEA 4EI4A 4ZXTA 3S95A 4EZ3A 4CQEA 4HCVA 5H8GA 4IX6A 1GY3A 3IG7A 5AADA 3QZHA 5FXSA 3FMLA 3KA0A 2YITA 3WYYA 3ZO3A 3QCYA 4G31A 3VWAA 4K1BA 4AZFA 1JAMA 3A7FA 3EN5A 3FMNA 5HE0A 3UNZA 4TNDA 4EH8A 2XNMA 4P5ZA 1GNGA 4I4FA 5EI6A 4BDJA 4EC9A 3M1SA 4AT4A 1E1XA 1WVYA 5E8UA 4BI2A 4AOIA 5CEOA 4IM2A 3D5XA 3T8OA 2XJ1A 3IDPA 4BL1A 2J0IA 3E3PA 3EHAA 4C3RA 4H05A 5BMSA 3O8PA 2A0CX 2YWPA 4RVTA 2PU8A 4MWHA 2QR8A 1JLUE 2BRBA 4U9AA 2JIUA 2QO7A 5DE2A 3V04A 4AQCA 3Q32A 4BGGA 3HNGA 1SM2A 3GCSA 5CNOA 3DBEA 4I22A 3BU3A 1TQMA 2W05A 3AT4A 3FC2A 2XRUA 2J2IB 3QZFA 5J5SA 5DT4A 4D4YA 5FBOA 5EG3A 2QONA 4AGDA 1J1BA 2VRXA 3PRFA 1ZXEA 4O0VA 1ZYLA 4HYHA 1YXXA 4W9XA 4O7VA 2GSFA 4K11A 5GIPE 3TN8A 4BDKA 5AUVA 1FMKA 4FV8A 4Y73A 1I09A 2WMBA 5KHXA 3LFNA 1RQQA 5KHWA 5GINE 4WOVA 4YJPA 3SOAA 1NW1A 3ORXA 3ANRA 4ZSAA 2XBAA 3C5UA 4F08A 4CFVA 3LQ3A 3QBNA 4I0RA 4XG9A 4YNEA 4FA2A 5LOHA 3KF4A 4I92A 2WKMA 3ROCA 1PHKA 3DZQA 4YZDA 3UNKA 2CSNA 1XBCA 3ZC5A 4HVDA 3LJ0A 3IW4A 3FLSA 2R3QA 4GU9A 3UIBA 4FV9A 2P55A 4KBCA 5CSPA 3W2CA 4C34A 5DWRA 4IWDA 3TIYA 2ZDTA 1OB3A 4FTOA 4QMXA 5L6WL 3PYYA 5HGIA 3VC4A 5JFVA 2DQ7X 2Z7LA 5HTCA 2ITQA 2UZVA 4ZY6A 3PFQA 3TNQB 5H8EA 4AZVA 3NVMB 1VJYA 1YDSE 5D41A 2GU8A 4GU6A 4OW8A 4XG3A 4XV9A 3TG1A 4OTWA 4DGNA 2W17A 4FV2A 2PMLX 2UZEA 3PY1A 3PIYA 4S34A 5JRQA 4R5YA 4LGHA 4W4VA 2QOOA 3WZJA 4UBAA 1CM8A 2OJGA 2R3HA 1WBPA 3EL7A 3UMXA 3P7CA 4V01A 5HICA 4CD0A 4F7NA 5EQPA 1RW8A 2XYNA 2B1PA 1ZMVA 3BE2A 3D94A 3PXQA 4OTQA 2WQOA 3K3JA 4TN6A 4M67A 2ESMA 3W16A 4TWPA 3FYJX 4LFIA 2W9ZB 3MI9A 5IG1A 4C33A 2HIWA 4FT3A 3OF0A 3R21A 3QQGA 3N9XA 2WFYA 3ET7A 1U5RA 2PMIA 2IZUA 2YDKA 3F3TA 2CDZA 3FE3A 4GL9A 4RX7A 3WF8A 3PSCA 4E4LA 2CGVA 4L53A 3R2YA 2A2AA 4L3JA 2P0CA 2V7AA 3KK9A 4JOAA 4O27B 3FMKA 4U3ZA 3LXKA 1OUKA 2NRYA 2ZMDA 5AP1A 3QKLA 3TCPA 5BPYA 4O6LA 2C0OA 2G2IA 1WBSA 3HMIA 4CV8A 1BMKA 1JKLA 4H1JA 3ZHPC 3HUBA 5LMKA 2E9UA 5ANJA 3C4ZA 3OXZA 4BFMA 2R64A 3LMGA 4U81A 4MBJA 3DJ5A 3QHRA 2HW6A 1OBDA 3ORIA 1J3HA 2Z7RA 4MAOA 3FZTA 1BUHA 2PE1A 1J7IA 4FZ6A 5LARA 3KMUA 2B9HA 4YGAA 3FSFA 3ZLXA 2WTVA 3A7GA 1Y57A 3U4UA 3DB6A 1SZMA 4LM5A 3QTRA 2WOUA 5F95A 4FUXA 5F94A 4GFMA 4QQJA 5AIRA 4IAFA 1KV1A 3GU6A 3P23A 3ZMMA 2B52A 4IXPA 4FICA 4G6LA 2WHBA 4OUCA 3VF9A 3Q4UA 5FUTA 1PXPA 5A14A 4MD9E 2X2KA 5HG9A 3DQWA 4FC0A 4FIFA 5HLNA 3I0QA 4WBOA 3OMVA 4PTCA 1H01A 5HBEA 4O22A 4HYSA 3EB0A 4XX9A 1H1SA 2VTJA 2VWWA 2WMQA 3VBVA 4XP3A 3L9PA 4PL3A 2YWVA 4YTFA 4EWQA 5LCJA 2WOTA 3GC7A 3JY9A 3E7OA 2CKQA 4P4CA 3W2QA 2IW6A 3HECA 5JT2A 5LXMA 3LQ8A 4A9SA 1YDRE 3DK3A 4RT7A 4BBMA 4DAWA 4S31A 4X6RA 5CAOA 3COIA 2C1BA 1KE8A 2C30A 3ZXZA 4DFNA 2XCKA 3ZUUA 2XIZA 1UNGA 4X3JA 3R83A 1OECA 5HHWA 3LLTA 5T6KA 5KMKA 1U46A 5DT3A 5C26A 4F6UA 1IA8A 4Q5EA 3BCEA 3DK7A 3BZ3A 4QYEA 4EH7A 1G5SA 3E5AA 3VO3A 4EH4A 3V01A 4DF3A 4GKIA 2GCDA 2YM4A 3NDMA 3WZEA 1X8BA 2BIYA 3UC3A 1OKYA 2W5HA 3QRJA 4GKHA 2HCKA 4I0SA 4FV1A 2IVUA 3PXFA 5EDRA 4UZHA 5HE3A 3FDNA 1HCKA 3E64A 4OBPA 4ZOGA 4F63A 3BHHA 5M57A 1ZMWA 3HV3A 5J7BA 3NRMA 4FKWA 1JWHA 4O7SA 1Q99A 4HGEA 4QMVA 3UGCA 3LM0A 4AW0A 5HZNA 1MP8A 2C6IA 3ZZEA 4ITIA 4K18A 3ULZA 4D2RA 1GIHA 4ZTMA 3OCBA 3FL4A 2B0QA 5GZAA 4C57A 4G2FA 3DNDA 4EK4A 4UN0C 3MB7A 2CGWA 1MRVA 5CLPA 1H1PA 3UBDA 4XYFA 2XNEA 3EQCA 2XF0A 5E8TA 1J7UA 3D14A 4ZJJA 5L2TA 2NPQA 4AA5A 2PE2A 5JK3A 4NH1A 4G3FA 4BDGA 4EYMA 3I4BA 2WTKC 4DTAA 3SDJA 3C0GA 3OT8A 4V04A 5TOZA 3WILA 2PUIA 1H26A 2PVNA 3GCVA 1H25A 1YXVA 3MIAA 4I4EA 2PUUA 1YOLA 3OROA 3F3UA 3PVBA 2J90A 3FI4A 4L43A 5EI8A 4E6DA 4HCTA 5JZJA 4IWOA 4USFA 2HK5A 5GZ8A 3QWKA 1PW2A 2X81A 4DH8A 4FK3A 4FTJA 4J95A 4USEA 3O71A 3BEAA 1F3MC 3OVVA 4FIJA 4MBIA 4FSQA 5AR4A 2J0MB 4UALA 1AGWA 2WMUA 1I44A 2YIWA 4I6BA 3II5A 3VBQA 3TUBA 4EOKA 4KKGA 4TWCA 3M11A 3UOHA 1UWJA 2R3PA 2OW3A 2WD1A 4G6NA 2XNGA 2VTPA 5CI7A 3SHEA 4D0WA 5CEKA 4JXFA 3EN7A 1U59A 3IDCA 3MY0A 3EMGA 1P2AA 4QYGA 5CASA 2PE0A 3A4PA 4F6SA 2E9OA 5A3XA 2F9GA 1F0QA 1XJDA 3DKGA 2GNLA 3DTCA 4IB5A 2GHMA 3DZOA 3Q4CA 4FEXA 4IC8A 4WT6A 4AWIA 1H28A 4PDOA 4IWPA 3A7HA 4F7LA 4UMTA 5AIKA 4AGUA 5CVGA 4IAYA 2VTAA 3ORZA 4IQ6A 4R5SA 5E8YA 2UZDA 2YM3A 5AR2A 4FEUA 3MFUA 4O96A 3O50A 2QD9A 4XG7A 4NKAA 5DR9A 5IA3A 1BL7A 5AP6A 4MNEB 1WBWA 4IJ9A 2GNHA 2ZB1A 5EM7A 3UP2A 1KV2A 3SVVA 3ERKA 4GT3A 4UX9A 2Y7JA 5FWKK 4O7WA 3QTIA 5IQAA 4QYFA 4X0MA 5KZIA 2Y4PA 2AUHA 3IGOA 3BGQA 4BCGA 4F9WA 4NFMA 5LMKC 1GIIA 4HOKA 3FV8A 3FHRA 5M08A 3DKOA 4TYEA 3MSSA 5HCZA 2VX3A 4OAUC 2W96B 4CCUA 4Y85A 2BZHB 4YC3A 2P2HA 4MNFA 2ITYA 4BCHA 4CFWA 1G8AA 3RPVA 3NUUA 4UMQA 3OXIA 4QQ5A 5DIAA 1FQ1B 4N4SA 2YABA 4RFYA 3VUIA 3GU4A 2ZV7A 5C8KA 3RNYA 3QTWA 3UO6A 3TZ8A 2VO0A 1J1CA 5CT7A 1IASA 1B39A 4X2NA 3CTJA 3GEQA 4H1MA 4IACA 1OIRA 3TL8A 4MQ2A 3KRLA 5HG8A 4AZSA 4M68A 3VJNA 1VR2A 4FTCA 1H0VA 4JT3A 3MJ1A 2ITUA 1MQ4A 2BDFA 4DA5A 4XEYA 5HESA 4JX7A 3LCSA 5HOAA 2BMCA 3U4WA 4JDHA 2ZDUA 3BGPA 4PDSA 3QCSA 3PIXA 2QLUA 4GFGA 4HW7A 5CSXA 4UYAA 3NEWA 3LXPA 4WNKA 4CFNA 4XG2A 3MH0A 3V8WA 4RSSA 2OXYA 3ALOA 3VHKA 2WXVA 3VJOA 3FLWA 4C4GA 1Q8WA 3R8UA 4ANSA 5E92A 3P5KA 5C01A 1CKPA 4JVGA 4D5KA 4TWNA 5I9VA 4QYHA 1OL2A 3PA3A 5IQBA 2BKZA 3H9OA 3QA8A 4IAAA 3ULIA 3KN6A 3ZLWA 4AN2A 3SXRA 4RX9A 5L8LA 5A6NA 2R0IA 3D83A 2OK1A 3LXNA 5CAPA 4C3FA 5AA9A 2C6TA 4JBQA 2X8DA 3KULA 2HZIA 5GJDA 5CQUA 4XOYA 5I9ZA 3AC1A 4RJ3A 4RG0A 3QTXA 2EUFB 4AGWA 3F3ZA 3HRBA 4EONA 4I0TA 3GBZA 1ERKA 3ZFMA 4QQTA 3EOCA 1ZARA 3FLNC 5JFXA 2CLQA 3DAEA 2XNPA 5M09A 2V5QA 2B54A 2HZ0A 3HVCA 1JVPP 2V62A 4NZWB 5CAVA 4C62A 3RAWA 5IQCA 5M51A 4WG4A 4OTDA 4DH1A 3UVQA 5LCKA 1OPLA 3U51A 4DITA 4U97A 3E92A 3MN3A 3E8CA 4H3QA 1DAWA 1OPKA 5KX8A 3OWKA 4RIYA 5BVFA 3PJ2A 4F9BA 3D0EA 2QOKA 2YJRA 3V5PA 5A4LA 4S2ZA 4XG6A 3F82A 2F2CB 4KINA 4DGMA 4EEVA 3LZBA 3OY3A 5HNGA 4DFXE 4DFLA 5BX0A 3E87A 1EH4A 3QYWA 4QP4A 2O65A 3PP1A 2C6EA 1FVVA 4JDJA 3DKCA 4EHZA 4KS7A 4WRGA 1ND4A 3WIKA 3S4QA 1CDKA 4WNPA 4A7CA 4B8LA 4QTDA 4CSVA 3FEGA 1H00A 5M4CA 3DCVA 1J91A 3R22A 4FEQA 1H0WA 3BKBA 2I0VA 4LUEA 1OUYA 1IG1A 1FVTA 4JL9A 4UYNA 4ID7A 4YSMA 3GC0A 4IAIA 3TKHA 3W33A 3FQEA 4KIKB 4A4OA 3KXGA 4K0YA 5D7AA 3I6UA 4NT4A 3C0HA 2WTWA 4FTTA 4TNBA 3SAYA 3RBWA 3MW1A 2C68A 4MF0A 4BTFA 5IUIA 3IECA 3VS2A 4FTUA 3CSVA 4AG8A 3I5ZA 2WNTA 3N4TA 1OKWA 3K3IA 1KE9A 4CG9A 3PJCA 1V0BA 4BCOA 3I1AA 2XEYA 4EUTA 4WKQA 3U6IA 4LYNA 3FZOA 4Z7GA 3NVKI 3R8ZA 2HY81 4YTIA 4EJ7A 3IW8A 4LL5A 3O96A 4BZDA 3KMMA 4RPVA 4FV6A 2UW3A 3PWDA 5FEQA 4FSMA 5HTBA 5IDPA 3LFQA 5AP3A 3ZTXA 3L8PA 2VWXA 4EOSA 3FQSA 2XK4A 3KRWA 2OGVA 3BHTA 4G16A 1DM2A 3FMMA 2EB2A 4ITHA 4DCEA 2JKKA 4E4MA 3PRIA 4RFMA 5HD7A 3PP0A 3R9OA 4AOTA 4C4JA 3OUKA 1MRYA 2JAMA 4FT0A 3UO4A 2QU5A 2WMSA 3ZDIA 3KC3A 5J9ZA 2ITZA 4L8MA 4EOPA 3SX9A 3AC2A 1K9AA 3EQIA 4EKKA 2R3RA 4IVDA 5L4QA 2X6DA 4JIAA 3R7UA 3Q60A 3A7JA 3DS6A 3WYXA 5BUJA 5JZNA 2KULA 3K2LA 2FSTX 3PJ8A 3S00A 4FOBA 2W99B 2NO3A 4I93A 4EK5A 5CXZA 1QCFA 1WVWA 3RCJA 4O86A 3MJ2A 3F88A 3NGAA 4WUNA 4XH6A 2Z7QA 2QI8A 2BVAA 2VN9A 4NM0A 3V8TA 1YOJA 2IVSA 2GDOA 4G3GA 4M3QA 5F20A 3D5VA 3D9VA 3CXWA 4IDVA 4ZJIA 4HZSA 4Q5HA 3P7BA 3R8VA 4F99A 2VTIA 3DFAA 3D4QA 4FEWA 2VTMA 4ITJA 5AP7A 3F5PA 2XVDA 3Q6WA 3OEZA 4IX5A 4RA4A 3TIZA 2VNYA 5JN2A 2C4GA 5DGZA 3QAME 4GK4A 3ZO2A 2BTRA 3O8TA 3FQHA 4NU1A 3F66A 3LFCA 3LAUA 3U54A 4D4SA 1SNXA 1WMKA 2FUMA 1B38A 3KCKA 3MTLA 3KXHA 2X1NA 4UMRA 3E3BX 4XP0A 4YR8A 3ENHA 4O1PA 4DEEA 2PVHA 3DV3A 4Y95A 3TNWA 4BDAA 3AD5A 3FY2A 3R04A 3R7YA 5JFSA 3IW7A 4R3PA 5B0XA 2VTHA 3R01A 4O81A 2IZRA 2YM6A 3LMHA 2X0GA 2CGUA 2YM8A 4Y5HA 4YJOA 3K5UA 5IUHA 5JMSA 1S9JA 4KS8A 1PXNA 4EH6A 5LVPA 1ZYJA 2X8IA 5KKRB 1UWHA 3P7AA 2H8HA 2XMYA 3NUSA 4V05A 4GUBA 3OW4A 4BDHA 5M4IA 1W83A 3CPBA 2GQSA 4FTAA 3ODYX 3QRKA 4A9TA 3G33A 3RM6A 1VYWA 4DLIA 4ZMFA 1K3AA 4OTPA 4OTHA 3O17A 4DN5A 3KK8A 4PF4A 4XJ0A 3DXNA 3F61A 3R9NA 4UY9A 4QMTA 1ZRZA 4PP9A 3MDYA 5C8NA 2VZ6A 2A1AB 5KMMA 3VS6A 1G3NA 4DEIA 5I3RA 3UMWA 2W9FB 3AD6A 4QP8A 4BDBA 5AM7A 1RE8A 1YHWA 3F3WA 3AC3A 2IVVA 3GOPA 4IBMA 5CS6A 3G15A 4JRVA 3QUDA 4PMTA 3JVSA 4QTCA 1ZOHA 3MVLA 1Q5KA 3VUTA 2ERKA 2EXCX 5E1EA 2WTCA 4NYEA 5CEIA 2NNWB 2WTIA 3NLBA 3ZSGA 4YJTA 3QQUA 4FKPA 4KAOA 3EN6A 4D4RA 5KCVA 4CXAA 4EQCA 5HO7A 3BELA 2PL0A 4C8BA 4F7SA 4J1RA 2YLEA 5FTOA 2YDIA 4RIWA 4IIRA 4X6QC 5EHLA 4ZY5A 3W18A 5FBNC 3BLQA 3LFSA 3ZBFA 3PA4A 3BYUA 2CKEA 3PE1A 4F09A 4FZDB 3FKOA 3DDPA 3MV5A 4YLJA 1H1WA 3Q9ZA 3C4FA 3RI1A 2X7OA 4Q2AA 4YLLA 4DEBA 3NUAA 2QC6A 2DWBA 3FJQE 3GP0A 2GFCA 3DKFA 1P4FA 4F6WA 3LJ1A 4RC3A 4V0GB 4X2FA 5AX3A 4UB7A 5I9UA 4GFOA 3ZXTA 1JSVA 3R28A 4B7TA 1O6KA 3KKVA 3FUPA 2IPXA 4QPAA 1PYXA 2F7EE 2ZB0A 2AC3A 2ITXA 4CG8A 1GAGA 3W32A 4N6YA 1PXMA 4KIOA 5JH6A 3MTFA 2B9IA 1BYGA 4RC4A 3PXRA 2OIBA 3L9NA 4H58A 5JFWA 5K0XA 3LFBA 4JIKA 2ITVA 3IONA 3NSZA 4AP7A 1XBAA 2R2PA 2UZTA 4I1ZA 2JAVA 3BGZA 3EFKA 3VUGA 4ACDA 3LM5A 3OEFX 5K5XA 3QKMA 4ACCA 5J5TA 4RJ5A 5CAUA 1YI3A 2W1GA 4YMJA 2PVMA 3Q9XA 3B2WA 3R63A 4FR4A 4CKJA 1H1RA 4FGRA 4DG0E 4FG9A 3BEGA 3CGOA 1ATPE 4HPTE 4IVAA 4PY1A 2F49A 5CU6A 4CFXA 4F9YA 5L2WA 3N4VA 3TDWA 5IQDA 2RIOA 2H9VA 1YXSA 3HDNA 3OY1A 5CEQA 3VQHA 1FBNA 2XK7A 3PUPA 5B2LA 3SC1A 4J8NA 4L7SA 5JQ5A 4OT5A 3F2AA 4WSQA 4TPTA 4CNHA 3OWLA 2GS7A 4ANLA 4QMOA 4BTMA 4G3CA 2O2UA 3Q5ZA 1QPEA 4M0YA 4J52A 4I23A 5IEYA 3EYGA 4AAAA 5ANDA 4D58A 1WCCA 2C6MA 4IH8A 1P5EA 2A19B 3C51A 3NAXA 3TJDA 3ZS5A 4BIBA 4FSNA 2JDOA 4YHTA 2F2UA 3HP2A 2W5BA 4DINA 3HX4A 1PY5A 3BHYA 5CTPA 4YZCA 4APPA 4B8MA 4GT5A 3U6JA 3KB7A 4MBLA 4KA3A 3CE3A 3BWFA 4X7QA 3ZONA 1OI9A 1XR1A 3R8PA 4S33A 3ATSA 3FMHA 3HL7A 3UYSA 2W7XA 5K4IA 4M66A 3VVHA 1Q61A 2FH9A 4F0GA 4CZUA 4U6RA 4G9CA 5A9UA 4ALVA 3RPRA 4IB0A 3UIUA 4ACGA 2PTKA 2J50A 3UNJA 3TI1A 2A4LA 5EYMA 4FVQA 1ZOGA 3O0GA 5HI2A 4ZK5A 3O23A 2CKPA 4DT9A 4ASXA 3AMYA 4E5AX 4GVAA 4FTNA 1OL7A 4D4VA 3RZBA 3IO7A 2R3JA 3SKCA 5DPVA 3JPVA 3A99A 2VO6A 3JS2A 4NW5A 4O2PA 5C27A 5I4NA 3MPTA 3EYHA 4AUAA 1Q8UA 2Y9QA 5HX8A 3SW7A 4WHZA 5FEDA 3TNPC 2JKQA 4FSTA 4O0UA 5DFPA 4E1ZA 4FZ7A 3KF7A 3LIJA 4L00A 4W8DA 4YBJA 5FTQA 5A46A 5ANOA 3HUCA 4PMPA 2YLFA 1FINA 1VYZA 2REIA 2Z7SA 3PXKA 1DI9A 3RK7A 2PMNX 4ZTHA 4B6LA 4KRDA 4BTJA 4LI5A 5AMNA 3D7TA 3QXPA 3LLAA 2G15A 2XJ0A 4EQUA 3A62A 4DH5A 2VO7A 1W98A 2OH4A 4G5JA 5KZ0A 2G1TA 1M7NA 3LFAA 5HCYA 3RAIA 4I5PA 2PZ5A 3MFSA 3RK9A 4FTRA 4LRKA 3AD4A 2ZMCA 3U87A 2GNIA 2GNJA 3TV6A 4EC8A 4F9AA 2OSCA 4O0XA 3CLYA 5C9CA 3RINA 4EH2A 5CAQA 4ALUA 3W10A 3RZFA 3D2IA 4FV5A 4GUEA 5LWMA 4IMYA 4RIWB 2E9VA 3WBLA 2UUEA 5E9EA 3ZBXA 3S0OA 2YHVA 4NSTA 3KCFA 3QC4A 5EM8A 5C8MA 4QRCA 3S3IA 5AX9A 2VTNA 4L7FA 4O0SA 3Q52A 3QC9A 2R4BA 2ACXA 4PQNA 4Y8DA 1UU7A 4MNEA 3P0MA 5J9YA 4L46A 5JGBA 3EJ1A 4QPMA 2B7AA 5AUYA 5IQEA 5KNJA 1V0OA 2QCSA 2PVLA 4C02A 4EZ7A 3GU5A 3M2WA 5D10A 5ITAA 3PA5A 4EH9A 4MCVA 2NRUA 2WMTA 3RPYA 5K5NA 4ZLYA 4IB3A 1R3CA 5I9WA 3TM0A 4EBWA 2OJ9A 4RVKA 2JIVA 4QP9A 2PVJA 5DEYA 4A9RA 4AN3A 2VX0A 4OR5A 2GMXA 3ZH8A 1W84A 4C4EA 2XA4A 5I0BA 3LOKA 2JDRA 3ZZWA 4E4XA 3QUPA 4YO6A 3TWJA 2CHLA 3B8QA 3A2CA 2IW9A 4Z55A 3A61A 3ANQA 2R3MA 2YAAA 4TTHB 2ONLA 3BE9A 4CKRA 4DBNA 2QNJA 1ZYDA 1H4LA 4U3YA 5HG5A 2VV9A 3FMJA 5I3OA 5H3QA 5EW8A 5AV1A 3VS7A 4AA0A 2WQNA 4CT2A 1TQPA 4PPAA 5FP5A 5BQ0A 2P33A 4CLJA 3KEXA 4KB8A 4EOQA 1PXKA 4EOOA 4QMQA 4JDKA 1UNHA 3CIKA 3SV0A 2ZVAA 3N51A 3NNWA 3FPMA 2BAKA 3P9JA 3EQHA 4ZZMA 4PP7A 2A27A 2J5EA 2PUPA 2YERA 5EOLA 3QQJA 4OTRA 2XK6A 3PWYA 3T3UA 4E7WA 4M14A 5BNJA 4JR3A 3HYHA 5D12A 4BCMA 5L2QA 3HAVA 3ORMA 2UVXA 2W1DA 4QMZA 5EK7A 4R7BA 3MFRA 3QD0A 5CALA 3VRYA 4GK3A 4ZLZA 4GRBA 1NVQA 3ATTA 2QLQA 4O1OA 2YM5A 5HNBA 2RL5A 3E63A 3MS9A 3BYSA 5IQFA 4AU8A 4FVRA 4GG5A 2CKOA 5AFVA 2BTSA 3AMAA 2AC5A 3QFVA 5JSMA 4P2KA 4XMOA 2JEDA 3RVGA 5ICPA 2RKUA 3IW6A 4EK6A 5E7RA 1MRUA 3WZKA 3DXQA 4RJ8A 4L6QA 2BDJA 5FTGA 4BCPA 2PZPA 4QP3A 3ZU7A 2XNNA 5CEPA 5LVMA 4JG8A 4FV3A 4DGLC 5KUPA 1OM1A 4D9UA 4XLVA 5DN3A 5EH0A 4NTSA 3MBLA 4KSPA 5DVRA 1KE6A 3GB2A 3MH3A 4DBXA 4WSYA 2GTMA 4GG7A 4MHAA 5FD2A 5F9EA 4UWBA 2UW8A 5C4KA 2WMAA 3ZSHA 1JKTA 2JITA 3HA8A 5BVKA 3LXLA 2EVAA 3H3CA 4H3PA 4JDIA 4JBVA 4OTIA 3UVPA 3PY3A 4JJRA 2QU6A 4AW5A 4DH3A 3KXMA 4GH2A 3TUDA 2WMRA 4ZSEA 5KO1A 3EFJA 3LE6A 2CMWA 5B7VA 4CTBA 4JRNA 1IA9A 3ZRLA 2I0YA 4FSRA 2R7BA 2YACA 4JBOA 3GUBA 2OJJA 4F4PA 3QHWA 3R1SA 2PWLA 5IA5A 4NEUA 5CU4A 2X7FA 4YC8A 4EQMA 3AQVA 1LP4A 4YJSA 3NWWA 3TV7A 4YJVA 5AUTA 5M56A 3D7TB 5E4HA 3LCDA 3EL8A 2I7QA 2BZIB 3FI2A 3HMPA 3KMWA 3TJCA 3U9NA 5CX9A 3V5TA 2BPMA 5AEPA 2UZNA 2BALA 2PZIA 3RNIA 1ZY4A 2Z60A 4HGLA 3NW7A 2ITTA 1P14A 3TZ7A 2IVTA 3BQRA 3UQGA 4F64A 4MXXA 2Z02A 4WG5A 3EIDA 4YZBA 1JPAA 1O9UA 1S9IA 4I20A 5E8SA 3R7EA 4BC6A 5J9LA 2XS0A 3F7ZA 4FI1A 2UZUE 4PV0A 5HO8A 4BBFA 3EFLA 4JG6A 4N57A 1E1VA 3SRVB 4X2GA 3RK5A 5E91A 3UZRA 4M12A 5BYLA 3DOGA 4U42A 3CD8A 3AXWA 2ITOA 1M14A 2BRHA 4KIKA 4WA9A 3HMNA 1W8CA 3UQFA 4ZS4A 4O84A 2VGOA 3LKMA 3CTHA 3DGKA 1FVRA 1Q3DA 2J6MA 3E93A 4QD6A 4TYHB 1Q4LA 1IAJA 4D1ZA 2WPAA 4CRLA
chains in the Genus database with same CATH superfamily
3OD6X 3QA0A 4DTKA 3Q4ZA 3QCQA 1PMVA 1DS5A 4M69B 3QTUA 4L3PA 4ZIMA 4IFCA 3RHKA 4O21A 4KABA 3BU6A 2YCRA 3B8RA 4L42A 4PNIA 4DTBA 4APCA 1GZOA 4N6ZA 4ZLOA 3ALNA 4RQVA 3HA6A 3E7VA 4FL3A 4RVLA 2XKDA 3PG1A 3QZIA 4MXCA 3NPCA 4U7ZA 4JQ7A 2YAKA 3OTUA 4FKTA 5J7HA 2HW7A 1UU9A 5CXHA 2X9EA 2GQGA 4BF2A 2HZ4A 4FKOA 4BIEA 3LFEA 5EQEA 3BYVA 4QMWA 2W1IA 3ACJA 2ZM4A 4ANBA 4HCUA 2BILB 2PVRA 1FOTA 2IZTA 4NK9A 3E88A 4X3FA 4QYYA 4ENXA 3EN9A 1IR3A 2OG8A 3U8WA 1H1QA 3VUDA 3FZ1A 3AC5A 1BI7A 3RHXA 4OBQA 1GZ8A 4RIXB 3G0EA 4TT7A 3VONA 2ETKA 2GTNA 5BVNA 4BKYA 4HZRA 4CTCA 4ZTRA 4EHEA 5C1QB 2QR7A 4PPCA 3AGLA 2X2LA 3LQ5A 4C35A 5T68A 2KTYA 3HKOA 1BI8A 5IMEA 3BBWA 5CVFA 1E9HA 2VTLA 2ONLC 2R7IA 3LCKA 1TKIA 5AA8A 4FEVA 3PG3A 2EXEA 4DEGA 5I9YA 3GU7A 4DDGA 3Q96A 1XBBA 2BDWA 1OIUA 2R3FA 3CKXA 3GQLA 4RA5A 3C4CA 3HAMA 3L8SA 4WNMA 3COMA 1CTPE 2C0IA 3N4UA 3QYZA 2BUJA 1A06A 4IVBA 3NS9A 4KKHA 3I0OA 4BCFA 3IOPA 3RKBA 4QMNA 2VAGA 1SYKA 4D0XA 4FSUA 5K4JA 3DJ6A 1CMKE 4ZTQA 3B2TA 4QP6A 4Q9SA 2FSOX 1ZLTA 2WGJA 2B4SB 3M42A 1BX6A 4FKIA 4ANOA 3DU8A 4KIQA 4CMTA 3TKUA 1GZKA 1H24A 4BY9E 4YZ9A 2H6DA 4ARKA 2VNWA 2O3PA 1W2DA 1M7QA 2DYLA 2VU3A 4IANA 2GS2A 4U79A 4E6QA 1UKHA 5A4EA 5CSWA 5IUGA 3BV2A 3SG9A 2X4ZA 3RJCA 3MIYA 3LW0A 3NYXA 4HJOA 3C0IA 4AAYA 5JRSA 2PZYA 4M15A 4U43A 4U80A 3MA6A 3RPOA 3I6WA 2O63A 2XNBA 2OO8X 3BV3A 4XOZA 4BIDA 4BN1A 2XP2A 4WD5A 5BYZA 3T9TA 4FYOA 3VRZA 2IEWA 2R3GA 4K2RA 4QMSA 2RGPA 4DH7A 1YOMA 4XRLA 2XIYA 2GNGA 3IOKA 3OW3A 4J8MA 5FEEA 2FGIA 3IK3A 3I81A 3E8EA 1SVEA 1L8TA 2CPKE 2OBJA 1O6LA 1SVGA 5HE2A 3PZHA 5IA4A 1YDTE 5HTIA 3A8XA 1RDQE 3PVGA 5EOBA 3I7CA 5AUZA 3MH2A 4C3PA 3PJ1A 5EYKA 1PF8A 4CKIA 2W4JA 4F65A 3HP5A 1NY3A 3E62A 3GCUA 3ORKA 3OTVA 5EKOA 1SMHA 2H96A 4TKSA 4CYJA 3DT1A 4LG4A 3KY2A 4JAJA 2R9SA 2I6LA 2Y4IB 5ETAA 4GYGA 1T45A 4LV7A 2WQBA 4IW0A 1GJOA 1DI8A 4HGTA 3THBA 4NIFA 4IZ7A 2HELA 4XNEA 4XV3A 3CPCA 5IU2A 4DG2E 4QPSA 3VQUA 3JVRA 3F3VA 4QTAA 4FV4A 1JSUA 4I41A 4FSYA 3VAPA 2C69A 4IFGA 4HVGA 3COHA 2UW4A 2QHMA 3HMOA 4BDCA 2HXLA 3H0ZA 2CNVA 1Z9XA 3NR9A 4QP7A 3HRFA 2F57A 3CP9A 2BZJA 4GT4A 4C4FA 4DFZE 5BUIA 5HNIX 1JKSA 2IO6A 3OXTA 3DPKA 4E93A 3NIZA 3P78A 4GIHA 4ENYA 4ANNA 4PUZA 5IQHA 1W0XC 4CMOA 2X7GA 3FLYA 3O2MA 3VW8A 3GXLA 2VWUA 2CCHA 2C5VA 4XHKB 4CCBA 4OAVB 2ITPA 3WF9A 4PDYA 2FVDA 3OOGA 2JKMA 3MFTA 2YDJA 2WB8A 4F1TA 4O0WA 4V0GA 4GJ3A 4AOJA 2W0JA 5HQ0A 2UW0A 4FMQA 5K0KA 1GIJA 3QWJA 3HV5A 1WAKA 3R9HA 4QMUA 3V6RA 2P4IA 5HU9A 2R3IA 3H4JA 2XEZA 3ORTA 5KMLA 1U5QA 3UDZA 1G8JA 4GSBA 1V1KA 1FGIA 2XUUA 2ZAZA 3FBVA 3QU0A 3RCDA 5HLWA 5AR5A 3EQDA 1UU3A 3G0FA 2R3OA 4NM3A 5B2KA 3WF6A 3WE4A 4NM7A 5AV2A 2UZBA 3LCTA 4X3FB 3QD2B 3WIGA 4JQEA 5M53A 2QODA 5HEZA 5M55A 4AX8A 2YIRA 4CGAA 5EM5A 2BROA 2XIKA 3LCOA 5ANEA 5BVEA 4FT9A 5JGAA 4QTBA 4LRJA 3TZ9A 3R7IA 5HIBA 4DGGA 5KMNA 2CN8A 3OWJA 3SGCA 3Q6UA 1YKRA 5EDPA 4EWHA 5CU2A 5AUXA 3PY0A 1CKIA 3W1FA 2QKRA 4BGQA 4E4NA 1FPUA 2WAJA 3AC8A 3C4EA 5CENA 1NVSA 5HVYA 1RJBA 2I1MA 2C47A 3LJ2A 3EFWA 4FNYA 1HCLA 1M52A 2WTJA 3UE4A 3QLFA 2CNQA 3VW6A 4BKJA 4X3FC 5HD4A 2XZSA 4MXOA 3FPQA 1FMOE 3BLHA 4LV5A 3P86A 3UPXA 1NT2A 4AXDA 3GVUA 3EH9A 3R1YA 4BYJA 4NCTA 1KE5A 2X8EA 4DGOA 4MYGA 1YI4A 3OT3A 1ZZLA 4DFUA 1P4OA 3G9LX 3AKJA 3RALA 3QF9A 2BIKB 4IZYA 4RWKA 4Y83A 4O7NA 4NW6A 3QL8A 2YZLA 4KSQA 4XLIA 3R2BA 1UNLA 5AR3A 5HLPA 3T9IA 4C7TA 3BI6A 1OITA 2R3NA 3R9DA 1F5QA 2HYYA 3G6HA 3QRIA 5H2UA 4R77A 2V0DA 2H34A 3OS3A 4ZSGA 1OL5A 2GFSA 4UV0A 2UVZA 3GC8A 3QX4A 4NJ3A 5CVHA 1PXIA 5DH3A 4BZOA 5I9XA 4IZ5A 3P5JC 3SD0A 2HXQA 4YHJA 3F7WA 3PVWA 2OLCA 4O83A 3DXPA 4D1SA 2JKOA 4FKVA 1ZOEA 4DFYA 2ZYBA 2XK8A 1R0EA 4MXAA 1R39A 2YIYA 5AUWA 3C9WA 4AZTA 4D1XA 4BYIA 3POZA 2OIDA 1M2QA 4B0GA 5L8KA 5M06A 4FK6A 3R1NA 3R30A 4L67A 2UW5A 2Z2WA 4BZNA 4GYIA 4XBRA 4XBUA 2E9PA 2JIIA 2YEXA 3GT8A 2QOHA 4P90A 3W2PA 4G6OA 4U45A 4BB4A 5CU0A 3RAHA 1BKXA 4ZEGA 3H0YA 1OL1A 4OGRA 4LDTA 4AACA 3EKKA 3OBGA 3HRCA 2V7OA 4BDEA 4F7JA 5BYYA 2PYWA 3Q2JA 3TTJA 4FNWA 4EOMA 5ANKA 4K77A 5FRIA 4D28A 3AKLA 3OG7A 3C1XA 4GVJA 2QHNA 1Q24A 3IW5A 3DFCB 2PY3A 2C5OA 4GCJA 4Y5QA 4NJDA 5ACBC 3FXZA 4CZYB 3QD3A 4F70A 3RMFA 4BI1A 5AP5A 5CF5A 5IQIA 3TZMA 3MA3A 5E90A 5CF4A 5KKRC 3ZEWA 2UW7A 1YWNA 4O91A 5FXRA 3L8VA 3RM7A 3GNIB 1M2RA 4LL0A 4NIFB 2P3GX 4A07A 3POOA 3NYNA 1STCE 4E20A 2ERZE 2EXMA 5DR6A 4UWYA 2XK9A 3QXOA 3H30A 4BDIA 3ZC6A 5FXQA 4G17A 4AT3A 4AZWA 2WQEA 2BHHA 4XS2A 4O7YA 4LUDA 3L8XA 4FTQA 3QTZA 3RPSA 3NIEA 2RF9A 5AAGA 4AW1A 3PPZA 4DHZA 3KREA 4JBPA 5ANGA 2ZV2A 5L8JA 1B6CB 1URWA 1M17A 1XH4A 4I24A 1Q8YA 3E8DA 5IH4A 5CANA 1U4DA 2OH0E 2Y6MA 3QZGA 4MKCA 1O6YA 3U55A 3PLAE 3VHEA 5LVLA 1XMLA 4KBAA 3NFFB 3UP7A 4DHFA 3IPHA 3O7LD 5IF1A 3R71A 3UIXA 3KXNA 2BAQA 4TYJA 1JSTA 4EL9A 2C6DA 3CTQA 5CZHA 2CNUA 4D5HA 4L52A 5JQ8A 1XHAA 4B9DA 4FV0A 5FM3A 4RWJA 3UOLA 2J51A 3AT2A 3EQGA 4M13A 4Z16A 4XV1A 2C0TA 4BHNA 4FZFB 4YTHA 4K6ZA 2B9FA 4H36A 2XYUA 4G34A 1MQBA 2V55A 2IZSA 1OKZA 4YJRA 2Q0BA 4LOPA 3UODA 1REJA 2IG7A 3ID6C 4OTGA 5IH6A 3FLQA 3W8QA 4O0RA 2PULA 3UPZA 5JEBA 4IEBA 4EOLA 3ZCLA 4EUUA 2XB7A 3P79A 4E73A 5GHVA 4F9CA 5EFQA 5AP0A 2WIHA 3FWQA 3F69A 2RFEA 4E26A 1H27A 3OCSA 3ACKA 1ZZ2A 4ERKA 4G1WA 4ASDA 4KD1A 2W1ZA 3C4XA 4D2PA 3LMIA 3C5IA 4W9WA 4FIGA 4NWMA 4DT8A 3LFFA 4AZEA 2OKRA 3HLLA 3PJ3A 5IDNA 4QMYA 5AUUA 4O6EA 4EOJA 4EHVA 2XK3A 2YIQA 2J0JA 4FTKA 3G5DA 1UU8A 1W82A 3Q53A 2OZAB 3PLSA 4FTIA 2W4KA 5IQGA 3GCPA 3GGFA 4R3CA 4MEDA 1DAYA 2IJMA 4R3RA 3ZDUA 1YQJA 3HDMA 2VGPA 4C36A 4JG7A 1H08A 3NAYA 5AR8A 4P5QA 1QPCA 2QOFA 4WIHA 3G90X 2QOCA 2YCQA 3UDBA 4TL0A 5E8ZA 5L2IA 4DC2A 5FLFA 4R78A 4HVIA 3T3VA 3ZM4A 3FHIA 3AMBA 4L01A 3UVRA 3SG8A 3WF5A 2YFXA 3L9MA 4P7EA 4DEHA 2HOGA 2QO9A 3UIMA 2WQMA 3NCZA 4JS8A 4U8ZA 4EH5A 1PXOA 5EYDA 2VTQA 1ZWSA 3CD3A 3FZPA 3R9RA 2BZKB 3D5UA 5EQYA 1GZNA 2X39A 4XG8A 3I5NA 4YURA 3CS9A 4FT7A 4J96A 3H9FA 3KU2A 3VBXA 3IS5A 4NCTC 3WZUA 2JBOA 4W4YA 3VUMA 3V6SA 5A54A 5DR2A 2VTSA 3ORPA 4CZTA 2BFXA 4IC7A 3D5WA 5HBJA 5CWZA 2RFDA 5DLSA 1AQ1A 4C61A 4C2WA 4MWIA 3CBLA 3U9CA 4L45A 3NNVA 4L3LA 1TVOA 4D55A 4FX3A 4GK2A 1JBPE 1PYEA 2AYPA 3BLAA 5E8VA 1IEPA 3MY1A 4NTTA 1CKJA 4C59A 5EW9A 3PSDA 2C3LA 5EKNA 3NYOA 3P08A 5LQFA 4AE6A 2XNOA 4BDDA 3QKKA 5F1ZA 3KRRA 3TNIA 4RLKA 4CVAA 2VTTA 2BRGA 2PVFA 4IE9A 4X21A 1UKIA 4HVHA 4CYIA 4MXZA 5CT0A 3UG1A 3QD4A 3KRXA 2XKFA 5BUEA 3IDBA 4FG7A 2HENA 1YW2A 4F1MA 3BQCA 1PXJA 5J79A 5L6OA 3MVJA 3PIZA 3OP5A 3QALE 2CN5A 3KFAA 3NNUA 4BWPA 3CEKA 3KXXA 4RJ6A 3ZEPA 4C0TA 3V3VA 2CJMA 4OBOA 3UYTA 1T46A 3W8LA 5HX6A 3P4KA 2FYSA 3C13A 2PSQA 2ZM3A 2F7XE 2YZAA 3FKLA 3LVPA 1H8FA 4XCUA 5EW3A 4AA4A 4TWOA 2W1CA 3GENA 3SRVA 4MD8E 3K5VA 4I6HA 5HG7A 4A9UA 4Z9LA 1OIYA 2CLXA 3W0PA 4O7ZA 5IISA 5IEXA 4FSWA 4FUYA 5H9BA 5BVDA 3RP9A 3A60A 4B4LA 5J87A 4BKZA 3A4OX 3JR1A 3HZTA 1ZAOA 4PDPA 2C1AA 3IQ7A 5E8WA 4ACHA 4C38A 5ACKA 4L9IA 3CR0A 3G51A 4TYHA 5DT0A 3FAAA 3TACA 4NFNA 1VEBA 4U5JA 1NA7A 3SOCA 4A4LA 2G2FA 2BRMA 2RSVA 4MK0A 4EKLA 4BCIA 5CYIA 3F5XA 3SW4A 4PPBA 4M69A 3OFMA 1Q8ZA 5DI1A 4KIPA 3UO5A 2FA2A 4FIHA 2R0UA 3KXZA 3W0NA 4CFMA 3UC4A 4JI9A 2J4ZA 2O64A 2PVKA 3AT3A 3Q3BA 1JQHA 1YHSA 4Y46A 3KVWA 4GEOA 2PUNA 3W2OA 5EYCA 3W0RA 3V5LA 2XBJA 1Q97A 2VUWA 4KUJA 1A48A 4HYIA 4B99A 1QL6A 2FSMX 2VWYA 3NX8A 4JNWA 2ITNA 2Q83A 2JBPA 3ELJA 3UJGA 5AAFA 4I5HA 5FQDC 4ASEA 5KMIA 4PRJA 2C5XA 2E2BA 3QGYA 2FSLX 2BAJA 4FTMA 4AXAA 2J0KA 2OF4A 3QRUA 4O2ZA 4YTCA 4ZAUA 4YBKA 2DS1A 3D15A 3QUEA 4IAKA 4RIXA 3JUHA 4QMLA 2VWBA 2XCHA 2XIRA 3GFWA 3R0TA 3EQPA 3F9NA 4X2KA 3W2SA 3WE8A 4QNAA 5TR6A 4O0TA 4BBEA 1WFCA 3EZRA 2WU7A 2FO0A 5IA1A 4LRMA 1APME 4RZVA 5CZIA 3IKAA 4JAIA 4YC6A 2JD5A 2WIPA 2WMWA 4MD7E 5GNKA 5DMZA 4EHGA 5IH5A 3QRTA 3VNTA 4U0IA 5I5ZA 5IKWA 3V5JA 1WBNA 4W4XA 5G6VA 3EN4A 4FOCA 4QNYA 1CSNA 1OIQA 5FG8A 2ZM1A 4O7RA 4BR3A 4F0FA 3FMEA 2IN6A 4FL1A 4BWXA 4G3EA 4C2VA 5IA2A 2VWVA 5CQWA 4YJUA 3GCQA 5D1JA 3ZM9A 3TXOA 4AFJA 2IW8A 1URCA 2QURA 2O0UA 3DY7A 2ZJWA 2WZJA 2WU6A 3AG9A 3O7LB 4PMSA 4L68A 4ZP5A 4FF8A 4EOIA 2C3KA 4O0YA 4DE4A 3PSBA 3ZUTA 2ETMA 2VWZA 4H3BA 4ZJVA 1OGUA 3CC6A 3NW5A 4RMZA 4BGHA 5BVWA 2UW6A 2I0EA 2JDTA 4I3ZA 4YLKA 4I21A 4CT1A 3Q9WA 2GHGA 4LOQA 4YZMA 3REPA 5DNRA 3ENMA 3UTOA 2DUVA 5L2SA 1AD5A 4FIIA 1NXKA 4PX6A 4RFZA 4XUFA 5JGDA 3NFGB 4DCAA 2WEVA 4WRSA 3FL5A 3TTIA 3TT0A 4ZTSA 3NUXA 2WTKB 5LWNA 5J8IA 5GIOE 2B53A 4DFBA 4TYGA 4F78A 1LEWA 1PJKA 1H07A 3EZVA 3VUKA 4RJ4A 4NL0A 3GFEA 3PXYA 4BICA 1R0PA 3BYMA 5KMOA 1Y8GA 3KQ7A 2VWIA 4FKRA 4J7BA 3MH1A 2XALA 5C4LA 2QOQA 5DBXA 4Q9ZA 4KNBA 2JDVA 3IGGA 3JXWA 4PTEA 1ZYSA 4YU2A 1VZOA 4FG8A 4FKUA 4PWNA 4AF3A 4ASZA 4TRLA 1OPJA 5HIDA 3Q9YA 3SA0A 3AGMA 3UZTA 2W1HA 4W4WA 3QTQA 3I60A 4E5BA 3C50A 2GQRA 4YZNA 3H10A 2RG6A 3ZRKA 4RGJA 2BR1A 2J0LA 4GMYA 5AR7A 4X2JA 5TKDA 4PTGA 3Q5IA 4XRJA 1XH9A 4EK8A 1OKVA 2B9JA 1Q8TA 4HNFA 4BRXA 4IAZA 2I0HA 5J95A 1QMZA 5TE0A 3AOXA 3HMMA 3OCGA 2YM7A 4LOOA 3DBDA 3UOKA 5T3QA 5EM6A 4GV1A 2RFSA 3DAKA 1KSWA 4IB1A 4KBKA 2HAKA 4FT5A 2VTRA 3BX5A 2BFYA 3FYKX 3PXZA 2ZOQA 1ZMUA 2Q0NA 4GJ2A 4R1VA 2YA9A 2XM9A 3CQWA 2WMXA 1Y6BA 3TV4A 3VN9A 3QQKA 3RTPA 4JLCA 4IVCA 4UXLA 3ZUVA 2HY0A 4FL2A 2ZFYA 4R8QA 4AGCA 3C7QA 4CEGA 3OWPA 1OZ1A 4D2TA 5CSHA 5TO8A 3DLZA 3R7OA 2C6LA 4IM3A 2VD5A 3PPKA 4F0IA 5AAEA 5DYJA 5A6OA 4NUSA 3ORLA 4D2VA 3V5QA 3DAJA 4UXQA 4YSJA 4RJ7A 1XH8A 1HOWA 4M0ZA 5IA0A 3Q2MA 4RC2A 4ORKA 3R6XA 4OLIA 2YJSA 3NCGA 5G1XA 3L9LA 4HPUE 2XIXA 3O51A 5KMJA 1LUFA 3OUNB 1ZYCA 5FP6A 1L3RE 2GPHA 1PMNA 4FKGA 4FNXA 3A7IA 5CNNA 1OVEA 5KBQA 2V22A 3W2RA 4EORA 3MGYA 5E1SA 3FXXA 4FNZA 3F6XA 5EHOA 3RGFA 2BRNA 4QTEA 1OBGA 5HORA 3CGFA 5KE0A 2YCFA 4LGGA 4O4DA 2EU9A 3F5UA 4I6LA 4U44A 5CF6A 1PMEA 4U41A 2NP8A 3ZRMA 4RLLA 5FDXA 4IJPA 3PTGA 2W4OA 4O38A 1KOAA 3NZ0A 5KBRA 3TKIA 1U54A 3ZSIA 4YUQA 3KRJA 4FYNA 2X2MA 2C3IB 3PVUA 4HGSA 4EK3A 5IEVA 5A4CA 3EKNA 3MESA 5EI2A 4GIIA 1SNUA 1XO2B 4FBXA 5BMMA 5H8BA 4MXYA 5K9IA 3UQCA 4M84A 4OT6A 3ROYA 4BCNA 1JKKA 3FY0A 4KWPA 3CY3A 5GJFA 1GOLA 3DTWA 3UG2A 3CQUA 2VO3A 1BL6A 2FB8A 1XMMA 4FKSA 2HWPA 3TMOA 1YI6A 2J7TA 4RX8A 5ETIA 3DNEA 1YXUA 2QOBA 2W1FA 5D9HA 3HV7A 3VBTA 5AV3A 2UW9A 2JFLA 1WBVA 4JMQA 3BWJA 1OL6A 2ETRA 3R00A 3F2NA 2X0OA 3I7BA 4RRVA 4TW9A 3V5WA 2W1EA 2C5NA 3FC1X 1K2PA 2XM8A 4E5WA 4M8TA 3GC9A 3PPJA 5AV0A 3WF7A 2QKWB 2XKCA 4NM5A 4RZWA 5CF8A 4EBVA 1WZYA 3V51A 4FKQA 4L44A 1QPJA 3ZFXA 4BHZA 4C58A 2P2IA 1Z57A 4QMMA 1KOBA 4FJVA 2UZWE 2WMVA 3Q4TA 4ALWA 2F7ZE 2C6OA 1W7HA 4M97A 4UEUA 5A4QA 5IMXA 3DBFA 5LVOA 3FZSA 3TEIA 5M07A 1BLXA 2RG5A 4TXCA 4FIEA 4G3DA 2JGZA 4E6AA 1LPUA 4FSZA 4I5CA 1Y91A 4K33A 3QQHA 4A9YA 4BWKA 3DJ7A 4QO9A 5ETFA 5CEMA 3DBQA 3E8NA 4QQCA 3FSKA 4CLIA 4I6FA 2QOLA 5JKGA 4AQKA 4QP2A 5C03A 4YPDA 3COKA 4DHJA 1LR4A 3NUPA 2XJ2A 4K8AA 2YN8A 1JNKA 3F5GA 3FLZA 2OICA 2OJFE 2UZOA 3R1QA 4RIOA 2R3LA 3SXSA 4AT5A 3CKWA 1PMUA 2X6EA 5LVNA 4XV2A 4O7TA 4I6QA 3R8MA 4BTKA 4FV7A 5DHJA 4HYUA 3CCNA 3L1SA 4FTLA 4TYIA 3RWPA 4DEDA 3ITZA 2JC6A 4RVMA 2J9MA 3BBTB 2OU7A 4OTFA 4ACMA 3WI6A 3KN5A 4S30A 3GOKA 3BLRA 1A9UA 5ANIA 5BVOA 2OZOA 2UV2A 4YO4A 4E3CA 4MVFA 1OMWA 4K9YA 4A06A 2YIXA 3VS1A 1J7LA 1QPDA 4AW2A 3BPRA 5M4FA 3O8UA 4G9RA 5TT7A 5FGKA 2G01A 4AN9A 4C4IA 2R5TA 4ERWA 5A4TA 4WNOA 4LQMA 4D2WA 4CRSA 5HVKA 5AWMA 4E8AA 4W8EA 3CJFA 2ZV8A 4DLJA 2B55A 3Q04A 4R7HA 4ONAA 3OOMA 4ZTLA 4S32A 1TQIA 3EWHA 1R1WA 4YP8A 4ZZOA 3ETAA 3OHTA 3VUHA 3WOWA 2QG5A 4MTAA 2UVYA 4C4HA 4F1OA 3VS3A 3CJGA 2LAVA 2F4JA 3QQFA 4NKSA 2PMOX 4EZ5A 5B2MA 4IADA 5HKMA 4N70A 4DYMA 1SVHA 2Y4IC 4J98A 4PNKA 1YXTA 2OJIA 4GS6A 2UZLA 4ZMEA 3MPAA 3SXFA 3G6GA 3OC1A 4CV9A 2O8YA 4R1YA 1PRYA 5LJJA 4QMPA 3W55A 3RAKA 3EQFA 5F4NA 2OXDA 3BIZA 4I5MA 1MUOA 5AP4A 4E6CA 3C4WA 3ZO4A 5J1VA 4R7IA 3QLGA 4J53A 5HIEA 2WTDA 5DRBA 4UMUA 5AM6A 2Z8CA 3D2KA 3ODZX 2C6KA 3R73A 4AE9A 4QEBA 4IZAA 4BI0A 2OXXA 3FI3A 2W06A 4IX4A 4JX3A 3SQQA 3DA6A 3QCXA 2WELA 2Y0AA 3HV4A 2BHEA 2QVSE 2XH5A 3VIDA 2PK9A 1Z5MA 5DG5A 2BKKA 5L3AA 3CQEA 3H9RA 5M44A 3R8LA 5M4UA 2CCIA 4PMMA 4PL4A 3NUYA 4UWCA 4FODA 5L6PA 3FXWA 2QOIA 3KVXA 5GJGA 3G2FA 3VBYA 5D7VA 2C3JA 2LGCA 3VBWA 1U54B 1WVXA 3MVHA 4GW8A 3LPBA 1PXLA 2XRWA 2YCSA 3ZOSA 3MB6A 3DLSA 3MWUA 4FKJA 4FVPA 5TF9A 4C37A 3QX2A 1KE7A 3BYOA 4IHPA 1XKKA 5LMAA 3VS5A 4YJQA 1Q62A 3FI8A 3UZPA 3HEGA 3MPMA 4WO5A 3OBJA 2OZAA 2EB3A 4O82A 1YWRA 3ZFYA 3WARA 4BCKA 4HNIA 4CFFA 5AV4A 4UZDA 3VS0A 3ZLYA 1YVJA 5D11A 4KRCA 4QT1A 5GZ9A 1IAHA 3S1HA 1YWVA 5AJQA 4ZS0A 4Z3VA 2JDSA 5DOSA 4IM0A 4D2SA 4YPSA 4LMUA 4TY1A 4BCJA 5HBHA 3SLSA 4ZY4A 3TUCA 1TZDA 3MYGA 2RFNA 3BRBA 3QQLA 3GI3A 4ZSJA 5IPJA 2IWIA 3HGKA 3WZDA 3AC4A 4PL5A 4DG3E 4AXFA 4FKLA 3ZLSA 4YJNA 3BHVA 1WBTA 4RBLA 3R7VA 4KKEA 2QQ7A 4I94A 4XG4A 2PPQA 3TDVA 2OFUA 4JQ8A 3ZYAA 2CGXA 5DA3A 5DEWA 3NMUF 3V8SA 2PHKA 4RWIA 2E9NA 2GS6A 1Q3WA 2JLDA 2X9FA 4CMUA 4LGDA 4Z7HA 2OI4X 3DDQA 5DRDA 4UMPA 3PE2A 3ORNA 5HCXA 5HU3A 3KL8A 3QGWA 3CY2A 3NW6A 4II5A 4WG3A 3U6HA 2W5AA 3S2PA 1R78A 3PZEA 4Y72A 4N0SA 2X4FA 4EYJA 2QG7A 3DB8A 5CSVA 4MX9A 3KULB 4JR7A 2PZRA 4XP2A 2WO6A 1PKGA 5CU3A 4IDTA 4ZZNA 5LMBA 5CY3A 4RQKA 1LEZA 3UOJA 4ANMA 4RWLA 4LV8A 5EDQA 2Y6OA 5AP2A 1G8SA 1ZY5A 3FZRA 3GQIA 4TZRA 4H39A 3MVMA 2C5YA 2OFVA 4IWQA 4J97A 3FMDA 1YRPA 3FKNA 5ETCA 4AS0A 4EH3A 5IZFA 4HVSA 1UA2A 1JOWB 1KWPA 1Y6AA 3NUNA 4DEAA 3TNHA 4ZTNA 1Y8YA 1M2PA 3G9NA 3NNXA 5FM2A 3MY5A 5HE1A 4A4XA 2I40A 3A8WA 1XWSA 5BV3A 2BCJA 4R6VA 3VF8A 5J1WA 4MQ1A 2EWAA 1V0PA 3PDTA 3ZO1A 4EJNA 3EQBA 4FZAB 3DQXA 4RIYB 1NVRA 3RWQA 3VULA 4J99A 1XQZA 4MF1A 1KUTA 1PKDA 4U40A 2GNFA 3BU5A 3DK6A 4J71A 4G5PA 2GHLA 3BHUA 3D7ZA 1UV5A 3K54A 2OF2A 3OZ6A 2SRCA 2G2HA 1YHVA 3GU8A 2QO2A 4QP1A 1TFFA 2HZNA 2VX1A 5FDPA 3LHJA 2ZV9A 3KGAA 4M7IA 2JFMA 3JYAA 3OCTA 2WEIA 3F2RA 4FE2A 2OIQA 1Q41A 1UVRA 1FGKA 1XH5A 4BVUA 4RX5A 4YNOA 4QOXA 4O7LA 4CFUA 5K3YA 3R02A 4WBBB 1REKA 3R7GA 1ST0A 1IRKA 4ZSLA 1XH6A 2PVYA 3JY0A 3NYVA 2ITWA 4MH7A 4USDA 5HVJA 2VTOA 4CQGA 5HO6A 4ANQA 3HV6A 3QTSA 5EHYA 4BDFA 5CI6A 4WUAA 1XH7A 2J5FA 4LMNA 3LFDA 3P1AA