4GT3A

Atp-bound form of the erk2 kinase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
348
structure length
347
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
publication title ATP-bound form of the ERK2 kinase
rcsb
source organism Rattus norvegicus
total genus 106
structure length 347
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gt3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gt3A01
3KVWA 3EFWA 3G2FA 5EH0A 1PYXA 4D1ZA 4DGGA 4DH1A 4EORA 4KINA 4X3FA 3MJ1A 3EKKA 2HK5A 4BBFA 1V0BA 1OL6A 3W1FA 2QU6A 3ZFXA 4A9TA 3D2KA 4FIHA 5AR3A 3Q3BA 5D9HA 1VEBA 4RZWA 3IW4A 3TNQB 3ERKA 3I0QA 3PY3A 4O7ZA 3QFVA 2VV9A 5L6OA 4O7YA 3ZRMA 2WMUA 4O0SA 2BVAA 3GI3A 3ZO4A 4BDCA 4Z55A 4J1RA 3TI1A 5E4HA 3SRVA 3BPRA 3FL5A 3UC4A 5AUTA 2QODA 4RSSA 5AUVA 3A4OX 4AW0A 4QP8A 5ANIA 5CVFA 4L9IA 2JDSA 4GMYA 3IS5A 4O0VA 4II5A 4ZP5A 3CQUA 2C5YA 4FT0A 4XEYA 2WMWA 3ZLXA 4FSRA 4TNBA 3JR1A 3F61A 2OXYA 3RMFA 4ZTNA 4A9SA 4D0XA 3AMYA 3PJ3A 2BDWA 4GCJA 2JEDA 3CE3A 4LOPA 4WNOA 2BTSA 5DEYA 2CKEA 3QKLA 4LOQA 4ZSGA 2NRUA 4IVAA 4CMTA 1NW1A 3VIDA 2PL0A 1OM1A 2CGXA 3M1SA 3DTWA 3NUPA 4AG8A 5HKMA 3F3WA 3LLTA 2YM7A 5L2QA 2PSQA 2PUNA 3M2WA 2R2PA 5IUIA 4BDKA 4O83A 3F5PA 4EYJA 4P2KA 2B52A 4P90A 3ZU7A 3TTIA 3S95A 4QYYA 3ZH8A 3O8PA 4BDIA 2YIXA 3POZA 5EFQA 2NNWB 2QNJA 3KK8A 4PP7A 3NIEA 4FZ6A 3NRMA 4BKJA 2VWYA 3LKMA 2RGPA 5HEZA 4B7TA 1WZYA 4PY1A 4FKSA 3VUIA 4XH6A 4R1VA 4ENXA 5KMNA 4FBXA 3W8LA 1LEZA 1VZOA 3W8QA 4QP4A 3ZFMA 1XBAA 4L45A 4M84A 4FKUA 3HZTA 4CG8A 2HWPA 4IVBA 3FMLA 1WBTA 5DR9A 3BHUA 4TXCA 2ITOA 2X8EA 3UMWA 3QZHA 1O6KA 5C8KA 4BDDA 3DLSA 2XRUA 1WBVA 3F5GA 5IH6A 1H1PA 4AZEA 3Q9YA 4CFNA 5AADA 2BAKA 1AD5A 3ULIA 2VGPA 2Y9QA 3NCZA 2H6DA 4IVCA 1WMKA 3NW5A 3EQPA 5A46A 5JKGA 4FTLA 4DF3A 3JYAA 3QLGA 4I0TA 2R0IA 1GIIA 4QP1A 3ENHA 3FY2A 3L8SA 4AXAA 2G1TA 4QMVA 1GZNA 4RLKA 1IASA 5DFPA 1GIJA 2PVYA 3CTJA 1I09A 1YHVA 4MF0A 4YLKA 3RGFA 2UW0A 2R3JA 4BZOA 2WD1A 4YTCA 2ITXA 1U54A 3PXFA 4FODA 4GS6A 1UU8A 3R71A 2B9HA 3BIZA 2J4ZA 3LMIA 4GKHA 4IM3A 4K33A 3DTCA 1H07A 5BVFA 4FF8A 2IZUA 4G3CA 3NCGA 4FNYA 3V5WA 5EDQA 4DFNA 5DT0A 4CZUA 3B2WA 4EC8A 3G6HA 5CEPA 1SVEA 3HMOA 3V04A 4KBKA 3NUYA 1L8TA 1OPKA 2P3GX 4TYHA 5DHJA 5IQEA 4G34A 3TM0A 4I21A 2BIYA 5DR2A 3UZPA 3ATSA 1DI8A 1YOMA 1ZWSA 5C27A 4D58A 4FL2A 3LFNA 4JS8A 4OLIA 5CENA 2HELA 2LAVA 4P4CA 2JLDA 4NZWB 2C6EA 5A6NA 5CLPA 2P0CA 4H3PA 4RJ3A 5BUIA 4LOOA 5HX6A 2FSMX 3DBQA 4FSMA 4M13A 3U8WA 5EDRA 3EQCA 4RA5A 4FZ7A 3GCPA 3PG3A 3SOCA 4JG6A 2GS6A 2QOHA 3E5AA 3LM0A 4HNIA 1IAJA 4A4LA 3UTOA 5ETIA 5I0BA 3OF0A 3ORMA 2CGWA 5FUTA 4U81A 5ETFA 4DCAA 4L00A 1P4FA 4NUSA 2IZRA 3QUPA 2YABA 2YCQA 3DV3A 3EQIA 2XNBA 4GSBA 3TCPA 3CY3A 2ITNA 3R1NA 5CY3A 5M44A 5L3AA 3HAVA 4DINA 2WELA 5FD2A 3MPMA 2OJ9A 1R1WA 2A0CX 3LW0A 3DDQA 1OIRA 5D10A 5F20A 1YXVA 4BCGA 4EH3A 2ZOQA 3KQ7A 3P0MA 3UOHA 3QD4A 4F0IA 3QYZA 4OTDA 4CFMA 2JC6A 3VHEA 4BCMA 2XIKA 3BU6A 1Q99A 3GBZA 4HZSA 5D41A 5IMEA 1KOAA 1KV2A 3BI6A 3EB0A 4X2NA 5AIKA 5KX8A 2XIXA 4YNEA 1WVWA 2C5NA 3I60A 3R1YA 4WBOA 2R3FA 2Y7JA 2NO3A 2BROA 3ATTA 4E20A 5HBHA 5HG5A 1UVRA 4JAJA 5C4LA 2C3KA 1PXJA 3TKHA 4JG7A 4PP9A 4YJVA 5I9VA 3QALE 3CY2A 4CFWA 4Q2AA 3FLZA 1JLUE 1CTPE 1YHSA 2VD5A 3C4WA 3PJCA 2W1HA 5CS6A 5HLPA 5HQ0A 4MYGA 3HEGA 4RX7A 3FQHA 1J7IA 2WPAA 2IVSA 5AV4A 1HCKA 5A4LA 3EN6A 5KBQA 3C5UA 4MXXA 1K3AA 3RM7A 3ZYAA 1H26A 2UZWE 3MIYA 5FXRA 2YM5A 2GDOA 4MXCA 4JBOA 3WIGA 4BFMA 1QPJA 3QGYA 4ZJVA 2J90A 4J97A 4MAOA 1HOWA 4YJTA 5B7VA 1ZLTA 5HG7A 4F9CA 4NTTA 4RWJA 4RVTA 4UZDA 4GEOA 4V01A 4H3BA 1WBPA 1XH8A 2O64A 3D4QA 4RT7A 5HCYA 3ZBXA 3CKXA 3KF4A 4BTFA 4CT2A 4N70A 2YERA 4X3JA 3P5KA 4O0RA 3NZ0A 4A9UA 3EFKA 3OTUA 3PLAE 4OAUC 5CQUA 3UNJA 5AV0A 5IQIA 1JOWB 4QMXA 3DAKA 4FMQA 4O7RA 3SHEA 4PL5A 3OTVA 2R3IA 3RCJA 4UX9A 4MTAA 1DS5A 5K5NA 5BVEA 3U4UA 2XNGA 1OMWA 3BV3A 3DBFA 4C58A 5C26A 5EYMA 2VX1A 3FY0A 2IVVA 4IJ9A 5EHOA 2C6MA 1G8AA 2RG5A 3IDCA 5EW9A 4FSZA 5HLWA 3RPYA 1TQPA 4GVJA 3AT4A 3FPMA 5EM6A 3I81A 2B9FA 5F94A 3OT3A 5AEPA 3AGLA 4RJ4A 4OTPA 4XG6A 3U9NA 3NNXA 1H01A 3FI8A 3O23A 1YWRA 2W1CA 3AG9A 5CI6A 4I4EA 4IWDA 4L01A 3MN3A 3MSSA 4MD7E 3V8TA 3SG8A 3HRFA 1H0VA 1GNGA 2WQNA 3F3UA 4HYIA 4R8QA 2CPKE 5DNRA 1PMUA 5AJQA 4FV2A 4FV7A 3KU2A 2VX0A 3LVPA 3R02A 4QYFA 1W98A 4PPCA 3W2OA 1GAGA 3UIMA 2QO9A 3TDVA 2JGZA 3CS9A 4AN3A 4RIXB 4HCUA 4DLIA 4GFMA 2J0LA 2P4IA 4CTCA 4MNEA 1JSVA 1W82A 3V5LA 4C57A 5FGKA 3AGMA 4EH9A 2BAJA 3BX5A 4KIOA 3PZEA 2Y4PA 3Q4UA 2BALA 3ALNA 5CU2A 3VS6A 3MB7A 1QPDA 2BDJA 4JR3A 4AZVA 3EYGA 3JS2A 4A9RA 3DPKA 4GG5A 4WUNA 4ZLZA 4OT6A 4CFVA 4DG3E 4O7LA 4R77A 1KE7A 4PMMA 4R5YA 4OTQA 2C4GA 3F7WA 5E8SA 3ZTXA 4YO4A 3DXPA 4NKAA 3NS9A 3KL8A 4K77A 5D7AA 5ANOA 4BCJA 2YAKA 2QONA 5FEQA 2CKQA 4M68A 4I0RA 1PXMA 2J0MB 5KZIA 5CNOA 5FEEA 4QP7A 4MH7A 2ZJWA 1ZYJA 4FV8A 4L6QA 4LUEA 4RIWB 4DEEA 2PZYA 5HGIA 4M97A 1AGWA 2B0QA 4R6VA 1SNXA 4F1MA 2R0UA 2UW5A 4D4SA 3GGFA 5JN2A 2J50A 4FKQA 4FT9A 5HE2A 2W1EA 2Z7QA 2B54A 2JIIA 2O63A 3Q9WA 4K18A 1J7LA 3JXWA 3OW3A 5LMAA 4YZ9A 3E3BX 1UA2A 1OL7A 3MY1A 4F0FA 3TUDA 4YGAA 4OT5A 3RNYA 5AP5A 4Y85A 2QG7A 3OY3A 4J7BA 3ORKA 4E6AA 4FKLA 4QMUA 3I5NA 5J9YA 2X8IA 3ZLYA 3C0GA 2VTHA 4BB4A 4OAVB 3T9IA 3GC9A 1P5EA 2XNOA 2Q0NA 4GT5A 5HTBA 2V5QA 2O8YA 2A2AA 3CEKA 3FZTA 3V5JA 2PZ5A 3DOGA 4GJ3A 3R1SA 4XP0A 2YDJA 4D9UA 4C3RA 5L2SA 4E73A 4QD6A 4FA2A 2J7TA 2YJSA 4O0WA 3VW8A 5HVKA 4U3YA 2YACA 3FLNC 4MK0A 4LV5A 4XX9A 3OD6X 3LZBA 4K6ZA 4ASEA 5J9ZA 1V0OA 4D1XA 4FIIA 4M15A 1JBPE 1FVTA 4GK2A 1MP8A 2W4KA 3AC5A 3FAAA 4YJNA 3VWAA 4D4VA 3A61A 5JK3A 3LPBA 2CKOA 3HV7A 1UU3A 5DIAA 2GHMA 3CTHA 4FG9A 5EKOA 4CEGA 5JMSA 3E8NA 2JBPA 4MX9A 2FGIA 1Q8YA 4EKLA 3BHTA 2ESMA 3OXZA 3WZJA 1Z57A 4DBNA 4J95A 2XIRA 4RG0A 3CKWA 2UW9A 4BC6A 1OKVA 3ODYX 2QOBA 3Q04A 4CG9A 3POOA 1JWHA 3GFEA 4JX7A 3VQHA 1NA7A 2V55A 3CIKA 2XS0A 3DJ6A 3N9XA 4I5MA 2C5OA 4JVGA 4BIBA 4C4IA 2IPXA 2FYSA 3CR0A 2OZAB 5JRQA 1Y8GA 3DNEA 4LQMA 2VO3A 3L8VA 1U4DA 1XHAA 3HV4A 4FL3A 4NJDA 3QHRA 1CSNA 5DVRA 1YWNA 3TJDA 4ACHA 4F9AA 4USDA 5BVKA 4JBQA 3VC4A 4LGDA 4Y83A 5KUPA 5FBNC 5L4QA 5BUJA 3UZTA 2J0KA 1UV5A 3PXKA 5HE3A 4DC2A 2CNVA 2VTSA 3PRIA 4NYEA 2RKUA 3E64A 3LCDA 4EOMA 5FM2A 1XH6A 4Y46A 3NMUF 2Q0BA 4JLCA 3P1AA 4HVIA 3EQRA 3OUKA 4BWKA 2VAGA 3LCKA 4C37A 4K8AA 3TUBA 5J87A 1A9UA 4KNBA 3QAME 4OTRA 4FE2A 2FB8A 2WQMA 4E4LA 4L3JA 1RW8A 2GS7A 4N6ZA 3DXQA 5IEYA 4HGSA 4FEVA 4ACDA 4E5BA 2XBJA 3C1XA 3MYGA 4XG9A 5CSVA 4TYIA 5KBRA 2WOTA 5TE0A 3EJ1A 4ZZOA 4K11A 2J51A 5C8MA 3R7OA 3SD0A 4IX3A 3FQEA 5BNJA 3PPZA 5HVJA 4XHKB 3WARA 2HIWA 4U6RA 4QMSA 3SXFA 2EXMA 2GFSA 2ITYA 5AUWA 2OK1A 1ZOHA 4TY1A 4ZZMA 1XR1A 3MB6A 3CC6A 2A27A 3QCSA 4WUAA 3FKLA 4YJOA 3DFCB 1KWPA 2PUPA 2X2MA 4FIJA 4YSMA 5K0KA 5BUEA 3UQCA 4BGHA 5KMKA 3PTGA 2XKFA 5J1VA 1MUOA 4Q5EA 1GJOA 2WTDA 3DCVA 5ANKA 1T45A 5LARA 5BQ0A 1GZKA 4BCQA 3BYSA 4P5ZA 5FBOA 5GJDA 2CGUA 2XIYA 1REKA 4O27B 4QMPA 4I4FA 5DRBA 3O2MA 2OSCA 1QCFA 4V04A 3PE2A 4NCTC 2OKRA 2W1GA 3D94A 1YXSA 2XCKA 1YQJA 5E1SA 2X7FA 5ANGA 5JZJA 3W2QA 2OU7A 4DFUA 3T8OA 4ZMEA 4D0WA 1S9IA 3NEWA 2OG8A 2R7BA 3AQVA 3BBTB 3PDTA 2VWVA 3EZVA 4NKSA 5CU4A 2VTNA 4R3RA 4OTHA 5M06A 3R7GA 4KRDA 3QD3A 4QMWA 2YCRA 1UU7A 2YISA 3NPCA 1PXLA 4PRJA 5EYKA 4IWOA 1YXUA 3VS5A 3DB6A 4QMYA 4H39A 4BCOA 3MGYA 4C4JA 3GU4A 1W83A 4JI9A 4GIIA 3LCSA 4AU8A 1FGIA 1AQ1A 3O17A 4IW0A 3C4ZA 4L3LA 4FGRA 1YRPA 4MQ2A 4L7FA 4C0TA 2R3QA 4DGOA 4YJSA 4YZNA 3SC1A 4RX5A 3KCFA 1PXKA 4J8MA 2HCKA 4M7IA 3DA6A 4V0GA 3TZ8A 5M57A 1GZOA 1Y6AA 4JL9A 4U80A 3P7CA 1ZYDA 4EOIA 2OJJA 3P7AA 4C4FA 3K2LA 5I3OA 3TV4A 4E3CA 4E7WA 3KMMA 2QURA 4EOSA 1YVJA 3BLHA 3FSKA 1PXIA 3OFMA 2JDRA 2GTNA 3CGOA 4X2FA 3ACKA 3V6SA 4KWPA 2QOFA 2YN8A 1W84A 3NX8A 4AFEA 3JVSA 3BGZA 3QZIA 2RFNA 3ZDIA 3BQRA 1ZZLA 5HI2A 3MS9A 5DE2A 5AP4A 1K9AA 5HIBA 3BYUA 5DH3A 2HWOA 1PF8A 2JFMA 3NYOA 5AAFA 2V0DA 3UQFA 2X1NA 2F2UA 1MRYA 4FZFB 4K9YA 2YIYA 4WSYA 2ZM1A 3RVGA 4WIHA 4BDJA 3AC3A 4CKIA 2ZB0A 2O3PA 3HMIA 5EQPA 4FUXA 3W2SA 1IA9A 4N6YA 3N51A 5HCXA 1OKZA 1WBOA 4I20A 3EN4A 3F5XA 4YZCA 2ETMA 2C6LA 3QUEA 3F82A 2YM8A 3M11A 3F69A 1VJYA 2OF2A 2I0EA 2UW7A 4IB5A 3PJ1A 2CSNA 4E5WA 4HVDA 3VW6A 5EM8A 2HZ0A 4G9RA 3TIYA 1QPCA 2BR1A 5AWMA 3QBNA 5IQDA 1CKJA 5IDPA 4L68A 1JPAA 5CAPA 2PULA 5CEKA 3UODA 4AUAA 4JDKA 5CSHA 4GH2A 4QNAA 5E8WA 5D11A 5HNIX 5HX8A 5M56A 3HX4A 3ETAA 3QYWA 4FSTA 5DG5A 4AAAA 4QMNA 4M66A 3H9RA 4IC8A 5GHVA 3DKCA 4CKJA 4F64A 2QO2A 4G1WA 2ZV9A 3HP5A 3O0GA 3S00A 3UP7A 5FM3A 2OO8X 4BR3A 4D55A 1F0QA 3JY9A 3LHJA 3OC1A 4MXZA 2X0GA 5JGBA 4ZTQA 5LMKA 4FEUA 3Q52A 3FI3A 4X7QA 1OL1A 3V8WA 5KMMA 4G6LA 2YCFA 4ANQA 5CAQA 3B8RA 4M69A 4B4LA 4OTWA 4LI5A 4QPAA 2OIQA 4FIFA 1BL7A 3IPHA 4O7WA 2G2HA 3RPVA 3QGWA 4RC4A 2W5BA 1O6YA 4IX4A 5HE1A 1XKKA 5B0XA 3Q6WA 4HVSA 5HTIA 2E9NA 2QKRA 5B2LA 1V0PA 4ZK5A 1JKLA 3C7QA 3IO7A 3E87A 4RZVA 3QQLA 4HGTA 4XG3A 2QLQA 3ZSIA 4UMTA 1QMZA 2IO6A 3F88A 2R3NA 3NSZA 4ZY5A 4YLLA 1BMKA 1U59A 4LGHA 4FTCA 4YJQA 4BGQA 1BYGA 3U4WA 3BEGA 3O7LD 3RZFA 3MV5A 3KULB 4FK3A 4FSYA 2PZPA 4RJ7A 4FEXA 5AR2A 2XYNA 2ERZE 3R6XA 2GQGA 4U7ZA 3P08A 1FGKA 3DGKA 2E9VA 1OIQA 3FBVA 3WZUA 4CNHA 4HJOA 4WT6A 2C3JA 1IA8A 2AC5A 3NUXA 5LCKA 3N4TA 3ROCA 5L6WL 3UNZA 5C1QB 2BTRA 3MPTA 3PVGA 3DBCA 4QTEA 3WYXA 3QQFA 2ERKA 5CEIA 5HBJA 4ZSLA 4W4VA 3IK3A 4F6WA 4AFJA 4KS7A 4BBMA 2OFVA 4A06A 4E6CA 3MVLA 4FKGA 2YWPA 1SM2A 5IA2A 3AC1A 3QA0A 2DWBA 1OECA 2ZM3A 4GJ2A 5HVYA 4YC8A 4BCPA 1FVRA 3CJGA 4CRLA 2Q83A 4ZLOA 3AXWA 3ZFYA 4PUZA 3V51A 4MF1A 3KY2A 1CDKA 4DEDA 3FMNA 4TNDA 1ZZ2A 1XO2B 2BPMA 3BV2A 3GOPA 4B0GA 3QXPA 3R30A 2C68A 4ZXTA 3QKKA 4NW5A 3BWFA 2Z02A 3GCQA 3FMMA 3T3UA 3KF7A 4NL0A 2WMXA 2YA9A 3NAYA 5CT0A 5H8BA 3ORPA 4C3PA 4QQTA 1L3RE 1DI9A 4Q9ZA 4LRJA 4KAOA 4FL1A 2PVMA 2R3GA 4CZYB 3L9LA 4EI4A 5IA4A 3VUGA 5TF9A 3UDBA 3I1AA 3CSVA 4I24A 4KA3A 1QPEA 2RFEA 3UG1A 2JDOA 3ORIA 4TWOA 5L8JA 5GZAA 5TKDA 3F3TA 2F57A 2HXQA 2QKWB 3LJ1A 4I23A 2WIHA 3HDNA 3EFLA 2GFCA 3KXHA 1Y6BA 3QWKA 3KXXA 1URWA 3PE1A 4RBLA 4XUFA 3AC2A 4FKIA 3EWHA 3IW6A 4X3FB 5IA3A 2OH0E 5D1JA 4ZIMA 4CCBA 4EH8A 5HIDA 2KTYA 4NK9A 2FVDA 5LVNA 4W4WA 4YNOA 3N4VA 4BCKA 3EL8A 3Q96A 1WFCA 4O6LA 4BVUA 1I44A 4B6LA 4GUBA 4RJ6A 3P86A 2C3IB 4ZTMA 2XEZA 3CBLA 2PY3A 2ITUA 3NDMA 3TNPC 1U46A 5DEWA 3R21A 5FDPA 2YLFA 3P4KA 3QUDA 3SRVB 3KA0A 5JGAA 5LXMA 5A54A 3MWUA 2J2IB 2WU6A 3R8ZA 2WTIA 4BF2A 4UMUA 3QCXA 5EI2A 4FEWA 5M4CA 3ZXZA 4ERKA 4PPBA 3Q5IA 2WMQA 1UNHA 2BRBA 3PY0A 1Q62A 4F9BA 3FSFA 4E26A 2PE2A 4RIYA 4APPA 4ITIA 3VS1A 4KKEA 3ORNA 2O2UA 2E9OA 4EK6A 3LCTA 3C9WA 2F9GA 2PVHA 2ZB1A 3H4JA 4XP2A 5JEBA 5DPVA 5M4IA 4QNYA 3BBWA 2F49A 4JRVA 4F9WA 2NPQA 4ALWA 3T3VA 4JR7A 1H0WA 1S9JA 1UKHA 2AYPA 2REIA 3MBLA 3MW1A 4TYGA 5IH4A 4I6FA 4M12A 4JDJA 1KE5A 2BZHB 2J5EA 3DS6A 4FKWA 3MH0A 3H9FA 4HGLA 1YDTE 3R28A 3PUPA 3UIXA 2PVJA 5IQFA 4XLIA 4QMLA 3IKAA 2C0TA 4JQ8A 4LGGA 1V1KA 3ZLSA 3S1HA 2HZ4A 4EUUA 4BI2A 3VNTA 4AW2A 4O7NA 4DTAA 1O9UA 3MDYA 2GNJA 2CHLA 4FNZA 1DAWA 3WE8A 2YZAA 3PG1A 3VUHA 2W1ZA 2C1BA 4IB0A 3NGAA 2RFSA 4D2VA 4E8AA 3UOLA 5B2MA 4F0GA 3A2CA 3D7TA 3CTQA 1G5SA 3O51A 4S34A 5E8TA 4NFMA 2UV2A 3UZRA 4WA9A 4CYJA 1Q8UA 3COIA 4EZ3A 4A9YA 4ZEGA 3OY1A 4QOXA 4O96A 4EHZA 2A4LA 5K4JA 3D0EA 5C03A 4RIOA 4CLJA 4R78A 3GT8A 2P2HA 3NYVA 4PTCA 4PMTA 4RWLA 3U6JA 1MRUA 3VS2A 4IX6A 3DFAA 4C7TA 1WBWA 3BGPA 4UXQA 5FP6A 3TNIA 2W1DA 3LLAA 2HENA 4I6HA 2IG7A 4X2GA 4HYSA 5G6VA 4EH4A 1U54B 2C3LA 3KRWA 4FT5A 4YSJA 3ZUTA 2BDFA 4U0IA 5IZFA 2PVLA 3BRBA 3PPJA 2VO7A 1NVQA 4MWIA 2PUUA 4S31A 2YDIA 4FKRA 3ID6C 5KHWA 2X9FA 4IQ6A 1JKKA 1YHWA 2QD9A 1PMVA 2AUHA 3PIYA 3EKNA 5CVHA 4EH7A 5AR4A 2CDZA 2UVXA 4YHTA 4ZJJA 2R3PA 2R7IA 5DWRA 4CLIA 2OI4X 3PPKA 3A8XA 3LMGA 3UGCA 5K0XA 4B8MA 4IDVA 1UWHA 3LFSA 3ZM9A 5I3RA 3FV8A 3I6WA 3RPRA 3BYVA 4PDOA 2BIKB 4C3FA 1LUFA 3QQKA 1YI3A 4IAZA 4NH1A 3BE2A 5FP5A 3R9DA 3ZS5A 5AMNA 2XH5A 4FSWA 4R7IA 3ZCLA 4DH7A 4TRLA 2XZSA 2FSLX 3SDJA 1JVPP 5AP3A 1H1QA 3D2IA 2JDVA 2C0IA 4J71A 2YITA 4FVQA 2ONLC 4KUJA 2BHHA 5CU0A 2WTCA 1OBGA 5KKRC 3RAWA 2H96A 2JIUA 2I6LA 1VR2A 3E8DA 4TN6A 4GKIA 1TQMA 1W0XC 4LYNA 4DH3A 1ZOGA 3OOGA 4FIEA 3NW6A 4N4SA 2ETKA 3IDPA 2R3LA 3EN9A 4WOVA 4IM2A 2VZ6A 2B1PA 3FXZA 3ZO3A 4X3FC 2WTWA 2WIPA 1OUYA 3H10A 5AIRA 3ZZWA 3KK9A 3HKOA 1PRYA 1Q3WA 3MFTA 5L6PA 4NWMA 5BYYA 2PYWA 3R7EA 4BDHA 3LE6A 4Z9LA 4O86A 4O7SA 4KIPA 3JUHA 4W8DA 3K54A 1Q8WA 4WO5A 3WIKA 4G3FA 1FINA 1PXOA 4HPUE 4IAAA 5L8KA 3W10A 4USEA 2QOCA 2G2IA 5AP6A 3COHA 3TZ7A 4HGEA 4G6OA 3GU7A 3FMDA 2W0JA 1Q24A 5AUYA 4DFLA 3F66A 1MQBA 3VF9A 4AT4A 4AA5A 2W4JA 5AFVA 4O0YA 4OUCA 3RAKA 4FNWA 5CSXA 4OW8A 5IISA 4IZ7A 4L52A 5BYZA 2V7AA 4IZAA 4R7HA 2R5TA 3ZDUA 4C61A 5D7VA 3G51A 2JKKA 3RPSA 2W06A 3R7VA 4YMJA 3EHAA 3GU8A 4YPDA 4RFYA 5J8IA 4D2RA 3QRKA 4GIHA 2QCSA 4NSTA 3WE4A 4J53A 5A4QA 4MD8E 4FV9A 3D5UA 1OI9A 4ONAA 2C6IA 1Q41A 3FWQA 3LXNA 3Q2MA 1M7NA 5A3XA 3UYSA 4L42A 3EZRA 4FTTA 4CKRA 5HG9A 3UQGA 3NUNA 3ITZA 1ZARA 5CU6A 3F3VA 4QQJA 4L7SA 3OCSA 4IEBA 3TZ9A 3EQHA 3ORTA 3VJOA 3W2PA 5AR5A 3FPQA 4S32A 4FNXA 2XNPA 3QTRA 4RIXA 3SXSA 4Z3VA 4PQNA 4RVMA 4OTFA 4QP3A 4C35A 4O0TA 3G33A 1ZMUA 4Z7GA 4WKQA 5CI7A 4QT1A 3FMHA 3A7JA 1PMEA 4DITA 4EQCA 3G15A 4QYGA 4YO6A 4OTIA 1IG1A 2B9IA 3H9OA 4BWPA 3IG7A 3LQ8A 4EOLA 1JNKA 2V7OA 2QR8A 5H3QA 5KE0A 3W2CA 4L44A 5I5ZA 5IQBA 4ZS4A 4GUEA 4W9WA 3WBLA 3OBGA 2YZLA 4G5JA 4YP8A 4QP2A 3DK6A 5AUZA 3FDNA 2UZOA 3LFFA 2OICA 4QPSA 2YIQA 4I22A 4XJ0A 3F2RA 1Y57A 3QRIA 4NM3A 4AE9A 2Y8OA 5DA3A 3U9CA 2UZUE 5CAVA 3W33A 3IECA 4FOCA 1YXTA 4XOZA 4RRVA 3H3CA 4RLLA 5H9BA 4DGNA 1YI6A 5IA1A 3CGFA 4IAYA 1QL6A 3A7HA 3GUBA 4CZTA 1BI7A 5AP0A 1YOJA 2XRWA 1Q4LA 2I0HA 5EM5A 3HUCA 4D5KA 5GJGA 3ELJA 4FTKA 3R8UA 4GT3A 3GC7A 3OBJA 4RMZA 3DBDA 2OH4A 2O0UA 2W7XA 4QTBA 3UJGA 2X81A 4HVGA 4IH8A 3Q2JA 4JIAA 2RIOA 2Z8CA 3NAXA 5EK7A 3MPAA 2YM6A 2RG6A 2BRHA 4W9XA 4QQCA 5FTOA 3K3IA 5JRSA 4EOKA 4D4YA 5ANEA 3ZRKA 3R63A 2YM3A 3D5XA 4BTKA 4EOQA 5H8EA 2YWVA 5ITAA 5AUUA 4MNEB 1FBNA 2C5VA 4FVPA 4F7NA 3OXIA 4XRJA 4AOTA 2PE1A 3GQIA 3RINA 1H8FA 3ACJA 5FQDC 4X6QC 2EXEA 4HW7A 2O65A 4ID7A 2WU7A 2Y6MA 4FICA 4ITHA 4QQ5A 3ZEPA 2VNWA 3I5ZA 4I5PA 4KS8A 4L67A 2W9ZB 1NVSA 3BU5A 2XNMA 3ANRA 4RWKA 4AA4A 4EQMA 3DBEA 3R8VA 1GOLA 1M2PA 3PSCA 2DQ7X 3KXGA 3VUDA 4C62A 2ZMDA 1H28A 1OB3A 4DEGA 5CQWA 4XP3A 4D4RA 5DGZA 1VYWA 1YXXA 2B9JA 2WMAA 4PMSA 3HRBA 3SG9A 4S30A 5C01A 1CMKE 2GNFA 4G9CA 3RAIA 3R22A 4AZWA 3WILA 4LL0A 2GQSA 2EU9A 3EQBA 5LQFA 3QU0A 4EOJA 2GNHA 5LWNA 4IMYA 4FZAB 4TKSA 3VJNA 4TW9A 3UVRA 3GB2A 2XUUA 5EHYA 5I4NA 2JAMA 1PMNA 2QOOA 4NFNA 5FEDA 3VBWA 4Q5HA 4BCHA 4FC0A 3ZOSA 2RFDA 1FOTA 1R39A 1Y91A 2VNYA 3GCVA 4GK4A 4EL9A 3AD5A 5EI6A 5E90A 1MRVA 5GZ9A 1LPUA 4GG7A 3IW5A 5HOAA 5DT4A 3QL8A 5EOBA 2JFLA 2HZIA 4WG5A 4I41A 3C50A 3G9NA 4EONA 3HUBA 2ZMCA 3IOPA 4BZDA 5J7BA 4MXOA 4O22A 2BCJA 3QLFA 3ZO2A 4UEUA 3FI2A 4RC3A 3EFJA 1WBSA 2W5HA 2ZYBA 2UVZA 5CEMA 5AR8A 2FH9A 3ZHPC 4CXAA 2J6MA 4TWNA 3QCYA 5DMZA 4RQVA 3QTIA 4DT8A 4DEIA 1SVHA 3PVWA 4S33A 2R64A 4DA5A 1E1VA 3FC2A 3FYKX 5HE0A 1KE6A 2EXCX 2HOGA 3BHVA 4O38A 3EIDA 2C5XA 2YFXA 1FMOE 2WQEA 2PZRA 2VGOA 3R9HA 2GTMA 1NT2A 4P5QA 4TZRA 4XV1A 4R7BA 4G16A 1GY3A 2WTJA 3OVVA 4CQEA 4PTEA 4YR8A 3DT1A 2VX3A 2QHMA 3BU3A 3WF5A 2C30A 2VTRA 4APCA 2QO7A 3G5DA 4N57A 3GU5A 3R0TA 1PHKA 2HY0A 2J0IA 3LMHA 4XG2A 5GIPE 2EB2A 2XA4A 2UW8A 3LFDA 2W96B 3KRXA 4YUQA 4TPTA 5LVMA 1JAMA 5LCJA 3LFQA 3E93A 2XK6A 3ZZEA 4CYIA 4DFZE 4XG4A 2VWWA 3QHWA 4YHFA 3DU8A 2CCIA 4WNPA 4W4XA 4XG7A 1RDQE 3DAJA 3ET7A 5JFXA 3MVHA 4MXAA 2UUEA 4PTGA 3LXLA 4XV9A 3R9OA 5I9WA 2JKOA 4L8MA 2R3HA 3HNGA 3QD0A 4JRNA 5K4IA 3JVRA 1UKIA 3P9JA 2BZIB 3VBYA 3DNDA 5HNGA 5J9LA 5M07A 2VO0A 2F2CB 4CFFA 4EK3A 3DJ5A 3W16A 4H05A 3ANQA 5BMSA 5CF5A 5E8XA 3L9NA 2WTKB 3HECA 4F65A 4XLVA 4HNFA 3B8QA 1H1WA 4QTDA 2I0YA 3HGKA 3KRJA 5GJFA 1YDRE 4R3CA 3TKUA 5HLNA 5DN3A 2QOQA 5A14A 2BAQA 4RFMA 3U87A 5BVOA 2P2IA 5L8LA 3OCTA 5LVOA 2OF4A 4OBOA 5E92A 4EWQA 2OWBA 3CPBA 1A48A 2JBOA 3K5VA 3HAMA 3OCGA 2QC6A 2I1MA 4TTHB 2WKMA 5JQ8A 3KRLA 3NYXA 4YZBA 2UW4A 5F95A 3TV7A 4FKOA 3UP2A 1OIUA 2EB3A 4EHEA 4AGUA 4EBVA 4O0XA 3DY7A 4I92A 1YW2A 4E6QA 3H30A 4WHZA 1RE8A 1IEPA 4F1TA 3PXRA 5LWMA 1W7HA 4UWBA 3PLSA 3RI1A 2XKCA 3SX9A 2VRXA 4RVLA 4ALUA 5JFSA 3TUCA 5E8YA 1B39A 3C4FA 1G8SA 5LVLA 3TTJA 4U97A 4DLJA 1UWJA 3NWWA 3R7IA 4MBLA 3C0IA 2ZDTA 3I6UA 3Q9ZA 4GFGA 5CEOA 4U9AA 4AA0A 5AA9A 1OGUA 3T9TA 2QLUA 4QMQA 3ZBFA 4JQ7A 4DE4A 3IONA 3HA6A 4M0YA 4WRSA 1KE8A 4BHNA 2X4ZA 4HCVA 2BILB 3W55A 3QQUA 3DB8A 3RWQA 3P79A 2H34A 2GHGA 3V6RA 3SA0A 3C51A 2ITZA 4CV8A 5CSPA 4QTAA 1MQ4A 4GYGA 5ANDA 4GL9A 4FYNA 3MY5A 4EJ7A 4YTHA 3Q6UA 2CLXA 2RL5A 3LFEA 3QTQA 1VYZA 4U43A 3S3IA 2XJ1A 2ZAZA 2HAKA 4KIKA 3BHYA 4UB7A 3AC4A 4KSQA 3QQHA 1FVVA 2XYUA 5A6OA 1BLXA 2UZLA 5DI1A 5HU3A 2G2FA 2X7OA 2OLCA 2QOKA 4ZTRA 4CFUA 4F7JA 5E8ZA 3VRYA 3PXZA 3CLYA 3PA3A 2PE0A 3OT8A 1EH4A 4IWQA 2X8DA 4FTIA 4N0SA 2B7AA 4PL3A 4GU9A 4ZZNA 3F9NA 1JSUA 3ZSGA 4GYIA 1YKRA 4NIFA 4FKTA 3KKVA 4KKHA 2E9PA 3FKNA 3OMVA 2OIDA 3E8EA 2ITPA 4IJPA 4XYFA 1J91A 4KSPA 4YPSA 3UG2A 4CFXA 5EI8A 4KRCA 5FRIA 2VWBA 4ZJIA 5CZIA 5IDNA 3R00A 4IZYA 1J1BA 3VBVA 4AS0A 4I5CA 5DR6A 3PWDA 4FT3A 2IW6A 3RAHA 3V5TA 3DKOA 1STCE 5GINE 5HIEA 3PXYA 4MBIA 2J5FA 3MH1A 1A06A 3FKOA 5CF6A 3NUAA 4DHFA 2X39A 3RPOA 1T46A 1RQQA 2VTQA 3LCOA 3R9RA 2VTTA 1YOLA 5CXHA 4RFZA 5F1ZA 3ZM4A 1SYKA 2OJFE 5M4UA 3VBQA 4F63A 4WRGA 1DAYA 1H00A 1Q8TA 2IVUA 3E62A 4XNEA 4FKPA 5IPJA 1H24A 3R9NA 3FZPA 2FUMA 5CEQA 4BDFA 4IFCA 4TT7A 4O84A 5CASA 4QO9A 4K2RA 3WZDA 4UXLA 5B2KA 4PF4A 4DBXA 4GVAA 4ZOGA 2GNGA 4I5HA 3BKBA 4FSUA 3FZSA 1IRKA 3PXQA 3IQ7A 4AOJA 3A7IA 4AOIA 1BI8A 4M69B 4MWHA 3TJCA 5IA0A 2XBAA 2EWAA 1XWSA 3DKGA 4O7VA 2VTPA 4FV1A 4RX9A 1J7UA 4TWPA 3NVKI 1O6LA 4BZNA 2GS2A 2XJ0A 3D5VA 2Y6OA 3VRZA 4RPVA 3AT2A 2WTKC 3LFBA 3LJ2A 4MBJA 3Q9XA 5DBXA 3DQWA 4XS2A 3R7YA 4F08A 5CXZA 4ERWA 2A19B 4O7TA 2GNLA 2ACXA 2R3RA 5A4EA 3BZ3A 1Q5KA 1H25A 3RHKA 1Q97A 2OXDA 2RF9A 2C6DA 3ZUVA 1WVXA 5J95A 4FTRA 1UNGA 4F6SA 2PMOX 2JKQA 4AGWA 3ODZX 4EKKA 2HXLA 2QR7A 5CALA 2WTVA 4I94A 3ZC5A 1FQ1B 5E1EA 3F7ZA 3PIXA 2QQ7A 2AC3A 2XKDA 4YLJA 4FKJA 3QZFA 5ACBC 4NU1A 1OUKA 2UZBA 4XBUA 4D9TA 3FLYA 4JDHA 5KMJA 1H08A 3VULA 5E8VA 4BL1A 5CF4A 3OOMA 5J7HA 5H8GA 2JIVA 4KIQA 4FTMA 3KCKA 5TO8A 1JKTA 3MA3A 4HYHA 3PZHA 4FIGA 4D28A 5KKRB 4A7CA 3BHHA 3VAPA 2C69A 5E9EA 3C4CA 3L8PA 3FLWA 3IOKA 2W4OA 4AX8A 4GRBA 3E92A 3QTXA 2UVYA 3AMBA 2VTOA 2ETRA 2BHEA 2XKEA 3MH2A 4EK8A 4AE6A 3QX2A 3G9LX 4IADA 2WO6A 3QTUA 4JDIA 2X7GA 2WHBA 2E9UA 3EH9A 2UZEA 3HRCA 5FLFA 3GVUA 3KREA 3GEQA 2BMCA 1ZOEA 3PSBA 4C4HA 5E8UA 4UALA 4ASXA 1W8CA 2XEYA 3I79A 5CAOA 2CNUA 4FV5A 4LG4A 4C59A 3BYOA 3G6GA 2PMNX 3OXTA 5EW8A 4DH8A 1ND4A 2PPQA 4DGMA 4FZDB 2CKPA 4TYJA 3VVHA 1CKPA 3MIAA 2WXVA 4R3PA 2DS1A 4X6RA 5HU9A 1H4LA 1ZYLA 3R8LA 5AX9A 3TIZA 2PMLX 3BEAA 4FI1A 5FTQA 4H58A 2G01A 2JAVA 2QOIA 4UMQA 5I9YA 3IGGA 2Y4IC 4J98A 3L8XA 2BFYA 4FX3A 4F4PA 5L2TA 2DYLA 3G0FA 4LUDA 3UE4A 2BRNA 2B53A 5AP7A 5JSMA 3D5WA 3PVBA 3UMXA 2WQBA 2QVSE 4J52A 3UPXA 4L46A 1OZ1A 3ORLA 3FLSA 3MH3A 3QCQA 4BDEA 4IE9A 4WBBB 3RK7A 1Q61A 3N4UA 4AT3A 1X8BA 3JPVA 4YJPA 3VS4A 4AACA 2Z7RA 4CT1A 3TZMA 1PKDA 3TWJA 2PK9A 3WZKA 2VWUA 1REJA 3WZEA 2BUJA 2O5KA 1OL5A 3E3PA 4DN5A 4Y72A 5D12A 5J1WA 3VF8A 3IGOA 4JT3A 1KV1A 4FTAA 3FHRA 4PV0A 1DM2A 2G15A 2V62A 1Y8YA 2C0OA 3I7BA 3AC8A 4J96A 1PW2A 3MJ2A 4G2FA 4DGLC 4WSQA 4DEBA 3VS7A 4QMMA 4AF3A 5AAEA 2OJGA 4MCVA 3GC8A 5JFWA 4RIYB 4RGJA 5HNBA 4PDSA 1E9HA 5T68A 4DEHA 2Z60A 3AMAA 4JJRA 4EH2A 4ZS0A 4AZFA 3DJ7A 4KBCA 4BGGA 4BI0A 4EOOA 1TKIA 2OXXA 3O8UA 3HLLA 1ZY4A 5LMKC 4IANA 4OTGA 3NUUA 1OITA 1P14A 4NM5A 5HO6A 5IQCA 3HMPA 3PRFA 3OS3A 3ULZA 4IACA 1OPLA 4ANSA 5AP2A 5K9IA 2EVAA 4G5PA 4HPTE 2W99B 4BCFA 2Z7SA 1F3MC 5J79A 4D2SA 4C36A 4YZMA 4MD9E 5J5TA 3QTWA 4C02A 5E91A 4LM5A 3DLZA 4MEDA 3E63A 3LOKA 3FJQE 3VUKA 1CM8A 4E6DA 2XK7A 3QQJA 5TT7A 1K2PA 4UN0C 4Z7HA 5ACKA 5JH6A 3CCNA 3NNVA 4I1ZA 4JBPA 4U42A 2VTAA 3R01A 5HHWA 4R1YA 3KN6A 3C0HA 4F6UA 5IEXA 4TYHB 4EZ7A 2V22A 3ZRLA 3I0OA 2XVDA 3Q60A 2X2LA 1OBDA 2P55A 3IDBA 2YEXA 1YWVA 3D7TB 3A4PA 2CCHA 3VQUA 4FVRA 4F70A 3C4EA 4LMNA 4TYEA 5AA8A 4IC7A 2WNTA 3O7LB 5JGDA 3FE3A 4FV4A 4QYHA 2KULA 3FC1X 5M51A 4U44A 4CRSA 4PMPA 3EQDA 5IF1A 5DYJA 5DRDA 3SGCA 2F7XE 4BBEA 5G1XA 4AZTA 3UYTA 3REPA 4HYUA 1ZXEA 4BCNA 2XK3A 2H8HA 2PHKA 3OG7A 4U40A 3ZUUA 2GMXA 3DDPA 3NNUA 4DYMA 1OL2A 2YLEA 3QZGA 4E93A 4BYJA 1OVEA 3ZSHA 3MFRA 5M4FA 1ZRZA 2IZSA 3U55A 5AV1A 3WI6A 3ORZA 4IAIA 3WF8A 4U3ZA 3O96A 1OPJA 1XH4A 4R5SA 2OBJA 5FXQA 4AN2A 2C47A 3D15A 3EN5A 4M8TA 1B38A 3G0EA 2H9VA 3SKCA 3DQXA 2YCSA 4BICA 3LIJA 4ORKA 3A8WA 5JZNA 4IWPA 4DAWA 4ZY6A 4EBWA 3DXNA 2OGVA 4G6NA 5A9UA 5F9EA 4W4YA 4FTQA 3LQ3A 4ZY4A 5BYLA 3H0YA 3W18A 4A07A 4KBAA 3LAUA 3TNHA 2BRMA 1KOBA 5FWKK 3KGAA 2QOLA 4ENYA 5L2WA 3OROA 3NW7A 3TXOA 5JT2A 1XH7A 2VTMA 1IR3A 3AOXA 4Y5HA 5BMMA 1ATPE 4CD0A 3WF7A 4EOPA 4ZLYA 3R8PA 3SAYA 2BKZA 2C1AA 5IU2A 3Q4CA 2PVKA 2CN8A 4YTIA 3DAEA 5IUHA 1BKXA 3FLQA 4QMTA 1M2QA 3FUPA 3QXOA 3PP0A 4O2PA 2NP8A 1XBBA 4ZSEA 5IEVA 4HVHA 3S2PA 1SZMA 4IIRA 4O91A 4UYAA 4FG7A 3BYMA 3RJCA 3SLSA 4F1OA 1LP4A 3F6XA 3KRRA 4FTUA 4ZTSA 3PY1A 3FZOA 4XBRA 4EH6A 3UIUA 1NXKA 2XNEA 2YJRA 2UZNA 3JY0A 4UMPA 4XV2A 4O6EA 3S4QA 1Z5MA 4J99A 1BL6A 4L43A 4U5JA 4AGDA 4Z16A 3NVMB 3GC0A 2E2BA 3R1QA 2XK4A 3FI4A 5CTPA 2CMWA 5F4NA 4XOYA 4QMZA 4UZHA 3QX4A 5HD7A 5KCVA 1ZMWA 3MA6A 1U5QA 4BCIA 3PIZA 4JAIA 4UYNA 4TL0A 1ZMVA 1JQHA 1R3CA 3ZXTA 1M14A 1WVYA 3R2BA 3UBDA 2B4SB 4A4XA 2IWIA 2A1AB 3FXXA 3CQEA 4M67A 4PX6A 3R83A 2JD5A 2WEIA 3AD6A 4I93A 4QPMA 4X21A 3RALA 3ZEWA 3SVVA 2JKMA 3KMUA 4O21A 4EUTA 3GENA 1P2AA 3E7VA 2VU3A 4F7LA 3TN8A 4EQUA 2YIRA 4I3ZA 3FMJA 4X0MA 4M0ZA 4YZDA 3M42A 3BE9A 1XH5A 3PYYA 5DLSA 3VBTA 3NR9A 2F4JA 1Z9XA 3ZMMA 3F2AA 4HOKA 1R78A 2X6EA 4ZTHA 5C9CA 3OEFX 4NCTA 3QRJA 2X6DA 4JQEA 2CLQA 1M17A 3KC3A 4WG3A 5EHLA 3MESA 3TNWA 3RNIA 3OP5A 3MI9A 4I6QA 5AR7A 3LQ5A 3MTLA 2WAJA 2ZV2A 4JNWA 2W1IA 2OW3A 3GQLA 3NIZA 4ANLA 1H1RA 3COKA 2I40A 3EYHA 4FR4A 5GZ8A 2PZIA 4RIWA 5AM7A 1R0EA 2GPHA 4EHGA 4M3QA 4KD1A 3WYYA 4BY9E 1JSTA 2XCHA 3F3ZA 5M55A 2WGJA 5M09A 2P33A 1KSWA 4LRMA 4USFA 4FKVA 3C5IA 3A62A 3UVPA 5KO1A 1E1XA 2W17A 2FSTX 4YU2A 1PXPA 4X2KA 1OIYA 4G3GA 3THBA 4QYEA 4H1MA 3RKBA 3RTPA 1BUHA 2B55A 5DT3A 3E8CA 4I6BA 4LV8A 3SW7A 3QD2B 4QRCA 4DFXE 4MKCA 3ZONA 3HMMA 4ZMFA 3A7GA 3OZ6A 3QQGA 2NRYA 1P4OA 2X2KA 3HVCA 5EYCA 5HO8A 4GV1A 3CD8A 3K3JA 4V05A 3RBWA 3MFSA 3K5UA 3FQSA 2VTLA 3FZ1A 5H2UA 4DFYA 4DG2E 4ALVA 5C4KA 4JXFA 4E4NA 4ZSJA 1ZAOA 2W9FB 4PL4A 3GFWA 5BVDA 3KB7A 3EMGA 5IMXA 4AZSA 3GXLA 3CQWA 3KEXA 3UNKA 2PVNA 5IKWA 3HDMA 5A4TA 4NM7A 3V8SA 1PJKA 2EUFB 2PU8A 4DFBA 3WOWA 5KZ0A 5I9ZA 3RWPA 3CP9A 2BRGA 4IB1A 4JOAA 4PWNA 4YBJA 4U41A 5HBEA 5HO7A 1ZYCA 4Y73A 1SMHA 2UZTA 2JITA 2VUWA 4J8NA 4RQKA 5AX3A 4PNKA 5A4CA 4W8EA 3U54A 4YHJA 5CX9A 5IG1A 4YC3A 4C2WA 2VN9A 3C4XA 5AAGA 2OJIA 3GNIB 3TT0A 1M52A 3LXKA 4BKZA 5EQYA 4ANMA 2FA2A 3MFUA 3QC4A 5HORA 1PXNA 2WQOA 5ETAA 3Q53A 4ACCA 2X4FA 3RK5A 5J5SA 3PJ2A 5IQAA 1BX6A 3D7ZA 5IUGA 1G3NA 1FMKA 4FGBA 4AP7A 4BDBA 5CF8A 2BKKA 4XMOA 4AW1A 2F7EE 2OZAA 4NM0A 2VWIA 4L53A 4BTJA 4G17A 3VS3A 4Q9SA 4IDTA 3LJ0A 2ITVA 2FO0A 3EL7A 4FG8A 4QMOA 3H0ZA 4TWCA 2UW3A 3BQCA 5HICA 2ZM4A 4IAKA 5EQEA 2HW6A 2XM8A 5IH5A 5C8NA 3QF9A 3PWYA 4QP9A 4B99A 2CJMA 5AUXA 4BWXA 3TKIA 4IBMA 4RC2A 3DK3A 4EJNA 4DG0E 5JQ5A 1B6CB 4H1JA 3HV6A 2HYYA 3RK9A 4O81A 1LEWA 3HL7A 4NTSA 2OFUA 3LXPA 3TEIA 5T6KA 5HTCA 4ASDA 1GZ8A 5HG8A 4MVFA 5TR6A 4D1SA 4D2PA 3RM6A 4YURA 5CT7A 2ITWA 5LMBA 2ZV8A 3U6HA 3OEZA 3KN5A 2VWZA 2R3KA 1WCCA 4IZ5A 3IW7A 4RWIA 4EK4A 5LJJA 3UO5A 4CVAA 2WMVA 3R7UA 2LGCA 3NYNA 3KXZA 4BI1A 5KMOA 2IW9A 3PA5A 3OUNB 2IZTA 3U6IA 5IA5A 2XF0A 3SXRA 3LFCA 2C6TA 1H1SA 3Q4TA 4H3QA 3UIBA 3VHKA 3U51A 2BZJA 3EQFA 4X2JA 3SV0A 4CSVA 3BELA 3ORXA 3E7OA 4IB3A 1NVRA 3KXNA 2Z7LA 3OWKA 4Y8DA 4C2VA 3WF9A 3R73A 2I7QA 4CMOA 3BLQA 5CAUA 2VTIA 4XRLA 4DT9A 3A99A 5EOLA 2CN5A 3KMWA 5EW3A 2UZDA 1UNLA 4FSQA 1CKIA 2IJMA 4D2WA 5I9XA 4EHVA 2WMRA 3OHTA 4IHPA 4MXYA 5CNNA 4KB8A 3MVJA 5EKNA 3TDWA 4UWYA 1H27A 4BKYA 3UOKA 2FSOX 5HZNA 4PPAA 5CANA 3LFAA 2WMTA 3FZRA 4ANNA 1SNUA 2WB8A 2CNQA 1KE9A 1Q8ZA 3V01A 1R0PA 4C4EA 5HESA 3CJFA 3I7CA 2BFXA 3TL8A 4E4MA 4C33A 2W1FA 4JG8A 3G90X 3L1SA 4ANOA 4FV0A 3C13A 5CVGA 4H36A 4K0YA 3FXWA 5FTGA 4PNIA 1XQZA 4UV0A 3VBXA 3F2NA 4OGRA 1XBCA 4BRXA 2J0JA 3CD3A 3PP1A 4NT4A 4UBAA 2GSFA 1OKYA 2R4BA 4AN9A 2GHLA 2W05A 2WFYA 4IXPA 1YI4A 3FMEA 3UC3A 5L2IA 3RZBA 2GNIA 3HP2A 1M7QA 4ITJA 3P23A 2YIWA 1GIHA 2WOUA 4L3PA 2PVFA 2XIZA 2I0VA 3TG1A 3QWJA 4FTNA 3Q5ZA 5TOZA 1HCLA 3ZC6A 2Z2WA 4IM0A 4M14A 2ITTA 2PTKA 3W2RA 3QTZA 5KMLA 4FTOA 5E7RA 3DZQA 3UO6A 2IVTA 5LVPA 4HCTA 5K5XA 4BTMA 4XCUA 3P7BA 4EWHA 3R8MA 1URCA 2GCDA 4EK5A 2C6KA 3SOAA 4LL5A 3NUSA 2XM9A 4E4XA 4E5AX 3W32A 3UO4A 3UOJA 4XG8A 3VN9A 3IW8A 3PJ8A 3CXWA 1PYEA 4FTJA 3E88A 3EN7A 1SVGA 3F5UA 2C6OA 1J1CA 2Y0AA 4FEQA 4B9DA 4CQGA 1ZY5A 3R2YA 2R9SA 4FV6A 3V5PA 4OBQA 4WNKA 5BPYA 4UY9A 4OBPA 4C8BA 3FYJX 2OIBA 2YAAA 4G3EA 2QG5A 2GQRA 4WG4A 3RHXA 3GP0A 3ROYA 3QC9A 2W5AA 2UW6A 4O1PA 5ETCA 4DTKA 1APME 5FXSA 4CCUA 2G9XA 5BX0A 5T3QA 3AD4A 4U8ZA 1OKWA 2DUVA 3PA4A 4EZ5A 4LRKA 2OZOA 2VO6A 2XJ2A 4NJ3A 4GK3A 3V5QA 1UU9A 4DTBA 3DZOA 3GCSA 4WD5A 4XV3A 5FDXA 3SW4A 4ZSAA 4FYOA 3FMKA 2PUIA 3CPCA 3QRTA 4ZAUA 5GIOE 3VO3A 4DH5A 4LFIA 2IN6A 3QKMA 4E1ZA 5JFVA 2YHVA 4D5HA 4C34A 2F7ZE 3R04A 2GU8A 3PFQA 2XK8A 4G3DA 4JX3A 4V0GB 1WAKA 2R3MA 3L9MA 4LMUA 3WF6A 1TVOA 1XH9A 2WEVA 2QU5A 3KXMA 2ZDUA 3ALOA 3VS0A 3ZLWA 4YC6A 3OWPA 3QRUA 1JKSA 3HV5A 4FT7A 2VTJA 5IQGA 5GNKA 1PY5A 4O82A 3TV6A 2XMYA 2SRCA 4WNMA 5AM6A 2ZVAA 3KFAA 3KVXA 5K3YA 4ARKA 4C4GA 1F5QA 4DCEA 5DOSA 3HMNA 1IAHA 3BWJA 4FSNA 5ANJA 2Y4IB 3S0OA 3O71A 3Q32A 4MHAA 3SQQA 3VUTA 3B2TA 4C38A 4QTCA 4F09A 4CGAA 3DKFA 4K1BA 4RX8A 3QTSA 1J3HA 4A4OA 4YJRA 3GCUA 3OWJA 4FK6A 4AT5A 4Y5QA 4D2TA 1M2RA 4JBVA 3RCDA 4CV9A 3A7FA 5M53A 2QHNA 4BDAA 4BHZA 5KHXA 2XP2A 2PMIA 4FUYA 4PDPA 5CYIA 4B8LA 2PWLA 5ICPA 3HA8A 3I4BA 4OR5A 5CU3A 4MNFA 3FHIA 1FPUA 4NEUA 2WZJA 3OW4A 4RVKA 2WMBA 5KNJA 2XNNA 3HYHA 2HW7A 4ASZA 4GFOA 4BYIA 3O50A 2IW8A 3D83A 3BCEA 3AT3A 3KULA 3UVQA 3O8TA 2RSVA 4EEVA 4FOBA 5EM7A 5AP1A 4BIDA 1PKGA 4F99A 4RJ5A 5AV3A 5BVNA 2J9MA 1U5RA 2CGVA 5KMIA 4KIKB 3ZO1A 4GT4A 4QP6A 3PSDA 1Q3DA 4AQCA 4ZTLA 3UPZA 1ZYSA 4FV3A 2XB7A 3OWLA 5BVWA 3MTFA 1YDSE 2HY81 2YM4A 3COMA 2HZNA 4IFGA 4RJ8A 3PVUA 3BLRA 5LOHA 2YDKA 2ZV7A 4JIKA 4BDGA 4F7SA 1WBNA 5HD4A 3EOCA 1KUTA 4NIFB 3FL4A 4P7EA 3MY0A 4AWIA 4UMRA 3MVMA 3OCBA 4UWCA 4GU6A 4BIEA 4EH5A 3VUMA 3ENMA 4U79A 3BGQA 4NW6A 4AW5A 3D14A 2UZVA 1ERKA 2VWXA 5EDPA 3LM5A 3D9VA 4HZRA 4RA4A 5FG8A 3V3VA 5AV2A 4ANBA 4O2ZA 3RP9A 4KKGA 5CWZA 4BN1A 3QA8A 4F9YA 4O0UA 5IQHA 2ITQA 1RJBA 4EC9A 5CSWA 2BZKB 3Q4ZA 3L9PA 3II5A 5HCZA 2R3OA 3GOKA 4ACGA 4CTBA 4GW8A 5M08A 3GU6A 3P78A 4I0SA 4KABA 2JDTA 4DEAA 5EG3A 4O1OA 4PDYA 1TQIA 4Y95A 4AGCA 3NLBA 2XK9A 3HV3A 4ACMA 4G31A 2PVRA 4IVDA 1XJDA 4YJUA 4IX5A 4EYMA 4YTFA 2QI8A 3TACA 1NY3A 2WMSA 4S2ZA 2ONLA 3FEGA 1LR4A 5EYDA 2X9EA 3NNWA 3EQGA 4U45A 5I9UA 5CZHA 3DK7A 4IAFA 4CMUA 4YBKA 3A60A 4MQ1A
chains in the Genus database with same CATH superfamily
3KVWA 3EFWA 3G2FA 5EH0A 1PYXA 4D1ZA 4DGGA 4DH1A 4EORA 4KINA 4X3FA 3MJ1A 3EKKA 2HK5A 4BBFA 4BJJB 1V0BA 1OL6A 3W1FA 1OGYA 2QU6A 3ZFXA 4A9TA 3D2KA 4FIHA 5AR3A 3Q3BA 5D9HA 1VEBA 4RZWA 3IW4A 3TNQB 3ERKA 3I0QA 3PY3A 4O7ZA 3QFVA 2VV9A 5L6OA 4O7YA 3ZRMA 2WMUA 4O0SA 2BVAA 3GI3A 3ZO4A 4BDCA 4Z55A 4J1RA 3TI1A 5E4HA 3SRVA 3BPRA 3FL5A 3UC4A 5AUTA 3UDZA 2QODA 4RSSA 5AUVA 3A4OX 4AW0A 4QP8A 5ANIA 5CVFA 4L9IA 2JDSA 4GMYA 3IS5A 4O0VA 4II5A 4ZP5A 3CQUA 2C5YA 4FT0A 4XEYA 2WMWA 3ZLXA 4FSRA 4TNBA 3JR1A 3F61A 2OXYA 3RMFA 4ZTNA 4A9SA 4D0XA 3AMYA 3PJ3A 2BDWA 4GCJA 2JEDA 3CE3A 4LOPA 1W2CA 4WNOA 2BTSA 2XARA 5DEYA 2CKEA 3QKLA 4LOQA 4ZSGA 2NRUA 4IVAA 4CMTA 1NW1A 3VIDA 2PL0A 1OM1A 2CGXA 3M1SA 3DTWA 3NUPA 4AG8A 5HKMA 3F3WA 3LLTA 2YM7A 5L2QA 2PSQA 2PUNA 3M2WA 2R2PA 5IUIA 4BDKA 4O83A 3F5PA 4EYJA 4P2KA 2B52A 4P90A 3ZU7A 3TTIA 3S95A 4QYYA 3ZH8A 3O8PA 4BDIA 2YIXA 3POZA 5EFQA 2NNWB 2QNJA 3KK8A 4PP7A 2AQXA 3NIEA 4FZ6A 3NRMA 4BKJA 2VWYA 3LKMA 2RGPA 5HEZA 4B7TA 1WZYA 4PY1A 4FKSA 3VUIA 4XH6A 4R1VA 4ENXA 5KMNA 4FBXA 3W8LA 1LEZA 1VZOA 3W8QA 4QP4A 3ZFMA 1XBAA 4L45A 4M84A 4FKUA 3HZTA 4CG8A 2HWPA 4IVBA 3FMLA 1WBTA 5DR9A 3BHUA 4TXCA 2ITOA 2X8EA 3UMWA 3QZHA 1O6KA 5C8KA 4BDDA 3DLSA 2XRUA 1WBVA 3F5GA 5IH6A 1H1PA 4AZEA 3Q9YA 4CFNA 5AADA 2BAKA 1AD5A 3ULIA 1W2FA 2VGPA 2Y9QA 3NCZA 2H6DA 4IVCA 1WMKA 3NW5A 3EQPA 5A46A 5JKGA 4FTLA 4DF3A 3JYAA 3QLGA 4I0TA 2R0IA 1GIIA 4QP1A 3ENHA 3FY2A 3L8SA 4AXAA 2G1TA 4QMVA 1GZNA 4RLKA 1IASA 5DFPA 1GIJA 2PVYA 3CTJA 1I09A 1YHVA 4MF0A 4YLKA 3RGFA 2UW0A 2R3JA 4BZOA 2WD1A 4YTCA 2ITXA 1U54A 3PXFA 4FODA 4GS6A 1UU8A 3R71A 2B9HA 3BIZA 2J4ZA 3LMIA 4GKHA 4IM3A 4K33A 3DTCA 1H07A 5BVFA 3W0PA 4FF8A 2IZUA 4G3CA 3NCGA 4FNYA 3V5WA 5EDQA 4DFNA 5DT0A 4CZUA 3B2WA 4EC8A 3G6HA 5CEPA 1SVEA 3HMOA 3V04A 4KBKA 3NUYA 1L8TA 1OPKA 2P3GX 4TYHA 5DHJA 5IQEA 4G34A 3TM0A 4I21A 2BIYA 5DR2A 3UZPA 3ATSA 1DI8A 1YOMA 1ZWSA 5C27A 4D58A 4FL2A 3LFNA 4JS8A 4OLIA 5CENA 2HELA 2LAVA 4P4CA 2JLDA 4NZWB 2C6EA 5A6NA 5CLPA 2P0CA 4H3PA 4RJ3A 5BUIA 4LOOA 5HX6A 2FSMX 3DBQA 4FSMA 4M13A 3U8WA 5EDRA 3EQCA 4RA5A 4FZ7A 3GCPA 3PG3A 3SOCA 4JG6A 2GS6A 2QOHA 3E5AA 3LM0A 4HNIA 1IAJA 4A4LA 3UTOA 5ETIA 5I0BA 3OF0A 3ORMA 2CGWA 5FUTA 4U81A 5ETFA 4DCAA 4L00A 1P4FA 4NUSA 2IZRA 3QUPA 2YABA 2YCQA 3DV3A 3EQIA 2XNBA 4GSBA 3TCPA 3CY3A 2ITNA 3R1NA 5CY3A 5M44A 5L3AA 3HAVA 2X0PA 4DINA 2WELA 5FD2A 3MPMA 2OJ9A 1R1WA 2A0CX 3LW0A 3DDQA 1OIRA 5D10A 5F20A 1YXVA 4BCGA 4EH3A 2ZOQA 3KQ7A 3P0MA 3UOHA 3QD4A 4F0IA 3QYZA 4OTDA 4CFMA 2JC6A 3VHEA 4BCMA 2XIKA 3BU6A 1Q99A 3GBZA 4HZSA 5D41A 5IMEA 1KOAA 1KV2A 3BI6A 3EB0A 4X2NA 5AIKA 5KX8A 2XIXA 4YNEA 1WVWA 2C5NA 3I60A 3R1YA 4WBOA 2R3FA 2Y7JA 2NO3A 2BROA 3ATTA 4E20A 5HBHA 5HG5A 1UVRA 4JAJA 5C4LA 2C3KA 1PXJA 3TKHA 4JG7A 4PP9A 4YJVA 5I9VA 3QALE 3CY2A 4CFWA 4Q2AA 3FLZA 1JLUE 1CTPE 1YHSA 2VD5A 3C4WA 3PJCA 2W1HA 5CS6A 5HLPA 5HQ0A 4MYGA 3HEGA 4RX7A 3FQHA 1J7IA 2WPAA 2IVSA 5AV4A 1HCKA 5A4LA 3EN6A 5KBQA 3C5UA 4MXXA 1K3AA 3RM7A 3ZYAA 1H26A 2UZWE 3MIYA 5FXRA 2YM5A 2GDOA 4MXCA 4JBOA 3WIGA 4BFMA 1QPJA 3QGYA 4ZJVA 2J90A 4J97A 4MAOA 1HOWA 4YJTA 5B7VA 1ZLTA 5HG7A 4F9CA 4NTTA 4RWJA 4RVTA 4UZDA 4GEOA 4V01A 4H3BA 1WBPA 1XH8A 2O64A 3D4QA 4RT7A 5HCYA 3ZBXA 3CKXA 3KF4A 4BTFA 4CT2A 4N70A 2YERA 4X3JA 3P5KA 4O0RA 3NZ0A 4A9UA 3EFKA 3OTUA 3PLAE 4OAUC 5CQUA 3UNJA 5AV0A 5IQIA 1JOWB 4QMXA 3DAKA 4FMQA 4O7RA 3SHEA 4PL5A 3OTVA 2R3IA 3RCJA 4UX9A 4MTAA 1DS5A 5K5NA 5BVEA 3U4UA 2XNGA 1OMWA 3BV3A 3DBFA 4C58A 5C26A 5EYMA 2VX1A 3FY0A 2IVVA 4IJ9A 5EHOA 2C6MA 1G8AA 2RG5A 3IDCA 5EW9A 4FSZA 5HLWA 3RPYA 1VLRA 1TQPA 4GVJA 3AT4A 3FPMA 5EM6A 3I81A 2B9FA 5F94A 3OT3A 5AEPA 3AGLA 4RJ4A 3UDSA 4OTPA 4XG6A 3U9NA 3NNXA 1H01A 3FI8A 3O23A 1YWRA 2W1CA 3AG9A 5CI6A 4I4EA 4IWDA 4L01A 3MN3A 3MSSA 4MD7E 3V8TA 3SG8A 3HRFA 1H0VA 1GNGA 2WQNA 3F3UA 4HYIA 4R8QA 2CPKE 5DNRA 1PMUA 5AJQA 4FV2A 4FV7A 3KU2A 2VX0A 3LVPA 3R02A 4QYFA 1W98A 4PPCA 3W2OA 1GAGA 3UIMA 2QO9A 3TDVA 2JGZA 3CS9A 4AN3A 4RIXB 4HCUA 4DLIA 4GFMA 2J0LA 2P4IA 4CTCA 4MNEA 1JSVA 1W82A 3V5LA 4C57A 5FGKA 3AGMA 4EH9A 2BAJA 3BX5A 4KIOA 3PZEA 2Y4PA 3Q4UA 2BALA 3ALNA 5CU2A 3VS6A 3MB7A 1QPDA 2BDJA 4JR3A 4AZVA 3EYGA 3JS2A 4A9RA 3DPKA 4GG5A 4WUNA 4ZLZA 4OT6A 4CFVA 4DG3E 4O7LA 4R77A 1KE7A 4PMMA 4R5YA 4OTQA 2C4GA 3F7WA 5E8SA 3ZTXA 4YO4A 3DXPA 4NKAA 3NS9A 3KL8A 4K77A 5D7AA 5ANOA 4BCJA 2YAKA 2QONA 5FEQA 2CKQA 4M68A 4I0RA 1PXMA 2J0MB 5KZIA 5CNOA 5FEEA 4QP7A 4MH7A 2ZJWA 1ZYJA 4FV8A 4L6QA 4LUEA 4RIWB 4DEEA 2PZYA 5HGIA 4M97A 1AGWA 2B0QA 4R6VA 1SNXA 4F1MA 2R0UA 2UW5A 4D4SA 3GGFA 5JN2A 2J50A 4FKQA 4FT9A 5HE2A 2W1EA 2Z7QA 2B54A 2JIIA 2O63A 3Q9WA 4K18A 1J7LA 3JXWA 3OW3A 5LMAA 4YZ9A 3E3BX 1UA2A 1OL7A 3MY1A 4F0FA 3TUDA 4YGAA 4OT5A 3RNYA 5AP5A 4Y85A 2QG7A 4DDIA 3OY3A 4J7BA 3ORKA 4E6AA 4FKLA 4QMUA 3I5NA 5J9YA 2X8IA 3ZLYA 3C0GA 2VTHA 4AXFA 4BB4A 4OAVB 3T9IA 3GC9A 1P5EA 2XNOA 2Q0NA 4GT5A 5HTBA 2V5QA 2O8YA 2A2AA 3CEKA 3FZTA 3V5JA 2PZ5A 3DOGA 4GJ3A 3R1SA 4XP0A 2YDJA 4D9UA 4C3RA 5L2SA 4E73A 4QD6A 4FA2A 2J7TA 2YJSA 4O0WA 3VW8A 5HVKA 4U3YA 2YACA 3FLNC 4MK0A 4LV5A 4XX9A 3OD6X 3LZBA 4K6ZA 4ASEA 5J9ZA 1V0OA 4D1XA 4FIIA 4M15A 4QDVA 4AXEA 1JBPE 1FVTA 4GK2A 3BL7A 1MP8A 2W4KA 3AC5A 3AKLA 3FAAA 4YJNA 3VWAA 4D4VA 3A61A 5JK3A 3LPBA 2CKOA 3HV7A 1UU3A 5DIAA 2GHMA 3CTHA 4FG9A 5EKOA 4CEGA 5JMSA 3E8NA 2JBPA 4MX9A 2FGIA 1Q8YA 4EKLA 3BHTA 2ESMA 3OXZA 3WZJA 1Z57A 4DBNA 4J95A 2XIRA 4RG0A 3CKWA 2UW9A 4BC6A 1OKVA 3PUFC 3ODYX 2QOBA 3Q04A 4CG9A 3POOA 1JWHA 3GFEA 4JX7A 3VQHA 1NA7A 2V55A 3CIKA 2XS0A 3DJ6A 3N9XA 4I5MA 2C5OA 4JVGA 4BIBA 4C4IA 2IPXA 2FYSA 3CR0A 2OZAB 5JRQA 1Y8GA 3DNEA 4LQMA 2VO3A 3L8VA 1U4DA 1XHAA 3HV4A 4FL3A 4NJDA 3QHRA 1CSNA 5DVRA 1YWNA 3TJDA 4ACHA 4F9AA 4USDA 5BVKA 4JBQA 3VC4A 4LGDA 4Y83A 5KUPA 5FBNC 5L4QA 5BUJA 3UZTA 2J0KA 1UV5A 3PXKA 5HE3A 4DC2A 2CNVA 2VTSA 3PRIA 4NYEA 2RKUA 3E64A 3LCDA 4EOMA 5FM2A 1XH6A 4Y46A 3NMUF 2Q0BA 4JLCA 3P1AA 4HVIA 3EQRA 3OUKA 4BWKA 2VAGA 3LCKA 4C37A 4K8AA 3TUBA 5J87A 1A9UA 4KNBA 3QAME 4OTRA 4FE2A 2FB8A 2WQMA 4O4DA 4E4LA 4L3JA 1RW8A 2GS7A 4N6ZA 3DXQA 5IEYA 4HGSA 4FEVA 4ACDA 4E5BA 2XBJA 3C1XA 3MYGA 4XG9A 5CSVA 4TYIA 5KBRA 5BV3A 2WOTA 5TE0A 3EJ1A 4ZZOA 4K11A 2J51A 5C8MA 3R7OA 3SD0A 4IX3A 3FQEA 5BNJA 3PPZA 5HVJA 4XHKB 3WARA 2HIWA 4U6RA 4QMSA 3SXFA 2EXMA 2GFSA 2ITYA 5AUWA 2OK1A 1ZOHA 4TY1A 4ZZMA 1XR1A 3MB6A 3CC6A 2A27A 3QCSA 4WUAA 3FKLA 4YJOA 3DFCB 1KWPA 2PUPA 2X2MA 4FIJA 4YSMA 5K0KA 5BUEA 3UQCA 4BGHA 5KMKA 3PTGA 2XKFA 5J1VA 1MUOA 4Q5EA 1GJOA 2WTDA 3DCVA 5ANKA 2AEGA 1T45A 5LARA 5BQ0A 1GZKA 4BCQA 3BYSA 4P5ZA 5FBOA 5GJDA 2CGUA 2XIYA 1REKA 4O27B 4QMPA 4I4FA 5DRBA 3O2MA 2OSCA 1QCFA 2XALA 4V04A 3PE2A 4NCTC 2OKRA 2W1GA 3D94A 1YXSA 2XCKA 1YQJA 5E1SA 2X7FA 5ANGA 5JZJA 3W2QA 2OU7A 4DFUA 3T8OA 4ZMEA 4D0WA 1S9IA 3NEWA 2OG8A 2R7BA 3AQVA 3BBTB 3PDTA 2VWVA 3EZVA 4NKSA 5CU4A 2VTNA 4R3RA 4OTHA 5M06A 3R7GA 4KRDA 3QD3A 4QMWA 2YCRA 1UU7A 2YISA 3NPCA 1PXLA 4PRJA 5EYKA 4IWOA 1YXUA 3VS5A 3DB6A 4QMYA 4H39A 4BCOA 3MGYA 4C4JA 3GU4A 1W83A 4JI9A 4GIIA 3LCSA 4AU8A 1FGIA 1AQ1A 3O17A 4IW0A 3C4ZA 4L3LA 4FGRA 1YRPA 4MQ2A 4L7FA 4C0TA 2R3QA 4DGOA 4YJSA 4YZNA 3SC1A 4RX5A 3KCFA 1PXKA 4J8MA 2HCKA 4M7IA 3DA6A 4V0GA 3TZ8A 5M57A 1GZOA 1Y6AA 4JL9A 4U80A 3P7CA 1ZYDA 4EOIA 2OJJA 3P7AA 4C4FA 3K2LA 5I3OA 3TV4A 4E3CA 4E7WA 3KMMA 2QURA 4EOSA 1YVJA 3BLHA 3FSKA 1PXIA 3OFMA 2JDRA 2GTNA 3CGOA 4X2FA 3ACKA 3V6SA 4KWPA 2QOFA 2YN8A 1W84A 3NX8A 2A98A 4AFEA 3JVSA 3BGZA 3QZIA 2RFNA 3ZDIA 3BQRA 1ZZLA 5HI2A 3MS9A 5DE2A 5AP4A 1K9AA 5HIBA 3BYUA 5DH3A 2HWOA 1PF8A 2JFMA 3NYOA 5AAFA 2V0DA 3UQFA 2X1NA 2F2UA 1MRYA 4FZFB 4K9YA 2YIYA 4WSYA 2ZM1A 3RVGA 4WIHA 4BDJA 3AC3A 4CKIA 2ZB0A 2O3PA 3HMIA 5EQPA 4FUXA 3W2SA 1IA9A 4N6YA 3N51A 5HCXA 1OKZA 1WBOA 4I20A 3EN4A 3F5XA 4YZCA 2ETMA 2C6LA 3QUEA 3F82A 2YM8A 3M11A 3F69A 1VJYA 2OF2A 2I0EA 2UW7A 4IB5A 3PJ1A 2CSNA 4E5WA 4HVDA 3VW6A 3TMOA 5EM8A 2HZ0A 4G9RA 3TIYA 4FJVA 1QPCA 2BR1A 5AWMA 3QBNA 5IQDA 1CKJA 5IDPA 4L68A 1JPAA 5CAPA 2PULA 5CEKA 3UODA 4AUAA 4JDKA 5CSHA 4GH2A 4QNAA 5E8WA 5D11A 5HNIX 5HX8A 5M56A 4I6LA 3HX4A 3ETAA 3QYWA 4FSTA 5DG5A 4AAAA 4QMNA 4M66A 3H9RA 4IC8A 5GHVA 3DKCA 4CKJA 4F64A 2QO2A 4G1WA 2ZV9A 3HP5A 3O0GA 3S00A 3UP7A 5FM3A 2OO8X 4BR3A 4D55A 1F0QA 3JY9A 3LHJA 3OC1A 4MXZA 2X0GA 5JGBA 4ZTQA 5LMKA 4FEUA 3Q52A 3FI3A 4X7QA 1OL1A 3V8WA 3BLAA 5KMMA 4G6LA 2XAMA 2YCFA 4ANQA 5CAQA 3B8RA 4M69A 4B4LA 4OTWA 4LI5A 4QPAA 2OIQA 4FIFA 1BL7A 3IPHA 4O7WA 2G2HA 3RPVA 3QGWA 4RC4A 2W5BA 1O6YA 4IX4A 5HE1A 1XKKA 5B0XA 3Q6WA 4HVSA 5HTIA 2E9NA 2QKRA 5B2LA 1V0PA 4ZK5A 1JKLA 3C7QA 3IO7A 3E87A 4RZVA 3QQLA 4HGTA 4XG3A 2QLQA 3ZSIA 4UMTA 1QMZA 2IO6A 3F88A 2R3NA 3NSZA 4ZY5A 4YLLA 1BMKA 1U59A 4LGHA 4FTCA 4YJQA 4BGQA 1BYGA 3U4WA 4AQKA 1XMLA 3BEGA 3O7LD 3RZFA 3MV5A 3KULB 4FK3A 4FSYA 2PZPA 4RJ7A 4FEXA 5AR2A 2XYNA 2ERZE 3R6XA 2GQGA 4U7ZA 3P08A 1FGKA 3DGKA 2E9VA 1OIQA 3FBVA 3WZUA 4CNHA 4HJOA 4WT6A 2C3JA 1IA8A 2AC5A 3NUXA 5LCKA 3N4TA 3ROCA 5L6WL 3UNZA 5C1QB 2BTRA 3MPTA 3PVGA 3DBCA 4QTEA 3WYXA 3QQFA 2ERKA 5CEIA 5HBJA 4ZSLA 4W4VA 3IK3A 4F6WA 4AFJA 4KS7A 4BBMA 2OFVA 4A06A 4E6CA 3MVLA 4FKGA 2YWPA 1SM2A 5IA2A 3AC1A 3QA0A 2DWBA 1OECA 2ZM3A 4GJ2A 5HVYA 4YC8A 4BCPA 1FVRA 3CJGA 4CRLA 2Q83A 4ZLOA 3AXWA 3ZFYA 4PUZA 3V51A 4MF1A 3KY2A 1CDKA 4DEDA 3FMNA 4TNDA 1ZZ2A 1XO2B 2BPMA 3BV2A 3GOPA 4B0GA 3QXPA 3R30A 2C68A 4ZXTA 3QKKA 4NW5A 3BWFA 2Z02A 3GCQA 3FMMA 3T3UA 3KF7A 4NL0A 2WMXA 2YA9A 3NAYA 5CT0A 5H8BA 3ORPA 4C3PA 4QQTA 1L3RE 1DI9A 4Q9ZA 4LRJA 4KAOA 4FL1A 2PVMA 2R3GA 4CZYB 3L9LA 4EI4A 5IA4A 3VUGA 5TF9A 3UDBA 3I1AA 3CSVA 4I24A 4KA3A 1QPEA 2RFEA 3UG1A 2JDOA 3ORIA 4TWOA 5L8JA 5GZAA 5TKDA 3F3TA 2F57A 2HXQA 2QKWB 3LJ1A 4I23A 2WIHA 3HDNA 3EFLA 2GFCA 3KXHA 1Y6BA 3QWKA 3KXXA 1URWA 3PE1A 4RBLA 4XUFA 3AC2A 4FKIA 3EWHA 3IW6A 4X3FB 5IA3A 2OH0E 5D1JA 4ZIMA 4CCBA 4EH8A 5HIDA 2KTYA 4NK9A 2FVDA 5LVNA 4W4WA 4YNOA 3N4VA 4BCKA 3EL8A 3Q96A 1WFCA 4O6LA 4BVUA 1I44A 4B6LA 4GUBA 4RJ6A 3P86A 2C3IB 4ZTMA 2XEZA 3CBLA 2PY3A 2ITUA 3NDMA 3TNPC 1U46A 5DEWA 3R21A 5FDPA 2YLFA 3P4KA 3QUDA 3SRVB 3KA0A 5JGAA 5LXMA 5A54A 3MWUA 2J2IB 2WU6A 3R8ZA 2WTIA 4BF2A 4UMUA 3QCXA 5EI2A 4FEWA 5M4CA 3ZXZA 4ERKA 4PPBA 3Q5IA 2WMQA 1UNHA 2BRBA 3PY0A 1Q62A 4F9BA 3FSFA 4E26A 2PE2A 4RIYA 4APPA 4ITIA 3VS1A 4KKEA 3ORNA 2O2UA 2E9OA 4EK6A 3LCTA 3C9WA 2F9GA 2PVHA 2ZB1A 3H4JA 4XP2A 5JEBA 5DPVA 5M4IA 4QNYA 3BBWA 2F49A 4JRVA 4F9WA 2NPQA 4ALWA 3T3VA 4JR7A 1H0WA 1S9JA 1UKHA 2AYPA 2REIA 3MBLA 3MW1A 4TYGA 5IH4A 4I6FA 4M12A 4JDJA 1KE5A 2BZHB 2J5EA 3DS6A 4FKWA 2X0OA 3MH0A 3H9FA 4HGLA 1YDTE 3R28A 3PUPA 3UIXA 2PVJA 5IQFA 4XLIA 4QMLA 2ZFYA 3IKAA 2C0TA 4JQ8A 4LGGA 1V1KA 3ZLSA 3S1HA 2HZ4A 4EUUA 4BI2A 2IEWA 3VNTA 4AW2A 4O7NA 4DTAA 1O9UA 3MDYA 2GNJA 2CHLA 4FNZA 1DAWA 3WE8A 2YZAA 3PG1A 3VUHA 2W1ZA 2C1BA 4IB0A 3NGAA 2RFSA 4D2VA 4E8AA 3UOLA 5B2MA 4F0GA 3A2CA 3D7TA 3CTQA 1G5SA 3O51A 4S34A 5E8TA 4NFMA 2UV2A 3UZRA 4WA9A 4FRFA 4CYJA 1Q8UA 3COIA 4EZ3A 4A9YA 4ZEGA 3OY1A 4QOXA 4O96A 4EHZA 2A4LA 5K4JA 3D0EA 5C03A 4RIOA 4CLJA 4R78A 3GT8A 2P2HA 3NYVA 4PTCA 4PMTA 4RWLA 3U6JA 1MRUA 3VS2A 4IX6A 3DFAA 4C7TA 1WBWA 3BGPA 4UXQA 5FP6A 3TNIA 2W1DA 3LLAA 2HENA 4I6HA 2IG7A 4X2GA 4HYSA 5G6VA 4EH4A 1U54B 2C3LA 3KRWA 4FT5A 4YSJA 3ZUTA 2BDFA 4U0IA 5IZFA 2PVLA 3BRBA 3PPJA 2VO7A 1NVQA 4MWIA 2PUUA 4S31A 2YDIA 4FKRA 3ID6C 5KHWA 2X9FA 4IQ6A 1JKKA 1YHWA 2QD9A 1PMVA 2AUHA 3PIYA 3EKNA 5CVHA 4EH7A 5AR4A 2CDZA 2UVXA 4YHTA 4ZJJA 2R3PA 2R7IA 5DWRA 4CLIA 2OI4X 3PPKA 3A8XA 3LMGA 3UGCA 5K0XA 4B8MA 4IDVA 1UWHA 3LFSA 3ZM9A 5I3RA 3FV8A 3I6WA 3RPRA 3BYVA 4PDOA 2BIKB 4C3FA 1LUFA 3QQKA 1YI3A 4IAZA 4NH1A 3BE2A 5FP5A 3R9DA 3ZS5A 5AMNA 2XH5A 4FSWA 4R7IA 3ZCLA 4DH7A 4TRLA 2XZSA 2FSLX 3SDJA 1JVPP 5AP3A 1H1QA 3D2IA 2JDVA 2C0IA 4J71A 2YITA 4FVQA 2ONLC 4KUJA 2BHHA 5CU0A 2WTCA 1OBGA 5KKRC 3RAWA 2H96A 2JIUA 2I6LA 1VR2A 3E8DA 4TN6A 4GKIA 1TQMA 1W0XC 4LYNA 4DH3A 1ZOGA 3OOGA 4FIEA 3NW6A 4N4SA 2ETKA 3IDPA 2R3LA 3EN9A 4WOVA 4IM2A 2VZ6A 2B1PA 3FXZA 3ZO3A 4X3FC 2WTWA 2WIPA 1OUYA 3H10A 5AIRA 3ZZWA 3KK9A 3HKOA 1PRYA 1Q3WA 3MFTA 5L6PA 4NWMA 5BYYA 2PYWA 3R7EA 4BDHA 3LE6A 4Z9LA 4O86A 4O7SA 4KIPA 3JUHA 4W8DA 3K54A 1Q8WA 4WO5A 3WIKA 4G3FA 1FINA 1PXOA 4HPUE 4IAAA 3TYKA 5L8KA 3W10A 4USEA 2QOCA 2G2IA 5AP6A 3COHA 3TZ7A 4HGEA 4G6OA 3GU7A 3FMDA 2W0JA 1Q24A 5AUYA 4DFLA 3F66A 1MQBA 3VF9A 4AT4A 4AA5A 2W4JA 4O4FA 5AFVA 4O0YA 4OUCA 3RAKA 4FNWA 5CSXA 4OW8A 5IISA 4IZ7A 4L52A 5BYZA 2V7AA 4IZAA 4R7HA 2R5TA 3ZDUA 4C61A 5D7VA 3G51A 2JKKA 3RPSA 2W06A 3R7VA 4YMJA 3EHAA 3GU8A 4YPDA 4RFYA 5J8IA 4D2RA 3QRKA 4GIHA 2QCSA 4NSTA 3WE4A 4J53A 5A4QA 4MD8E 4FV9A 3D5UA 1OI9A 4ONAA 2C6IA 1Q41A 3FWQA 3LXNA 3Q2MA 1M7NA 5A3XA 3UYSA 4L42A 3EZRA 4FTTA 4CKRA 5HG9A 3UQGA 3NUNA 3ITZA 1ZARA 5CU6A 3F3VA 4QQJA 4L7SA 3OCSA 4IEBA 3TZ9A 3EQHA 3ORTA 3VJOA 3W2PA 5AR5A 3FPQA 4S32A 4FNXA 2XNPA 3QTRA 4RIXA 3SXSA 4Z3VA 4PQNA 4RVMA 4OTFA 4QP3A 4C35A 4O0TA 3G33A 1ZMUA 4Z7GA 4WKQA 5CI7A 4QT1A 3FMHA 3A7JA 1PMEA 4DITA 4EQCA 3G15A 4QYGA 4YO6A 4OTIA 1IG1A 2B9IA 3H9OA 4BWPA 3IG7A 3LQ8A 4EOLA 1JNKA 2V7OA 2QR8A 5H3QA 5KE0A 3W2CA 4L44A 5I5ZA 5IQBA 4ZS4A 4GUEA 4W9WA 3P5JC 3WBLA 3OBGA 2YZLA 4G5JA 4YP8A 4QP2A 3DK6A 5AUZA 3FDNA 2UZOA 3LFFA 2OICA 4QPSA 2YIQA 4I22A 4XJ0A 3F2RA 1Y57A 3QRIA 4NM3A 4AE9A 2Y8OA 5DA3A 3U9CA 2UZUE 5CAVA 3W33A 3IECA 4FOCA 1YXTA 4XOZA 4RRVA 3H3CA 4RLLA 5H9BA 4DGNA 1YI6A 5IA1A 3CGFA 4IAYA 1QL6A 3A7HA 3GUBA 4CZTA 1BI7A 5AP0A 1YOJA 2XRWA 1Q4LA 2I0HA 5EM5A 3HUCA 4D5KA 5GJGA 3ELJA 4FTKA 3R8UA 4GT3A 3GC7A 3OBJA 1XMMA 4RMZA 3DBDA 2OH4A 2O0UA 2W7XA 4QTBA 3UJGA 2X81A 4HVGA 4IH8A 3Q2JA 4JIAA 2RIOA 2Z8CA 3NAXA 3W0RA 5EK7A 3MPAA 2YM6A 2RG6A 2BRHA 4W9XA 4QQCA 5FTOA 3K3IA 5JRSA 4EOKA 4D4YA 5ANEA 3ZRKA 3R63A 2YM3A 3D5XA 4BTKA 4EOQA 5H8EA 2YWVA 5ITAA 5AUUA 4MNEB 1FBNA 2C5VA 4FVPA 4F7NA 3OXIA 4XRJA 4AOTA 2PE1A 3GQIA 3RINA 1H8FA 3ACJA 5FQDC 4X6QC 2EXEA 4HW7A 2O65A 4ID7A 2WU7A 2Y6MA 4FICA 4ITHA