4IX5A

Crystal structure of a stt7 homolog from micromonas algae in complex with amp-pnp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
346
structure length
346
Chain Sequence
LKARGGPKTLRRTPGVEPKDIRVLPGPLGSGNFGTVFRGVFKGDQDVVLKNAKADVMAAEELLECEMDVNYHVHANAKGTCARFMGCIELGAKDGGEIYNGTLTEGLWLMWANEGENTVEALMRRGTAPLATAMACADATELGVTKKAMRELLGSLARLHECGVVHRDVKPANLIAAEKDGGVLKLIDLGAAALCLPLPETLNYYPGDGPADPRYAKADELYLLPPGSPRPTKDNAAKLWEAHKPDRFDSWSAGCVMLQLAVVGLRTDAGLERFLADYKAVGYDVNAFRGEKSGEYGTMDFAALDANGGAGWDLCQRLMEAERDARASCEAALSHAFFDAAALEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MsStt7d protein
publication title Structure of the catalytic domain of a state transition kinase homolog from Micromonas algae
pubmed doi rcsb
source organism Micromonas
molecule tags Transferase
total genus 104
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ix5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ix5A01
2LAVA 4WKQA 4BB4A 4LYNA 3D7TA 4YO4A 3GU5A 5I9UA 4PUZA 1PHKA 1B38A 2VWYA 4RC4A 5I5ZA 5FD2A 2B9JA 5CQWA 5T3QA 4OTGA 3UYSA 5IQHA 5IA1A 3OP5A 1O6LA 4X21A 3MWUA 3LCTA 3O8TA 3TG1A 5IEYA 1IEPA 2WEVA 3NGAA 5EM8A 2ETKA 4GMYA 2YIQA 3CD8A 2W1DA 4NFNA 3ZO2A 2OO8X 5IKWA 1CTPE 2OK1A 5HEZA 4BCOA 2VX1A 3BZ3A 4QNAA 3M2WA 3EHAA 4TWPA 4M13A 1IA8A 3PY0A 5BX0A 1NY3A 2HOGA 3BHHA 4RFYA 4PWNA 4TT7A 4DLIA 4QMNA 4O0XA 2XS0A 2X6DA 4D4SA 3A99A 4HNIA 5DWRA 2QCSA 3ENMA 3PIXA 1O6KA 4NIFA 1WVWA 4TN6A 3NNXA 3IPHA 3SOCA 2PMOX 4X3FB 4CGAA 3C7QA 2UUEA 3MPAA 4JAIA 1IR3A 2JIIA 3QD0A 4FV9A 3PVUA 4KD1A 4R1VA 4C4FA 3CTQA 4RVLA 4LI5A 4QTBA 4YJNA 3G2FA 4MVFA 5JKGA 3NNWA 4ANBA 4NFMA 3VO3A 3PVWA 3RNYA 3FI8A 3JYAA 5JT2A 4C38A 4DGMA 2BPMA 3KCFA 4C57A 3U6JA 5FEDA 3WILA 3IW5A 4OTDA 4BDHA 4IWPA 5IQFA 5C01A 3ZH8A 3R1YA 3LJ2A 2Z7LA 5TE0A 5LVLA 2H96A 4G6OA 1P14A 4PQNA 4C4EA 4S33A 4XJ0A 4WT6A 4JRNA 3I4BA 3VC4A 5D1JA 4GK4A 3UODA 2O0UA 4RC3A 5AR5A 3RPRA 3EQPA 4MBIA 5J1VA 4ZTNA 4GJ3A 2GNHA 3GB2A 3R7IA 4O7VA 3ORXA 4RQKA 3AC3A 4IVCA 4ACHA 3F2RA 3DTCA 5D7VA 1Y8YA 2C1BA 4FV3A 3UIBA 1NXKA 2QG7A 3VS2A 2ACXA 4Q5EA 2GTNA 4EH6A 3GCPA 4DFXE 4JBVA 3WF7A 1VZOA 1U5RA 4H3QA 4FUXA 3R7UA 2W9ZB 4C3RA 3GXLA 4AZWA 4EOPA 5J79A 2WU7A 5E8ZA 3R73A 5FG8A 2GS7A 1H0VA 4O38A 3SG8A 4CV8A 3NVKI 3ACJA 4XCUA 4X2NA 3LFSA 3OS3A 4DEAA 5K3YA 3BKBA 4RFZA 2ITNA 2A0CX 2BMCA 4L45A 4E4NA 3F5UA 2XEYA 1ATPE 5KKRB 3KEXA 3A60A 2HCKA 1T46A 4EH3A 4BKYA 1TQIA 3C0IA 4GT5A 3VUKA 5E8UA 4EOQA 4PNKA 5BYZA 3RGFA 5IZFA 1M14A 4HCVA 4M69B 2HAKA 3VUGA 4FE2A 1ND4A 4O7WA 3FJQE 5I9ZA 4WBOA 5K0KA 3PUPA 5B0XA 4C4GA 4C36A 4O7RA 3JY9A 2W1EA 2XJ2A 2PSQA 1KV1A 3QD4A 4ANMA 1O6YA 3CS9A 4R6VA 5FEEA 5GIPE 4FIFA 3C1XA 3R22A 4IFCA 4MF1A 4ASEA 4E4XA 5DNRA 4CKJA 3EZRA 5CEMA 3QQJA 4AT4A 4EH7A 1Y6AA 4BDIA 2C69A 4ID7A 5EYKA 4DT8A 2XM8A 1KOAA 1M2RA 3DBCA 3E87A 1UNHA 3U8WA 4H36A 3UIUA 2BFYA 3G6HA 4R3RA 5AR4A 4CLIA 4YUQA 2YJRA 3ZDUA 3FSKA 4K11A 4ASXA 5K5NA 1OKYA 4QMYA 3E8CA 3W2OA 2OIBA 4EH8A 2XIRA 1PXJA 3EL8A 4F1TA 4GYGA 4RX7A 4E8AA 3BCEA 4ERKA 3MH1A 4F7JA 2VWIA 4UMTA 5H3QA 3I1AA 3NS9A 4FV0A 3T3VA 4AW2A 2H6DA 1OITA 2RFNA 2IG7A 3A4OX 4YP8A 5JGBA 1YDSE 3NLBA 4X3FC 4PNIA 3C4EA 4MNFA 4ZTMA 3QKLA 3D9VA 4MXAA 2F2UA 3ZZWA 4G1WA 4JBPA 4KKEA 2WTKB 3GENA 3HNGA 4YZDA 3UVPA 4BIDA 2BAJA 4I41A 2HELA 3MPTA 1YOMA 1PXOA 5GZ9A 1RW8A 5G1XA 3KGAA 1KE5A 3E3BX 3NX8A 3OROA 4GS6A 4LM5A 4YJVA 5AJQA 2ZDTA 3QLFA 1VEBA 2R0UA 3FC1X 2JC6A 4FZFB 3OZ6A 3AC5A 4P4CA 1TKIA 4LG4A 2UW5A 2XB7A 3PIZA 5DA3A 3IK3A 2X4FA 3TNWA 5LOHA 1OIUA 3IW7A 3LQ8A 2YM7A 5HKMA 4ACDA 4FSRA 3RPSA 2VWXA 2C68A 2BTRA 1PKDA 3MFRA 4GIHA 3VQHA 1ZMVA 2CGWA 2OXYA 5IH5A 4ZP5A 2G1TA 4BTJA 1WFCA 1PXMA 4I24A 1Q3DA 4RA4A 5IISA 2X4ZA 4J53A 2PZIA 5HLWA 1QPJA 2OSCA 4ACCA 3D4QA 4EH9A 1IAJA 2GMXA 1JOWB 2QLQA 5M4IA 4UMPA 4QMOA 2BALA 2YIRA 3HEGA 2IWIA 3O8UA 3R9RA 3R7GA 2I0VA 3WF9A 1WVXA 4F65A 5DT3A 2WMVA 4TZRA 3ATTA 4D2TA 4PDYA 5M07A 2ESMA 5AAEA 4G31A 4RIWB 5AP2A 5F1ZA 5KKRC 4U45A 4JQ8A 5FTOA 3U55A 2YZAA 3S1HA 3FLWA 3F3ZA 3KMWA 3DXQA 1JSTA 5E7RA 3LJ0A 4F7LA 5KCVA 4L7SA 5BVFA 3ZZEA 1ZY5A 4IX3A 3K5UA 4KIOA 5AAGA 2C3IB 5ANEA 1V0OA 3TI1A 4WRGA 1SNUA 2PK9A 3TUCA 4FV5A 1H08A 4BWKA 3IONA 5IUHA 2KTYA 1Y57A 1W82A 2O65A 5CAOA 3K3IA 1WCCA 3W33A 3COIA 4X2GA 4U43A 3ZUTA 2FO0A 3PPKA 3B2WA 4FKRA 3CD3A 4XV2A 3NYXA 3R01A 3OG7A 3GOKA 4P5ZA 5E9EA 1HOWA 4G5PA 2GU8A 2WPAA 4ALVA 3PG3A 3VS1A 4YU2A 2UW7A 1YOLA 3O51A 4QPMA 4DFUA 2Z7SA 2C3KA 4TYHB 1YWNA 4FZDB 4C58A 3MDYA 4AZVA 1OECA 2UZDA 2CN5A 4QYYA 3EFJA 3R7YA 4E6AA 5E1SA 2XNPA 5ANKA 3TV6A 2JBOA 4PPCA 3PP0A 2XIZA 2YEXA 3FKOA 5IUIA 1H28A 1JSVA 1OKVA 4DH5A 2VWBA 5HLNA 2HWOA 3MIYA 4JRVA 2WTKC 2A27A 1XR1A 4CZTA 2C6EA 4EEVA 4G3FA 2VWZA 4KRDA 2PMNX 1H1PA 2IVVA 4XG2A 4EBWA 3LM0A 3MB6A 3SXFA 4B8LA 3BYUA 4A4XA 1FMOE 4FMQA 2B4SB 4EJ7A 3LW0A 1URCA 3F5PA 3ZCLA 2FB8A 1FOTA 1FINA 4EWHA 2BIYA 3FE3A 1GY3A 2X0GA 5HU3A 2VAGA 3EQRA 4JG7A 5IQAA 4F7SA 2W5AA 2PMLX 5AV2A 4N6ZA 2UZEA 2Z7RA 4H58A 3DKOA 4D2PA 5AP7A 4EHGA 3UVQA 2YCFA 4E4LA 3ORLA 3TZ7A 3PIYA 4QMVA 3R8UA 3VQUA 4O7NA 2R7BA 5AIKA 2PYWA 2QLUA 1OIRA 3QTWA 1URWA 5CU2A 5AV0A 2JDSA 3LXKA 3G9NA 4RX9A 2WHBA 4TW9A 2WIPA 4DBXA 3Q6UA 4A9TA 3TUDA 2PWLA 1J1CA 1H1SA 3LCOA 4IXPA 2C3LA 2IZUA 2WXVA 4P90A 3R21A 4YC3A 4ACMA 5C4LA 4CVAA 2QOOA 3EOCA 3P78A 2CN8A 2CSNA 1H1WA 3F3WA 4CMUA 4EOMA 4CFVA 3C0GA 4L9IA 2EB2A 3DPKA 2P33A 2R3MA 4CYIA 4FL3A 2YZLA 1OKZA 5HCXA 2GNLA 2PVMA 3R1SA 4KKGA 4DFNA 3CSVA 4CCUA 2PVYA 3HDNA 3R8MA 1WBVA 2BFXA 4RA5A 4XBRA 4RVTA 3TT0A 1JBPE 4IB3A 4Y73A 3E63A 5HBEA 3IG7A 5I0BA 4FV6A 4MTAA 4TL0A 3KRRA 4YZMA 4E1ZA 5M4FA 3AMYA 2A19B 3TV7A 3QQFA 4ZTSA 3E7VA 4OBQA 2C6MA 4QNYA 4AFJA 2ZV9A 3MFTA 3BX5A 3MJ1A 2QOLA 3RAIA 4L7FA 2OZAB 5LMKC 1DI8A 1QL6A 1XH9A 4YHFA 5JN2A 5F9EA 4CNHA 4GKIA 3LFQA 3VIDA 4FNZA 3F2AA 4EOJA 2XF0A 2X2LA 3Q9XA 4I0SA 3VUIA 3U54A 3DXNA 5L2IA 1WAKA 3PPZA 2W4KA 3W2SA 3TM0A 4V04A 1U54A 4DAWA 4R3PA 3IOPA 5CLPA 5H8EA 4FICA 4I6HA 2BRMA 4F9YA 3THBA 4QMZA 3VF8A 4AW0A 4EK5A 1OL5A 2XK7A 4S32A 3CY2A 3GBZA 4O27B 2J5FA 3KRXA 3PXFA 5EI2A 5IA2A 5L4QA 1M52A 3QX4A 4MBLA 2IZSA 2UZWE 3CGFA 3NUYA 3BGQA 3PJ1A 4O0WA 4K1BA 4MEDA 4O0RA 3RVGA 5CYIA 4E5AX 3C4ZA 3KF7A 4BCGA 4U6RA 5HO6A 4L8MA 2BZIB 2O2UA 4U42A 1E1VA 1YW2A 2ONLC 2PVRA 3QALE 4FIEA 4FV1A 4IAKA 2BAKA 4AWIA 4UXLA 4D1ZA 5AP6A 2XRUA 3EN9A 5IMEA 3KQ7A 2J9MA 3R2YA 4TRLA 3MA6A 2QOFA 2YABA 3AMBA 3OFMA 4KS8A 2WNTA 3L8VA 5CU3A 1QCFA 4OTRA 3WBLA 4FIHA 3R28A 3ANQA 4FT9A 3VJNA 4A9RA 3QC9A 4EOSA 2JAMA 2WZJA 5B2MA 4XP0A 3OVVA 3TEIA 3RZFA 5EDRA 1NT2A 3JS2A 2P55A 4MQ1A 4WBBB 3A62A 1BUHA 3QUDA 3ALNA 4U81A 4CV9A 4CFUA 4L68A 2ITPA 3LFNA 3FMLA 4HYUA 4DH3A 4BGHA 1JKTA 5EM6A 3AT4A 4AOIA 3OCSA 3G0FA 4IH8A 3COHA 4CMTA 2OW3A 2VNYA 2R5TA 4G16A 4QP2A 5JQ5A 4QMQA 4CKRA 2VX3A 4L6QA 2X2KA 4MXYA 2X81A 5JZNA 5M4CA 4LV5A 5F94A 4TYIA 2HY0A 1XH7A 3HDMA 2UZNA 4BCPA 1WBTA 3NIZA 3OT8A 2VTOA 4Y95A 4QMMA 2PZRA 3QHRA 3TL8A 5IH4A 4NM7A 3VUDA 5M09A 3EB0A 3KMMA 4Z9LA 2VN9A 1AD5A 3SD0A 3TV4A 3HAMA 3ZLWA 2OIQA 3DKCA 4F0FA 3ORIA 4YTFA 3QAME 1ZZ2A 1S9IA 2WQEA 5M4UA 3W32A 4XG6A 4AQCA 4CTCA 3Q52A 4JG8A 5ACBC 3E93A 5C8KA 1ZWSA 2IJMA 5C27A 5CNNA 1UNGA 1K2PA 3OXTA 2WTJA 3R2BA 3M42A 2H8HA 4FTNA 3LMGA 3FUPA 4K0YA 5HNBA 4I1ZA 1OB3A 1OBDA 2WMUA 4RBLA 4XMOA 4A07A 4D2RA 4JL9A 4BDDA 2Y0AA 5J7HA 4YTCA 4DTAA 2WTDA 5DRDA 4JX7A 3MFSA 2OJIA 2EXEA 4YR8A 4D55A 4APCA 1YHVA 4FKJA 4QQ5A 5TOZA 4BTKA 3IW4A 4DGNA 3DCVA 1MP8A 4XG7A 3Q4ZA 2XYUA 2Y7JA 4XP2A 4ZSEA 5HD4A 1GZ8A 3KKVA 4N0SA 3HV7A 3HYHA 4FODA 3VRYA 2CKPA 3GU8A 4RJ3A 2JLDA 3VN9A 5FWKK 3TNIA 5HO7A 5CEIA 2VNWA 2YIWA 5L6WL 3DK3A 3KULB 4BDJA 5A4LA 3KK8A 3N51A 3TN8A 1V0PA 3NUNA 4DGGA 4ZAUA 5KMJA 4EZ7A 3UOLA 4CG8A 1ZXEA 3W2CA 5JGDA 4FTMA 4WO5A 3R8VA 4C4HA 5J95A 2XIYA 4U97A 3WYYA 4A06A 4O7LA 2ITYA 4EL9A 4RPVA 1RE8A 4GYIA 3VS0A 5BYLA 3EWHA 4XUFA 4UMRA 2VTLA 4IB1A 3FY0A 4JOAA 4XLVA 4QOXA 3HVCA 2J90A 2WFYA 2HIWA 2Y4IB 3ZBXA 2X7GA 3OD6X 1OUYA 5GZAA 4QMLA 3LVPA 3CJFA 4ENYA 1ZMUA 5EW8A 3RHXA 4ARKA 5HG8A 3VS5A 1OGUA 4YC8A 1JVPP 3ZONA 5GIOE 3KA0A 4O21A 2Q0BA 2RG6A 3VS7A 4E93A 4FKOA 2WMAA 2WMTA 5E92A 5EKOA 3LFCA 3GC8A 1BKXA 4DFYA 3WZEA 4D2SA 4GUBA 5BVEA 3F3VA 3I0QA 3PY3A 1CKJA 3QUEA 4BVUA 3AC2A 3DBEA 4BIBA 4APPA 4NM0A 4O0VA 2WTWA 5DEYA 1H01A 3QRKA 5HE2A 4V05A 1H27A 4OUCA 3NAYA 2OJGA 3MGYA 4UZDA 5CU6A 4ZXTA 5DYJA 3D0EA 4HPUE 4DITA 1SYKA 1OMWA 4IEBA 4IZAA 3CR0A 4K8AA 4BGGA 1M17A 3KRJA 5D41A 2J6MA 4W4VA 2YAAA 4KSPA 5CEOA 2WEIA 2WQMA 2XCHA 3UMWA 2QO2A 4QQJA 3G9LX 3GQLA 2X8DA 2Q83A 2QKWB 2R3FA 3L9PA 4USEA 5KZIA 5HTBA 2UW4A 1WBPA 4FG8A 2WMWA 2PTKA 2UZOA 4L43A 3MSSA 4BBEA 4DYMA 4AG8A 2CDZA 4RJ6A 5A4CA 2IO6A 3BRBA 3QGWA 4BCMA 3SKCA 4BY9E 3F88A 3R71A 3W18A 3HMNA 5ETAA 4FL2A 1QPCA 4A4LA 5FXSA 2GFCA 2B9FA 4XLIA 4EOLA 5ANJA 3OOMA 3S95A 3AD4A 3DAKA 1XH5A 4C2WA 3AG9A 4XP3A 4O82A 3TNPC 4W4XA 5I3OA 1KWPA 5D12A 3SRVA 4F70A 2R3KA 3DXPA 3FLYA 5EM5A 4Z7HA 4KABA 4P5QA 4XRJA 3I0OA 2XKEA 2BKZA 3ZSIA 3LLTA 5FRIA 3ZXZA 1BLXA 3C5UA 5AV1A 5AP1A 3Q9ZA 4AN2A 4AAAA 2BIKB 1GAGA 1WVYA 2V62A 3WIKA 3R0TA 2XUUA 1UV5A 3OUKA 3QQUA 5T68A 5TO8A 4BHNA 5K4JA 2W17A 4WOVA 3UZPA 2VRXA 4M8TA 1QPDA 1G8SA 3E64A 3OHTA 2RL5A 1PRYA 4FKVA 1OZ1A 4J98A 3V5LA 3BEAA 3RCJA 2C6DA 4XBUA 4F6UA 3LFEA 5EHYA 3S0OA 4EOKA 3OBGA 4F64A 3UO4A 4CT2A 4WG4A 1H07A 1XBCA 3AOXA 1Q8UA 3ALOA 2Y4IC 1PMNA 2OU7A 2ITZA 4IM3A 4LQMA 3ZC6A 4IAIA 1LP4A 4LOPA 1M2QA 2PZ5A 3CBLA 3QD2B 4Y83A 1ZAOA 4QP6A 2XBJA 2X39A 4EUUA 2JD5A 3VBQA 1WBSA 3VHKA 4N4SA 2G01A 4O7ZA 4AN3A 5CS6A 4TPTA 3DNEA 4X6RA 5HGIA 1JLUE 3G5DA 2QU5A 4PDPA 4PMMA 5EI8A 3GNIB 4GH2A 3FXXA 5HE1A 4C37A 3EMGA 4CQGA 2OBJA 4OLIA 3UBDA 2CPKE 4RZWA 4XG9A 4FIIA 3N9XA 5DN3A 5CSVA 2XP2A 3LXNA 5KMOA 4KIKB 4F1OA 3H30A 3FPQA 3SGCA 4FOBA 3PG1A 2W05A 2GHGA 4QQCA 5A4EA 4LOQA 2YAKA 4O91A 4WUNA 5CENA 3GCUA 2VTJA 3R1NA 4ZEGA 2AYPA 3HMPA 2X8IA 3D7ZA 4YLKA 3P0MA 3ZM9A 5AP4A 3R83A 2PUPA 3NYOA 4ZMFA 2X9EA 2ZMDA 4GT4A 4G3DA 3I5NA 5CZIA 2W5HA 5HE0A 4PPAA 1R39A 4IDTA 2J51A 1JSUA 5GNKA 4GV1A 3HUBA 4W9WA 3GU4A 2I1MA 2P4IA 5AX3A 3PTGA 1R0PA 4DEHA 4FKGA 4R77A 4FBXA 3O17A 4GT3A 3NUPA 3ATSA 3DLZA 3WF6A 3LCKA 3QTRA 2FVDA 4IIRA 1CMKE 4JR7A 3UOKA 2ITVA 3RK7A 4Q9ZA 4NM5A 5J9ZA 5DR6A 5JEBA 3G6GA 3UNJA 4AE6A 4JXFA 1OIQA 2GNFA 3PE2A 3D14A 1VYZA 4E4MA 3H3CA 3CLYA 4CD0A 2PHKA 2QG5A 3W2QA 1MRVA 4EYMA 2NPQA 2F49A 2XIKA 2VO7A 4XV9A 4PTEA 1GZKA 4N6YA 4ANLA 4IDVA 2VWVA 5E90A 3C0HA 5KBQA 1IRKA 4DG0E 4ITHA 4PP7A 3WF8A 1J7IA 4IQ6A 1FQ1B 4UYAA 4WUAA 2C47A 3Q6WA 3KN5A 4C2VA 4FG7A 4QPSA 3ZHPC 5I9XA 4BGQA 4M97A 4O2PA 5DI1A 3UZTA 2VV9A 2QHMA 4H3PA 3QXPA 2ZM1A 5JK3A 2VTIA 3HV6A 3OXZA 5HIDA 1P5EA 5AR8A 3C4FA 1YI3A 2VUWA 2Y6OA 3EFKA 2BVAA 1H4LA 5CWZA 2B52A 1WZYA 3BQRA 4CT1A 1L3RE 2XNGA 3QC4A 4MD8E 4OW8A 2KULA 5M44A 3L8PA 4LRMA 1Z9XA 4DGOA 5BYYA 2H9VA 2JBPA 4LUEA 4PX6A 3RAWA 4DH7A 3SA0A 2JITA 3V8TA 3H9OA 3U4UA 2V0DA 2O8YA 4LRKA 3PDTA 4JI9A 4DN5A 4YZNA 3LCSA 4RIXA 2HYYA 4MD7E 5LARA 5E8SA 3DGKA 1J3HA 4EORA 4EONA 3PJ2A 2OH0E 4K18A 4S31A 1HCKA 4OTHA 4YZCA 3UPZA 4QP3A 3RI1A 4F08A 3V6SA 2CGXA 2W4JA 1NA7A 3BELA 2HW6A 4K77A 4UWCA 1XBAA 1U4DA 2BRNA 2VTSA 2HZNA 2XYNA 4RJ8A 4WHZA 1W7HA 3ZC5A 3QTSA 5LVOA 3PXZA 4KIPA 4Z55A 1SZMA 4BCNA 1PMUA 2ZJWA 5HVYA 4QQTA 3ROYA 3QRUA 3OBJA 1FVTA 3DQXA 3N4TA 2IW9A 2HY81 3KMUA 4DH8A 4UWYA 5E4HA 1WMKA 2CKEA 4IVAA 3MH2A 3ETAA 4U7ZA 3MS9A 1OL1A 1KE9A 5CAVA 2PMIA 3BLQA 4FL1A 2A1AB 4F4PA 3GQIA 3ZOSA 4G5JA 4BI2A 4FVPA 3LKMA 4PMPA 1B6CB 3UE4A 1XWSA 3SXRA 2QVSE 2WTVA 3PZHA 4ZTHA 3Q3BA 3V5JA 1F5QA 3TTJA 3G33A 2JDOA 1KV2A 2UZUE 5D7AA 4DEIA 4J95A 2IVSA 5IF1A 3AT2A 4EZ3A 3HAVA 3CPCA 4ONAA 3GU6A 3WF5A 3NVMB 4YO6A 3S00A 4FTUA 4TKSA 1P2AA 2HW7A 3UDBA 2RFDA 5L6OA 5HOAA 3I60A 2CCHA 1YI6A 3DNDA 2JIVA 4RWKA 3I5ZA 4JAJA 4LGDA 3VW8A 3U6HA 3MJ2A 4BCHA 4D4VA 4MD9E 4FKQA 2XK3A 2R7IA 3OMVA 3UG2A 4HVIA 5ICPA 3HP5A 3DKGA 2UW9A 3R7EA 5IA4A 2ITOA 4FKTA 1Y91A 3QD3A 4GRBA 4RIOA 1DS5A 4W8DA 4ZY6A 1I44A 4D28A 4I3ZA 3MBLA 1XH4A 4C3PA 4HGLA 3TTIA 1NW1A 5AR7A 3PSCA 3RM6A 5LVPA 3UQFA 2UW0A 3SXSA 4ORKA 4FC0A 4RSSA 2FSOX 2JGZA 2NO3A 4ITIA 4BCKA 3DQWA 4FGBA 4U80A 2BKKA 5KZ0A 1W0XC 3OCGA 3U51A 4MNEA 4NT4A 3QCYA 2E9UA 4DTBA 3DAJA 4GIIA 1FGIA 3IGGA 3CY3A 3HKOA 2Y9QA 1Z5MA 2IVUA 5IMXA 4XV3A 5GZ8A 1J91A 3LE6A 4LOOA 5HX6A 5LWNA 5M51A 5EYDA 2W1HA 3QF9A 3EL7A 2QODA 3Q9YA 2GQGA 2EXMA 3I79A 2CLQA 3VHEA 5EKNA 1EH4A 2X7FA 3JVRA 2XK4A 3LPBA 3C4WA 3NCZA 3VBYA 1YQJA 3OWKA 2G9XA 4FV8A 4F7NA 3TKUA 5FDPA 5BNJA 3FPMA 4AW5A 5BUEA 5AUTA 5DH3A 3FYJX 5GJDA 4YZ9A 3L1SA 4LGHA 4V0GB 5ETCA 4PF4A 1OI9A 3L9MA 4WG5A 5EDQA 5FQDC 3DT1A 2PZYA 3F61A 3W55A 3DLSA 4AZTA 5BVNA 4HCTA 4JNWA 4L52A 4ZZOA 3QCSA 4FSYA 5K5XA 5AUYA 2J4ZA 3QZGA 4RVKA 4BYIA 3OCTA 3QZIA 4OAVB 4OTPA 4NU1A 3MY1A 4ZTQA 2QI8A 5HBJA 4X2JA 3Q5ZA 2ETRA 3FC2A 3JXWA 4FSZA 4NTTA 2W9FB 1KE8A 4J52A 3HA8A 2XH5A 1UNLA 3D2KA 5AIRA 2B53A 3ZBFA 3OY1A 4FIGA 3Q5IA 4UYNA 2EVAA 3NUXA 3VW6A 4EC8A 2I6LA 4D1XA 4Y5QA 3O0GA 2C5XA 3RP9A 3OT3A 4JBQA 4GU9A 5AEPA 4ZZNA 4HVHA 3KU2A 4G3CA 4RJ4A 1MRYA 5HO8A 3TXOA 3P7BA 2RSVA 3NUUA 1Q99A 2FSTX 4IZYA 3W8QA 2PUIA 4W4YA 4YJOA 2VO6A 1UWHA 5BVKA 4MH7A 4PMTA 4TWCA 4F1MA 4NKSA 4UB7A 4BCFA 5J8IA 4DEGA 3FEGA 4FSQA 2CKQA 4G9RA 4DEDA 1LEZA 4FTKA 4IVBA 3GI3A 4BDBA 3ENHA 3OY3A 4GG7A 4J71A 3MI9A 5E1EA 3DKFA 1GZNA 5CT7A 4OGRA 4DG3E 3M1SA 3K3JA 4IWOA 5FXQA 4X2FA 1CDKA 3EQFA 4YJRA 4U0IA 1XQZA 3TACA 4IC7A 4L67A 2PVJA 3LQ5A 3NYNA 4FKIA 3M11A 3SAYA 1BI7A 3D5UA 3DY7A 3QFVA 4WG3A 3A2CA 1VJYA 2ITXA 4AU8A 4S2ZA 4U41A 4QMUA 4GSBA 4BZDA 3P79A 1GIIA 3ZU7A 4F0IA 1H1RA 4RZVA 4O84A 2PVHA 3TWJA 4J96A 3SQQA 5FXRA 3BYOA 5CTPA 5F4NA 3F66A 2HXLA 3KXZA 4E3CA 2Z02A 3BBWA 3RZBA 4ERWA 3DBQA 4BZOA 2I40A 1JPAA 4NCTC 3C9WA 2H34A 2WB8A 3LHJA 2IW6A 1VR2A 2XKFA 2XNEA 4FTRA 4B7TA 2YM5A 3R9NA 1KE6A 3HLLA 4ZTRA 3G90X 4BN1A 2OXDA 3BYSA 3HRBA 2Y6MA 3UC3A 5EHOA 4DH1A 4IVDA 2RF9A 5L2WA 5FUTA 3E7OA 2E9OA 4YNOA 4X3FA 3CEKA 2BDJA 3PLAE 3WZDA 3O7LB 3QZFA 3LQ3A 3Q2JA 3QWKA 2PVFA 2W5BA 5CU0A 3WI6A 3OF0A 5I9YA 1F0QA 2REIA 3LXPA 4PPBA 3C51A 4QTDA 4J7BA 3NPCA 4I5HA 2IZTA 5LWMA 3SRVB 2F4JA 3JR1A 3V6RA 3QQLA 4QYGA 4WNMA 4Y46A 2JKMA 3RPOA 5CU4A 4EH5A 1JKKA 4E6QA 4FV7A 4I4FA 3IO7A 4D2WA 3PSDA 3GT8A 4DBNA 4EWQA 2W1GA 2UVXA 2FH9A 4C4JA 5LXMA 3G15A 2R3LA 3TKIA 2R64A 5AUUA 2ZVAA 4NZWB 3QCXA 3RK5A 4CKIA 3ANRA 4XG3A 3HRFA 4NJ3A 4F09A 3RTPA 3PXRA 3FL5A 3CQEA 1TVOA 3ZFXA 4A4OA 3I7CA 4DFBA 4Y72A 4O7TA 2V7OA 5BQ0A 1CM8A 2J0LA 1ERKA 4FSMA 4JR3A 1PXLA 4BBFA 3DK7A 2GHMA 3MTLA 5M55A 4ZS0A 3WE4A 2QURA 3Q4TA 3G51A 3HX4A 3GC9A 4EK3A 1ZYCA 3IDPA 5EG3A 4G6LA 4F9BA 4RX5A 2YFXA 5HCZA 4IMYA 3HMOA 4Q2AA 2ZOQA 3WZUA 3HECA 3UIXA 3VNTA 1OIYA 3GP0A 3KRWA 5EI6A 5HNIX 3ZS5A 4I6FA 4KA3A 4NYEA 3S3IA 2FUMA 4E26A 1A06A 4HYHA 4XNEA 4XOYA 5AR2A 4CYJA 4AP7A 4KINA 5CF6A 4XV1A 4KUJA 3FXZA 4KWPA 2QR7A 1DAYA 3RBWA 3V5QA 5M57A 3D7TB 4UN0C 2ZB1A 1CSNA 2XVDA 2XNBA 2XNMA 1HCLA 3BPRA 3DB6A 3OW3A 4IFGA 4RLKA 5HIBA 4FYNA 3DZOA 3FQSA 4ANNA 3DJ7A 2VD5A 1UWJA 1JAMA 2GPHA 1CKIA 2PVKA 3NDMA 5LCJA 4D5KA 4CFFA 4HZSA 4FKWA 3OWPA 3N4UA 1WBOA 2AC3A 1TQMA 4IHPA 5A46A 2VTTA 3NNVA 4ZZMA 3ZFYA 3KVWA 4FX3A 3H9RA 4ALUA 4JT3A 3RAHA 4KS7A 3DV3A 5LMBA 3HA6A 5KUPA 3E8NA 1JQHA 3MVMA 1MRUA 4N70A 1ZOEA 4KBKA 5L6PA 4C4IA 4ZJJA 4L00A 3WOWA 4ANQA 4NIFB 3DBFA 3RK9A 2C5NA 2SRCA 3D5XA 2R3QA 4Q9SA 4WNPA 5CI7A 5IEVA 2BILB 3CKWA 3DZQA 5HVJA 2UZVA 3FZRA 4PRJA 5L8KA 4MCVA 4YGAA 4YURA 2GHLA 3UQCA 4U9AA 4G6NA 1H24A 4IADA 5CVHA 5DR9A 3TIYA 5CAUA 4IX6A 3SG9A 3EQBA 2F7XE 4E20A 4FTOA 4EKLA 4ZS4A 3NMUF 4O81A 4WSYA 3GEQA 3ZEPA 4O1PA 5EDPA 1V0BA 2P3GX 3GFWA 4FEWA 2EWAA 4IB5A 1JNKA 3R1QA 5FP5A 4DCEA 1UU8A 4RMZA 3R9OA 2O63A 3QKKA 3BE9A 4JVGA 4C33A 4FEVA 2VWWA 3UC4A 1R1WA 4BDAA 2YHVA 3ITZA 1GOLA 4L3JA 4PY1A 4QYHA 4YJUA 4GVJA 3VUTA 2OFUA 3WYXA 4IAFA 3O96A 5G6VA 2PL0A 2LGCA 4I23A 3FMNA 3ORNA 3UP2A 2W0JA 1PXNA 2RFSA 3IW8A 4NSTA 5IQGA 5HCYA 3EN6A 2OF2A 4H1MA 4PMSA 5A3XA 4AZFA 3F5XA 1PXPA 4NJDA 5DFPA 5CXHA 4TWOA 5CF5A 3HL7A 4MXCA 4F6WA 2Q0NA 3FZPA 1PKGA 3GFEA 3IECA 3L9LA 4YMJA 1LPUA 2XJ1A 3LAUA 3FKNA 3E3PA 4J99A 4W4WA 4YC6A 3IDCA 4II5A 3R9HA 1GIHA 2Y4PA 2O3PA 3KFAA 2QR8A 5AM7A 4RIXB 5CASA 4AZSA 2C6TA 1FVVA 2FA2A 1Q41A 4O1OA 5EM7A 5EOBA 4BI0A 3BV2A 4FEQA 4BKZA 4CMOA 1Z57A 3E8DA 3LM5A 2NRYA 3R9DA 2E9PA 2X1NA 5F95A 4TYEA 2C0TA 2OWBA 3Q4UA 5IA0A 4HVSA 4NEUA 2QNJA 4RIWA 1Q8TA 3Q2MA 2HZIA 2RGPA 3Q32A 2BUJA 3CCNA 3EKNA 4PTGA 5CX9A 1PYEA 1YHWA 5IA3A 2W1IA 5EQEA 5HX8A 4MAOA 4QYFA 5D9HA 4OT6A 5KMMA 1RDQE 3FYKX 4OBOA 4BCIA 3K54A 4E73A 5DBXA 4RX8A 5EQPA 2QKRA 4MXOA 2V22A 3O8PA 5JFXA 4JDHA 4X7QA 3UVRA 4YSJA 2XJ0A 5KBRA 1H0WA 2QO9A 1Q62A 3O50A 3PFQA 4QTCA 5DGZA 3SDJA 3FLQA 3KL8A 3V5WA 4WIHA 3DTWA 2XK9A 4AT3A 2GQSA 4FTTA 5J87A 3AC4A 3C4CA 5J1WA 2VX0A 3KVXA 2W7XA 3W10A 3IS5A 5HI2A 2XK8A 3KRLA 4UV0A 4GJ2A 2IN6A 4HCUA 4HZRA 3OC1A 2BR1A 4BC6A 2DUVA 4X0MA 2BDFA 2VTPA 4EBVA 3FY2A 3SC1A 2HWPA 3FMHA 5TF9A 4K6ZA 5CY3A 5BUIA 3EYGA 4NL0A 3KY2A 2FSLX 4OTFA 5HG7A 3ULZA 2Z8CA 3RALA 1B39A 3ORPA 4QP7A 3MA3A 4BTMA 4X6QC 4YLJA 1K9AA 3R04A 4OTQA 5KX8A 4IAYA 3QA0A 2R3HA 5HTIA 2ERZE 2NNWB 3CQUA 2WO6A 2JIUA 4FNYA 4MKCA 3VS3A 4AACA 2YWPA 4QP8A 3N4VA 1NVQA 3HUCA 3B8RA 4P2KA 4UWBA 3CIKA 5H8GA 4RLLA 5AV4A 2C6OA 4F6SA 3ACKA 4EQCA 4LFIA 3LMIA 3LFAA 4O96A 4XG4A 5TR6A 4ZOGA 3A7FA 4Y5HA 3RHKA 5DT4A 5DT0A 4YTIA 4RC2A 4MXXA 4RIYA 1DAWA 3DB8A 3O2MA 4ANSA 4EH4A 5JH6A 5IPJA 5B7VA 4DC2A 3BV3A 3P08A 3ZO4A 5DLSA 3T3UA 1OPLA 2UZLA 3SV0A 4K2RA 4WNKA 5E8YA 4XHKB 3DFCB 4DEBA 1PXKA 3PA3A 3GGFA 4BFMA 5LVNA 4WNOA 4CSVA 2OH4A 2CGVA 3ZDIA 2J0JA 2CCIA 4H3BA 2QOIA 4FIJA 3HP2A 4O2ZA 4FEUA 3PXKA 4C61A 4O22A 5JSMA 2R9SA 4RWIA 5BVWA 2CGUA 3BQCA 3GC7A 2CHLA 2E9VA 4X2KA 2YCRA 2QD9A 4FNXA 1GNGA 2ITWA 3NIEA 5CI6A 3D5VA 1WBNA 4AS0A 3MVHA 4EC9A 4XYFA 3A7IA 3ORTA 3QXOA 5HNGA 2V7AA 3A7HA 3FMEA 3ODZX 4FZAB 4YJSA 2XCKA 2BDWA 2JKOA 4JDKA 3QTXA 2YDJA 4FA2A 3E88A 3PXYA 4TNDA 5DE2A 5JMSA 5A6OA 3HV4A 4GK3A 3CPBA 4IWDA 3QX2A 5HORA 4ACGA 3UQGA 3EQIA 5EH0A 3KF4A 1PXIA 5DHJA 1UA2A 3MVLA 2B7AA 2F7EE 4UALA 4G2FA 3UO5A 4M0YA 5BPYA 1OBGA 4QMWA 4C0TA 1SVHA 4ZSLA 5AWMA 4BWXA 2CLXA 4AFEA 4Y85A 4BIEA 3F3UA 4E7WA 4ZLYA 4RJ5A 4YJTA 5AR3A 2B54A 2BRGA 3PXQA 3OEZA 4WRSA 4U8ZA 5LJJA 5IG1A 1M7NA 5CT0A 2P2HA 2V55A 3VBTA 2JFMA 2UV2A 4L3LA 2C6IA 3ZM4A 4FV4A 3BIZA 3Q4CA 2FYSA 1ZYJA 2OZAA 3K2LA 3IQ7A 3VJOA 4EHVA 4M67A 3C5IA 5A4TA 3WE8A 2VTNA 2BRHA 2I7QA 3C13A 2QO7A 5HU9A 2VO3A 2ZM4A 4FGRA 2JDRA 2WOUA 1ZARA 3IOKA 4TTHB 2YLFA 1ZMWA 3H0YA 4RWJA 4ZLZA 1ZLTA 3WIGA 2O64A 1FVRA 1JKLA 4FYOA 3POZA 2VTHA 5JZJA 3D83A 3OOGA 3KB7A 1ZZLA 2RFEA 2ZV7A 5H2UA 2XEZA 4Z16A 5IU2A 4KNBA 3VUMA 4JQEA 3NW5A 4UZHA 5E8TA 3OEFX 2WD1A 3GC0A 4O0YA 3ZYAA 4AA4A 4EZ5A 1IG1A 3L8XA 5L2TA 3NNUA 2GS2A 4XOZA 3DJ5A 2C5OA 4R1YA 3UPXA 2WELA 3R00A 3HV3A 2XNNA 3BU6A 4DGLC 4FKLA 4O7YA 4BR3A 4I0RA 3RWQA 4D0WA 3AT3A 4N57A 1IASA 4BBMA 3A7JA 4GKHA 4UX9A 3SVVA 4KRCA 3MH0A 5GINE 4HOKA 4GG5A 2VGPA 4R3CA 2YM3A 1CKPA 4LL5A 3I81A 4QMTA 4BCJA 4CFWA 4GUEA 2W1ZA 4FZ6A 3A8WA 1K3AA 2YM6A 3LLAA 3PSBA 3RPVA 4BDEA 3DU8A 5AFVA 3EFWA 5ETFA 3QCQA 5CVGA 4AX8A 4Q5HA 5FDXA 4E5WA 4XH6A 4IM2A 3LCDA 4TWNA 2YERA 2W99B 3MYGA 4FSTA 4J8MA 3PZEA 1GZOA 4M84A 2R0IA 5M56A 3R7VA 4GFOA 1MQBA 4GL9A 4FTJA 3NUSA 1R78A 4RG0A 5CAPA 1IA9A 1R3CA 5FTQA 2XIXA 5M06A 4PDSA 3A8XA 5GHVA 4CXAA 2G2FA 4BWPA 3VVHA 4HVDA 4X3JA 3RWPA 2QC6A 3GCQA 4ZSGA 5FLFA 1E1XA 4BCQA 2IZRA 4B99A 5JRQA 4PL4A 5AUWA 3F7WA 1DI9A 3OCBA 4IANA 2BZJA 3UNZA 3ERKA 4ZSAA 3BU5A 3AC1A 3EJ1A 5AP3A 4P7EA 4MF0A 1WBWA 5AAFA 4XRLA 2DWBA 2YCQA 2E9NA 3CQWA 1YXXA 3D15A 4MQ2A 5J9YA 5HE3A 4A7CA 3KN6A 4UMUA 4CRSA 4H05A 2W1FA 4IZ7A 2Z7QA 3VS4A 3W16A 4UEUA 4YBKA 1PF8A 2WU6A 4AOJA 3TZMA 5E8VA 1KSWA 4CFNA 2GNJA 1TQPA 4RQVA 4QP4A 5ITAA 1JKSA 4FT7A 4CFMA 4EUTA 3PE1A 3V04A 2OF4A 1OKWA 1ZOGA 4LGGA 3ID6C 3EFLA 3JPVA 3QGYA 4QYEA 2UW6A 4AW1A 2YITA 4I5CA 1V1KA 3BEGA 4ZMEA 3OWJA 2Z60A 3DFAA 4CCBA 4G17A 4A9UA 5ANOA 3NSZA 2VWUA 4I21A 4QP9A 5L3AA 4PP9A 1Q97A 4ZK5A 3VS6A 4R78A 4FG9A 1XBBA 3W1FA 2PE2A 4EK8A 1STCE 2PUNA 2J2IB 3QTZA 3VBVA 5C4KA 2OI4X 3S4QA 1W98A 4F63A 3I6WA 4CLJA 2I0YA 4FVQA 3BHVA 1U54B 3R6XA 4AA5A 5I9WA 5KMNA 1OPJA 2J5EA 3OWLA 4R5SA 5AA8A 2RIOA 4FK6A 4CEGA 2JKKA 5B2LA 1YWVA 5BMSA 4IAZA 3CE3A 3FSFA 5EW3A 1Q8WA 2ZYBA 4NK9A 2R3OA 2XM9A 3QLGA 3UOHA 2BCJA 2ITUA 4EQMA 3ZUVA 4R7BA 5CSPA 5IQCA 3BE2A 3II5A 2P0CA 3ZSGA 3R63A 4NWMA 2WAJA 3KULA 5FBNC 1AQ1A 3AXWA 1UKHA 4R5YA 2PU8A 4IJPA 3ZLSA 4BYJA 3ZRKA 3F82A 1OPKA 1BMKA 2WMBA 4QD6A 4DA5A 2R3NA 3BYVA 1BL7A 3U9NA 3AD6A 3V51A 4GEOA 4I20A 1H1QA 4EQUA 3ORZA 4MHAA 2YM8A 5CNOA 2XZSA 3VRZA 5ANIA 3ZRLA 2QOBA 2G2HA 3VAPA 3ZFMA 5ANGA 5E8WA 5FP6A 3JUHA 2F57A 3EN5A 5DPVA 5HG5A 4B4LA 4FKPA 4YJPA 3VWAA 2R3RA 2QHNA 3I7BA 4R7IA 1X8BA 3BBTB 5JRSA 5DOSA 4FKSA 2GCDA 1KE7A 2WKMA 3B2TA 3EZVA 4GK2A 5CEKA 3SOAA 3U87A 3QBNA 4EK6A 2J0IA 1PMEA 3QYWA 4DFLA 2PY3A 4LMUA 2FSMX 4QP1A 2XMYA 4IBMA 1FMKA 4RWLA 3GOPA 1UU9A 3MIAA 4NW6A 3R02A 3UO6A 4O0TA 5CSHA 4QTEA 1Y6BA 4C34A 2JDTA 1M2PA 4AUAA 1YVJA 3DDQA 2GTMA 2J0MB 4AE9A 4DE4A 3P5KA 2OG8A 2J50A 4CTBA 5AUZA 2B0QA 2W4OA 5HD7A 4TNBA 4EYJA 3F7ZA 2V5QA 4I6QA 3QA8A 3F6XA 4AA0A 3MPMA 3V8SA 2UZBA 5TKDA 3ZLYA 2YA9A 4FTQA 4W9XA 5T6KA 3RMFA 2EXCX 4D1SA 3QHWA 3FZOA 4EHEA 3HGKA 3PWDA 4PL3A 5L2QA 3PWYA 4UXQA 5IQEA 3QRIA 1PJKA 3QTQA 4XX9A 3ZXTA 3ORMA 1R0EA 3GVUA 2PPQA 2GNIA 1S9JA 1G8AA 3PYYA 4U44A 5HG9A 3RAKA 2OFVA 2OJFE 5M53A 3HRCA 2BTSA 2ZV2A 5IQIA 2JDVA 3FI3A 2B9IA 2VGOA 4G34A 2X8EA 3TNHA 5AUXA 3BHTA 3QKMA 2OIDA 2JEDA 5EK7A 1NVRA 3FWQA 4HPTE 4D9TA 4AGDA 3F2NA 1LUFA 1F3MC 4FEXA 3ORKA 4DTKA 2WOTA 4C59A 5A14A 2QQ7A 4PDOA 2NRUA 2A2AA 1E9HA 3HMIA 4LL0A 4O6LA 3DBDA 4CZUA 3NWWA 5AA9A 5J5SA 4O86A 4ASDA 4FTIA 4I5MA 3VULA 1W84A 2C6LA 2QOCA 3TJCA 3EYHA 4UBAA 4BKJA 4RT7A 4LRJA 1ZOHA 3C50A 1KOBA 4FT3A 3BI6A 2ZAZA 3GUBA 1SNXA 5HQ0A 1A9UA 5I3RA 3RM7A 5KMLA 3DDPA 3OW4A 4GW8A 4JG6A 4EI4A 4E6DA 3FMDA 4EK4A 5DR2A 5LCKA 2O5KA 4MWHA 5A9UA 4L44A 1FGKA 2ZDUA 2UVYA 1U5QA 5DMZA 5IDNA 3F3TA 4C8BA 4HW7A 3P86A 3AMAA 4BRXA 4FOCA 4AZEA 4BDGA 5K4IA 2ERKA 1FPUA 5BVOA 2CNQA 2ZMCA 3D2IA 2VTRA 4D2VA 3DS6A 3R30A 4OBPA 1FBNA 3UG1A 2Y8OA 3BWFA 5IUGA 4WSQA 3BWJA 1J1BA 5CANA 3A4PA 3QQGA 2XKDA 5EW9A 3PRFA 2VZ6A 4XS2A 2HENA 3DK6A 3EQCA 3OUNB 4WD5A 3W8LA 3OXIA 4DFZE 2OGVA 5CF4A 1BL6A 4AXAA 1YOJA 1XKKA 4ZLOA 2B9HA 3PVGA 3BGZA 3D5WA 4IWQA 2OLCA 3TJDA 2P2IA 4HYSA 2BHHA 2WMSA 4U5JA 4KIKA 4M66A 2PUUA 3IW6A 4DT9A 5K9IA 3KXGA 4WA9A 5FGKA 3TDVA 3JY0A 4JDJA 4W8EA 4JX3A 4EOIA 4E5BA 5KMIA 3NUAA 3P7CA 5GJGA 3PA5A 3B8QA 4M68A 4B6LA 2PVNA 2VTMA 3U4WA 3EIDA 3UIMA 2WQOA 2YDIA 3PA4A 4M0ZA 5EOLA 5C26A 5C8NA 4F0GA 1G3NA 3QQHA 3MB7A 4AGWA 4DF3A 2YIXA 3KXMA 3V5PA 3ZMMA 3KC3A 1ZRZA 3FZ1A 4RIYB 4YZBA 3GU7A 1OL6A 4KSQA 1UKIA 4A9SA 4BDCA 4L3PA 5DEWA 3LFDA 1RJBA 3BLHA 3PVBA 4FTAA 2BHEA 5ANDA 2GQRA 1BI8A 2XRWA 3Q60A 4DG2E 3Q96A 2RKUA 4PL5A 4QMSA 4BICA 1ZYSA 4BHZA 3BHYA 4AT5A 3AGMA 4FR4A 4I5PA 2YWVA 3TCPA 3FDNA 5CEPA 3DA6A 4ASZA 2UW8A 4FK3A 2R3PA 4LMNA 4A9YA 2WMQA 3ZLXA 5J9LA 3H10A 3HV5A 3FXWA 4GU6A 4TYJA 1ZY4A 3OTUA 4IZ5A 4O0SA 2F7ZE 3P23A 3REPA 4BL1A 2PVLA 4TY1A 3UNKA 2W96B 3V8WA 3BYMA 4GVAA 4OAUC 4OT5A 4D58A 5CAQA 1DM2A 5AADA 4AOTA 4FV2A 1YDTE 4BTFA 2DYLA 2WTIA 2UVZA 5BUJA 2ETMA 2I0HA 4R7HA 3TZ8A 2GFSA 5CF8A 4CG9A 3F5GA 3AC8A 4QRCA 4EH2A 1SM2A 3IDBA 4PV0A 2ITQA 4IX5A 4BZNA 2E2BA 4D4YA 3QZHA 4O7SA 3O71A 4IM0A 2BAQA 1SMHA 4F99A 4F9CA 4CQEA 1OL2A 4RFMA 5JFWA 1QMZA 5L8LA 4DLJA 1YXTA 1W83A 3H4JA 2QU6A 4OTWA 3O23A 2CNVA 4U3ZA 4YHJA 5IQBA 3EQDA 2X6EA 2C5YA 1YDRE 5FM2A 2YJSA 4EJNA 5A4QA 3PRIA 3ULIA 3NZ0A 2B55A 2A4LA 5B2KA 2C1AA 3FHIA 4HNFA 4Z3VA 2YDKA 4JBOA 3RKBA 4USDA 5CSXA 4RRVA 4U40A 2XBAA 3UYTA 2JFLA 5I9VA 4NM3A 5A54A 1XH8A 3QL8A 4HGTA 3BHUA 4XG8A 1H26A 3R7OA 5CQUA 5HTCA 2R4BA 3UP7A 3TDWA 3V5TA 1UU7A 3TZ9A 4DCAA 4JIKA 4C7TA 4ZIMA 3T9TA 4LV8A 4M69A 5DVRA 2YISA 4C62A 1P4FA 3LIJA 4I92A 3E92A 5AP5A 3MN3A 3FLSA 5KHWA 3LZBA 4C35A 3HMMA 2HZ4A 4JJRA 4D9UA 1OUKA 3G0EA 3FI4A 4FKUA 3ROCA 1YRPA 4G3EA 3FAAA 4D5HA 3PY1A 3EQHA 5KO1A 1YXUA 2EU9A 3LFBA 5IA5A 3FMKA 2OJ9A 2BRBA 3MVJA 3EN7A 3GCSA 3TKHA 3AGLA 3ZRMA 3ET7A 3V3VA 2OXXA 4O6EA 1YHSA 4ITJA 3P7AA 2PE0A 5LMAA 4EKKA 2VTQA 4J1RA 4L42A 4TYGA 5AM6A 2B1PA 4EHZA 1KUTA 4HGSA 4FT5A 3W2RA 4IX4A 1YKRA 4GFGA 2GSFA 2J0KA 1PMVA 1L8TA 3LMHA 1U59A 3MTFA 3PJCA 3R8PA 3UMXA 4ZJVA 3R8ZA 5DG5A 4H39A 3EN4A 1MUOA 1W8CA 5FBOA 3PPJA 3P9JA 4IACA 4YSMA 3P1AA 3CKXA 1OVEA 3RINA 4BF2A 3COKA 1YI4A 3NCGA 4FI1A 4YTHA 3QYZA 3FV8A 3RJCA 4RJ7A 4U79A 3FLZA 1PY5A 3CTHA 3PP1A 4KBCA 2C0IA 4NKAA 5C1QB 5I4NA 2X7OA 3CXWA 1SVGA 1VYWA 4J8NA 1P4OA 2DS1A 5EFQA 5ACKA 5HHWA 1REKA 5HESA 5HIEA 3MESA 4JS8A 4NW5A 4OR5A 3BU3A 1NVSA 1GJOA 2ITTA 3FZTA 5DIAA 1XJDA 5H8BA 2ZB0A 3UJGA 4M15A 5JGAA 3ELJA 4I4EA 4E6CA 1ZYLA 3KXNA 5CVFA 4NTSA 4DHFA 5KNJA 4Z7GA 3FMJA 3C4XA 3DAEA 3MY0A 4YLLA 5JQ8A 3VUHA 3NW6A 4QPAA 4BDFA 4FSUA 2EB3A 5AX9A 3ZSHA 2QOHA 3GCVA 3O7LD 1I09A 2PZPA 4NCTA 2VU3A 3FMMA 3LXLA 4M7IA 1RQQA 1YXSA 3MW1A 4I0TA 5BVDA 1JWHA 2IPXA 2BROA 1H00A 2UZTA 2VTAA 3P4KA 1Y8GA 5HZNA 3QRJA 4ZTLA 1U46A 2Z2WA 3TUBA 4JLCA 2WIHA 3FKLA 3KXXA 3AQVA 2C5VA 5A6NA 5HVKA 3W2PA 4USFA 2DQ7X 3PJ8A 5LQFA 1XO2B 3F9NA 2CNUA 4IJ9A 3QU0A 4U3YA 4MXZA 4D4RA 4GCJA 3EH9A 2PULA 5IQDA 4HVGA 3IGOA 3L8SA 2WGJA 4DEEA 5L8JA 3PLSA 4FT0A 3FQHA 4RVMA 3BGPA 3UGCA 3CGOA 2FGIA 2C3JA 5HICA 4FUYA 2IVTA 3ZO3A 1Q61A 4M12A 4DINA 4AGCA 4V0GA 5JFVA 2C4GA 4GFMA 4L46A 4CZYB 3T8OA 2EUFB 4IE9A 5CZHA 4HJOA 4QMXA 3RNIA 3MY5A 4FTCA 5H9BA 5C9CA 5CALA 4R8QA 4QT1A 3SW7A 2AUHA 1PYXA 3LFFA 2R3IA 4I22A 4IB0A 3RPYA 1YXVA 3IKAA 4L01A 1H25A 4OTIA 3TIZA 3U6IA 2C30A 3FBVA 3BLRA 1O9UA 2XNOA 3OTVA 5AV3A 5EYCA 2OZOA 5LMKA 4M14A 3A7GA 4UMQA 4L53A 5ETIA 5FTGA 3V01A 4KB8A 5C8MA 1LEWA 3FZSA 1Q8ZA 1M7QA 4FF8A 3PJ3A 4KBAA 1Q5KA 3VF9A 1AGWA 3AD5A 3ZTXA 4TYHA 2F9GA 1BX6A 3QTUA 4Y8DA 4MX9A 3UZRA 5EYMA 3E8EA 3Q9WA 2W06A 4S30A 2X2MA 3MFUA 3SLSA 2HXQA 3VBWA 2HK5A 5KMKA 2ZV8A 5K0XA 4BDKA 4ZY5A 2ZM3A 3FL4A 5E91A 4ZJIA 2YM4A 4M3QA 4MWIA 4EOOA 1YWRA 3SW4A 5AMNA 1LR4A 3WZJA 3ZEWA 4QMPA 4YPSA 2F2CB 3EQGA 4B9DA 4ENXA 4O83A 4YHTA 3ZO1A 2BZKB 4K9YA 5F20A 2CMWA 5GJFA 1J7UA 4I93A 3CP9A 3H0ZA 4FZ7A 2ONLA 5HBHA 1APME 4YJQA 4FTLA 3CJGA 1XH6A 5C03A 4G9CA 3QQKA 5E8XA 4BI1A 2C0OA 4CFXA 5J5TA 2J7TA 2W1CA 5J7BA 3DOGA 5L2SA 2WMRA 3QRTA 4KIQA 1REJA 4I94A 1UVRA 5JFSA 2UW3A 5D11A 3WARA 4MNEB 2XK6A 2IW8A 4JDIA 3F69A 5CSWA 2I0EA 3H9FA 2R2PA 3POOA 4J97A 4KKHA 5EHLA 4C3FA 2QOKA 4JQ7A 1Q24A 1OL7A 2BZHB 2R3GA 2WMXA 2OKRA 4YBJA 3UTOA 5KE0A 4QO9A 1Q4LA 4FSNA 2C6KA 5CXZA 3A61A 4ALWA 2YLEA 4KAOA 3QTIA 1ZYDA 3TNQB 4YPDA 3U9CA 2RG5A 4PTCA 4F9AA 1J7LA 4QTAA 5IEXA 3FQEA 5AUVA 1Q8YA 3CC6A 3EKKA 3K5VA 1MQ4A 3FI2A 3WZKA 4LUDA 4NUSA 5DRBA 2JAVA 4IAAA 2JKQA 4B8MA 1XHAA 1PW2A 3UOJA 1Q3WA 4F9WA 5EQYA 3MV5A 1OM1A 3LOKA 2NP8A 3QUPA 3DJ6A 2GS6A 3L9NA 4B0GA 2VO0A 4ANOA 3CTJA 1UU3A 2YN8A 3HZTA 5CEQA 1QPEA 5FM3A 5LVMA 4FSWA 4HYIA 3KREA 3RCDA 3FHRA 2GDOA 2CJMA 3NR9A 3JVSA 4NH1A 4D0XA 4AF3A 3QWJA 4IC8A 4MYGA 4JIAA 1T45A 4YNEA 4FNWA 2WTCA 2YCSA 2GNGA 3T9IA 3ODYX 5HLPA 5D10A 2G15A 3Q04A 5IH6A 4K33A 1A48A 3SX9A 2YACA 3I6UA 4TXCA 5BMMA 2OICA 4S34A 3R8LA 2CKOA 4MK0A 3NEWA 2XKCA 2X9FA 2PE1A 2WQNA 2G2IA 4AN9A 1GIJA 1SVEA 4H1JA 3COMA 4CRLA 3VBXA 3FLNC 3KK9A 5M08A 2R3JA 3KXHA 4MBJA 5TT7A 2HZ0A 2WQBA 2QOQA 5IDPA 3ZUUA 3MH3A 4I6BA 3S2PA 4RGJA 5AP0A 1H8FA 3NYVA 4ZSJA 3D94A 4IW0A 2OJJA 3E5AA 1IAHA 3NRMA 4O0UA 3LJ1A 4UY9A 5FEQA 3SHEA 4G3GA 4XEYA 5KHXA 2QONA 2XA4A 2YIYA 3NAXA 4V01A 3Q53A 3E62A 4C02A 1BYGA 3KCKA 4FVRA 4ZY4A 2AC5A 4HGEA 3NW7A 1G5SA 4AGUA
chains in the Genus database with same CATH superfamily
2LAVA 4WKQA 4BB4A 4LYNA 3D7TA 4YO4A 3GU5A 5I9UA 4PUZA 1PHKA 1B38A 2VWYA 4RC4A 5I5ZA 5FD2A 2B9JA 5CQWA 5T3QA 4OTGA 3UYSA 5IQHA 5IA1A 3OP5A 1O6LA 4X21A 3MWUA 3LCTA 3O8TA 3TG1A 5IEYA 1IEPA 2WEVA 3NGAA 5EM8A 2X0OA 4LV7A 2ETKA 4GMYA 2YIQA 3CD8A 2W1DA 4NFNA 3ZO2A 2OO8X 5IKWA 1CTPE 2OK1A 5HEZA 4BCOA 2VX1A 3BZ3A 4QNAA 3M2WA 3EHAA 4TWPA 4M13A 1IA8A 3PY0A 5BX0A 1NY3A 2HOGA 3BHHA 4RFYA 4PWNA 4TT7A 4DLIA 4QMNA 4O0XA 2XS0A 2X6DA 4D4SA 3A99A 4HNIA 5DWRA 2QCSA 3ENMA 3PIXA 1O6KA 4NIFA 1WVWA 4TN6A 3NNXA 3IPHA 3SOCA 2PMOX 4X3FB 4CGAA 3C7QA 2UUEA 3MPAA 4JAIA 1IR3A 2JIIA 3QD0A 4FV9A 3PVUA 4KD1A 4R1VA 4C4FA 3CTQA 4RVLA 4LI5A 4QTBA 4YJNA 3G2FA 4MVFA 5JKGA 3NNWA 4ANBA 4NFMA 3VO3A 3PVWA 3RNYA 3FI8A 3JYAA 5JT2A 4C38A 4DGMA 2BPMA 3KCFA 4C57A 3U6JA 5FEDA 3WILA 3IW5A 4OTDA 4BDHA 4IWPA 5IQFA 5C01A 3ZH8A 3R1YA 3LJ2A 2Z7LA 5TE0A 5LVLA 2H96A 4G6OA 1P14A 4PQNA 4C4EA 4S33A 4XJ0A 4WT6A 4JRNA 3I4BA 3VC4A 5D1JA 4GK4A 3UODA 2O0UA 4RC3A 5AR5A 3RPRA 3EQPA 4MBIA 5J1VA 4ZTNA 4GJ3A 2GNHA 3GB2A 3R7IA 4O7VA 3ORXA 4RQKA 3AC3A 4IVCA 4ACHA 3F2RA 3DTCA 5D7VA 1Y8YA 2C1BA 4FV3A 3UIBA 1NXKA 2QG7A 3VS2A 2ACXA 4Q5EA 2GTNA 4EH6A 3GCPA 4DFXE 4JBVA 3WF7A 1VZOA 1U5RA 4H3QA 4FUXA 3R7UA 2W9ZB 4C3RA 3GXLA 4AZWA 4EOPA 5J79A 2WU7A 5E8ZA 3R73A 5FG8A 2GS7A 1H0VA 4O38A 3SG8A 4CV8A 3NVKI 3ACJA 4XCUA 4X2NA 3LFSA 3OS3A 4DEAA 5K3YA 3BKBA 4RFZA 2ITNA 2A0CX 2BMCA 4L45A 4E4NA 3F5UA 2XEYA 1ATPE 5KKRB 3KEXA 3A60A 2HCKA 1T46A 4EH3A 4BKYA 1TQIA 3C0IA 4GT5A 3VUKA 5E8UA 4EOQA 4PNKA 5BYZA 3RGFA 5IZFA 1M14A 4HCVA 4M69B 2HAKA 3VUGA 4FE2A 1ND4A 4O7WA 3FJQE 5I9ZA 4WBOA 5K0KA 3PUPA 5B0XA 4C4GA 4C36A 4O7RA 3JY9A 2W1EA 2XJ2A 2PSQA 1KV1A 3QD4A 4ANMA 1O6YA 3CS9A 4R6VA 5FEEA 5GIPE 4FIFA 3C1XA 3R22A 4IFCA 4MF1A 4ASEA 4E4XA 5DNRA 4CKJA 3EZRA 5CEMA 3QQJA 4AT4A 4EH7A 1Y6AA 4BDIA 2C69A 4ID7A 5EYKA 4DT8A 2XM8A 1KOAA 1M2RA 3DBCA 3E87A 1UNHA 3U8WA 4H36A 3UIUA 2BFYA 3G6HA 4R3RA 5AR4A 4CLIA 4YUQA 2YJRA 3ZDUA 3FSKA 4K11A 4ASXA 5K5NA 1OKYA 4QMYA 3E8CA 3W2OA 2OIBA 4EH8A 2XIRA 1PXJA 3EL8A 4F1TA 4GYGA 4RX7A 4E8AA 3BCEA 4ERKA 3MH1A 4F7JA 2VWIA 4UMTA 5H3QA 3I1AA 3NS9A 4FV0A 3T3VA 4AW2A 2H6DA 1OITA 2RFNA 2IG7A 3A4OX 4YP8A 5JGBA 1YDSE 3NLBA 4X3FC 4PNIA 3C4EA 4MNFA 4ZTMA 3QKLA 3D9VA 4MXAA 2F2UA 3ZZWA 4G1WA 4JBPA 4KKEA 2WTKB 3GENA 3HNGA 4YZDA 3UVPA 4BIDA 2BAJA 4I41A 2HELA 3MPTA 1YOMA 1PXOA 5GZ9A 1RW8A 5G1XA 3KGAA 1KE5A 3E3BX 3NX8A 3OROA 4GS6A 4LM5A 4YJVA 5AJQA 2ZDTA 3QLFA 1VEBA 2R0UA 3FC1X 2JC6A 4FZFB 3OZ6A 3AC5A 4P4CA 1TKIA 4LG4A 2UW5A 2XB7A 3PIZA 5DA3A 3IK3A 2X4FA 3TNWA 5LOHA 1OIUA 3IW7A 3LQ8A 2YM7A 5HKMA 4ACDA 4FSRA 3RPSA 2VWXA 2C68A 2BTRA 1PKDA 3MFRA 4GIHA 3VQHA 1ZMVA 2CGWA 2OXYA 5IH5A 4ZP5A 2G1TA 4BTJA 1WFCA 1PXMA 4I24A 1Q3DA 4RA4A 5IISA 2X4ZA 4J53A 2PZIA 5HLWA 1QPJA 2OSCA 4ACCA 3D4QA 4EH9A 1IAJA 2GMXA 1JOWB 2QLQA 5M4IA 4UMPA 4QMOA 2BALA 2YIRA 3UDTA 3HEGA 2IWIA 3O8UA 3PFYA 3R9RA 3R7GA 2I0VA 3WF9A 1WVXA 4F65A 5DT3A 2WMVA 4TZRA 3ATTA 4D2TA 4PDYA 5M07A 2ESMA 2IF8A 5AAEA 4G31A 4RIWB 5AP2A 5F1ZA 5KKRC 4U45A 4JQ8A 5FTOA 3U55A 2YZAA 3S1HA 3FLWA 3F3ZA 3KMWA 3DXQA 1JSTA 5E7RA 3LJ0A 4F7LA 5KCVA 4L7SA 5BVFA 3ZZEA 1ZY5A 4IX3A 3K5UA 4KIOA 5AAGA 2C3IB 5ANEA 1V0OA 3TI1A 4WRGA 1SNUA 2PK9A 3TUCA 4FV5A 1H08A 4BWKA 3IONA 5IUHA 2KTYA 1Y57A 1W82A 2O65A 5CAOA 3K3IA 1WCCA 3W33A 3COIA 4X2GA 4U43A 3ZUTA 2FO0A 3PPKA 3B2WA 4FKRA 3CD3A 4XV2A 3NYXA 3R01A 3OG7A 3GOKA 4P5ZA 5E9EA 3W0QA 1HOWA 4G5PA 2GU8A 2WPAA 4ALVA 3PG3A 3VS1A 4YU2A 2UW7A 1YOLA 3O51A 4QPMA 4DFUA 2Z7SA 2C3KA 4TYHB 1YWNA 4FZDB 4C58A 3MDYA 4AZVA 1OECA 2UZDA 2CN5A 4QYYA 3EFJA 3R7YA 4E6AA 5E1SA 2XNPA 5ANKA 3TV6A 4AXEA 2JBOA 4PPCA 4AAYA 3PP0A 2XIZA 2YEXA 3FKOA 5IUIA 1H28A 1JSVA 1OKVA 4DH5A 2VWBA 5HLNA 2HWOA 3MIYA 4JRVA 2WTKC 2A27A 1XR1A 4CZTA 2C6EA 4EEVA 4G3FA 2VWZA 4KRDA 2PMNX 1H1PA 2IVVA 4XG2A 4EBWA 3LM0A 3MB6A 3SXFA 4B8LA 3BYUA 4A4XA 1FMOE 4FMQA 2B4SB 4EJ7A 3LW0A 1URCA 3F5PA 3ZCLA 2FB8A 1FOTA 1FINA 4EWHA 2BIYA 3FE3A 1GY3A 2X0GA 5HU3A 2VAGA 3EQRA 4JG7A 5IQAA 4F7SA 2W5AA 2PMLX 5AV2A 4N6ZA 2Z7RA 2UZEA 4H58A 3DKOA 4D2PA 5AP7A 4EHGA 3UVQA 2YCFA 4E4LA 3ORLA 3TZ7A 3PIYA 4QMVA 3R8UA 3VQUA 3BL7A 4O7NA 2R7BA 5AIKA 2PYWA 2QLUA 1OIRA 3BL9A 3QTWA 1URWA 5CU2A 5AV0A 2JDSA 3LXKA 3G9NA 4RX9A 2WHBA 4TW9A 2WIPA 4DBXA 3Q6UA 4A9TA 3TUDA 2PWLA 1J1CA 1H1SA 3LCOA 4IXPA 2C3LA 2IZUA 2WXVA 4P90A 3R21A 4YC3A 4ACMA 5C4LA 4CVAA 2QOOA 3EOCA 3P78A 2CN8A 2CSNA 1H1WA 3F3WA 4CMUA 4EOMA 4CFVA 3C0GA 4L9IA 2EB2A 3DPKA 2P33A 2R3MA 4BJJB 4CYIA 4FL3A 2YZLA 1OKZA 5HCXA 2GNLA 2PVMA 3R1SA 4KKGA 4DFNA 3CSVA 4CCUA 2PVYA 3HDNA 3R8MA 1WBVA 2BFXA 4RA5A 4XBRA 4RVTA 3TT0A 1JBPE 4IB3A 4Y73A 3E63A 5HBEA 3IG7A 5I0BA 4FV6A 4MTAA 4TL0A 3KRRA 4YZMA 4E1ZA 5M4FA 3AMYA 2A19B 3TV7A 3QQFA 4ZTSA 3E7VA 4OBQA 2C6MA 4QNYA 4AFJA 1TFFA 2ZV9A 3MFTA 3BX5A 3MJ1A 3BLAA 2QOLA 3RAIA 4L7FA 2OZAB 5LMKC 1DI8A 1QL6A 1XH9A 4YHFA 5JN2A 5F9EA 4CNHA 4GKIA 3LFQA 3VIDA 4FNZA 3F2AA 4EOJA 2XF0A 2X2LA 3Q9XA 4I0SA 3VUIA 3U54A 3DXNA 5L2IA 1WAKA 3VONA 3PPZA 2W4KA 3W2SA 3TM0A 4V04A 1U54A 4DAWA 4R3PA 3IOPA 5CLPA 5H8EA 4FICA 4I6HA 2BRMA 4F9YA 3THBA 4QMZA 3VF8A 4AW0A 4EK5A 1OL5A 2XK7A 4S32A 3CY2A 3GBZA 4O27B 2J5FA 3KRXA 3PXFA 5EI2A 4AT3A 5IA2A 5L4QA 1M52A 3QX4A 4MBLA 2IZSA 2UZWE 3CGFA 3NUYA 3BGQA 3PJ1A 4O0WA 4K1BA 4MEDA 4O0RA 3RVGA 2ZFYA 5CYIA 4E5AX 3C4ZA 3KF7A 4BCGA 4U6RA 5HO6A 4L8MA 2BZIB 2O2UA 4U42A 1E1VA 1YW2A 2ONLC 2PVRA 3QALE 4FIEA 4FV1A 4IAKA 2BAKA 4AWIA 4UXLA 4D1ZA 5AP6A 2XRUA 3EN9A 5IMEA 3KQ7A 3P5JC 2J9MA 3R2YA 4DDIA 4TRLA 3MA6A 2QOFA 2YABA 3AMBA 3OFMA 4KS8A 2WNTA 3L8VA 5CU3A 1QCFA 4OTRA 3WBLA 4FIHA 3R28A 3ANQA 4FT9A 3VJNA 4A9RA 3QC9A 4EOSA 2JAMA 2WZJA 5B2MA 4XP0A 3OVVA 3TEIA 3RZFA 5EDRA 1NT2A 3JS2A 2P55A 4MQ1A 4WBBB 3A62A 1BUHA 3QUDA 3ALNA 4U81A 4CV9A 4CFUA 4L68A 2ITPA 3LFNA 3FMLA 4HYUA 4DH3A 4BGHA 1JKTA 5EM6A 3AT4A 4AOIA 3OCSA 3G0FA 4IH8A 3COHA 4CMTA 2OW3A 2VNYA 2R5TA 4G16A 4QP2A 5JQ5A 4QMQA 4CKRA 1W2CA 2VX3A 2X2KA 4L6QA 2X81A 4MXYA 5JZNA 5M4CA 4LV5A 5F94A 4TYIA 2HY0A 1XH7A 3HDMA 2UZNA 4BCPA 1WBTA 3NIZA 3OT8A 2VTOA 4Y95A 4QMMA 2PZRA 3QHRA 3TL8A 5IH4A 4NM7A 3VUDA 5M09A 3EB0A 3KMMA 4Z9LA 2VN9A 1AD5A 3SD0A 3TV4A 3HAMA 3ZLWA 2OIQA 3DKCA 4F0FA 3ORIA 4YTFA 3QAME 1ZZ2A 1S9IA 2WQEA 5M4UA 3W32A 4XG6A 4AQCA 4CTCA 3Q52A 4JG8A 5ACBC 3E93A 5C8KA 1ZWSA 2IJMA 5C27A 5CNNA 1UNGA 1K2PA 3OXTA 2WTJA 3R2BA 3M42A 2H8HA 4FTNA 1TZDA 3LMGA 3FUPA 4K0YA 5HNBA 4I1ZA 1OB3A 1OBDA 2WMUA 4RBLA 4XMOA 4A07A 4D2RA 4JL9A 4BDDA 2Y0AA 5J7HA 4YTCA 4DTAA 2WTDA 5DRDA 4JX7A 3MFSA 2OJIA 2EXEA 4YR8A 4D55A 4APCA 1YHVA 4FKJA 4QQ5A 5TOZA 4BTKA 3IW4A 4DGNA 3DCVA 1MP8A 4XG7A 3Q4ZA 2XYUA 2Y7JA 4XP2A 4ZSEA 5HD4A 1GZ8A 3KKVA 4N0SA 3HV7A 3HYHA 4FODA 3VRYA 2CKPA 3GU8A 4RJ3A 2JLDA 3VN9A 5FWKK 3TNIA 5HO7A 3W0MA 5CEIA 2VNWA 2YIWA 5L6WL 3DK3A 3KULB 4BDJA 5A4LA 3KK8A 3N51A 3TN8A 1V0PA 3NUNA 4DGGA 4ZAUA 5KMJA 4EZ7A 3UOLA 4CG8A 1ZXEA 3W2CA 5JGDA 4FTMA 4WO5A 3R8VA 4C4HA 5J95A 2XIYA 4U97A 3WYYA 4A06A 4O7LA 2ITYA 4EL9A 4RPVA 1RE8A 4GYIA 3VS0A 5BYLA 3EWHA 4XUFA 4UMRA 2VTLA 4IB1A 3FY0A 4JOAA 4XLVA 4QOXA 3HVCA 2J90A 2WFYA 2HIWA 2Y4IB 3ZBXA 2X7GA 3OD6X 1OUYA 5GZAA 4QMLA 3LVPA 3CJFA 4ENYA 1ZMUA 5EW8A 3RHXA 4ARKA 5HG8A 3VS5A 1OGUA 4YC8A 1JVPP 3ZONA 5GIOE 3KA0A 4O21A 2Q0BA 2RG6A 3VS7A 4E93A 4FKOA 2WMAA 2WMTA 5E92A 5EKOA 3LFCA 3GC8A 1BKXA 4DFYA 3WZEA 4D2SA 4GUBA 5BVEA 3F3VA 3I0QA 3PY3A 1CKJA 3QUEA 4BVUA 3AC2A 3DBEA 4BIBA 4APPA 3W0SA 4NM0A 4O0VA 2WTWA 5DEYA 3AKKA 1H01A 3QRKA 5HE2A 4V05A 1H27A 4OUCA 3NAYA 2OJGA 3MGYA 4UZDA 5CU6A 4ZXTA 5DYJA 3D0EA 4HPUE 5BV3A 4DITA 1SYKA 1OMWA 4IEBA 4IZAA 3CR0A 4K8AA 4BGGA 1M17A 3KRJA 5D41A 2J6MA 4W4VA 2YAAA 4KSPA 5CEOA 2WEIA 2WQMA 2XCHA 3UMWA 2QO2A 4QQJA 3G9LX 3GQLA 2X8DA 2Q83A 2QKWB 2R3FA 3L9PA 4USEA 5KZIA 5HTBA 2UW4A 1WBPA 4FG8A 2WMWA 2PTKA 2UZOA 4L43A 3MSSA 4BBEA 4DYMA 4AG8A 2CDZA 4RJ6A 5A4CA 2IO6A 3BRBA 3QGWA 4BCMA 3SKCA 4BY9E 3F88A 3R71A 3W18A 3HMNA 5ETAA 4FL2A 1QPCA 4A4LA 5FXSA 2GFCA 2B9FA 4XLIA 4EOLA 5ANJA 3OOMA 3S95A 3AD4A 3DAKA 1XH5A 4C2WA 3AG9A 4XP3A 4O82A 3TNPC 4W4XA 5I3OA 1KWPA 5D12A 3SRVA 4F70A 2R3KA 2XARA 3DXPA 3FLYA 5EM5A 4Z7HA 4KABA 4P5QA 4XRJA 3I0OA 2XKEA 2BKZA 3ZSIA 3LLTA 5FRIA 3ZXZA 1BLXA 3C5UA 5AV1A 5AP1A 3Q9ZA 4AN2A 4AAAA 2BIKB 1GAGA 1WVYA 2V62A 3WIKA 3R0TA 3AKLA 2XUUA 1UV5A 3OUKA 3QQUA 5T68A 5TO8A 4BHNA 5K4JA 2W17A 4WOVA 3UZPA 2XAOA 2VRXA 4M8TA 1QPDA 1G8SA 3E64A 3OHTA 2RL5A 1PRYA 4FKVA 1OZ1A 4J98A 3V5LA 3BEAA 3RCJA 2C6DA 4XBUA 4F6UA 3LFEA 5EHYA 3S0OA 4EOKA 3OBGA 4F64A 3UO4A 4CT2A 4WG4A 1H07A 1XBCA 3AOXA 1Q8UA 3ALOA 2Y4IC 1PMNA 2OU7A 2ITZA 4IM3A 4LQMA 3ZC6A 4IAIA 1LP4A 4LOPA 1M2QA 2PZ5A 3CBLA 3QD2B 4Y83A 1ZAOA 4QP6A 2XBJA 2X39A 4EUUA 2JD5A 3VBQA 1WBSA 3W0OA 3VHKA 4N4SA 2G01A 4O7ZA 4AN3A 5CS6A 4TPTA 3DNEA 4X6RA 5HGIA 1JLUE 3G5DA 2QU5A 4PDPA 4PMMA 5EI8A 3GNIB 4GH2A 3FXXA 5HE1A 4C37A 3EMGA 4CQGA 2OBJA 4OLIA 3UBDA 2CPKE 4RZWA 3NFGB 4XG9A 4FIIA 3N9XA 5DN3A 5CSVA 2XP2A 3LXNA 5KMOA 4KIKB 4F1OA 3H30A 3FPQA 3SGCA 4FOBA 3PG1A 2W05A 2GHGA 4QQCA 5A4EA 4LOQA 2YAKA 4O91A 4WUNA 5CENA 3GCUA 2VTJA 3R1NA 4ZEGA 2AYPA 3HMPA 2X8IA 3D7ZA 4YLKA 3P0MA 3ZM9A 5AP4A 3R83A 2PUPA 3NYOA 4ZMFA 2X9EA 2ZMDA 4GT4A 4G3DA 3I5NA 5CZIA 2W5HA 5HE0A 4PPAA 1R39A 4IDTA 2J51A 1JSUA 5GNKA 4GV1A 3HUBA 4W9WA 3GU4A 2I1MA 2P4IA 5AX3A 3PTGA 1R0PA 4DEHA 4FKGA 4R77A 4FBXA 3O17A 4GT3A 3NUPA 3ATSA 3DLZA 3WF6A 3LCKA 3QTRA 2FVDA 4IIRA 1CMKE 4JR7A 3UOKA 2ITVA 3RK7A 4Q9ZA 4NM5A 5J9ZA 5DR6A 5JEBA 3G6GA 3UNJA 4AE6A 4JXFA 1OIQA 2GNFA 3PE2A 3D14A 1VYZA 4E4MA 3H3CA 3CLYA 4CD0A 2PHKA 2QG5A 3W2QA 1MRVA 4EYMA 2NPQA 2F49A 2XIKA 2VO7A 4XV9A 4PTEA 1GZKA 4N6YA 4ANLA 4IDVA 2VWVA 5E90A 3C0HA 5KBQA 1IRKA 4DG0E 4ITHA 4PP7A 3WF8A 1J7IA 4IQ6A 1FQ1B 4UYAA 4WUAA 2C47A 3Q6WA 3KN5A 4C2VA 4FG7A 4QPSA 3ZHPC 5I9XA 4BGQA 4M97A 4O2PA 5DI1A 3UZTA 2VV9A 3W0NA 2QHMA 4H3PA 3QXPA 2ZM1A 5JK3A 2VTIA 3HV6A 3OXZA 5HIDA 1P5EA 5AR8A 3C4FA 1YI3A 2VUWA 2Y6OA 3EFKA 2BVAA 1H4LA 5CWZA 2B52A 1WZYA 3BQRA 4CT1A 1L3RE 2XNGA 3QC4A 4MD8E 4OW8A 2KULA 5M44A 3L8PA 4LRMA 1Z9XA 4DGOA 5BYYA 2H9VA 2JBPA 4LUEA 4PX6A 3RAWA 4DH7A 3SA0A 2JITA 3V8TA 3H9OA 3U4UA 2V0DA 2O8YA 4LRKA 3PDTA 4AXDA 4JI9A 4DN5A 4YZNA 3LCSA 4RIXA 2HYYA 4MD7E 5LARA 5E8SA 3DGKA 1J3HA 4EORA 4EONA 3PJ2A 2OH0E 4K18A 4S31A 1HCKA 4OTHA 4YZCA 3UPZA 4QP3A 3RI1A 4F08A 3V6SA 2CGXA 2W4JA 1NA7A 3BELA 2HW6A 4K77A 4UWCA 1XBAA 1U4DA 2BRNA 2VTSA 2HZNA 2XYNA 4RJ8A 4WHZA 1W7HA 3ZC5A 3QTSA 5LVOA 3PXZA 4KIPA 4Z55A 1SZMA 4BCNA 1PMUA 2ZJWA 5HVYA 4QQTA 3ROYA 3QRUA 3OBJA 1FVTA 3DQXA 3N4TA 2IW9A 2HY81 3KMUA 4DH8A 4UWYA 5E4HA 1WMKA 2CKEA 4IVAA 3MH2A 3ETAA 4U7ZA 3MS9A 1OL1A 1KE9A 5CAVA 2PMIA 3BLQA 4FL1A 2A1AB 4F4PA 3GQIA 3ZOSA 4G5JA 4BI2A 4FVPA 3LKMA 4PMPA 1B6CB 3UE4A 1XWSA 3SXRA 2QVSE 2WTVA 3PZHA 4ZTHA 3Q3BA 3V5JA 4DHZA 1F5QA 3TTJA 3G33A 2JDOA 1KV2A 2UZUE 5D7AA 4DEIA 4J95A 2IVSA 5IF1A 3AT2A 4EZ3A 3HAVA 3CPCA 4ONAA 3GU6A 3WF5A 3NVMB 4YO6A 3S00A 4FTUA 4TKSA 1P2AA 2HW7A 3UDBA 2RFDA 5L6OA 5HOAA 3I60A 2CCHA 1YI6A 3DNDA 2JIVA 4RWKA 3I5ZA 4JAJA 4LGDA 3VW8A 3U6HA 3MJ2A 4BCHA 4D4VA 4MD9E 4FKQA 2XK3A 2R7IA 3OMVA 3UG2A 4HVIA 5ICPA 3HP5A 3DKGA 2UW9A 3R7EA 5IA4A 2ITOA 4FKTA 1Y91A 3QD3A 4GRBA 4RIOA 1DS5A 4W8DA 4ZY6A 1I44A 4D28A 4I3ZA 3MBLA 1XH4A 4C3PA 4HGLA 3TTIA 1NW1A 5AR7A 3PSCA 3RM6A 5LVPA 3UQFA 2UW0A 3SXSA 4ORKA 4FC0A 4RSSA 2FSOX 2JGZA 2NO3A 4ITIA 4BCKA 3DQWA 4FGBA 4U80A 2BKKA 5KZ0A 1W0XC 3OCGA 3U51A 4MNEA 4NT4A 3QCYA 2E9UA 4DTBA 3DAJA 4GIIA 1FGIA 3IGGA 3CY3A 3HKOA 2Y9QA 1Z5MA 2IVUA 5IMXA 4XV3A 5GZ8A 1J91A 3LE6A 4LOOA 5HX6A 5LWNA 5M51A 5EYDA 2W1HA 3QF9A 3EL7A 2QODA 3Q9YA 2GQGA 2EXMA 4AXFA 3I79A 2CLQA 3VHEA 4O4DA 5EKNA 1EH4A 2X7FA 3JVRA 2XK4A 3LPBA 3C4WA 3NCZA 3VBYA 1YQJA 3OWKA 2G9XA 4FV8A 4F7NA 3TKUA 5FDPA 5BNJA 3FPMA 4AW5A 5BUEA 5AUTA 5DH3A 3FYJX 5GJDA 4YZ9A 3L1SA 4LGHA 4V0GB 5ETCA 4PF4A 1OI9A 3L9MA 4WG5A 5EDQA 5FQDC 3DT1A 2PZYA 3F61A 3W55A 3DLSA 4AZTA 5BVNA 4HCTA 4JNWA 4L52A 4ZZOA 3QCSA 4FSYA 5K5XA 5AUYA 2J4ZA 3QZGA 4RVKA 4BYIA 3OCTA 3QZIA 4OAVB 4OTPA 4NU1A 3MY1A 4ZTQA 2QI8A 5HBJA 4X2JA 3Q5ZA 2ETRA 3FC2A 3JXWA 4FSZA 4NTTA 2W9FB 1KE8A 4J52A 3HA8A 2XH5A 3ML1A 1UNLA 3D2KA 5AIRA 2B53A 3ZBFA 3OY1A 4FIGA 3Q5IA 4UYNA 2EVAA 3NUXA 3VW6A 4EC8A 2I6LA 4D1XA 4Y5QA 3O0GA 2C5XA 3RP9A 3OT3A 4JBQA 4GU9A 5AEPA 4ZZNA 4HVHA 1W2FA 3KU2A 4G3CA 4RJ4A 1MRYA 5HO8A 3TXOA 3P7BA 2RSVA 3W0PA 3NUUA 1Q99A 2FSTX 4IZYA 3W8QA 2PUIA 4W4YA 4YJOA 2VO6A 1UWHA 5BVKA 4MH7A 4PMTA 4TWCA 4F1MA 4NKSA 4UB7A 4BCFA 5J8IA 4DEGA 3FEGA 4FSQA 2CKQA 4G9RA 4DEDA 1LEZA 4FTKA 4IVBA 3GI3A 3UDZA 4BDBA 3ENHA 3OY3A 4GG7A 4J71A 3MI9A 5E1EA 3DKFA 1GZNA 5CT7A 4OGRA 4DG3E 3M1SA 3K3JA 4IWOA 4DHIB 5FXQA 4X2FA 1CDKA 3EQFA 4YJRA 4U0IA 1XQZA 3TACA 4IC7A 4L67A 1OGYA 2PVJA 3LQ5A 3NYNA 4FKIA 3M11A 3SAYA 1BI7A 3D5UA 3DY7A 3QFVA 4WG3A 3A2CA 1VJYA 2ITXA 4AU8A 4S2ZA 4U41A 4QMUA 4GSBA 4BZDA 3P79A 1GIIA 3ZU7A 4F0IA 1H1RA 4RZVA 4O84A 2PVHA 3TWJA 4J96A 3SQQA 5FXRA 3BYOA 5CTPA 5F4NA 3F66A 2HXLA 3KXZA 4E3CA 2Z02A 3BBWA 3RZBA 4ERWA 3DBQA 4BZOA 2I40A 1JPAA 4NCTC 3C9WA 2H34A 2WB8A 3LHJA 2IW6A 3TYKA 1VR2A 2XKFA 2XNEA 4FTRA 4QDEA 4B7TA 2YM5A 3R9NA 1KE6A 3HLLA 4ZTRA 3G90X 4BN1A 2OXDA 3BYSA 3HRBA 2Y6MA 3UC3A 5EHOA 4DH1A 4IVDA 2RF9A 5L2WA 5FUTA 3E7OA 2E9OA 4YNOA 4X3FA 3CEKA 2BDJA 3PLAE 3WZDA 3O7LB 3QZFA 3LQ3A 3Q2JA 3QWKA 2PVFA 2W5BA 5CU0A 3WI6A 3OF0A 5I9YA 1F0QA 2REIA 3LXPA 4PPBA 3C51A 4QTDA 4J7BA 3NPCA 4I5HA 2IZTA 5LWMA 3SRVB 2F4JA 3JR1A 3V6RA 3QQLA 4QYGA 4WNMA 4Y46A 2JKMA 3RPOA 5CU4A 4EH5A 1JKKA 4E6QA 4FV7A 4I4FA 3IO7A 4D2WA 3PSDA 3GT8A 4DBNA 4EWQA 2W1GA 2UVXA 2FH9A 4C4JA 5LXMA 3G15A 2R3LA 3TKIA 2R64A 5AUUA 2ZVAA 4NZWB 3QCXA 3RK5A 4CKIA 3ANRA 4XG3A 3HRFA 4NJ3A 4F09A 3RTPA 3PXRA 3FL5A 3CQEA 1TVOA 3ZFXA 4A4OA 3I7CA 4DFBA 4Y72A 4O7TA 2V7OA 5BQ0A 1CM8A 2J0LA 1ERKA 4FSMA 4JR3A 1PXLA 4BBFA 3DK7A 2GHMA 3MTLA 5M55A 4ZS0A 3WE4A 2QURA 3Q4TA 3G51