3L1SA

3-aryl-4-(arylhydrazono)-1h-pyrazol-5-ones: highly ligand efficient and potent inhibitors of gsk3
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
360
structure length
336
Chain Sequence
SMKVSRDSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogen synthase kinase-3 beta
publication title 3-Aryl-4-(arylhydrazono)-1H-pyrazol-5-ones: Highly ligand efficient and potent inhibitors of GSK3beta.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 336
sequence length 360
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3l1sA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3l1sA01
3CTQA 3DKCA 2Z02A 5E8XA 3HMNA 3NAXA 4NT4A 4QP6A 3MVJA 3EN5A 4MF0A 4Y8DA 3D7TA 1XH6A 4N4SA 3QL8A 3ATTA 3DBDA 4ZLOA 5C26A 3W32A 4DFNA 2XRUA 3H10A 3ZRMA 2V62A 3KGAA 4I6HA 1YI6A 3ZO4A 5IEYA 2ZDUA 2BRNA 2Y9QA 4NU1A 3WZDA 4Y72A 2VTNA 2NNWB 3IQ7A 4O0UA 1NT2A 3OCTA 4J96A 3LQ8A 1YOJA 4L3LA 4QMMA 4FTNA 3AC1A 3JYAA 5DR2A 5HBEA 3CSVA 3PY0A 3CY3A 2I7QA 5LJJA 4F9BA 5HO6A 4GEOA 4ZTLA 2XF0A 2QONA 5KBQA 1ZZ2A 3MJ2A 4ZOGA 5AUVA 4QP4A 3FKNA 3WIKA 4ANBA 3C13A 5BNJA 2Y6OA 4E8AA 2NRUA 3TI1A 3O7LD 4QTBA 3B8QA 2YIYA 2ZM3A 4IZYA 2W1CA 3LJ2A 4ERKA 5LVMA 3ODYX 4L3PA 3LQ3A 3RWQA 3QQUA 5AM6A 3LJ0A 5TT7A 4U40A 2QG7A 1XH7A 5LARA 4DGNA 4EQMA 2PUUA 1Y8YA 5AUWA 5J79A 4G9CA 2ITWA 1F3MC 3R2YA 1YW2A 4WHZA 2UZTA 2HY0A 3MYGA 4J1RA 3R7EA 4F1TA 5I9VA 4W8DA 4B8MA 3PE2A 4YTIA 2X8DA 3MH3A 3LFDA 5CZHA 1Q8TA 1TKIA 3GFEA 4W4VA 3R8VA 2YJSA 3FUPA 3N4TA 4WRSA 5B2LA 4YSJA 1PMUA 3HX4A 4NK9A 2UW3A 3VBQA 5HKMA 4ZJIA 3MFUA 1O6LA 5LVNA 3ZCLA 3OROA 3BU3A 2GQRA 3ACKA 4IIRA 2VX1A 5CALA 3CKWA 5JKGA 4EZ5A 3QA8A 5ETFA 4RIXA 4PNKA 4DGMA 4ENXA 4KUJA 4FT0A 4AA4A 3Q52A 3HV3A 5HIEA 3FQEA 3NRMA 4F64A 4O38A 4PX6A 2UZOA 3DFCB 4F9CA 3FL5A 3MVHA 3PG3A 3MIYA 4O82A 3DJ6A 5ANDA 5K5NA 1YXVA 2JAVA 2R3LA 4FZ7A 5L2QA 3W2PA 1BUHA 2R3FA 4UYNA 4B6LA 4ID7A 4BI2A 5JFWA 3SW4A 1OITA 4LV5A 2VTHA 3NCGA 4R78A 4M66A 2X2MA 3MY0A 3AMYA 3HEGA 2PYWA 3R6XA 4E5AX 4ZJVA 3VW6A 4OBQA 3EFWA 3RPSA 2RFEA 1PXJA 3EZRA 3G33A 4EOSA 2R0UA 3CR0A 4IFCA 2FVDA 2PMLX 4IB0A 1T45A 5F4NA 4ANLA 3D5VA 3JR1A 1A9UA 1H26A 4TYEA 3OY3A 3ET7A 4UWYA 1FQ1B 2PTKA 5M56A 3EH9A 3UP7A 4O0XA 5I0BA 4UWBA 2UW6A 3R7UA 4XV3A 3QAME 2G15A 4IAZA 3TL8A 3G6HA 1HOWA 2PVNA 2OJIA 1M2PA 4BCHA 4E5WA 5LCJA 1DI8A 4FYNA 2F4JA 3ZZEA 2X8IA 5I9YA 3DTCA 3VAPA 4CYIA 3IW8A 4I0TA 3I0OA 3I5NA 4DLIA 2C6LA 4QMQA 5AEPA 3F9NA 1REKA 5KKRB 2C1AA 2PVFA 3OUKA 4Q5HA 3WARA 2ITQA 2V7OA 3O96A 4FSYA 3LM0A 3E3BX 4G3EA 3FQSA 3PJ2A 5AV3A 4YNOA 4XG8A 4YJPA 4AW2A 4EOJA 3KULA 1BI8A 4XEYA 2WEVA 3EFKA 4U9AA 2HZ4A 5KHWA 3RAHA 3UZRA 4II5A 4AGUA 1KE5A 3CY2A 2JIVA 4IVDA 3KCFA 5DA3A 3LMIA 4APCA 1RDQE 3I6UA 3QALE 4JLCA 5EM8A 4ENYA 4AFJA 4YZCA 2BAQA 2YIWA 3EQRA 1WBNA 3LFEA 3OBJA 4UZHA 5M53A 3FZPA 3FZRA 4WNKA 3VO3A 4RJ6A 2R3QA 2JD5A 1DAYA 3C4XA 3HLLA 4O27B 4AXAA 2H9VA 4C61A 1OECA 2IZTA 1ZLTA 1CKPA 1P2AA 5M09A 4FZFB 1PMEA 3RNYA 3UP2A 1OM1A 4L01A 2R7IA 2QI8A 3DB8A 4QMXA 4EYJA 1BI7A 4FICA 4TYJA 5FEDA 3TDVA 4FC0A 2W5BA 3EQCA 3NS9A 4X6RA 1R0EA 3F7ZA 2B1PA 4RWJA 1ND4A 5I9WA 3EL7A 2GNLA 2X2KA 3Q9WA 1U54B 2BROA 3P86A 3FLNC 5IEVA 4BIEA 2IW6A 3VUKA 4C8BA 5KMLA 4J53A 4F1MA 2CKPA 4QMLA 2IVTA 2WQBA 3F5GA 4CQEA 4YBKA 4YGAA 1OIUA 4O7LA 1YOMA 5B2MA 2VWYA 4N6YA 4BCMA 3NNWA 4L8MA 2J0LA 2RFDA 5A3XA 3PWDA 4MXXA 2ETKA 5CEKA 5ANGA 1OIYA 4RBLA 3VUHA 3PIZA 5CX9A 3GENA 3H4JA 4TNBA 3QTZA 4KRCA 1Y6BA 3UOJA 5CVFA 2DUVA 2X7FA 2JDVA 3DQWA 1WBWA 2H34A 4XG2A 5JN2A 4GSBA 4OT5A 3C7QA 3C5IA 4EORA 3SRVB 4GJ3A 4FIFA 4IWDA 4CFFA 2FH9A 3O23A 5F1ZA 3ZM4A 2CHLA 3GBZA 3I81A 4J97A 4F6UA 3HV4A 1RJBA 2JAMA 4RMZA 3LFBA 4L7FA 2VWWA 3HVCA 2WMAA 4BDBA 2OICA 4GW8A 4YJOA 5IG1A 2W5HA 4FIIA 5AUTA 4HYSA 5HLPA 1H4LA 3VUMA 5IUGA 4WBOA 4DH7A 4RWKA 4FTKA 2IW8A 4C34A 3L8VA 4X2GA 3FXXA 4C3PA 4ZSEA 4RC4A 4ZY5A 5AV0A 4G6OA 1WVWA 5TF9A 5FTGA 2WQOA 4CGAA 2O8YA 4D55A 3ANQA 3VRZA 1G5SA 2GDOA 2GNGA 4JXFA 3DTWA 2WMQA 3KU2A 4UB7A 3G0FA 3K5VA 4AAAA 4DE4A 3VUTA 5HE1A 5IH5A 4CT2A 4EUUA 2OGVA 4RX8A 4MF1A 3VS6A 5K5XA 1OIQA 2PMNX 5C8NA 2C5OA 5H3QA 4K18A 2W1IA 4BTKA 4XRJA 2C3JA 2JDRA 4FZAB 4JAIA 3WOWA 3ZMMA 2UV2A 3CS9A 2P2HA 2XM8A 4ACMA 3AOXA 4D9UA 3VJNA 3U6HA 3F2RA 4FIEA 4GV1A 4RIWB 3UC3A 1WZYA 2JITA 3ORIA 2IG7A 3BX5A 1V1KA 5EI6A 2XNNA 4CFNA 3EJ1A 2ERKA 3KF7A 1S9IA 2A27A 3DK3A 5FP6A 3LZBA 1WBTA 4UZDA 3ROCA 2ZV7A 3O8TA 4IEBA 4CFXA 2R3JA 5E8TA 4WNPA 3P5KA 4FEQA 3PXFA 2WTJA 4L52A 2HWPA 3RJCA 3MVLA 5J7BA 4CZYB 2C6DA 3QUDA 1L8TA 2WTCA 3F61A 3LCSA 5CQWA 3JVRA 3OTUA 4F4PA 2XCHA 3O8PA 5I9XA 3A61A 2VTRA 4RT7A 3MH1A 2QR7A 2XIYA 4HOKA 4EKLA 3UJGA 2R3RA 2W4KA 4CRLA 3FMDA 3NUSA 2P4IA 1UWHA 4MD8E 5A4LA 4H36A 3VBYA 2P3GX 2QNJA 5TR6A 5JZNA 5HVKA 4PL5A 4HZRA 4W8EA 4GFGA 3LXNA 2PE2A 3GNIB 4EZ3A 2Z8CA 3LPBA 4G6NA 4I0SA 4WG3A 3OC1A 5JFSA 3LCTA 3WF7A 3VS7A 2QOCA 5FGKA 4HZSA 3CTHA 4XCUA 4CXAA 3T9IA 1CKJA 2GS7A 2X7GA 1OZ1A 4I94A 5HVJA 3BKBA 2Z7LA 4QP7A 2VTMA 3NPCA 2F7EE 2J5EA 3W2SA 5HI2A 3S3IA 4APPA 3UNKA 4CEGA 5AP7A 2JKKA 3RCJA 5HLNA 1YDSE 3GCUA 4E4NA 5E1SA 4FNYA 1IA9A 1JVPP 2YDKA 2GS2A 2V22A 4RZWA 4ERWA 2Y7JA 5JFXA 3FKLA 2HOGA 1MUOA 3QRUA 4RJ8A 1OMWA 5CNOA 5HD7A 4MWHA 4BIBA 4PNIA 1OBDA 4FVRA 2W9FB 4EK4A 1REJA 1TQMA 4IX3A 3FEGA 4XV9A 2G2HA 2IZSA 3H0YA 4CFUA 5AUUA 4E3CA 1BYGA 3SDJA 4F9YA 4FTRA 3F5XA 5JSMA 3RI1A 2GTMA 3DU8A 3FI2A 3AC8A 4X7QA 3UYTA 4PPCA 2ITTA 4LGDA 2JEDA 1AD5A 3TIYA 4BGGA 4ZIMA 4AZFA 1R0PA 3BIZA 3N4UA 4WO5A 3ZRKA 3EZVA 4XBRA 2ZB0A 3DK6A 5LCKA 5C27A 3R71A 4EHEA 1OKYA 3DLZA 4GK3A 4ZS0A 3QKLA 3F3ZA 5AWMA 2QOLA 4ANSA 2J0KA 3BBWA 3TZMA 4R77A 4DEIA 2YABA 4MD7E 4USEA 2X8EA 3LFQA 4I6FA 4S31A 5AJQA 4C3RA 4JVGA 4JIKA 2R3MA 3DB6A 3HP5A 5FTOA 3PG1A 1JPAA 4NM7A 3HP2A 4LMNA 3A62A 4RZVA 4O7SA 5KKRC 1ZAOA 4RVKA 5FD2A 5KZIA 4FV1A 3W16A 4AA5A 5HCYA 4QMVA 5HTBA 5KCVA 5CASA 3HDNA 3BWFA 4IQ6A 5K4JA 3PP1A 2C1BA 4O96A 4UV0A 3G0EA 3UQCA 3PA4A 3QFVA 3V6SA 4F1OA 3LKMA 4EK6A 3TKIA 5E1EA 5ACKA 3TNQB 4IX4A 4Q2AA 2OFVA 2RKUA 5CZIA 3S4QA 4BDDA 2YWVA 4K1BA 5IUIA 5JGAA 2LGCA 4YBJA 4NWMA 4XG6A 5HORA 3UIMA 5M57A 3AT4A 2W9ZB 4QT1A 2ZMCA 4ITJA 2VGPA 2WEIA 5LMKC 5EDPA 5AP3A 4KD1A 1LEZA 5CU6A 4RX5A 4AFEA 3TUDA 5HG7A 4OW8A 5HG9A 3SXFA 5GJGA 4FG8A 4DHFA 1NVQA 1LP4A 3C4WA 1SNUA 2B53A 4FBXA 4AGDA 3CQUA 3EN7A 3FAAA 3ZBXA 4ZTMA 2WTVA 2YIRA 4EHZA 3LCOA 2VTJA 2QU5A 1H1RA 3RKBA 2OJJA 5ETIA 3E63A 1KOBA 2B7AA 2GFSA 4X2KA 2C6OA 3C0HA 4UBAA 2OSCA 2XH5A 3H9FA 3FMHA 1GZOA 5E8SA 5GIPE 3HRFA 4FTLA 3VRYA 3JY0A 3G9NA 4IX6A 4QTDA 1IAHA 4O84A 2ZV2A 2X4FA 4YJSA 3MA3A 4BC6A 5CF4A 3DDPA 2WKMA 3OOMA 3QLFA 4RJ7A 5KMOA 3HMIA 1G8AA 3TKHA 4FMQA 4IJ9A 5EHOA 5JH6A 3D0EA 4BDFA 1DAWA 4DEHA 4MK0A 5J9YA 4M0YA 2R3HA 1UWJA 1H1WA 2J50A 4EH8A 1ZMUA 2H6DA 2X39A 2SRCA 2AC5A 3VS5A 4YO4A 4EWQA 1URWA 1YWRA 1E1XA 3NWWA 2OFUA 5AIKA 3ZO1A 3F6XA 4O2ZA 4E93A 2PZYA 2YCRA 4LRKA 1OPLA 4KINA 2PUNA 2FGIA 4DBXA 3SX9A 1PYEA 1Y57A 1GIJA 3EQFA 2UW0A 4D4SA 5AM7A 3RM7A 2JKMA 4P2KA 4XBUA 2WTWA 3HL7A 5LMAA 3VS1A 2YA9A 3A7FA 3ZUTA 4FKUA 4YMJA 5AA9A 4BHZA 4JDKA 4PRJA 1W83A 3RPRA 4RQKA 3NUYA 4YU2A 5M51A 4XV2A 4QQTA 1FOTA 1DM2A 4XG7A 3UVRA 4O7VA 1NA7A 1JKTA 3F66A 1KV1A 1W8CA 3MFRA 5D12A 3HDMA 4IAFA 4XG9A 3IW5A 4WIHA 4FEUA 4I24A 1ZYCA 3KB7A 3VQUA 4NKSA 4AZWA 4HGEA 4FTUA 5E4HA 4DCAA 1UNLA 4J71A 4G5PA 4KA3A 5AV1A 1T46A 3SVVA 4I4EA 5CAVA 4HGTA 4WKQA 4OTIA 3HMMA 2P2IA 3QYZA 5EFQA 3HRBA 4FIHA 4GFMA 1NXKA 2PZ5A 3QGYA 3KN6A 2A0CX 4RWIA 4C4EA 4DG3E 2JFLA 3JVSA 2VX0A 5GZ9A 4EWHA 4FK3A 3PJ8A 2ZOQA 5EHLA 3TZ8A 3BE9A 3V5LA 4BBEA 5CQUA 1JOWB 2E9VA 4JI9A 4QMUA 4RRVA 5C8MA 5CS6A 4YJUA 3HMOA 3QRJA 4FV8A 5AFVA 4OAUC 3KK8A 1QPJA 1ZMVA 4FGBA 5ICPA 5DT0A 3VHKA 1XQZA 4ITIA 3VW8A 1XR1A 5E7RA 2BR1A 4E1ZA 3M1SA 4UMQA 5FLFA 4A4XA 3FWQA 3DFAA 5GZ8A 5AP1A 3LLAA 4V01A 4QMSA 2I0HA 2ZJWA 5LMKA 4ZAUA 3TTJA 2QG5A 4ZTQA 3SXSA 5BVDA 4FNZA 3UQGA 4G1WA 4M14A 5EYKA 2IVSA 4EBVA 3ZM9A 1I44A 2WFYA 2VTOA 5HICA 1YRPA 2PE1A 4U43A 5CAOA 5E8YA 2RIOA 3EQPA 4BHNA 4LFIA 3FPQA 3WZUA 4J7BA 2B54A 1U54A 4IH8A 4FKRA 4P90A 4IMYA 2CN8A 2B52A 5FWKK 1KOAA 2ZDTA 3ENMA 3PXQA 2UVYA 3VUGA 4AS0A 2BIKB 3QQGA 2XZSA 2ZAZA 3W18A 1R39A 2OF4A 4QQCA 3QCXA 4UMTA 4EOQA 2WB8A 3DXQA 2J6MA 4YLJA 5HU3A 3A8XA 3R28A 4FIJA 3V5QA 3EFLA 2ITZA 3BGZA 4F0IA 3KA0A 3R22A 4GVJA 4MXYA 4P5QA 3TKUA 4FTCA 1SNXA 4FL2A 1ZY5A 5DNRA 3Q96A 4ZMFA 2WXVA 2XIZA 3P4KA 2OIBA 4ARKA 5EK7A 3PVUA 2RFNA 3SV0A 2CGWA 2QURA 4IWQA 3ULZA 5A6OA 5EM7A 3AC5A 4C62A 3POZA 3LHJA 4G6LA 3UPZA 4TYHB 1BLXA 3ORTA 3HUBA 4IZ5A 4X2NA 4FYOA 5HEZA 3SRVA 4CLJA 1ATPE 3THBA 3ZYAA 5KMMA 1SM2A 3VF8A 4D2WA 4EHGA 5B0XA 4V05A 5E92A 3K3JA 3CE3A 3FLSA 1XO2B 3QWKA 2O64A 3ZFMA 2BIYA 3FYJX 5L8KA 4CRSA 4ZS4A 3CLYA 2RF9A 2PVMA 4L7SA 5DVRA 3ZHPC 3H9RA 4I5PA 4JAJA 3ZUVA 3Q2JA 4EOKA 4BYIA 4WOVA 2W4OA 4OBOA 5HCZA 4ZY6A 3TACA 2F9GA 4KS7A 2VNWA 2UZWE 3OMVA 4FTMA 3LCKA 5GZAA 2XEZA 5IEXA 4O7TA 2QODA 3NYOA 2VD5A 3ZOSA 4AT3A 1WBVA 4IWOA 3KXZA 3GU4A 4GUBA 5AA8A 4IM3A 4N70A 2ACXA 2BCJA 2OKRA 4KS8A 4BCNA 2I6LA 3I4BA 5KUPA 1J91A 5ANOA 3HA6A 3ACJA 3TNIA 2YN8A 1JSVA 5AR2A 5FEQA 4OAVB 4Y46A 3TDWA 1VEBA 4TYGA 3IDBA 3L9NA 3VVHA 2C0IA 1YKRA 2G01A 2W1ZA 4LL0A 3AD4A 3W2CA 3HV6A 3KXHA 3I7CA 3E7VA 5IQGA 3I7BA 3OWLA 3K5UA 4TRLA 3E88A 4RIWA 1STCE 3EKNA 5FM3A 5JQ5A 4U0IA 3V5PA 3WE4A 5J9ZA 5I9ZA 1PHKA 3K54A 4MNEB 4Y95A 4CSVA 5K0XA 3ZLSA 4HCTA 4DT9A 5L6OA 4IADA 3KY2A 2VX3A 5J8IA 3NIZA 1OB3A 4RX7A 3C5UA 3PZEA 3TV4A 4H58A 4HYIA 3WF5A 2XKEA 1JKLA 3AGLA 3KQ7A 1DI9A 3PJ3A 3IDCA 2W0JA 1AQ1A 4J52A 4DEGA 2ZM1A 3BGPA 4AZVA 2UZDA 4KBKA 2V0DA 4ZZNA 3S0OA 5IQCA 4W4YA 3P0MA 3WZJA 3QQJA 5FG8A 4V0GB 1P4OA 2Q83A 4MEDA 3DGKA 3CD3A 5D41A 4D1SA 3N4VA 3R1QA 3FDNA 1ZMWA 3BQCA 3JPVA 3V8TA 1Z5MA 2FO0A 2OXXA 3F5UA 4FOCA 4UWCA 2VO7A 1XH8A 4IX5A 2UZLA 2VWIA 5ANKA 2A19B 4EJNA 3AC3A 3M11A 3QQLA 3ZSIA 3S95A 3U87A 4BIDA 3GU7A 4IVCA 3CQWA 1HCLA 3HV5A 4RFZA 3MPTA 2PWLA 4JG6A 3R9HA 3FC2A 3DOGA 5CWZA 4AN9A 4AT4A 4BCPA 3IW6A 1UV5A 3IONA 3NYXA 4NYEA 4GS6A 2RSVA 2XNOA 2AYPA 4NW6A 4I93A 4IAIA 3DZQA 3QX2A 2JKQA 3ZLYA 4X21A 5CU3A 4CZTA 5EI2A 1KUTA 4KB8A 3BQRA 5ETAA 2PE0A 3F7WA 5KNJA 3QTWA 4O7NA 1UNGA 2C4GA 1Q3WA 2J51A 5HHWA 3UO6A 3V5WA 3ZLXA 4G31A 3R83A 4BVUA 4C35A 3QZIA 1OIRA 3SOCA 4LOOA 3PUPA 3L8PA 4FSUA 1U4DA 3MFSA 3Q6UA 4E6CA 3LXPA 3R01A 4O7WA 2WHBA 3W2OA 2QKWB 3UNZA 1FMKA 5A4EA 2WTDA 3V8SA 2O63A 4A9TA 4U45A 2YDJA 4TYIA 5EKOA 1WVXA 3EN6A 4Q9SA 3BELA 5CY3A 4EKKA 4NKAA 5F94A 3R1YA 2V7AA 4EC9A 5DFPA 3VQHA 3SQQA 5HE3A 1UU3A 4GMYA 4YLLA 4IB3A 4I23A 1FVVA 2JBOA 2YIQA 3FSKA 3DBQA 4X3JA 3QWJA 5FM2A 2I40A 4RJ5A 5J5SA 3GUBA 4CTCA 4FUYA 5C1QB 1J1CA 2YLEA 4AF3A 5LVPA 2ETMA 1MRVA 4AW1A 4QYGA 5IKWA 4PY1A 1YHSA 4O86A 4ZTRA 2BVAA 2GHGA 4X2JA 4RFMA 2I1MA 3RWPA 3MY1A 4AZTA 4QMYA 2BILB 3CEKA 3ODZX 4QMWA 3ZONA 2OLCA 1PXMA 3IGOA 3IPHA 3KVXA 2PZRA 5CF8A 3HNGA 2XB7A 5JK3A 2HY81 1APME 3RHKA 3KRJA 5FTQA 5M08A 4QD6A 2OZAB 4CLIA 3OTVA 5CEQA 2XNEA 2XRWA 1YQJA 1J1BA 3HMPA 4MNFA 3RNIA 3DBEA 4ZY4A 4FX3A 5FRIA 4K33A 3OHTA 1Q4LA 3ORZA 1ZARA 1YI3A 2C3IB 5CSWA 5AUYA 1H27A 4RGJA 3W8LA 3ZU7A 4L46A 1M7NA 2OF2A 4EZ7A 2GNFA 4UXLA 2BFXA 4NSTA 2G9XA 3BWJA 4WT6A 5ANJA 3BV3A 5EG3A 3NUXA 2W05A 3LFCA 2XA4A 5EYMA 3UIBA 4KWPA 4FK6A 4ANMA 3TEIA 2C5VA 4IFGA 3TM0A 4HNFA 2JKOA 3IW4A 5M4FA 2YDIA 3C4ZA 4CQGA 2XJ0A 2PUIA 3UMWA 4TWCA 2WMXA 2C6IA 2BRHA 2OXYA 2J7TA 3EQDA 3OXIA 2FSLX 2EB3A 3U8WA 4IXPA 3OW3A 4G34A 4IVBA 4QRCA 2YJRA 4XYFA 2GPHA 3W55A 5B7VA 5CAPA 4AW5A 5IH6A 5L4QA 2PHKA 2CJMA 5FDXA 1FINA 3Q4UA 4FTOA 4O91A 4B4LA 1PJKA 2FUMA 3COMA 4MXOA 3OBGA 4L42A 4A9SA 5HLWA 5IA4A 2QO9A 4EJ7A 3VC4A 4NCTC 2PVJA 5DIAA 3FQHA 4F9AA 3NZ0A 3P7AA 1MRYA 4ZLYA 3P9JA 3QC9A 4X0MA 4YHJA 3DCVA 5JFVA 1R1WA 1YHVA 1FVRA 1Z9XA 2Z7RA 4MAOA 4H39A 1YWVA 2DWBA 3FMKA 3PYYA 1Q62A 4FV9A 4LMUA 4OTQA 4R1VA 2Q0NA 4XOZA 4ZZOA 5LWNA 2VN9A 5M07A 3TNWA 5DI1A 2WU6A 5DLSA 2ITXA 4AX8A 5HBHA 4JJRA 1O6YA 3AMBA 1OPKA 4DGOA 2X4ZA 3EOCA 5LVLA 4PP9A 4U81A 3U51A 4BDEA 1BMKA 4KKEA 2R3KA 2H8HA 2R3GA 3OT8A 3O0GA 4TT7A 2G2IA 3DKGA 1ZOHA 5K4IA 5C4LA 3DKOA 1BL7A 3RPVA 3MN3A 4GK4A 5IA5A 3EYGA 4IE9A 1O9UA 2QLUA 4A9UA 3R9RA 4YJTA 2C3LA 4QO9A 3LVPA 2CNUA 2UVXA 4CG8A 3IS5A 4YHFA 3T3UA 2RFSA 3I60A 5DYJA 3TCPA 4D2SA 3DZOA 1YHWA 4FUXA 4M0ZA 4QYHA 4RA5A 4K9YA 2O5KA 5C9CA 1ZY4A 2B9JA 5BVEA 3NAYA 1PRYA 3CJFA 4R8QA 4G3CA 3NUUA 2WMWA 3KKVA 4FV4A 4C38A 3P79A 4QP1A 4QOXA 3OOGA 2BZIB 3R02A 4MKCA 4PWNA 4ZP5A 5DN3A 2C5YA 4EBWA 3SG8A 1KV2A 2GSFA 2YLFA 4FODA 4GIIA 4RIYB 3UG2A 3W2RA 4D2TA 4G17A 2E9OA 3DXNA 4JIAA 3RP9A 1URCA 2B0QA 4BKJA 3QQKA 3SHEA 1XWSA 2GU8A 3QC4A 4GYIA 5EI8A 4BTMA 3NIEA 5TO8A 4BCFA 5HE2A 2C6MA 2WD1A 5AR5A 4FR4A 4QQJA 5AP5A 4CNHA 1UA2A 2WMBA 1WCCA 3LXLA 4RLLA 4WRGA 4KSQA 3ZSHA 2WTIA 3GT8A 5DMZA 3CPCA 4KSPA 4B99A 2WOUA 3ZSGA 2YM8A 3OCBA 3AC4A 3W33A 3GP0A 3ZXZA 2XKFA 1OI9A 3KFAA 1MRUA 2BZHB 1E9HA 2VWZA 2F2CB 3NYNA 4DAWA 4YJVA 2WMUA 5A14A 3R2BA 4R3PA 2JIUA 3SOAA 4UMRA 2GNIA 5IA1A 3ATSA 4XLIA 3L1SA 4DEEA 2HW6A 4FEWA 1H28A 2X9EA 4FOBA 4LV8A 4XP2A 4DFXE 3KL8A 3ROYA 3R9OA 5D10A 3Q6WA 4QPSA 4HVSA 1OGUA 4F9WA 4HVHA 4CVAA 3Q3BA 2I0EA 2WGJA 2XIXA 1GJOA 2UZNA 4D4VA 3ZC5A 3PE1A 3KRLA 4JL9A 4MH7A 4JDJA 3MS9A 4HVDA 3CJGA 4DA5A 3BHVA 3R7GA 4GL9A 5KMNA 3GEQA 2BTSA 3L9LA 3BE2A 4QP3A 4UALA 3H0ZA 4CMOA 2A4LA 2VTPA 4QYEA 1ERKA 2WNTA 3MWUA 3QD0A 4OBPA 3NUPA 3D5UA 4HJOA 5IF1A 4NCTA 3CKXA 4JR7A 3C51A 3ERKA 2CGXA 1J3HA 5F95A 5CU0A 4IC7A 3C4FA 4CV9A 4DLJA 4FTQA 5BMSA 4J8MA 5M4CA 4DINA 1OL1A 1V0OA 2IJMA 4J99A 4L00A 3RM6A 3ORXA 2X7OA 4BTFA 3C9WA 3VS2A 5M4UA 4M3QA 3BEGA 3ANRA 3QRIA 3DA6A 2W1GA 3F5PA 4FSRA 4HYHA 2J0MB 4TYHA 2C6EA 2NO3A 3GGFA 3BU5A 5CI7A 5EDRA 3PRIA 4A4LA 4UMPA 1IAJA 3WZKA 5HIDA 2CLQA 5AIRA 4XUFA 3ZLWA 4BWKA 3L9MA 2QOBA 3PPKA 3GU5A 4RVTA 4YR8A 4FGRA 3VBXA 4BY9E 4ACGA 3U4WA 3POOA 3NNUA 5BPYA 5LVOA 2XNPA 2W7XA 4FKIA 4XOYA 1JKKA 4E6QA 4OGRA 2PY3A 4CCBA 4UX9A 2F49A 4Y5HA 4G5JA 5AAEA 4IB5A 4XHKB 3REPA 2BDJA 3R7YA 3BLQA 4L43A 3K2LA 1PYXA 1IG1A 4QP9A 4LOPA 2Y6MA 1IEPA 5C03A 2EXEA 2VAGA 3OVVA 2GNJA 1TQPA 5KO1A 2R7BA 3BYMA 4OTFA 1OL2A 3QCQA 2QOHA 4AACA 4P7EA 5IQAA 1ZYDA 4M8TA 4O0YA 1FPUA 4S2ZA 2HCKA 3FZ1A 2UVZA 3KN5A 1OBGA 4IC8A 3ZZWA 4TL0A 2VTIA 3QHWA 2C3KA 4MBJA 3SC1A 3ZUUA 4E26A 4W9WA 1U5QA 4USDA 2IW9A 3BU6A 2F7ZE 4AOJA 3R8LA 4LGHA 4PDSA 5BX0A 1BKXA 2X9FA 3S2PA 3OWPA 4IM2A 2OO8X 4FNWA 3V5JA 4BDJA 2XNGA 4EC8A 4Q5EA 4YTFA 2WTKC 2XS0A 3DNDA 2QLQA 3I0QA 2WQEA 3QD2B 5IMEA 4XP0A 5M44A 5BYZA 5KX8A 4DG2E 2YCFA 4XH6A 5HVYA 2PVYA 5ACBC 1W0XC 3UVPA 4MNEA 2JLDA 4PTGA 2BALA 5AP4A 1KSWA 1SVGA 3CBLA 2XMYA 5F20A 3ZDIA 4F7JA 3B8RA 4UMUA 2OZOA 3DK7A 5HO7A 3EQGA 2VZ6A 3O17A 2FYSA 3UMXA 2QO2A 3KEXA 2QHNA 4FEVA 4ASXA 4FT3A 1FVTA 4GVAA 4EUTA 5D7VA 2GMXA 2YIXA 5CSXA 4BGHA 4E7WA 3GCPA 3E87A 3F2NA 2OH0E 3ZDUA 2VU3A 2VO6A 1UKHA 2I0YA 3Q04A 1W98A 4I4FA 3IECA 1YOLA 4V0GA 4AE6A 4C2VA 3RPYA 3WF6A 4LI5A 1LR4A 5AP6A 4UYAA 3OEZA 3DS6A 2OH4A 2UZVA 2GHLA 4RQVA 4I21A 4WG5A 4C4FA 2W5AA 3E8EA 4U44A 4YC6A 4IAKA 4FV5A 5EHYA 3UOLA 4DFUA 3E7OA 3LLTA 5GJDA 2C6TA 2JC6A 5EM5A 4J95A 4TWPA 1ZXEA 4I1ZA 3OZ6A 3EIDA 1XH4A 5IQHA 3ORLA 1K2PA 3SXRA 3KMUA 3U6JA 4TXCA 1H07A 3MI9A 4ZTSA 2X6EA 4U41A 3LQ5A 4F7NA 1JSTA 4QMOA 1OUYA 4S32A 2C47A 3VHEA 2WAJA 5JT2A 3GQLA 2W06A 1BL6A 4FE2A 4D9TA 3VNTA 4PDPA 3VN9A 4EI4A 2A1AB 1UKIA 2XK7A 5EW8A 4C59A 2C5NA 4M84A 3ZH8A 3VBVA 4D4RA 5HU9A 3L8SA 4HCVA 1SVHA 2Y8OA 4BFMA 3IO7A 4XG4A 5CSVA 2JBPA 1M2QA 5K0KA 4B7TA 2BTRA 2GTNA 4C4GA 1YDRE 4LYNA 4B8LA 4PDYA 3OCGA 4TKSA 3TJDA 3I79A 2CGUA 2VGOA 3ALNA 5L8LA 5DOSA 4D1ZA 4Y73A 5ETCA 4RLKA 2VTAA 1ZYLA 3BLHA 5BMMA 2LAVA 3RCDA 5BQ0A 2PUPA 4AUAA 3PA5A 3PA3A 4CG9A 4K2RA 5FBOA 3GC7A 4BYJA 1PXKA 5EQPA 3MESA 3NX8A 4JQ8A 2HXQA 3ETAA 1PMVA 4KRDA 4MQ2A 4PTEA 3BRBA 5K9IA 2OG8A 1YVJA 1LEWA 3ORMA 3V3VA 5AR7A 4G3GA 3CQEA 4FSMA 5LMBA 1VJYA 4EOMA 5CSPA 1H01A 4MBLA 4U3YA 5M06A 4R6VA 5CVHA 1OVEA 2WU7A 1GNGA 2YFXA 3NCZA 3Q9XA 2B9HA 4FT9A 3ORKA 4CD0A 5HTIA 1Q24A 4AE9A 5A4TA 1SMHA 3MTLA 4YC8A 5IQDA 4BWXA 3F88A 1M14A 1WVYA 2B55A 2FSOX 2PVHA 1Q3DA 4JG8A 3DKFA 4YTCA 2GS6A 4NW5A 4U8ZA 5ANIA 5BUIA 3GQIA 4EOPA 3R63A 2C5XA 3U9NA 2YCQA 3QUPA 3ORPA 4KBCA 1M17A 5GIOE 1Q8UA 5L2IA 2R3IA 2VO0A 3KXMA 5HTCA 1PXOA 4A9RA 4F0FA 2C0TA 2RGPA 2VO3A 3UG1A 4H05A 2X1NA 2J0JA 4AZEA 2OZAA 4GT5A 3VS0A 4CFVA 3PZHA 3OF0A 3A60A 4ITHA 1WBPA 2BDWA 5E8ZA 2CKOA 1ZYJA 3PFQA 4C4IA 5J1VA 4GK2A 5A9UA 4PL4A 3NVMB 4M13A 4WUNA 1SVEA 4ALVA 5IUHA 4L6QA 3FMNA 3CGFA 3FSFA 5HO8A 2VTLA 3R8MA 4C58A 3DT1A 4GG5A 4BKYA 3P78A 4HPUE 1BX6A 4TW9A 3HUCA 1GOLA 2CN5A 3DBFA 1CSNA 4DH5A 4FV2A 4IDTA 3D14A 3QTQA 5AP2A 5CENA 4GCJA 4BZDA 2GHMA 2E9NA 5D11A 4H3PA 5FUTA 3GOKA 4A7CA 4JX7A 4DBNA 4AA0A 4KIOA 3R8PA 4BTJA 2X6DA 1P14A 4RX9A 3NUNA 4JBOA 4RSSA 4K8AA 5FP5A 4EQUA 4PMSA 4DT8A 1QL6A 4BCGA 1Q41A 2YM3A 4D4YA 4KKHA 4NM3A 3HV7A 3AT3A 4FTIA 3RHXA 3OEFX 5LOHA 1OL6A 1M2RA 2HZ0A 4FSNA 1OKZA 2EU9A 2CNQA 2DS1A 2XEYA 3IK3A 2IO6A 4DH3A 2R0IA 3FLYA 1GZKA 5IDPA 4FNXA 2ITOA 3WILA 4R1YA 4EK8A 2ZVAA 2XIRA 3R7IA 3A7JA 3EB0A 2JDSA 3H9OA 4IAYA 5FEEA 4JBQA 4E4MA 3D83A 2BUJA 4R3RA 4DG0E 1YXUA 2OJ9A 4KBAA 3HYHA 1Q8YA 3BI6A 1CKIA 3QXPA 2WQMA 4XMOA 3R7OA 3HECA 2JGZA 3R9DA 5L8JA 2J4ZA 3RK5A 3T3VA 3W1FA 4C4JA 3NGAA 3A2CA 3OXTA 3MB7A 3V6RA 4ALUA 5DPVA 5DWRA 3G9LX 2ITPA 3BPRA 5D9HA 3UODA 4BDAA 5J5TA 2CLXA 2OJGA 1M7QA 4G2FA 3E8CA 4G3DA 5E91A 4D28A 2Z7QA 3QZFA 3HGKA 3QA0A 4HYUA 3SD0A 2AC3A 3AG9A 4L45A 5HIBA 2UW4A 3W2QA 5EOBA 5H2UA 2Y4IB 3HKOA 5HG5A 3SAYA 4DITA 5DE2A 3PY3A 1P5EA 2EB2A 4ZTHA 3TTIA 3U6IA 1OPJA 2YAAA 2R3NA 3ORNA 3PVWA 4FKQA 4NFNA 3MSSA 1VZOA 1Y6AA 3GC8A 4JRNA 3R8ZA 3V5TA 4ANQA 3ENHA 5HNIX 5HX8A 1NW1A 2CNVA 3AD6A 3UE4A 3BHHA 4CFWA 3LJ1A 3BCEA 3D2KA 5CSHA 2E2BA 4X2FA 3CD8A 4RIYA 4MX9A 4H1JA 4MTAA 1O6KA 4D2PA 2UW5A 2X81A 4HCUA 4LM5A 4U79A 5CAQA 2QVSE 3TNHA 3CC6A 3F69A 5DRBA 4M68A 5HQ0A 2W4JA 4WUAA 5DT4A 4I22A 5H8BA 1UU7A 2FSMX 5DEYA 3C1XA 4B0GA 3S1HA 4C57A 3QCSA 4CZUA 4EH2A 1QPEA 2QU6A 3NYVA 1H0WA 1KE8A 4C3FA 5JEBA 2OI4X 2NRYA 2DYLA 2VV9A 3VULA 5JRQA 4R5YA 2BHHA 3LM5A 4F70A 3GI3A 3R1NA 4KAOA 4PMPA 4UN0C 5HD4A 5IA0A 1F0QA 4C33A 3R8UA 3P1AA 2UUEA 4Y85A 1Q8ZA 5GINE 2YM5A 5IH4A 5BVWA 2B9FA 1RQQA 1R78A 2XUUA 3KXGA 4GH2A 5EYDA 2XKDA 4WSYA 3DY7A 2PK9A 1NVSA 5C8KA 4C7TA 4GFOA 3RK9A 4H1MA 3UBDA 3MBLA 4EH5A 4ZXTA 3NR9A 4EOOA 3ZS5A 2ETRA 2C0OA 5CT0A 4A07A 4ACHA 4F65A 4PL3A 4EH7A 5AR8A 2XYNA 1RE8A 4LQMA 4BI0A 4AN3A 3AMAA 3K3IA 3ZFXA 3LFFA 3QXOA 4N0SA 3WF8A 1MQ4A 3UGCA 3PXZA 3MH2A 3EHAA 5EDQA 5TOZA 3KRRA 4EEVA 2GQSA 2V5QA 5EW3A 2BMCA 3BYUA 3MPAA 4FZ6A 4YLKA 1H0VA 4J98A 3PSBA 2KTYA 4C36A 3Q4TA 1YWNA 3LMGA 3VBWA 2R2PA 4MQ1A 4O2PA 1UVRA 1WBOA 4XJ0A 4E4LA 4EK5A 1B39A 4MXAA 2UZBA 3H3CA 3KMWA 5EKNA 3PWYA 1XHAA 2Y4PA 3C0GA 1FMOE 3PJ1A 1ZZLA 3PJCA 4FV3A 3QKKA 4YZBA 3U4UA 1IA8A 3PSDA 3RBWA 1J7UA 5AMNA 1ZRZA 2UW7A 3LIJA 3O7LB 4TN6A 5DR6A 4FG9A 3GFWA 4QQ5A 3PPZA 5CI6A 3CGOA 4FT7A 4HVIA 4M69A 4I6BA 2CMWA 5AV2A 2QD9A 4A9YA 4BDIA 4AG8A 5G1XA 3R21A 5AX9A 3LW0A 3MPMA 5DH3A 1VYWA 3QHRA 3TG1A 3CXWA 4X3FB 3MH0A 2R5TA 4UY9A 3EWHA 2EVAA 3G2FA 4OTRA 3PIYA 5BVOA 4F99A 3WE8A 4FL1A 5AR3A 2W1EA 4QMTA 3G90X 5H9BA 3BEAA 5A6NA 4JS8A 3LXKA 3QD3A 4CCUA 2WIHA 1Q99A 4TWNA 1KE7A 1FGIA 5EOLA 4ZJJA 3LMHA 3BHYA 3P7BA 4MBIA 3ZTXA 3RMFA 4FKWA 1KE6A 3A7IA 4I92A 3MB6A 3UYSA 4NUSA 2VWXA 5ITAA 2GFCA 4WSQA 4YZNA 4JT3A 1A48A 1QPCA 3LFAA 5DG5A 3VIDA 1K9AA 3FKOA 3QTIA 4D5KA 3PLAE 1E1VA 1WMKA 4RIOA 2A2AA 4BDKA 4DFYA 3FI8A 2R4BA 3NW6A 4PMTA 3UOKA 4G9RA 3IG7A 3UNJA 4I5MA 4DH8A 4DFBA 3FJQE 4Z7HA 5I3RA 4O0VA 3UPXA 3GU6A 4TWOA 3UTOA 4RC3A 4U7ZA 3W8QA 5CXZA 2CDZA 3GCVA 2WO6A 2BRBA 4F08A 5IQEA 3KRWA 3Q9YA 5EH0A 4BI1A 3HRCA 3QF9A 3NW5A 4OTDA 3UIUA 3VS4A 3N9XA 2WTKB 2ITNA 1YDTE 3R1SA 4C0TA 3PSCA 2VWUA 2XNMA 3FI4A 5BVFA 2IVUA 2R3OA 4IVAA 4JDHA 4OTGA 4GYGA 4R7BA 3WF9A 2W1FA 4USFA 5CNNA 4BZNA 2JFMA 4BF2A 3ZEPA 5DHJA 3U54A 4FKVA 1XBCA 2BHEA 3EYHA 4U97A 4AWIA 5HG8A 1A06A 2YZAA 4EQCA 5IZFA 3KVWA 4FZDB 3NVKI 4FI1A 1U46A 4FF8A 3R0TA 4NTSA 4LRJA 4XS2A 4Z55A 3KRXA 1Q8WA 2CKQA 3MA6A 5ANEA 3TIZA 4BZOA 2HELA 3FZSA 1Z57A 3FLZA 2OW3A 2HW7A 3DJ7A 3SA0A 2XBJA 3BZ3A 3AXWA 3DPKA 1ZWSA 4I0RA 3AGMA 3TV6A 4PTCA 3CTJA 3O71A 3FMJA 2JDOA 3QZHA 4H3BA 1OUKA 4JBVA 2REIA 2QO7A 4Y83A 4YNEA 5FBNC 5CTPA 4N6ZA 4F0GA 5AV4A 3R04A 5D7AA 3QTRA 5M55A 2YISA 4JBPA 4RPVA 3NNXA 1OL5A 2YM4A 2FA2A 4FKJA 5DR9A 2GCDA 4FV7A 4IBMA 4JX3A 3RGFA 4AP7A 4DTBA 3BV2A 3RAWA 3F3TA 4Z16A 3NNVA 4O0SA 4O1PA 2YHVA 2J9MA 3R00A 3G6GA 4OUCA 4X6QC 3DXPA 4GT3A 2YZLA 4FVPA 3RPOA 3FYKX 3QGWA 4IW0A 3VJOA 3II5A 3ZEWA 4FV6A 2YITA 3DAKA 4E4XA 4H3QA 4IZAA 4WNMA 5J95A 3EQIA 5E8WA 4D2VA 3H30A 2F7XE 2UZEA 1ZOEA 2Y0AA 3OG7A 3KC3A 4O1OA 2OIDA 2Z7SA 4ONAA 4O21A 4CFMA 4YJQA 4DN5A 4F6SA 3Q60A 2VRXA 3EQBA 1GZNA 2Q0BA 2QCSA 4FT5A 2Y4IC 3QTSA 5AAGA 3WI6A 4M15A 3FY0A 3A8WA 5AX3A 4DEBA 5CU2A 4Z9LA 2J90A 5JMSA 2HZIA 3C4EA 4WA9A 3QBNA 2PU8A 5IQBA 4R7IA 4IDVA 5JRSA 3QTXA 2WMSA 3CIKA 3Q5IA 2ZMDA 1PKGA 3OUNB 3PPJA 1J7IA 2QOFA 3QCYA 4O0RA 2EWAA 2BKKA 5EQEA 4YURA 1GY3A 4BDHA 1JLUE 4EYMA 4TTHB 2O65A 3AT2A 3NDMA 4TY1A 2XJ1A 2PVLA 3GCSA 3LFSA 4O0TA 2BZJA 4BKZA 1FGKA 3A4PA 3B2WA 4IWPA 4RVMA 4D0XA 5AP0A 2E9UA 4PUZA 4P5ZA 2UW9A 4L44A 4I5HA 3OCSA 1L3RE 1G3NA 3E62A 4L68A 3FXZA 5EYCA 4ZSAA 2W1DA 3Q5ZA 4W9XA 2BKZA 1JQHA 4NTTA 4O6LA 5AAFA 5HE0A 5TE0A 3VS3A 1HCKA 5HNBA 2QOQA 1U59A 5FXSA 1JSUA 2IZUA 3FHIA 1LPUA 3QX4A 5BUJA 5HESA 2CGVA 3L9PA 1IASA 4BCIA 3RZFA 4B9DA 4O83A 3P23A 3UZPA 4ZSGA 3I5ZA 4FIGA 4OTWA 4D0WA 2QR8A 3COHA 4GUEA 4AW0A 4UXQA 3MTFA 2Z60A 5DRDA 3DQXA 3FLQA 2RL5A 4OTPA 5H8GA 2IWIA 3ZO2A 4GKHA 3HA8A 1OKVA 5HCXA 4A06A 3GU8A 4E73A 3OWKA 5I4NA 4ZSJA 4LL5A 4XNEA 3V04A 2ZV9A 3ELJA 3F2AA 3OD6X 5GNKA 1FBNA 3TZ9A 3TT0A 1YXSA 3QTUA 3UZTA 1JKSA 4QMZA 4GRBA 1X8BA 2YEXA 4JQEA 4FG7A 4R7HA 4U6RA 3GB2A 4ZK5A 2XJ2A 3TJCA 5CF5A 3FHRA 5CEPA 2WIPA 3WYXA 4FVQA 4Q9ZA 5J7HA 4FL3A 2H96A 4PV0A 4CKRA 4D5HA 1DS5A 4AN2A 4OLIA 2XP2A 1RW8A 3EMGA 1JNKA 3QLGA 4YZ9A 4MWIA 4A4OA 4I6QA 2WMRA 4D1XA 1Q5KA 2QQ7A 2CCHA 2VTTA 3FV8A 3O8UA 4DGLC 4IJPA 2EXMA 2OBJA 2BDFA 1UU9A 3C4CA 4KIKA 3OT3A 4NZWB 4EK3A 1R3CA 1PXPA 5CLPA 2BFYA 4AOIA 5JGBA 1YI4A 4WBBB 4BWPA 4F09A 3BYSA 1LUFA 2J2IB 2WPAA 3CP9A 2GQGA 3D7TB 5CEOA 1SZMA 3MY5A 4QP2A 3TZ7A 2XVDA 2AUHA 5A46A 5CF6A 2IVVA 2ITUA 2Z2WA 4YTHA 5AADA 3DAEA 4IHPA 2PZIA 2PMOX 4F7LA 4CKJA 2CSNA 2FSTX 4BDCA 1G8SA 3PDTA 4PQNA 1XBAA 3A4OX 3D9VA 4FKSA 3MIAA 4ZMEA 3SLSA 1W7HA 3TUBA 4FSQA 2XBAA 3NUAA 3IDPA 4QMPA 1H1QA 1PKDA 3FMEA 3ZXTA 5G6VA 1H08A 1OL7A 2BAKA 3T8OA 4JNWA 4FSZA 4XRLA 4X3FC 2HXLA 2W1HA 3NSZA 1JBPE 2XKCA 4M69B 2VNYA 5HX6A 4DFLA 3RTPA 4EOIA 3MV5A 5BVKA 5IISA 2XNBA 5FXQA 2C69A 2VUWA 2RG6A 5EQYA 4L9IA 3ZC6A 2HWOA 4EOLA 4HNIA 3D15A 4FSTA 1QCFA 3R73A 4TPTA 4O7ZA 4YJRA 3UO4A 3ZO3A 2PVRA 2XK6A 4ZEGA 2ZM4A 3E8DA 3KXNA 4ASDA 3DBCA 5IMXA 3ULIA 4AT5A 4C02A 3UQFA 2KULA 5KE0A 3EQHA 4ZSLA 1XKKA 4WNOA 3GOPA 1EH4A 2CCIA 2V55A 3O51A 3FE3A 4OT6A 1M52A 3WYYA 3UOHA 3KXXA 1H24A 3LCDA 3PVBA 5I3OA 4KIPA 5LWMA 5DBXA 2G1TA 2YM7A 3AQVA 3E64A 4M12A 3COIA 2J0IA 4FTJA 2W99B 4QMNA 5LQFA 3LOKA 3FZOA 3NEWA 1GIHA 2QOIA 4R3CA 3S00A 4U80A 1UNHA 3DJ5A 4I41A 1CDKA 2WOTA 3PP0A 4KNBA 4QYFA 5KHXA 1GZ8A 4KABA 2VTSA 3PLSA 1PXNA 4XLVA 5HGIA 4FKTA 3MDYA 4RWLA 4RIXB 5CYIA 3ALOA 5L2WA 5HNGA 2OXDA 1H1SA 5T6KA 3KF4A 1XH5A 4ORKA 4I5CA 3OY1A 4BBMA 3D7ZA 1PW2A 1H1PA 3FXWA 5CU4A 3QD4A 2J5FA 4K0YA 3VUDA 4DEDA 1S9JA 3A7HA 3PVGA 5DGZA 3VBTA 3E3PA 4NIFA 3JY9A 4E5BA 4EH6A 5F9EA 2JIIA 4KKGA 3EN4A 3W10A 3QQHA 5FXRA 4QNAA 3UVQA 4NEUA 4C2WA 3RAKA 2VWVA 3FLWA 4V04A 3BBTB 4WG4A 5CEIA 5BVNA 2XYUA 3D2IA 4FV0A 4EH9A 5E8UA 3FMMA 4NM5A 2VTQA 4O22A 4QPMA 4DEAA 1YXTA 3U55A 3OXZA 4IANA 4YPDA 4PF4A 3Q53A 4EH4A 3SW7A 2XK4A 2HAKA 2WQNA 3QYWA 4CMTA 1OKWA 2WMVA 5BUEA 3HZTA 3A99A 3E93A 4QYYA 3Q32A 5FDPA 5CXHA 3E92A 1PXIA 4U3ZA 3GC9A 3MJ1A 3SKCA 4DFZE 3C50A 3DV3A 4D2RA 4ALWA 3MW1A 3M42A 3FI3A 5KZ0A 4BBFA 1SYKA 1J7LA 2PULA 4QTEA 5CANA 4FKOA 4IM0A 3QQFA 4F6WA 2UZUE 3OW4A 5AUXA 3V8WA 4GKIA 1ZOGA 4PPBA 3DAJA 3COKA 4DH1A 3P7CA 4C4HA 5AUZA 3IW7A 5B2KA 2PPQA 3QKMA 4G16A 2E9PA 4K6ZA 3G51A 1B6CB 2B4SB 4FKPA 3UO5A 4XP3A 5CEMA 3KULB 5A4QA 5E9EA 1U5RA 3FBVA 4JQ7A 1Y91A 3Q4CA 4X3FA 2XIKA 4YJNA 3FC1X 1PMNA 5TKDA 4DC2A 2IZRA 1Y8GA 5AR4A 2PL0A 4IB1A 4FKGA 4P4CA 2B9IA 4CTBA 3RVGA 4LUEA 4GU9A 3CPBA 3PTGA 3ZBFA 4BCQA 3TUCA 4E6DA 3E8NA 3Q4ZA 3PXKA 1W82A 4IACA 3C0IA 4CT1A 5EM6A 3V01A 4ANNA 2OWBA 2QOOA 3EFJA 4RVLA 1B38A 4UEUA 4DCEA 4MXZA 5IA2A 1H00A 3L8XA 4RFYA 4BCKA 2X2LA 1MP8A 1YXXA 3IKAA 3OP5A 4ACCA 1IR3A 2YCSA 3BYVA 3NW7A 4S33A 4EONA 4YHTA 4Z7GA 4CKIA 2FB8A 4YPSA 1PXLA 3D5XA 4L67A 1JWHA 5IA3A 3V51A 4S34A 2ITYA 2ERZE 2P0CA 4IZ7A 3SG9A 1V0BA 2YERA 3PY1A 5JQ8A 2IPXA 3PXYA 5IPJA 3ITZA 3N51A 1WFCA 2XK8A 2R9SA 4NM0A 4O7YA 3PRFA 3F3VA 3QUEA 3WBLA 2O3PA 2W17A 4YSMA 5BYYA 4PDOA 2PMIA 4WD5A 2QOKA 3QZGA 4G3FA 1JAMA 1PF8A 3A7GA 3QU0A 4JRVA 2HYYA 1V0PA 4QP8A 3TV7A 2IN6A 1TVOA 3AD5A 4K11A 2OIQA 3WIGA 3TXOA 2W96B 2C6KA 4KIQA 5DEWA 3ZRLA 2ONLC 4JOAA 2CPKE 5I5ZA 5L6PA 4QTCA 5L6WL 4FTTA 4XX9A 5A4CA 5E8VA 2BPMA 4O81A 3HAVA 4DTAA 2P55A 3RAIA 4ZLZA 2C68A 4YO6A 4RJ3A 4YUQA 2XCKA 3VUIA 5HZNA 1Q61A 5KBRA 1F5QA 4LOQA 2G2FA 2JDTA 5KMKA 3TNPC 3I1AA 3Q2MA 3OWJA 3UDBA 5A54A 5L3AA 2ZYBA 5IDNA 4F7SA 4YZMA 3CCNA 4E6AA 4MVFA 1Q97A 2VWBA 5IQFA 4HW7A 2HZNA 3UIXA 4BRXA 1NY3A 5J1WA 4LG4A 5T3QA 3D4QA 3DDQA 3VF9A 4PP7A 3HAMA 3JXWA 4HGSA 4RG0A 4RA4A 5L2TA 4GU6A 5J87A 1TQIA 1AGWA 2WELA 2NP8A 4AOTA 3NMUF 4JR3A 3RALA 1KE9A 2BRMA 4QTAA 5CAUA 4BICA 3OFMA 2P33A 4BN1A 4AZSA 2PSQA 4OTHA 5M4IA 4K77A 1UU8A 2OU7A 3F3WA 3G15A 2UW8A 3F3UA 2YM6A 3GXLA 4GJ2A 5FQDC 2OJFE 1XJDA 2WMTA 4TNDA 4IAAA 2QKRA 1MQBA 3LFNA 3NLBA 3BHUA 3O2MA 4I20A 1H8FA 4M7IA 4PPAA 4QPAA 3ID6C 4M67A 3U9CA 4W4XA 3PXRA 4FEXA 3R9NA 3BHTA 4KIKB 4BR3A 4ZZMA 4ASEA 3D94A 2WZJA 4HVGA 2X0GA 3EL8A 3OS3A 4QNYA 4U5JA 1CM8A 4O6EA 2PZPA 4FA2A 4RJ4A 1I09A 4GT4A 4NH1A 3FZTA 4S30A 4AGWA 4DTKA 3MVMA 4Z3VA 1WBSA 2F57A 3G5DA 3MFTA 3T9TA 1GIIA 4FTAA 2GNHA 3RK7A 3BYOA 3FL4A 3LAUA 3TWJA 4F63A 5C01A 1CMKE 1XH9A 2ZV8A 4JDIA 4AGCA 2R64A 4J8NA 5I9UA 4AQCA 5KMJA 5IQIA 1KWPA 4MHAA 3PIXA 4O0WA 1PY5A 2R3PA 4AU8A 4EL9A 4CV8A 3IOPA 4HGLA 4EHVA 4CYJA 3AC2A 2DQ7X 4M97A 4U42A 5JGDA 3LE6A 3E5AA 3IGGA 3QRKA 4YC3A 4Y5QA 4CMUA 1H25A 5HOAA 2RG5A 3MGYA 4ANOA 5J9LA 3KREA 3RZBA 5H8EA 4BL1A 4N57A 3SGCA 2YWPA 2HENA 2XK3A 3GVUA 2QC6A 5HBJA 5C4KA 2ZB1A 5E90A 2EUFB 3EN9A 4BCJA 2BAJA 3BLRA 4RC2A 4E20A 3KCKA 5CVGA 1CTPE 4FKLA 2O0UA 3FPMA 4L53A 3D5WA 5D1JA 4ASZA 4ZTNA 4JG7A 3GCQA 2HIWA 4BDGA 1QMZA 1VYZA 3IOKA 3P08A 4LRMA 3ZFYA 4O7RA 4EH3A 2EXCX 3R7VA 1K3AA 3RINA 2HK5A 1W84A 2ITVA 5EW9A 1XBBA 4ACDA 4MXCA 3R30A 3Q9ZA 3TN8A 5DT3A 4I3ZA 1IRKA 4XV1A 2BZKB 3FY2A 4NFMA 1QPDA 4NJDA 2PVKA 3BGQA 2ONLA 1P4FA 3O50A 4FSWA 4YZDA 4DYMA 4XG3A 4YP8A 3DLSA 4MD9E 4MYGA 2XK9A 2I0VA 2CKEA 3FMLA 3EKKA 4LUDA 5BYLA 4PMMA 5K3YA 1VR2A 5IU2A 3DNEA 1GAGA 4TZRA 4NL0A 3GC0A 3I6WA 3KMMA 5LXMA 1ZYSA 2QHMA 2YACA 3B2TA 4W4WA 5JZJA 4OR5A 3WZEA 4R5SA 3QRTA 5T68A 3F82A 3KK9A 2O2UA 2NPQA 4L3JA 4BB4A 4DF3A 4NIFB 2F2UA 3JUHA 4BCOA 4GIHA 4NJ3A 1WAKA 2C30A 2OK1A 2BRGA 5GHVA 2XM9A 5CT7A 4LGGA 3VWAA 4BGQA 2YAKA 3M2WA 4C37A 4HPTE 4DGGA 2ESMA 5GJFA 3JS2A 3UC4A 5KMIA 1NVRA 4D58A 4MCVA 5L2SA 4GG7A
chains in the Genus database with same CATH superfamily
2X0OA 3CTQA 3DKCA 2Z02A 5E8XA 3HMNA 3NAXA 4NT4A 4QP6A 3MVJA 3EN5A 4MF0A 4Y8DA 3D7TA 1XH6A 4N4SA 3QL8A 3ATTA 3DBDA 4ZLOA 5C26A 3W32A 4DFNA 3UDZA 2XRUA 3H10A 3ZRMA 2V62A 3KGAA 4I6HA 1YI6A 3ZO4A 5IEYA 2ZDUA 2BRNA 2Y9QA 4NU1A 3WZDA 4Y72A 2VTNA 2NNWB 3IQ7A 4O0UA 1NT2A 2XAMA 3OCTA 4J96A 3LQ8A 2AEGA 1YOJA 4L3LA 4QMMA 4FTNA 3AC1A 3JYAA 5DR2A 5HBEA 3CSVA 3PY0A 3CY3A 2I7QA 5LJJA 4F9BA 5HO6A 4GEOA 4ZTLA 2XF0A 2QONA 5KBQA 1ZZ2A 3MJ2A 4ZOGA 5AUVA 4QP4A 3FKNA 3WIKA 4ANBA 3C13A 5BNJA 2Y6OA 4E8AA 2NRUA 3TI1A 3O7LD 4QTBA 3B8QA 2YIYA 2ZM3A 4IZYA 2W1CA 3LJ2A 4ERKA 5LVMA 3ODYX 4L3PA 3LQ3A 3RWQA 3QQUA 5AM6A 3LJ0A 5TT7A 4U40A 2QG7A 1XH7A 5LARA 4DGNA 4EQMA 2PUUA 1Y8YA 5AUWA 5J79A 4G9CA 2ITWA 1F3MC 3R2YA 1YW2A 4WHZA 2UZTA 2HY0A 3MYGA 4J1RA 3R7EA 4F1TA 5I9VA 4W8DA 4B8MA 3PE2A 4YTIA 2X8DA 3MH3A 3LFDA 5CZHA 1Q8TA 1TKIA 3GFEA 4W4VA 3R8VA 2YJSA 3FUPA 3N4TA 4WRSA 5B2LA 4YSJA 1PMUA 3HX4A 4NK9A 2UW3A 3VBQA 5HKMA 4ZJIA 3MFUA 1O6LA 5LVNA 3ZCLA 3OROA 3BU3A 2GQRA 3ACKA 4IIRA 2VX1A 5CALA 3CKWA 5JKGA 4EZ5A 3QA8A 5ETFA 4RIXA 4PNKA 4DGMA 4ENXA 4KUJA 4FT0A 4AA4A 3Q52A 3HV3A 5HIEA 3FQEA 3NRMA 4F64A 4O38A 4PX6A 2UZOA 3DFCB 4F9CA 3FL5A 3MVHA 3PG3A 3MIYA 4O82A 3DJ6A 5ANDA 5K5NA 1YXVA 2JAVA 2R3LA 4FZ7A 5L2QA 3W2PA 1BUHA 2R3FA 4UYNA 4B6LA 4ID7A 4BI2A 5JFWA 3SW4A 1OITA 4LV5A 2VTHA 3NCGA 4R78A 4M66A 2X2MA 3MY0A 3AMYA 3HEGA 2PYWA 4BJJB 3R6XA 4E5AX 4ZJVA 3VW6A 4OBQA 3EFWA 3RPSA 2RFEA 1PXJA 3EZRA 3G33A 4EOSA 2R0UA 3CR0A 4IFCA 2FVDA 2PMLX 4IB0A 1T45A 5F4NA 4ANLA 3D5VA 3JR1A 1A9UA 1H26A 4TYEA 3OY3A 3ET7A 4UWYA 1FQ1B 2PTKA 5M56A 3EH9A 3UP7A 4O0XA 5I0BA 4UWBA 2UW6A 3R7UA 4XV3A 3QAME 3TYKA 2G15A 4IAZA 3TL8A 1TZDA 3G6HA 1HOWA 2PVNA 2OJIA 1M2PA 4BCHA 4E5WA 5LCJA 1DI8A 4FYNA 2F4JA 3ZZEA 2X8IA 5I9YA 3DTCA 3VAPA 4CYIA 3IW8A 4I0TA 3I0OA 3I5NA 4DLIA 2C6LA 4QMQA 5AEPA 3F9NA 1REKA 5KKRB 2C1AA 2PVFA 3OUKA 4Q5HA 3WARA 2ITQA 2V7OA 3O96A 4FSYA 3LM0A 3E3BX 4G3EA 3FQSA 3PJ2A 5AV3A 4YNOA 4XG8A 4YJPA 4AW2A 4EOJA 3KULA 1BI8A 4XEYA 2WEVA 3EFKA 4U9AA 2HZ4A 5KHWA 3RAHA 3UZRA 4II5A 4AGUA 1KE5A 3CY2A 2JIVA 4IVDA 3KCFA 5DA3A 3LMIA 4APCA 1RDQE 3I6UA 3QALE 4JLCA 5EM8A 4ENYA 4AFJA 4YZCA 2BAQA 2YIWA 3EQRA 1WBNA 3LFEA 3OBJA 4UZHA 5M53A 3FZPA 3FZRA 4WNKA 3VO3A 4RJ6A 2R3QA 2JD5A 1DAYA 3C4XA 3HLLA 4O27B 4AXAA 2H9VA 4C61A 1OECA 2IZTA 1ZLTA 1CKPA 1P2AA 5M09A 4FZFB 1PMEA 3RNYA 3UP2A 1OM1A 4L01A 2R7IA 2QI8A 3DB8A 4QMXA 4EYJA 4MUQA 1BI7A 4FICA 4TYJA 5FEDA 3TDVA 4FC0A 2W5BA 3EQCA 3NS9A 4X6RA 1R0EA 3F7ZA 2B1PA 4RWJA 1ND4A 5I9WA 3EL7A 2GNLA 2X2KA 3Q9WA 1U54B 2BROA 3P86A 3FLNC 5IEVA 4BIEA 2IW6A 3VUKA 4C8BA 5KMLA 4J53A 4F1MA 2CKPA 4QMLA 2IVTA 2WQBA 3F5GA 4CQEA 4YBKA 4YGAA 1OIUA 4O7LA 1YOMA 5B2MA 2VWYA 4N6YA 4BCMA 3NNWA 4L8MA 2J0LA 2RFDA 5A3XA 3PWDA 4MXXA 2ETKA 5CEKA 5ANGA 1OIYA 4RBLA 3VUHA 3PIZA 5CX9A 3GENA 3H4JA 4TNBA 3QTZA 4KRCA 1Y6BA 3UOJA 5CVFA 2DUVA 2X7FA 2JDVA 3DQWA 1WBWA 2H34A 4XG2A 5JN2A 4GSBA 4OT5A 3C7QA 3C5IA 4EORA 3SRVB 4GJ3A 4FIFA 4IWDA 4CFFA 2FH9A 3O23A 5F1ZA 3ZM4A 2CHLA 3GBZA 3I81A 4J97A 4F6UA 3HV4A 1RJBA 2JAMA 4RMZA 3LFBA 4L7FA 2VWWA 3HVCA 2WMAA 4BDBA 2OICA 4GW8A 4YJOA 5IG1A 2W5HA 4FIIA 5AUTA 4HYSA 5HLPA 1H4LA 3VUMA 5IUGA 4WBOA 4DH7A 4RWKA 4FTKA 2IW8A 4C34A 3L8VA 4X2GA 3FXXA 4C3PA 4ZSEA 4RC4A 4ZY5A 5AV0A 4G6OA 1WVWA 5TF9A 5FTGA 2WQOA 4CGAA 2O8YA 4D55A 3ANQA 3VRZA 1G5SA 2GDOA 2GNGA 4JXFA 4AXDA 3DTWA 2WMQA 3KU2A 4UB7A 3G0FA 3K5VA 4AAAA 4DE4A 3VUTA 5HE1A 5IH5A 4CT2A 4EUUA 2OGVA 4RX8A 4MF1A 3VS6A 5K5XA 1OIQA 2PMNX 5C8NA 2C5OA 5H3QA 4K18A 2W1IA 4BTKA 4XRJA 2C3JA 2JDRA 4FZAB 4JAIA 3WOWA 3ZMMA 2UV2A 3CS9A 2P2HA 2XM8A 4ACMA 3AOXA 4D9UA 3VJNA 3U6HA 3F2RA 4FIEA 4GV1A 4RIWB 3UC3A 1WZYA 2JITA 3ORIA 4FJVA 2IG7A 3BX5A 1V1KA 5EI6A 2XNNA 4CFNA 3EJ1A 2ERKA 3KF7A 1S9IA 2A27A 3DK3A 5FP6A 3LZBA 1WBTA 4UZDA 3ROCA 2ZV7A 3O8TA 4DHIB 4IEBA 4CFXA 2R3JA 5E8TA 4WNPA 3P5KA 4FEQA 4JMQA 3PXFA 2WTJA 4L52A 2HWPA 3RJCA 3MVLA 5J7BA 4CZYB 2C6DA 3QUDA 1L8TA 2WTCA 3F61A 3LCSA 5CQWA 3JVRA 3OTUA 4F4PA 2XCHA 3O8PA 5I9XA 3A61A 2VTRA 4RT7A 3MH1A 2QR7A 2XIYA 4HOKA 4EKLA 3UJGA 2R3RA 2W4KA 4CRLA 3FMDA 3NUSA 2P4IA 1UWHA 4MD8E 5A4LA 4H36A 3VBYA 2P3GX 2QNJA 5TR6A 5JZNA 5HVKA 4PL5A 4HZRA 5BV3A 4W8EA 4GFGA 3LXNA 2PE2A 3GNIB 4EZ3A 2Z8CA 3LPBA 4G6NA 4I0SA 4WG3A 3OC1A 5JFSA 3LCTA 3WF7A 3VS7A 2QOCA 5FGKA 4HZSA 3CTHA 4XCUA 4CXAA 3T9IA 1CKJA 2GS7A 2X7GA 1G8JA 1OZ1A 4I94A 5HVJA 3BKBA 2Z7LA 4QP7A 2VTMA 3NPCA 2F7EE 2J5EA 3W2SA 5HI2A 3S3IA 4APPA 3UNKA 4CEGA 5AP7A 2JKKA 3RCJA 5HLNA 1YDSE 3GCUA 4E4NA 5E1SA 4FNYA 1IA9A 1JVPP 2YDKA 2GS2A 2V22A 4RZWA 4ERWA 2Y7JA 5JFXA 3FKLA 2HOGA 1MUOA 3QRUA 4RJ8A 1OMWA 5CNOA 5HD7A 4MWHA 4BIBA 4PNIA 1OBDA 4FVRA 2W9FB 4EK4A 1REJA 1TQMA 4IX3A 3FEGA 4XV9A 2G2HA 4AAYA 2IZSA 3H0YA 4CFUA 5AUUA 4E3CA 1BYGA 3SDJA 4F9YA 4FTRA 3F5XA 5JSMA 3RI1A 2GTMA 3DU8A 3FI2A 3AC8A 4X7QA 3UYTA 4PPCA 2ITTA 4LGDA 2JEDA 1AD5A 3TIYA 4BGGA 4ZIMA 4AZFA 1R0PA 3BIZA 3N4UA 4WO5A 3ZRKA 3O5AA 3EZVA 3W0PA 4XBRA 2ZB0A 3DK6A 5LCKA 5C27A 3R71A 4EHEA 1OKYA 3DLZA 4GK3A 4ZS0A 3QKLA 1W2CA 3F3ZA 5AWMA 2QOLA 4ANSA 2J0KA 3BBWA 3TZMA 4R77A 4DEIA 2YABA 4MD7E 4USEA 2X8EA 3LFQA 4I6FA 4S31A 5AJQA 4C3RA 4JVGA 4JIKA 2R3MA 3DB6A 3HP5A 5FTOA 3PG1A 1JPAA 4NM7A 3HP2A 4LMNA 3A62A 4RZVA 4O7SA 4O4EA 1ZAOA 4RVKA 5FD2A 5KZIA 4FV1A 3W16A 4AA5A 5KKRC 5HCYA 4QMVA 5HTBA 5KCVA 5CASA 3HDNA 4AXEA 3BWFA 4IQ6A 4O4FA 5K4JA 3PP1A 2C1BA 4O96A 4UV0A 3G0EA 3UQCA 3PA4A 3QFVA 3V6SA 4F1OA 3LKMA 4EK6A 3TKIA 5E1EA 5ACKA 3TNQB 4IX4A 4Q2AA 2OFVA 2RKUA 5CZIA 3S4QA 4BDDA 2YWVA 4K1BA 5IUIA 5JGAA 2LGCA 4YBJA 4NWMA 4XG6A 5HORA 3UIMA 5M57A 3AT4A 2W9ZB 4QT1A 2ZMCA 4ITJA 2VGPA 2WEIA 5LMKC 5EDPA 5AP3A 4KD1A 1LEZA 5CU6A 4RX5A 4AFEA 3TUDA 5HG7A 4OW8A 5HG9A 3SXFA 5GJGA 4FG8A 4DHFA 1NVQA 1LP4A 3C4WA 1SNUA 2B53A 4FBXA 4AGDA 3CQUA 3EN7A 3FAAA 3ZBXA 4ZTMA 2WTVA 2YIRA 4EHZA 3LCOA 2VTJA 2QU5A 1H1RA 3RKBA 2OJJA 5ETIA 3E63A 1KOBA 2B7AA 2GFSA 4X2KA 2C6OA 3C0HA 4UBAA 2OSCA 2XH5A 3H9FA 3FMHA 1GZOA 5E8SA 5GIPE 3HRFA 4FTLA 3VRYA 3JY0A 3G9NA 4IX6A 4QTDA 1IAHA 4O84A 2ZV2A 2X4FA 4YJSA 3MA3A 4BC6A 5CF4A 3DDPA 2WKMA 3OOMA 3QLFA 4RJ7A 5KMOA 3HMIA 1G8AA 3TKHA 4FMQA 4IJ9A 5EHOA 5JH6A 3D0EA 4BDFA 1DAWA 4DEHA 4MK0A 5J9YA 4M0YA 2R3HA 1UWJA 1H1WA 2J50A 4EH8A 1ZMUA 2H6DA 2X39A 2SRCA 2AC5A 3VS5A 4YO4A 4EWQA 1URWA 4BJJA 1YWRA 1E1XA 3NWWA 2OFUA 5AIKA 3ZO1A 3F6XA 4O2ZA 4E93A 2PZYA 2YCRA 4LRKA 3W0RA 1OPLA 4KINA 2PUNA 2FGIA 4DBXA 3SX9A 1PYEA 1Y57A 1GIJA 3EQFA 2UW0A 4D4SA 5AM7A 3RM7A 2JKMA 4P2KA 4XBUA 2WTWA 3HL7A 5LMAA 3VS1A 2YA9A 3A7FA 3ZUTA 4FKUA 4YMJA 5AA9A 4BHZA 4JDKA 4PRJA 1W83A 3RPRA 4RQKA 3NUYA 4YU2A 5M51A 4XV2A 4QQTA 1FOTA 1DM2A 4XG7A 3UVRA 4O7VA 1NA7A 1JKTA 3F66A 1KV1A 1W8CA 3MFRA 5D12A 3HDMA 4IAFA 4XG9A 3IW5A 4WIHA 4FEUA 4I24A 1ZYCA 3KB7A 3VQUA 4NKSA 4AZWA 4HGEA 4FTUA 5E4HA 4DCAA 1UNLA 4J71A 4G5PA 4KA3A 5AV1A 1T46A 3SVVA 4I4EA 5CAVA 4HGTA 4WKQA 4OTIA 3HMMA 2P2IA 3QYZA 5EFQA 3HRBA 4FIHA 4GFMA 1NXKA 2PZ5A 3QGYA 3KN6A 2A0CX 4RWIA 4C4EA 4DG3E 2JFLA 3JVSA 2VX0A 5GZ9A 4EWHA 4FK3A 3PJ8A 2ZOQA 5EHLA 3TZ8A 1XMMA 3BE9A 3V5LA 4BBEA 5CQUA 1JOWB 2E9VA 4JI9A 4QMUA 4RRVA 5C8MA 5CS6A 4YJUA 3HMOA 3QRJA 4FV8A 5AFVA 4OAUC 3KK8A 1QPJA 1ZMVA 4FGBA 5ICPA 5DT0A 3VHKA 1XQZA 4ITIA 3VW8A 1XR1A 5E7RA 2BR1A 4E1ZA 3M1SA 4UMQA 5FLFA 4A4XA 3FWQA 3DFAA 5GZ8A 5AP1A 3LLAA 4V01A 4QMSA 2I0HA 2ZJWA 5LMKA 4ZAUA 3TTJA 2QG5A 4ZTQA 3SXSA 5BVDA 4FNZA 3UQGA 4G1WA 4M14A 5EYKA 2IVSA 4EBVA 3ZM9A 1I44A 2WFYA 2VTOA 5HICA 1YRPA 2PE1A 4U43A 5CAOA 5E8YA 2RIOA 3EQPA 4BHNA 4LV7A 4LFIA 3FPQA 3WZUA 4J7BA 2B54A 1U54A 4IH8A 4FKRA 4P90A 4IMYA 2CN8A 2B52A 5FWKK 1KOAA 2ZDTA 3ENMA 3PXQA 2UVYA 3VUGA 4AS0A 2BIKB 3QQGA 2XZSA 2ZAZA 3W18A 1R39A 2OF4A 4QQCA 3QCXA 4UMTA 4EOQA 2WB8A 3DXQA 2J6MA 4YLJA 5HU3A 4QEBA 3A8XA 3R28A 4FIJA 3V5QA 3EFLA 2ITZA 3BGZA 4F0IA 3KA0A 3R22A 4GVJA 4MXYA 4P5QA 3TKUA 4FTCA 1SNXA 4FL2A 1ZY5A 5DNRA 3Q96A 4ZMFA 2WXVA 2XIZA 3P4KA 2OIBA 4ARKA 5EK7A 3PVUA 2XARA 2RFNA 3SV0A 2CGWA 2QURA 4IWQA 3ULZA 5A6OA 5EM7A 3AC5A 4C62A 3POZA 3LHJA 4G6LA 3UPZA 4TYHB 1BLXA 3ORTA 3HUBA 4IZ5A 4X2NA 4FYOA 5HEZA 3SRVA 4CLJA 1ATPE 3THBA 3ZYAA 5KMMA 1SM2A 3VF8A 4D2WA 4EHGA 5B0XA 4V05A 5E92A 3K3JA 3CE3A 3FLSA 1XO2B 3QWKA 2O64A 3ZFMA 2BIYA 3FYJX 5L8KA 4CRSA 4ZS4A 3CLYA 2RF9A 2PVMA 4L7SA 5DVRA 3ZHPC 3H9RA 4I5PA 4JAJA 3ZUVA 3KIOC 4EOKA 3Q2JA 4BYIA 4WOVA 2W4OA 4OBOA 5HCZA 4ZY6A 3TACA 2F9GA 4KS7A 2VNWA 2UZWE 3OMVA 4FTMA 3LCKA 5GZAA 2XEZA 5IEXA 4O7TA 2QODA 3NYOA 2VD5A 3ZOSA 4AT3A 1WBVA 4IWOA 3KXZA 4DHZA 3GU4A 4GUBA 5AA8A 4IM3A 4N70A 2ACXA 2BCJA 2OKRA 4KS8A 4BCNA 2I6LA 3I4BA 5KUPA 1J91A 5ANOA 3HA6A 3ACJA 3TNIA 2IEWA 2YN8A 1JSVA 5AR2A 5FEQA 4OAVB 4Y46A 3TDWA 1VEBA 4TYGA 3IDBA 3L9NA 3VVHA 2C0IA 1YKRA 2G01A 2W1ZA 4LL0A 3AD4A 3W2CA 3HV6A 3KXHA 3I7CA 3E7VA 5IQGA 3I7BA 3OWLA 3K5UA 4TRLA 3E88A 4RIWA 1STCE 3EKNA 5FM3A 5JQ5A 4U0IA 3V5PA 3WE4A 5J9ZA 5I9ZA 1PHKA 3K54A 4MNEB 4Y95A 4CSVA 5K0XA 3ZLSA 4HCTA 4DT9A 5L6OA 4IADA 3KY2A 2VX3A 5J8IA 3NIZA 1OB3A 4RX7A 2XALA 3C5UA 3PZEA 3TV4A 4H58A 4HYIA 3WF5A 2XKEA 1JKLA 3AGLA 3KQ7A 1DI9A 3PJ3A 3IDCA 1ST0A 2W0JA 1AQ1A 4J52A 4DEGA 2ZM1A 3BGPA 4AZVA 2UZDA 2X0QA 2V0DA 4KBKA 4ZZNA 3S0OA 5IQCA 4W4YA 3P0MA 3WZJA 3QQJA 5FG8A 4V0GB 1P4OA 2Q83A 4MEDA 3DGKA 3CD3A 5D41A 4D1SA 3N4VA 3R1QA 3FDNA 1ZMWA 3BQCA 3JPVA 3V8TA 1Z5MA 2FO0A 2OXXA 3F5UA 4FOCA 4UWCA 2VO7A 1XH8A 4IX5A 2UZLA 2VWIA 5ANKA 2A19B 4EJNA 3AC3A 3M11A 3QQLA 3ZSIA 3S95A 3U87A 4BIDA 3GU7A 4IVCA 3CQWA 1HCLA 3HV5A 4RFZA 3MPTA 2PWLA 4JG6A 3R9HA 3FC2A 3DOGA 5CWZA 4AN9A 4AT4A 4BCPA 3IW6A 1UV5A 3IONA 3NYXA 4NYEA 4GS6A 2RSVA 2XNOA 2AYPA 4NW6A 4I93A 4IAIA 3DZQA 3QX2A 2JKQA 3ZLYA 4X21A 5CU3A 4CZTA 5EI2A 1KUTA 4KB8A 3BQRA 5ETAA 2PE0A 3F7WA 5KNJA 3QTWA 4O7NA 1UNGA 2C4GA 1Q3WA 2J51A 5HHWA 3UO6A 3V5WA 3ZLXA 4G31A 3R83A 4BVUA 4C35A 3QZIA 1OIRA 3SOCA 4LOOA 3PUPA 3L8PA 4FSUA 1U4DA 3MFSA 3Q6UA 4E6CA 3LXPA 3R01A 4O7WA 2WHBA 3W2OA 2QKWB 3UNZA 1FMKA 5A4EA 2WTDA 3V8SA 2O63A 4A9TA 4U45A 2YDJA 4TYIA 5EKOA 1WVXA 3EN6A 4Q9SA 3BELA 5CY3A 4EKKA 4NKAA 5F94A 3R1YA 2V7AA 4EC9A 5DFPA 3VQHA 3SQQA 5HE3A 1UU3A 4GMYA 4YLLA 4IB3A 4I23A 1FVVA 2JBOA 2YIQA 3FSKA 3DBQA 4X3JA 3QWJA 5FM2A 2I40A 4RJ5A 5J5SA 3GUBA 4CTCA 4FUYA 5C1QB 1J1CA 2YLEA 4AF3A 5LVPA 2ETMA 1MRVA 4AW1A 4QYGA 5IKWA 4PY1A 1YHSA 4O86A 4ZTRA 2BVAA 2GHGA 4X2JA 4RFMA 2I1MA 3RWPA 3MY1A 4AZTA 4QMYA 2BILB 3CEKA 3ODZX 4QMWA 3ZONA 2OLCA 1PXMA 3IGOA 3IPHA 3KVXA 2PZRA 5CF8A 3HNGA 2XB7A 5JK3A 2HY81 1APME 3RHKA 3KRJA 5FTQA 5M08A 4QD6A 2OZAB 4CLIA 3OTVA 5CEQA 2XNEA 2XRWA 1YQJA 1J1BA 3HMPA 4MNFA 3RNIA 3DBEA 4ZY4A 4AXFA 4FX3A 5FRIA 3W0OA 4K33A 3OHTA 1Q4LA 3ORZA 1ZARA 3AKLA 1YI3A 2C3IB 5CSWA 5AUYA 1H27A 4RGJA 3W8LA 3ZU7A 4L46A 1M7NA 2OF2A 4EZ7A 2GNFA 4UXLA 2BFXA 4NSTA 2G9XA 3BWJA 4WT6A 5ANJA 3BV3A 5EG3A 3NUXA 2W05A 3LFCA 2XA4A 5EYMA 3UIBA 4KWPA 4FK6A 4ANMA 3TEIA 2C5VA 4IFGA 3TM0A 4HNFA 2JKOA 3IW4A 5M4FA 2YDIA 3C4ZA 4CQGA 4DHJA 2XJ0A 2PUIA 3UMWA 4TWCA 2WMXA 2C6IA 2BRHA 2OXYA 2J7TA 3EQDA 3OXIA 2FSLX 2EB3A 3U8WA 4IXPA 3OW3A 4G34A 4IVBA 4QRCA 2YJRA 4XYFA 2GPHA 3W55A 5B7VA 5CAPA 4AW5A 5IH6A 5L4QA 2PHKA 2CJMA 5FDXA 1FINA 3Q4UA 4FTOA 4O91A 4B4LA 1PJKA 2FUMA 3COMA 4MXOA 3OBGA 4L42A 4A9SA 5HLWA 5IA4A 2QO9A 4EJ7A 3VC4A 4NCTC 2PVJA 5DIAA 3FQHA 4F9AA 3NZ0A 3P7AA 1MRYA 4ZLYA 3P9JA 3QC9A 4X0MA 4YHJA 2A98A 3DCVA 5JFVA 1R1WA 1YHVA 1FVRA 1Z9XA 2Z7RA 4MAOA 4H39A 1YWVA 2DWBA 3FMKA 3PYYA 1Q62A 4FV9A 4LMUA 4OTQA 4R1VA 2Q0NA 4XOZA 4ZZOA 5LWNA 2VN9A 5M07A 3TNWA 5DI1A 2WU6A 5DLSA 2ITXA 4AX8A 5HBHA 4JJRA 1O6YA 3AMBA 1OPKA 4DGOA 2X4ZA 3EOCA 5LVLA 4PP9A 4U81A 3U51A 4BDEA 1BMKA 4KKEA 2R3KA 2H8HA 2R3GA 3OT8A 3O0GA 4TT7A 2G2IA 3DKGA 1ZOHA 5K4IA 5C4LA 3DKOA 1BL7A 3RPVA 3MN3A 4GK4A 5IA5A 3EYGA 4IE9A 1O9UA 2QLUA 4A9UA 3R9RA 4YJTA 2C3LA 4QO9A 3LVPA 2CNUA 2UVXA 4CG8A 3IS5A 4YHFA 3T3UA 2RFSA 3VONA 3I60A 5DYJA 3TCPA 4D2SA 3DZOA 1YHWA 4FUXA 4M0ZA 4QYHA 4RA5A 4K9YA 2O5KA 5C9CA 1ZY4A 2B9JA 5BVEA 3NAYA 1PRYA 3CJFA 4R8QA 4G3CA 3NUUA 2WMWA 3KKVA 4FV4A 4C38A 3P79A 4QP1A 4QOXA 3OOGA 2BZIB 3R02A 4MKCA 4PWNA 4ZP5A 5DN3A 2C5YA 4EBWA 3SG8A 1KV2A 2GSFA 2YLFA 4FODA 4GIIA 4O4CA 4RIYB 3UG2A 3W2RA 4D2TA 4G17A 2E9OA 3W0MA 3DXNA 4JIAA 3RP9A 3ML1A 1URCA 2B0QA 4BKJA 3QQKA 3SHEA 1XWSA 2GU8A 3QC4A 4GYIA 5EI8A 4BTMA 3NIEA 5TO8A 4BCFA 5HE2A 2C6MA 2WD1A 5AR5A 4FR4A 4QQJA 5AP5A 4CNHA 3NFFB 1UA2A 2WMBA 1WCCA 3LXLA 4RLLA 4WRGA 4KSQA 3ZSHA 2WTIA 3GT8A 5DMZA 3CPCA 4KSPA 4B99A 2WOUA 3ZSGA 2YM8A 3OCBA 3AC4A 3W33A 3GP0A 3ZXZA 2XKFA 1OI9A 3KFAA 1MRUA 2BZHB 1E9HA 2VWZA 2F2CB 3NYNA 4DAWA 4YJVA 2WMUA 5A14A 3R2BA 4R3PA 2JIUA 3SOAA 4UMRA 2GNIA 5IA1A 3ATSA 4XLIA 3L1SA 4DEEA 2HW6A 4FEWA 1H28A 2X9EA 4FOBA 4LV8A 4XP2A 4DFXE 3KL8A 3ROYA 3R9OA 5D10A 3Q6WA 4QPSA 4HVSA 1W2FA 1OGUA 4F9WA 4HVHA 4CVAA 3Q3BA 2I0EA 2WGJA 2XIXA 1GJOA 2UZNA 4D4VA 3ZC5A 3PE1A 3KRLA 4JL9A 4MH7A 4JDJA 3MS9A 4HVDA 3CJGA 4DA5A 3BHVA 3R7GA 4GL9A 5KMNA 3GEQA 2BTSA 3L9LA 3BE2A 4QP3A 4UALA 3H0ZA 4CMOA 2A4LA 2VTPA 4QYEA 1ERKA 2WNTA 3MWUA 3QD0A 4OBPA 3NUPA 3D5UA 4HJOA 5IF1A 4NCTA 3CKXA 4JR7A 3C51A 3ERKA 2CGXA 1J3HA 5F95A 5CU0A 4IC7A 3C4FA 4CV9A 4DLJA 4FTQA 5BMSA 4J8MA 5M4CA 4DINA 1OL1A 1V0OA 2IJMA 4J99A 4L00A 3RM6A 3ORXA 2X7OA 4BTFA 3C9WA 3VS2A 5M4UA 4M3QA 3BEGA 3ANRA 3QRIA 3DA6A 2W1GA 3F5PA 4FSRA 4HYHA 2J0MB 4TYHA 2C6EA 2NO3A 3GGFA 3BU5A 5CI7A 5EDRA 3PRIA 4A4LA 4UMPA 1IAJA 3WZKA 5HIDA 2CLQA 5AIRA 4XUFA 3ZLWA 4BWKA 3L9MA 2QOBA 3PPKA 3GU5A 4RVTA 4YR8A 4FGRA 3VBXA 4BY9E 4ACGA 3U4WA 3POOA 3NNUA 5BPYA 5LVOA 2XNPA 2W7XA 4FKIA 4XOYA 1JKKA 4E6QA 4OGRA 2PY3A 4CCBA 4UX9A 2F49A 4Y5HA 4G5JA 5AAEA 4IB5A 4O4DA 4XHKB 2BDJA 3REPA 3R7YA 3BLQA 4L43A 3K2LA 1PYXA 1IG1A 4QP9A 4LOPA 2Y6MA 1IEPA 5C03A 2EXEA 2VAGA 3OVVA 2GNJA 1TQPA 5KO1A 2R7BA 3BYMA 4OTFA 1OL2A 3QCQA 2QOHA 4AACA 4P7EA 5IQAA 1ZYDA 4M8TA 4O0YA 1FPUA 4S2ZA 2HCKA 3FZ1A 2UVZA 3KN5A 1OBGA