3L1SA

3-aryl-4-(arylhydrazono)-1h-pyrazol-5-ones: highly ligand efficient and potent inhibitors of gsk3
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
360
structure length
336
Chain Sequence
SMKVSRDSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogen synthase kinase-3 beta
publication title 3-Aryl-4-(arylhydrazono)-1H-pyrazol-5-ones: Highly ligand efficient and potent inhibitors of GSK3beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 336
sequence length 360
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3l1sA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3l1sA01
1IR3A 4YBKA 5E8SA 3MGYA 5HNGA 1UU3A 3L9MA 4V0GA 1Q8TA 4IAAA 1TQPA 4P5QA 3DY7A 3F7ZA 1RQQA 1RW8A 2IO6A 4UXLA 3FQEA 3P5KA 4WNOA 3FC1X 4BGHA 3DCVA 3AC2A 3E7OA 2JEDA 4AT3A 2Y7JA 2V7OA 4Q2AA 4D9TA 4E73A 2QU5A 4HOKA 4L6QA 5EHLA 3BYVA 1GZOA 2IW6A 4LUDA 3R83A 3KF4A 4YZ9A 2OU7A 5FDPA 2GHGA 3NIEA 4QTBA 2ETRA 3RWQA 5ITAA 3V5QA 5A54A 5HEZA 4WRSA 3COHA 2DYLA 3HA8A 5GHVA 4TYEA 4BZDA 2XKCA 3PSCA 4RVTA 1DI9A 5M44A 5IQAA 4E5AX 5HIEA 5DR6A 1OUYA 5GIPE 1APME 3AT4A 4EH5A 2WB8A 2QO9A 2ETKA 1E1XA 3AT3A 3O23A 5IPJA 2PVMA 1WBWA 3TZ7A 4IE9A 2CKEA 2V7AA 4FV9A 1XHAA 2E9UA 4O22A 5IDNA 4CYJA 4S2ZA 4NWMA 2HZIA 1SZMA 4CSVA 3SD0A 3NVKI 3E5AA 2OFUA 1QPCA 1MQ4A 3IO7A 4O2ZA 3QC4A 4IX6A 3U4UA 4ASDA 4X2NA 4HCTA 3UIBA 4CT2A 3C0GA 4JR7A 4KS7A 1OBGA 3PXRA 2WTKC 3BV2A 2XNGA 3EQFA 1F5QA 5LOHA 3CIKA 4HNFA 3UZPA 5CX9A 2WTWA 1WCCA 3I7BA 4JAIA 4ZTQA 4EEVA 5CS6A 3LFBA 3QD4A 1OKZA 3PXYA 5K4IA 4WNKA 3PP1A 4FSMA 3SC1A 4EYMA 3U6IA 3NSZA 3NUAA 4RVKA 2QKWB 4UZDA 3EHAA 2HK5A 3UYSA 5FM3A 5M55A 2ZDTA 3FXWA 2VWWA 2ZAZA 2GS6A 2W0JA 2Y6OA 3BGZA 5KMIA 1F3MC 2AUHA 3OT3A 3QQUA 4IFGA 4PDSA 2X2LA 5TT7A 4UXQA 4BYIA 5K5NA 5IQIA 4AW2A 4RX9A 2JLDA 2VTQA 1Q3WA 4U7ZA 4IB0A 4CMUA 2CKPA 1H1SA 4MQ2A 3RCDA 4FNXA 4EOPA 4OTFA 4I23A 3QQLA 4U80A 1RE8A 1WBVA 4BY9E 4IDTA 3A61A 4JX7A 3R8PA 4FNYA 4N6ZA 1Q61A 4X2FA 3OUNB 4R1VA 1K9AA 2ACXA 3C5UA 3HUBA 3MTFA 4M97A 1JNKA 2IJMA 4IB5A 3RCJA 4E4XA 2YWVA 5HGIA 2WNTA 1VR2A 4HCVA 2SRCA 3LVPA 3KXMA 3R22A 4EZ5A 3C13A 3FLNC 2GHLA 3VBQA 4C4GA 2FVDA 4QD6A 2XUUA 3K5UA 4NYEA 3V51A 2BTRA 4FSTA 3UO5A 2UW8A 3EFLA 2XP2A 1WBSA 4XG4A 3AC4A 4EBWA 3WZJA 5D7AA 3ZXZA 4DT9A 1PKDA 4ZTHA 3CTJA 3HMPA 3KY2A 1OBDA 2WKMA 1H00A 3OTUA 2XIXA 5E1SA 1NW1A 4FEXA 4FTCA 4FTNA 1UU9A 3OF0A 4RIOA 2WHBA 1DI8A 1PXOA 2O8YA 1H1PA 1W82A 3QTRA 4RIYB 4CMTA 1OECA 4WA9A 2W7XA 2ERZE 1HCLA 1T46A 2R3KA 3P78A 4FT5A 4NFMA 3ORIA 4Y95A 3UC3A 3UQFA 5FTGA 2O2UA 3EQIA 4EQCA 4EYJA 3DPKA 3QKMA 3LMHA 3FKLA 4XG9A 3QHWA 4EOSA 4BCNA 3U54A 1V1KA 4TYGA 4FTUA 4QMXA 1J91A 4Z7HA 3EOCA 5AJQA 3V8WA 4EHVA 3VRYA 2UUEA 3PWDA 3PIXA 4FTOA 3NNXA 3LMIA 2X4FA 5KX8A 3P7BA 3W16A 2P55A 1Z57A 4BBFA 3PIZA 2BDFA 2C3LA 2W5AA 2E9NA 2QVSE 4PX6A 4GK4A 2ZM4A 4CFVA 3HAVA 1GAGA 2W1FA 4FKTA 4FKSA 4RZVA 1Q99A 2R3MA 3ATTA 2WXVA 3UOLA 4M12A 2ITPA 4XEYA 4F9BA 1KE7A 5EQEA 4BICA 5J5TA 3DGKA 1J7LA 1PKGA 4XJ0A 2CLQA 4TWNA 3RM6A 4RJ6A 4AWIA 4LL5A 5CEQA 2VN9A 3D14A 3SXRA 3GCQA 5G6VA 2PVRA 5BUIA 3W2RA 5LVNA 1KSWA 5FXRA 5J7HA 3Q96A 2QOIA 1SVGA 2XZSA 3SXFA 4FKUA 2HY81 4ONAA 5J95A 5LVPA 4DFXE 4EJ7A 2QQ7A 2Z7SA 2OXDA 4IVAA 1M2QA 4HJOA 2GTMA 4JL9A 3VRZA 4RJ8A 4A9TA 3AGLA 5ANJA 1YDTE 3E88A 5HNBA 4W4YA 5LVOA 5FM2A 4ZLOA 1PXPA 2R3RA 3ANRA 2QOCA 1JSVA 4IACA 3QRKA 4FV5A 3B8RA 4ACDA 3EQCA 5FBNC 2YIQA 3ROYA 5AMNA 3D7ZA 3L9LA 4TRLA 3UOKA 3TTJA 3VBTA 4D1SA 4FEVA 4O7ZA 2WOUA 4QYHA 4H39A 3S1HA 1GJOA 3PJ1A 3E8NA 2RFDA 5FEDA 5DI1A 3UQCA 3WYXA 3GC8A 4O82A 2WMWA 4IZ5A 3VBWA 3C7QA 4YLKA 5H2UA 4FTJA 5ANKA 5C4KA 4U40A 3GUBA 3F3UA 3QUPA 2WMAA 5D41A 2RSVA 1UKIA 2WTJA 2C5NA 3HX4A 3I5NA 3LJ0A 1B38A 1Y57A 3PE2A 5CI6A 4YC6A 3FDNA 5CAVA 4QMYA 3QRTA 3VW6A 4O38A 4MAOA 4O7RA 3QU0A 4P4CA 3FPQA 4ZS4A 4PMMA 4QO9A 4Y5QA 4YJRA 4YP8A 1H01A 4NSTA 2BAKA 4FT9A 5LMBA 5DT0A 5H8GA 2XRUA 5L8KA 3QUDA 1PMEA 1SVEA 2YM7A 4DGMA 4BDGA 3COIA 2G2IA 2NO3A 3FL5A 3RPYA 4DFLA 2VWIA 3UVQA 4F1TA 2FSOX 2W1CA 5HLWA 4QNYA 2YIRA 3RK7A 4H3PA 2G01A 4Y5HA 5FBOA 3EIDA 4JNWA 1O6KA 4FEUA 5FRIA 3CXWA 5EOLA 3VS0A 2VTJA 3TWJA 3VIDA 4JIKA 3O17A 4YJSA 4O7YA 5FP6A 3DS6A 4GUBA 1Q8UA 2B53A 2WEIA 2R3HA 3DBEA 4FIIA 4OAVB 2QR8A 3HV5A 3HMOA 4L7FA 4CCBA 5K0KA 4YMJA 2PVFA 1ZLTA 3QTQA 3C4FA 3DAEA 3NWWA 3HRCA 5LWMA 3I7CA 3BYOA 3C4WA 3E93A 4FVRA 3B8QA 3G0FA 4X3FC 1JKLA 2F7XE 4Y85A 4X21A 4DEGA 4RLKA 2QONA 4EC9A 4TWOA 4RWIA 4B8LA 5JFSA 1URCA 4TNBA 4GS6A 3ZUVA 3MFTA 2P33A 2J4ZA 2X8EA 3KRXA 2WTIA 4MXYA 4O0SA 3DJ6A 4ZEGA 4QYGA 5LJJA 3VNTA 4Z16A 5JQ5A 3WF5A 3BEGA 3CQWA 3NX8A 4GUEA 4BVUA 4ANQA 4F70A 4IVDA 4PQNA 1ZYJA 4IAIA 3ZM4A 1WMKA 1MRVA 3LXNA 4HZRA 4BI1A 3FZPA 4O27B 3RPSA 2P4IA 5LCKA 2X7OA 5JFWA 4MYGA 4AUAA 4NW5A 2VO6A 3FMHA 3EJ1A 3OWLA 2VTAA 4FG7A 4I6BA 5CZIA 4K77A 4PPCA 4C62A 4QQJA 4RQVA 5E1EA 4USEA 5HVJA 4YSJA 1OITA 5M53A 2X7GA 1OIQA 4I5CA 4JX3A 5CF4A 4FTMA 4IWQA 4D2RA 5BVFA 4AE9A 5HORA 3WE4A 2B4SB 3PRFA 5AUWA 3LLAA 4AGUA 1QPEA 4U81A 5B2LA 3VS7A 3TJDA 1Y91A 5ANEA 4PL4A 4FTRA 4ZSGA 4ANMA 3HMIA 3A7HA 4GJ2A 2ERKA 3EN4A 3R8MA 4DG2E 3DB6A 3FY0A 2W9FB 3G9NA 4G2FA 2VX1A 1ZMUA 2IW8A 2UW4A 2HXLA 4WRGA 4L45A 4E4NA 3QQJA 2XH5A 3FWQA 3I1AA 3QQHA 2C3IB 2F7EE 2UVZA 2I0HA 4ACMA 5HIBA 4EOKA 3GQLA 1DAYA 3JPVA 5M51A 3KVWA 1U5QA 4XH6A 3FQHA 3D15A 4NKAA 3A99A 3Q3BA 4EK8A 5L8JA 4JRVA 3DXPA 3MA6A 2YM3A 4JG8A 4MBJA 3UOHA 5CU2A 3DJ7A 4RIYA 4BI2A 3UDBA 2GFCA 4PDPA 4BL1A 4U3YA 2VD5A 3LCOA 3R7VA 2WOTA 3TNIA 3NZ0A 1IAJA 4G6NA 3H9FA 4HNIA 2VTIA 2RF9A 2Y8OA 1SMHA 3QA0A 3BE2A 4B6LA 2EWAA 2J7TA 3NUPA 2BAQA 4PY1A 2XK9A 4CFNA 4KINA 4ALWA 4E8AA 3ACKA 1KOBA 3JYAA 4B0GA 4D28A 2YAAA 3HRBA 4GCJA 3VBVA 3OCSA 5L8LA 4JDKA 5TE0A 4BKYA 5LWNA 2PVYA 4BIEA 1YXVA 4PP9A 4EBVA 1NVQA 3WIGA 5KO1A 3A7IA 1H27A 1V0BA 3DT1A 3ORTA 2R3IA 3W2OA 4FG9A 4M0YA 3PRIA 3WBLA 5CU6A 4LM5A 4CNHA 3FC2A 2VNWA 4RJ4A 1U54B 2YABA 3K3IA 3QC9A 3FE3A 3R1NA 5LXMA 4ITJA 2I0YA 2OLCA 4DT8A 5H8BA 4YR8A 4I5HA 3NNUA 3HAMA 3V01A 3DXQA 5KBRA 3Q5ZA 4U9AA 4DH3A 3PP0A 3R9OA 4EUTA 5EM8A 2WO6A 5A3XA 1BI7A 1G8SA 3D7TB 4ANSA 5CXHA 2DQ7X 2GDOA 2WTKB 3GNIB 5T68A 4HGSA 3II5A 4IH8A 3THBA 5AUUA 5EK7A 2Z02A 4W8DA 2ITVA 5KMOA 4W8EA 3P79A 4KBCA 3NLBA 4OTIA 3FLQA 3ENHA 5CALA 4V0GB 3SHEA 5B7VA 4G31A 4AZEA 3KC3A 5DRBA 1OI9A 2WZJA 4FYOA 4O6LA 4I41A 1SM2A 2FSMX 3KULA 1STCE 3HECA 1YHSA 5AV1A 4EUUA 2F4JA 2IVVA 4D0XA 3FAAA 2R3PA 3PA3A 1UNGA 3PXZA 4JJRA 3EFJA 4A7CA 3LM0A 4N6YA 5CU3A 4C36A 4ZLYA 3FYKX 2XF0A 3RZFA 3TDWA 4C38A 2Z2WA 4W4VA 5DOSA 3V6SA 2YFXA 4NIFA 3ZONA 5EYMA 3WZDA 5E8XA 4AGCA 2RIOA 4QPMA 2P2IA 5F95A 3V8SA 2OXYA 1JBPE 3HV7A 4FOBA 2EU9A 2JKOA 3AD4A 3SX9A 3A7JA 4GJ3A 4E6AA 3K5VA 4L3LA 5LMAA 3NS9A 2HXQA 2VTHA 4BCHA 3DTCA 3LLTA 3ZM9A 4RGJA 4YSMA 5AAEA 2FUMA 3E62A 5JRSA 2CNQA 3IONA 3NMUF 4IEBA 5EYDA 3OS3A 3SQQA 5LMKC 4K18A 4NJDA 1OL2A 4DGOA 5HD4A 3R01A 4IAYA 2IN6A 4OBOA 4LQMA 2X9FA 4ORKA 3BV3A 3AMBA 1ZXEA 2OJFE 3QZGA 4M67A 3QRJA 4PPAA 2XNEA 3A7GA 3OCGA 1OL6A 4ITIA 5AR5A 4QMSA 5BUJA 3F69A 2VV9A 3UNZA 4YLJA 2CNVA 5J1WA 1PXMA 3RM7A 3QX4A 4D4YA 5KUPA 3UOJA 1G8AA 4FBXA 4FGBA 3P1AA 3MSSA 3O7LD 3VC4A 2B9JA 1BUHA 1V0OA 4C35A 2BKZA 2VWVA 3TDVA 5JT2A 2BAJA 3FMNA 4PRJA 3OG7A 3FMJA 4AGWA 4HPUE 3GOKA 4FZFB 5T6KA 2R3QA 4O81A 2IVSA 3V6RA 4LGGA 4I94A 4G3EA 2CSNA 4A9SA 4GT5A 5ETIA 5F4NA 4YPDA 4IXPA 4AZTA 1GY3A 1KV2A 1E9HA 2C3KA 4FV2A 3O8UA 1XR1A 3FSFA 4KABA 3FZ1A 2W99B 3LMGA 2PMIA 5CVFA 3TKUA 2I6LA 4YTFA 4G16A 1FVRA 2YDJA 3QTZA 4IVCA 3ZLSA 4ZMFA 2CCHA 3EKNA 3JVRA 4BCPA 3ENMA 4BTMA 4YJUA 4DFNA 1FBNA 3ZRMA 3G51A 4HYIA 1CTPE 3GGFA 4KS8A 1OL1A 2ZVAA 2WU6A 4I0RA 3DLZA 3RALA 3UP2A 4ZY4A 3TV4A 2HELA 4N0SA 4A9RA 3NPCA 1SNUA 2OH4A 4O0XA 4FTAA 5F94A 3SVVA 3LFQA 3R21A 1JWHA 1ATPE 4GIHA 1ZY4A 2YITA 3S3IA 2G15A 4KBKA 4K0YA 3IW6A 4AP7A 2R64A 4O2PA 2OJJA 4WKQA 3UG1A 3ZYAA 4WD5A 4C4IA 3UIUA 3AC8A 3LFSA 4PMSA 3PXQA 2YA9A 5BVKA 5H9BA 5KBQA 3A4PA 2J0IA 3LXPA 4C58A 3BGQA 2YM5A 3BHYA 3NIZA 4W4XA 4KA3A 4ZJJA 3HLLA 2BMCA 4LMNA 4JQ8A 3GC9A 3TL8A 2C1BA 3ZDUA 2GCDA 1OM1A 3LFFA 3R04A 4QT1A 2F49A 4DGLC 2R7IA 1GNGA 2O65A 3LZBA 4I6QA 4CXAA 3LJ2A 4E6DA 2ESMA 3KK9A 1R78A 4I22A 1ZOGA 3R7IA 2WD1A 4CFUA 2YIWA 3U6HA 5A4QA 2O63A 4FKQA 3TCPA 4IADA 2XIKA 4RX7A 4QQTA 2YCSA 4LOPA 3POZA 4G1WA 4ANBA 2EXCX 4IFCA 2Q0BA 2PE2A 3TJCA 4NL0A 3AG9A 3M2WA 2E2BA 4J97A 3R7UA 4EOQA 4ZOGA 5C8NA 3S0OA 2JIVA 3EMGA 3E8EA 4CQGA 1ZYSA 3ITZA 2WELA 3PVUA 2I0EA 3NUYA 2WFYA 3UVPA 4EKKA 5CY3A 3ZLXA 5IQEA 4GU6A 3W2CA 4RC4A 3PY0A 1H1WA 4XCUA 5HLNA 3Q9WA 1ZY5A 3I0OA 1AD5A 5JFVA 4QOXA 5JH6A 1H1QA 2UZUE 3LOKA 2WQNA 2QG5A 2ZDUA 3DK6A 3QGYA 4D5KA 3F2AA 3TZ8A 2WIPA 3CTQA 4LFIA 3OD6X 2YM6A 4FL2A 4OW8A 5HQ0A 5HX8A 1LR4A 3DKGA 1FVTA 1XH4A 3QQFA 1YXXA 2W05A 5C8MA 5CU0A 3G2FA 4J96A 4QTCA 1S9JA 1M17A 1M14A 5IUHA 3COMA 4K1BA 5DE2A 3IPHA 1U5RA 3IW8A 3ERKA 3E63A 2X9EA 4FL3A 4DBNA 2WMXA 1QPDA 4ASEA 2B9FA 3HP2A 4LG4A 5AP0A 2JKKA 3SLSA 3SA0A 5L6PA 3TXOA 2EB3A 2OFVA 4F6UA 1JSUA 1U54A 1XJDA 5IZFA 4FF8A 3BYMA 4HGLA 4YC8A 5D7VA 5LVMA 4FVQA 3KXZA 4CLJA 3MH2A 3ODZX 3BHHA 3E92A 4RFYA 3VHKA 2XBAA 3G6GA 3D4QA 4LRKA 3BIZA 4KKGA 5ANGA 4M66A 5G1XA 4FL1A 3ORKA 3C50A 3UGCA 1YVJA 2IZUA 1CKJA 5E8VA 4DFZE 3ATSA 3HVCA 2JDTA 3D7TA 3MVMA 5BUEA 3QTXA 4F9YA 4K11A 4JS8A 5DFPA 4AW1A 2YN8A 4I0SA 3ZFMA 1Q3DA 2BRGA 2YLFA 2HCKA 1KE5A 3MV5A 5AWMA 4YPSA 4C0TA 4AXAA 3C5IA 2VX3A 1VEBA 3DBCA 3MY5A 3QCXA 4XMOA 4KB8A 4D1XA 4GIIA 4YZBA 2BILB 4G5JA 2W1DA 4RC3A 3QD0A 4HVSA 3RAKA 2QR7A 4EH8A 3FKOA 3QKKA 4QYYA 4EONA 2CKOA 1KE9A 3CCNA 3EN9A 4Z3VA 5KCVA 4G9RA 3FYJX 2JDRA 4A9UA 5EQYA 4J99A 4ACHA 3HV6A 4QP3A 5GZ8A 4BDJA 4AE6A 4RJ3A 5AR7A 4PDYA 3Q6WA 4IQ6A 4FKWA 4UYNA 3HA6A 3ZRLA 2YEXA 1WFCA 3HYHA 4JR3A 2PPQA 3FSKA 1OPJA 3OWKA 4EHEA 3NVMB 5FD2A 1OVEA 4EH3A 4FUXA 3Q5IA 4Y73A 3F66A 3GP0A 5T3QA 2VTMA 1U4DA 2ZOQA 2QD9A 5M56A 1YDSE 1W98A 3TACA 4MXZA 2EXEA 4R8QA 4Y72A 1ZZLA 3DFAA 5GJFA 3GU8A 4XG3A 4DEIA 3U9NA 2HOGA 3H10A 5CF6A 3R00A 4ZXTA 2B9IA 2VWUA 5DYJA 3UMWA 4MXOA 1YXUA 4A4LA 5KZ0A 2UZOA 1BKXA 4HW7A 4CKIA 3VN9A 2QLQA 1LEWA 2R0IA 3CEKA 4YJPA 4DE4A 3GENA 2BRMA 3NUXA 1NXKA 4IB1A 4ZTLA 3U55A 2AC5A 2PZIA 4O0UA 5D11A 5J9LA 2PUPA 2JDSA 3FI2A 4DEHA 3ROCA 4YTCA 3MVHA 2XBJA 2OIBA 3QTIA 5ETCA 3SOCA 4W4WA 3DBFA 5A4TA 2R7BA 3RTPA 4TPTA 2C6LA 3QTUA 3CD8A 3CBLA 4AW0A 2I0VA 2Z7RA 4LRJA 3W55A 1FOTA 3GCUA 3D9VA 5GINE 1YWVA 4YUQA 3CGFA 3AXWA 1BYGA 3PPZA 4RWKA 3HKOA 2PVHA 2JDOA 5DN3A 3E7VA 5FWKK 5HESA 4X3JA 4O86A 4R77A 2JAVA 1CDKA 2UVYA 2OGVA 2QO2A 4I92A 1YXTA 1PMNA 2ONLC 3FLYA 4WO5A 4CQEA 1YQJA 3CC6A 2R5TA 4BDCA 3CPCA 4B9DA 3GU6A 3NUNA 4V04A 3K2LA 4ZP5A 4D4RA 3Q32A 3KQ7A 4E20A 4GVAA 2VTNA 1NY3A 2I1MA 2O5KA 2VGPA 4W9XA 2RG6A 1LPUA 2F9GA 3KVXA 4EH2A 5AADA 5AP7A 2X2MA 5ACBC 3Q4CA 4E5WA 3HV3A 4ZTNA 3NCGA 5JK3A 3DAJA 2XEYA 5AUVA 3LHJA 1M52A 2O64A 4UWBA 1OIYA 5A46A 5DEYA 3TUDA 2PHKA 3E8DA 4C2WA 3QX2A 3SGCA 3KREA 4NZWB 4XYFA 3LW0A 4EQMA 3P7AA 4NTSA 5AR8A 2VTSA 3NW6A 4DF3A 4WUNA 3ZU7A 3HP5A 3KA0A 4RX8A 4KIQA 5BMSA 5LVLA 2QOFA 1M7QA 2XM9A 4ZTRA 4O7LA 1P4OA 2J5EA 3MA3A 3V5WA 3TZ9A 4WSQA 2IZTA 2UZTA 4AQCA 2BIYA 3G6HA 1WVWA 2X6DA 2ITQA 3N9XA 4Y83A 4XG2A 4ANLA 4AZVA 3MPTA 2CHLA 1OUKA 2VTOA 3JS2A 3Q9YA 2BZIB 2WAJA 3PE1A 3B2WA 4IHPA 3KN5A 4TYHA 4H1MA 5CQWA 3VQUA 2XJ0A 4IBMA 4L3JA 5I9ZA 1IG1A 5FEQA 3PVGA 1U59A 4XBRA 5HTBA 4G3CA 2G2HA 4KIKA 5HBHA 4U5JA 3CS9A 3CJFA 3HUCA 2A2AA 3DTWA 4NM0A 4FSRA 2QOQA 3OHTA 4Z7GA 2IG7A 3DKFA 4XUFA 2XNPA 4FIGA 3F61A 3W2QA 1LUFA 3SXSA 3GXLA 4G3GA 4RX5A 3A4OX 4DH7A 3QQKA 3FQSA 4BBEA 3ZSIA 4R7BA 5IMXA 2V55A 4M14A 4G5PA 3R8VA 5LQFA 2WTDA 2Y0AA 2PVJA 4R6VA 1Y8GA 5HO6A 5I0BA 3DKCA 4F0FA 5CT7A 3HRFA 3O2MA 4EK3A 1IAHA 4NW6A 4QMQA 4RT7A 2HAKA 5F20A 2FB8A 4M68A 5FGKA 2CN5A 4L43A 2A27A 4R78A 3DZQA 4S31A 4L68A 3GB2A 4FYNA 4I24A 4XG8A 4KRCA 4HVHA 2NRYA 5J87A 3DDPA 1VJYA 4JBQA 4C33A 4E5BA 2VO7A 4F7JA 2YCRA 1JSTA 5CSHA 4ZK5A 2XJ1A 2WMQA 2OZOA 4J7BA 1UNHA 4QMZA 4RWJA 4BDIA 2BIKB 3PA5A 3CE3A 2J0JA 2XEZA 3DXNA 3F7WA 2CGXA 3D94A 4FK6A 4OBPA 4ENYA 3VBXA 5IUIA 4DYMA 3BBTB 2F2CB 2GPHA 2VTLA 3VHEA 3R71A 3FUPA 3QCYA 1YOMA 3KULB 2QG7A 5C1QB 4O6EA 3FXXA 4BWPA 5JGDA 3SG8A 3KF7A 2F57A 4FTKA 3ZBFA 3RPOA 4JLCA 3I6WA 3LXLA 3IOPA 2R3GA 3QXPA 2GS7A 2NPQA 2OWBA 2OZAB 3QCSA 2H9VA 4FMQA 4NIFB 2BROA 2CMWA 3DAKA 2UW3A 4AZFA 4X3FA 4PDOA 1OKVA 1UWJA 4Y8DA 3GVUA 2RFNA 4D0WA 1S9IA 3GCPA 3REPA 3VULA 4O0WA 2NP8A 4UMQA 3T3VA 5DT3A 4IX5A 1NVRA 1JKTA 1FPUA 2OF2A 3ZFXA 1Q8ZA 5CLPA 4ARKA 5AX3A 4C3FA 4CFMA 4AN2A 3NR9A 3EFKA 1Q24A 2UW7A 4DCAA 2VTRA 4QP9A 4OAUC 4JAJA 3EWHA 4QMNA 1ZRZA 3EB0A 3EL8A 5GZAA 5JRQA 3WZUA 3W2PA 2GU8A 2LAVA 3RZBA 4FIFA 1YWRA 4JOAA 4CRSA 3G15A 3KEXA 4R1YA 3FHRA 3FZOA 3MH0A 4NT4A 4RFMA 3K54A 4YU2A 3MI9A 3KRWA 1H1RA 5EW8A 4G3FA 4DC2A 3DBDA 2WPAA 3ZLWA 3MPMA 2E9OA 2B52A 2JBOA 2PL0A 3C0HA 4WNPA 1KE8A 4E3CA 4ZSAA 3BE9A 3BQCA 4FSYA 4CFWA 1ZOEA 4QMVA 5IA3A 5CAOA 2V5QA 5C27A 3TG1A 4ASXA 2JDVA 4KIOA 4TWPA 3AD5A 4RPVA 4UZHA 1JKKA 2HWPA 2PMNX 4DEBA 3R28A 4AU8A 4MF1A 4EH7A 2JIIA 5IDPA 3AD6A 2JAMA 4XHKB 3U51A 3GCVA 5BYLA 4F6SA 3QBNA 4BWXA 4FEQA 3GCSA 2ZV8A 4FVPA 2VGOA 3U8WA 1H26A 1WBTA 3OROA 1OPLA 4IC8A 2WTVA 3SV0A 5CU4A 5ACKA 2PVNA 3WF7A 4ANNA 5EM7A 2ZM3A 4G17A 1YWNA 5M09A 3Q04A 5BMMA 3PSDA 4FGRA 2B54A 3IGOA 2RGPA 1BX6A 4XBUA 2Z60A 4O7WA 4WOVA 3FLSA 4NUSA 1ZWSA 2WQEA 1OB3A 4R5YA 5KHWA 5ANDA 4DG3E 3PJ2A 4R7IA 3WYYA 4D1ZA 4U8ZA 3GFWA 3H0YA 3RK9A 2YJRA 2QO7A 2XKEA 3KMWA 1BI8A 4II5A 4TZRA 2C6TA 3S00A 5B0XA 3QAME 3R1QA 5L4QA 2W5BA 4E93A 4WG4A 5JSMA 4GU9A 4QMLA 4YC3A 5E4HA 5CENA 3V5PA 4U79A 4CYIA 2BPMA 5KMMA 4MBLA 2C30A 1PXKA 4PNKA 3Q4UA 5A4CA 5IEXA 1CKPA 3TNPC 1I09A 4RQKA 3BX5A 2J50A 4H05A 4CGAA 5DRDA 2Y4IB 2FYSA 3OP5A 4WNMA 3F5GA 3EKKA 2DWBA 5C01A 4XRLA 2G9XA 4QP8A 4O96A 1OKWA 2PMLX 1ZOHA 5H8EA 2C47A 3BPRA 2ZV7A 2XB7A 4WIHA 4PL5A 4IDVA 4EJNA 3AMAA 5JGAA 4TYJA 4YGAA 4YZDA 3IW5A 3HV4A 4RIWA 5HTCA 4EK4A 3CY2A 3ORPA 2C69A 3TZMA 4AS0A 1Q41A 3NDMA 5ETAA 2I7QA 2WQBA 4ACGA 5I3RA 2RG5A 3A8XA 4WT6A 3LQ3A 2QU6A 3SDJA 3PVBA 3ZDIA 4GKIA 4EK5A 3SW7A 3WE8A 3LCDA 4CG9A 3EH9A 1ERKA 2OXXA 2EXMA 2P0CA 1GZ8A 3CY3A 4IAFA 4QTDA 4OTDA 2IW9A 1MP8A 1R0PA 2V0DA 3LIJA 3FZRA 2OJIA 3IK3A 3L8VA 4FTTA 5FQDC 4NM7A 4HVGA 3MS9A 2CDZA 4DG0E 1YXSA 1K3AA 3ORLA 3D2KA 3HZTA 4JG7A 1LP4A 1TKIA 2NRUA 2VO3A 4OT5A 4YNOA 5ANOA 2XIRA 2CGVA 4QPSA 4XV3A 5EFQA 5C4LA 2A0CX 5EW9A 3SW4A 2HZ4A 4PNIA 4FKIA 1HOWA 2GTNA 3KXGA 5CSPA 5IA0A 3OWPA 3MVJA 5BQ0A 2QKRA 3ORNA 2GNHA 4DINA 5HNIX 3QKLA 4NCTC 2H96A 3A62A 1B39A 3RAHA 3NAXA 4O7TA 3BKBA 4AG8A 4F63A 1IA9A 2WMVA 2C5YA 4FTIA 5J9ZA 3EQBA 3TUCA 3ZC6A 4D58A 3KMUA 2W06A 2BFYA 2UZNA 2W5HA 4QMPA 4LGHA 3MIAA 4YZCA 4DN5A 4NM5A 1RJBA 4EHZA 4IM3A 3H9OA 3OXIA 1W84A 4GYIA 4XX9A 3LFNA 1HCKA 3IW7A 3SKCA 4DH1A 4CTBA 4I20A 4RMZA 1OL7A 3BBWA 3F82A 3PFQA 3R6XA 4TN6A 4YURA 2GNFA 2J0MB 5AUTA 5LMKA 2ETMA 3HL7A 4I1ZA 5KMNA 3OCBA 4IC7A 5IQFA 2OH0E 3VJOA 2ITYA 3QD3A 3UO6A 4OBQA 4O0YA 1PYEA 3DB8A 4GRBA 3PXKA 3QA8A 3W1FA 4ZLZA 3EZVA 2XKDA 4F99A 4FV1A 4ZZNA 4WUAA 1JAMA 2HW6A 3OXTA 2GQRA 4RG0A 4Y46A 2WQOA 3MFRA 3V3VA 4EHGA 4QP4A 4JG6A 2C0TA 4TY1A 4C34A 3FV8A 5C9CA 3OZ6A 3O8TA 4RJ5A 3Q53A 3F3TA 4AW5A 4EC8A 2BRBA 4S33A 5HHWA 4PMTA 2GQSA 4QMWA 3OTVA 4M84A 5AUYA 3ORXA 4BDKA 2QC6A 5L2QA 1UU8A 3QRUA 3E3BX 5M4CA 5DGZA 5D10A 4MH7A 3OEFX 2Y9QA 2QNJA 1H24A 1H0WA 3VUMA 3MH1A 4J95A 5J7BA 3EYHA 2OZAA 5IKWA 4BN1A 4CFFA 5K4JA 2R4BA 4D9UA 3MJ1A 5EOBA 3CLYA 5FLFA 3R9DA 2ITTA 5TF9A 3R02A 5DLSA 4UN0C 3FZTA 3H9RA 4BF2A 4DCEA 1XBBA 4RBLA 4FZDB 4IMYA 4O0VA 5KKRC 4FE2A 5HZNA 1WVXA 4J8MA 3ET7A 4BYJA 3ETAA 4O7SA 5FTOA 3ZUTA 5DEWA 2OF4A 2YIYA 3F5UA 3N51A 3QTSA 4YHTA 4FV0A 5BVNA 5I9YA 4FSNA 3AT2A 2ZMCA 1M2PA 4FC0A 1UA2A 4M7IA 3GBZA 4O1PA 4EH4A 1ND4A 4EZ7A 2WMBA 1U46A 4PPBA 3R73A 1WBOA 5E8YA 1MRYA 2J6MA 5J9YA 4GG7A 5CAUA 3FZSA 2XA4A 5IU2A 1PMUA 1W0XC 4GK2A 4O0TA 2J0LA 3T8OA 5CQUA 2C6MA 5IH4A 4OTGA 4KUJA 4CTCA 4IIRA 5AUXA 2QOBA 2F2UA 4JBVA 3A8WA 3LAUA 2GS2A 4BCGA 3F88A 4F64A 4ANOA 4FV8A 4JXFA 1PXIA 1BL7A 3CP9A 3PA4A 2H34A 2W4JA 4KSPA 3ZZWA 2Q0NA 5BYZA 4Z9LA 3SG9A 4MCVA 4XV9A 3I81A 3UQGA 4ZTMA 2XNNA 3F2RA 1IASA 5EYCA 2HZNA 4CG8A 2Y6MA 3RWPA 1KOAA 2RFEA 3FJQE 4G3DA 4HYUA 4EOLA 5CVGA 4UMRA 4DITA 2VWBA 1P5EA 3GEQA 2PE0A 4O7NA 2DS1A 3QHRA 4YTHA 4MWIA 3LPBA 4CZUA 5JZNA 5EW3A 3VWAA 4C37A 3PLSA 4BDDA 3LCTA 4CZTA 3DLSA 3KMMA 3QXOA 4D4VA 4OT6A 2EVAA 3VW8A 3NYOA 1LEZA 1XWSA 4D2WA 4DEAA 1A06A 2VTPA 4JDJA 5GJGA 3FKNA 1PJKA 3UPXA 3CQUA 2YDKA 5JGBA 2R2PA 3NRMA 1ZAOA 2QOHA 3QGWA 4YNEA 5HIDA 4NH1A 4CZYB 2JFLA 2PK9A 2WEVA 4UMTA 1FINA 2PVKA 2EUFB 5JQ8A 4DFUA 5D1JA 2OI4X 5KHXA 4OTWA 2J0KA 2XIZA 1Q97A 3CTHA 3UNJA 1XH6A 4C4JA 4RA4A 5I9XA 3NUUA 4IAKA 4KBAA 3Q2MA 1R1WA 3VF9A 4UBAA 4UMUA 4XP3A 2X39A 3MH3A 4QYEA 5ETFA 5I9VA 4L8MA 2YAKA 3LQ8A 5HKMA 3RNYA 3TTIA 4JT3A 4M8TA 4USDA 4OLIA 3KB7A 2GHMA 4ZIMA 3GU4A 3Q4ZA 3P0MA 4IZ7A 3UVRA 4GG5A 3TN8A 4LV5A 4TYHB 1XO2B 2H6DA 5E7RA 4D55A 3IG7A 1GZNA 2OICA 5A6NA 5TO8A 1FVVA 3UYTA 3VS5A 5I9WA 2OJ9A 4KIKB 4L53A 2JKMA 4F7LA 4UALA 1XH5A 4EL9A 3LJ1A 4MWHA 3PY3A 5EI6A 5HU3A 3EQDA 3A60A 5GJDA 5E91A 1BL6A 5A4LA 1UU7A 4AFJA 3OOMA 5HOAA 3RMFA 2J5FA 4K8AA 2BRNA 4PUZA 4EOOA 4CKRA 1XH9A 4ZY6A 5DR9A 3OWJA 3ZO1A 2CGWA 4CLIA 3UPZA 4JBPA 4MXCA 1VYWA 4WBBB 4AN9A 1O9UA 5HVYA 1GIHA 3COKA 4X0MA 5IISA 2X7FA 1H4LA 3FMDA 3RINA 5CEPA 3CD3A 4F1OA 3FL4A 3ZO3A 4AT5A 5HBJA 5CI7A 3QZHA 5KZIA 2RKUA 3IECA 4FKVA 3C9WA 4HGEA 4YHFA 4GYGA 3N4VA 2C6OA 4HZSA 4CT1A 4F09A 2HYYA 3PXFA 2XK3A 4H36A 3VVHA 3CKXA 3KU2A 2XYUA 2X0GA 5AP1A 4J53A 4RA5A 2YISA 2ZM1A 5CNNA 4CVAA 4OUCA 5AFVA 3QFVA 4FNZA 5L6OA 4NFNA 4CV9A 4I5PA 1URWA 2FO0A 4O91A 2NNWB 2WMRA 4QTAA 4F1MA 3FHIA 3A2CA 5BX0A 3D2IA 5HG5A 2XK8A 1J1CA 3QTWA 4C7TA 3QD2B 4E6CA 5LARA 3LFAA 5CEOA 5GIOE 3RJCA 4FSUA 1GZKA 4O0RA 1TQMA 2QHNA 3EYGA 5ICPA 5L2IA 4TW9A 5TR6A 1QL6A 4BRXA 3RVGA 4IJPA 4I6FA 4X3FB 2W1GA 2Q83A 4AF3A 4PF4A 3UP7A 4PMPA 3AC3A 5AP5A 5AAFA 4AOJA 2H8HA 5CEMA 3BZ3A 3LFCA 5IEYA 1JQHA 4BCMA 2HZ0A 4Q9ZA 4TL0A 2UV2A 1XKKA 4C61A 3BYSA 5HE2A 4M0ZA 4RJ7A 3RAWA 4DHFA 3DA6A 3R7YA 3T9IA 2G2FA 2B55A 5CYIA 3D5WA 5H3QA 4G6OA 3VUGA 3MB7A 1WAKA 2XK7A 2PUNA 2C6KA 5EI8A 3E3PA 3FMMA 4M15A 2GNLA 3IW4A 3Q9ZA 4IB3A 1YHWA 3PJCA 2ONLA 2YIXA 4EORA 3AOXA 2WQMA 2ITXA 5A14A 4AA5A 4G6LA 4IZYA 4ALUA 1PMVA 1V0PA 5CNOA 5CASA 3RKBA 4UMPA 4O7VA 4OTRA 5EDPA 2HW7A 3G0EA 2P3GX 2VX0A 4QQCA 3F9NA 4FSQA 2C4GA 5AV2A 4A4OA 3MIYA 4FIHA 4DEDA 3FI4A 1CSNA 4BGGA 3EQHA 4U97A 3R8LA 4D4SA 5KNJA 2BRHA 3D0EA 3HGKA 4JIAA 4OTHA 3H30A 4MF0A 1DS5A 2B7AA 3C4ZA 3VUDA 2UW6A 3BU3A 3HEGA 4DTKA 3EN6A 4GVJA 4M13A 3BHUA 5J5SA 2E9VA 3M11A 2ZMDA 2YCQA 2UZWE 2A19B 2VNYA 3R9HA 3TV7A 2QI8A 2R3NA 2GSFA 3IGGA 2DUVA 3QWJA 5FP5A 4APCA 4ZJVA 2UZVA 2C5XA 2XVDA 2VZ6A 5CAPA 2ITUA 3O7LB 4AACA 2XYNA 3FMKA 4BDFA 4F0IA 3FLWA 4MVFA 3BYUA 1H0VA 3OBGA 3ORZA 4I93A 3MPAA 1NT2A 5A6OA 4FZ6A 4MTAA 4IVBA 1FQ1B 4U41A 3SOAA 5TOZA 3PPJA 2XCHA 2VRXA 3QUEA 4L01A 5DIAA 1R3CA 4QP2A 1CM8A 3R8UA 3L9NA 1PY5A 4BTFA 3WARA 5M4UA 3PPKA 1YDRE 3EQGA 3VF8A 4F9WA 3VQHA 4CD0A 3KRJA 4KNBA 4EKLA 2UZBA 4W9WA 3UZTA 3F5XA 4YBJA 4Q9SA 1K2PA 3C4XA 2OBJA 3NAYA 5E8WA 2GFSA 3ELJA 3VUIA 4LMUA 1J3HA 5CSWA 3I6UA 4F6WA 5HE0A 3RHKA 4AOTA 5KMKA 1P4FA 4L52A 3RI1A 5DH3A 4EI4A 3BQRA 1UV5A 4BFMA 2QOKA 4BIBA 5IA1A 2C0IA 1A48A 4X6QC 1IEPA 1P14A 3FLZA 5J1VA 4AAAA 3BU6A 1ZYDA 3TKIA 3H3CA 1PRYA 4RIWB 5L6WL 2W1ZA 3SRVA 4EOMA 3ZCLA 4L67A 1WBNA 3ULIA 3NGAA 3C4EA 1FMKA 4MNFA 2WMSA 3MW1A 4XOZA 4HVDA 4TXCA 5E90A 3FXZA 1YI4A 4BCFA 5A4EA 3PLAE 4QNAA 4KWPA 4WSYA 2RL5A 5JZJA 4UX9A 4EK6A 4HPTE 4FKPA 4D2PA 4XS2A 3BI6A 2WIHA 5AM6A 3DJ5A 5CSXA 4S30A 3R9NA 4ENXA 4DEEA 3PJ3A 4EWHA 3DBQA 5IH6A 4FIEA 3LCSA 3EN7A 2V62A 3KCKA 3OEZA 4ZTSA 5HG9A 5EKNA 3R0TA 4XV1A 4XNEA 4CRLA 3OVVA 4QRCA 2UVXA 3FEGA 4YJNA 2XK6A 3V5LA 3KXHA 3PG3A 3OXZA 4CMOA 2QCSA 2X81A 3EQRA 4TKSA 3KFAA 2C6EA 1MQBA 5DMZA 3S4QA 4LRMA 3BCEA 1JPAA 3AGMA 4M3QA 4R3CA 2UZEA 3FY2A 2W96B 4XLIA 2XJ2A 3ID6C 3BHTA 2CPKE 2YCFA 3POOA 2GQGA 3RP9A 4MQ1A 4C02A 5C26A 3ORMA 3KXXA 3P86A 2YZLA 3IDCA 2CLXA 5K3YA 4CKJA 1L8TA 2PMOX 2HY0A 3WF6A 2OK1A 3R7EA 4A06A 4C8BA 4I4FA 5KKRB 5L2WA 3VJNA 3MFUA 3QZIA 4MXXA 3DOGA 4I6HA 3SAYA 1VYZA 4ZY5A 5FUTA 2KTYA 4FKGA 5HD7A 4YO4A 5EM5A 3P08A 2PUUA 4XG6A 4FEWA 4DTAA 5FG8A 2BKKA 3C4CA 4LOOA 4R5SA 3FI8A 4L7SA 3TIZA 1DM2A 4Q5EA 2VWYA 2YWPA 4JI9A 3W32A 4FA2A 3E87A 5AX9A 3MBLA 5CTPA 1H25A 3PG1A 3Q6UA 3ZBXA 4ERKA 3D5UA 3R2BA 3BLHA 4FICA 4DLIA 2ZYBA 3R2YA 4FR4A 3TV6A 4BDAA 3W33A 5AA9A 2ZB0A 3QCQA 3OY3A 1FGIA 2X1NA 5HICA 4KSQA 5IMEA 5HBEA 4OR5A 4WG3A 4P7EA 4RIXB 3MESA 4GL9A 4KRDA 2PU8A 3RPRA 1Q4LA 3BRBA 3PWYA 3TNQB 4AOIA 1OKYA 1YHVA 4DLJA 3GI3A 1PW2A 3L8PA 2REIA 3F3ZA 5EHOA 4BDBA 1TQIA 3FBVA 4DH8A 2OJGA 2R3JA 4OTQA 3OW4A 4EOJA 2QODA 1KE6A 1PXNA 4LYNA 4YO6A 2AC3A 5IH5A 2JD5A 4F7SA 1H28A 3V5JA 3QALE 3TUBA 5HVKA 4BR3A 2R3LA 2UW5A 4IM2A 5DWRA 5EHYA 2Z7QA 3MN3A 2BHHA 4C4FA 4E1ZA 3TM0A 5EDQA 4FI1A 2PZRA 2WGJA 3OOGA 4I3ZA 2IVUA 4M69B 4RVMA 4AGDA 3TEIA 2J90A 3H4JA 5HG8A 1AGWA 3EL7A 4NEUA 4L42A 5FTQA 5JKGA 4B8MA 2W1HA 4LOQA 3ZRKA 3FMLA 3LKMA 2YLEA 1T45A 2OIQA 4RFZA 3LM5A 2HENA 5HO8A 3ULZA 3VAPA 3DQXA 3JXWA 4U6RA 3ZH8A 4AFEA 4WHZA 1WZYA 3EN5A 4GT4A 2E9PA 4GSBA 4D5HA 3AQVA 2VU3A 5I4NA 5IUGA 4XRJA 1L3RE 2RFSA 3CQEA 5AIRA 1H08A 3R9RA 3V5TA 2LGCA 3DNEA 3PJ8A 4YJQA 4HYSA 4FV4A 1PYXA 4IWPA 5DBXA 3RAIA 3C0IA 1JVPP 3MY1A 4GV1A 3ZFYA 1BLXA 3DZOA 4MEDA 4BGQA 3OY1A 1W8CA 3ALNA 5ANIA 2YM4A 3DKOA 3IDBA 4PTCA 2VUWA 2XK4A 4X2GA 3LCKA 4YJTA 2CN8A 4LUEA 4NKSA 2XKFA 5C03A 2QOOA 3V8TA 4FT7A 4EQUA 5L2TA 4H3BA 1ZMWA 2AYPA 2XNBA 3DQWA 2J9MA 3NW7A 3WF8A 4BZOA 4O84A 4EH6A 5HLPA 2A1AB 2C5VA 1Q5KA 3PSBA 3LQ5A 3L8SA 4ZSLA 5I9UA 4PWNA 3RNIA 4RLLA 4PP7A 5HG7A 4FTQA 4UY9A 4YJOA 3EQPA 4BKZA 4D2TA 3ALOA 2I40A 3ZLYA 3BU5A 3U6JA 3RHXA 3R8ZA 2C6IA 4FNWA 4BC6A 5JN2A 3OT8A 5K9IA 1SYKA 3LE6A 4I21A 5E8ZA 3WZKA 4BZNA 4NU1A 5HCYA 3Q52A 2C0OA 4L44A 4TYIA 1RDQE 4RRVA 3ZMMA 4F08A 2W1IA 1UWHA 1PHKA 3NUSA 4MX9A 3HNGA 4JRNA 3WOWA 3BLRA 3O96A 3P7CA 4H3QA 4LI5A 4TNDA 5J8IA 3ZUUA 4AZWA 4AZSA 3MJ2A 3P9JA 1J7IA 2PULA 5EQPA 4TWCA 3DDQA 4BDEA 3PZHA 4P5ZA 3S95A 3V04A 3FMEA 3PVWA 3Q4TA 3ZEWA 2JGZA 4RSSA 3U4WA 4C4HA 4PTEA 5JMSA 4DGGA 4E26A 4B7TA 5AP3A 4KKEA 3MVLA 2GMXA 2ZV2A 1ZMVA 2YHVA 1QCFA 5CEKA 1FMOE 2X2KA 2FA2A 4NCTA 2PWLA 4XV2A 4F7NA 2QURA 4C3RA 2YJSA 3G90X 4I5MA 1REJA 3NNWA 2OG8A 2YZAA 2B9HA 4QPAA 2G1TA 3KXNA 4F4PA 1NA7A 1M2RA 4C4EA 3R30A 3ZTXA 3UTOA 4D2SA 3OUKA 1P2AA 1XBAA 4AN3A 4KAOA 1DAWA 5DR2A 5J79A 4L00A 3L9PA 4XLVA 2QHMA 4LGDA 5CEIA 5EM6A 3P23A 4I0TA 2PYWA 4A07A 3ZSHA 3DK7A 3HMMA 5E9EA 5BVEA 4DFBA 4BTKA 4RC2A 4DFYA 3AMYA 2UW0A 2FSLX 5AP6A 5EKOA 5I5ZA 4WG5A 4MK0A 5JEBA 4MXAA 3CSVA 4FK3A 1PXJA 3HDMA 3W8QA 5BPYA 1YOLA 3F2NA 4UWCA 5BNJA 3CJGA 1FGKA 3QYZA 3BELA 2HIWA 2XCKA 1SVHA 2C68A 4MHAA 4U43A 5E8UA 1MUOA 5DNRA 3OC1A 4IX4A 5B2KA 3PDTA 4ASZA 4JVGA 2ITWA 2CCIA 3QQGA 5M4FA 1CMKE 4FT3A 4QP6A 4J71A 1ZYCA 3FPMA 4QMOA 1JOWB 4MNEB 2A4LA 4NJ3A 4BB4A 1PXLA 3QF9A 2PTKA 2VTTA 5L3AA 4F9CA 4U3ZA 3KK8A 2B0QA 1REKA 5C8KA 4ZS0A 5D9HA 3RBWA 1QMZA 4GK3A 1UKHA 1A9UA 2IZSA 5BYYA 1AQ1A 4ZAUA 3ODYX 2O0UA 2WTCA 4S32A 3TIYA 3IKAA 1ZARA 3NYVA 5JFXA 2CNUA 4FT0A 4QTEA 4GFGA 2Z8CA 1OGUA 3MB6A 5FXSA 4LV8A 5IQDA 4YZMA 4J52A 5AM7A 4ZSEA 2PSQA 3M1SA 4XP2A 3LXKA 4IW0A 2IWIA 2W4OA 4UYAA 2WU7A 3OMVA 4F65A 5AR2A 4NK9A 3S2PA 4JBOA 1I44A 4GEOA 3UE4A 1NVSA 3F5PA 4I4EA 1WVYA 4QP7A 2W17A 4X6RA 5DA3A 3UBDA 3IQ7A 4FKJA 2QLUA 4UB7A 2BZHB 4E7WA 4UEUA 2CKQA 2FGIA 3DV3A 4IM0A 1IA8A 3TT0A 4GKHA 2O3PA 2J51A 3KRLA 4K33A 3WI6A 2IVTA 2GNGA 4PL3A 2JFMA 5CANA 5FEEA 1H07A 3F3WA 4B99A 3ZS5A 1XBCA 4EH9A 3TKHA 5AV4A 5M06A 2C6DA 1BMKA 4CFXA 3MDYA 4XG7A 3VBYA 5CF8A 2BVAA 3OBJA 5EYKA 3UMXA 4YJVA 1G5SA 2OO8X 3QLFA 1Z5MA 2XNOA 3I79A 5AP2A 1MRUA 4FG8A 3HDNA 4RIXA 3VS1A 4EWQA 5M57A 2PUIA 4B4LA 3I60A 3EFWA 4H1JA 3K3JA 3NCZA 3JY9A 4YHJA 2C5OA 3GU7A 5IA2A 2CGUA 5K5XA 3O51A 3JVSA 3M42A 2C1AA 4F0GA 1YOJA 3WZEA 4TT7A 3QYWA 3RPVA 5HO7A 1ZZ2A 3PYYA 4QQ5A 3Q9XA 3NYXA 3N4UA 3WIKA 3JY0A 4ACCA 3NYNA 4F9AA 3IDPA 4C59A 5IF1A 4QYFA 2FH9A 2UZLA 2VO0A 4HGTA 2VWZA 5EDRA 3MFSA 1O6YA 3UZRA 2BCJA 3G33A 1TVOA 2UW9A 3QL8A 4M69A 5CZHA 5CXZA 4QP1A 4WBOA 4E4MA 5AR4A 3QLGA 3RGFA 1H8FA 1X8BA 4RZWA 4L46A 3T9TA 3QWKA 3Q60A 2OSCA 5AV3A 4DBXA 4ITHA 3R7GA 2R3FA 5CSVA 4ZSJA 3MY0A 4GW8A 5HI2A 3UNKA 3QZFA 2BDJA 3E64A 4X7QA 5HE1A 5BVOA 1IRKA 5M4IA 5BVWA 2BZKB 4P2KA 3KKVA 4K6ZA 1B6CB 4BCJA 4FKOA 4XOYA 5A9UA 3ZZEA 4U42A 1JKSA 5IQCA 2PZPA 5D12A 4FX3A 4O83A 4S34A 3NNVA 4N4SA 3OW3A 3ZO4A 3OFMA 4A9YA 2YACA 2YM8A 5AR3A 3ZXTA 4DTBA 1Q62A 4RWLA 4ZJIA 4GT3A 4Q5HA 3GU5A 3ZEPA 5LCJA 1Q8WA 4U0IA 3C1XA 4BIDA 3BGPA 4BHNA 5AV0A 3DNDA 4FOCA 2ITZA 5TKDA 1YRPA 4BCOA 1OMWA 2R0UA 1OL5A 3CKWA 1WBPA 3TI1A 5CAQA 1KUTA 2PZYA 2YDIA 2QOLA 4N70A 4HYHA 4O1OA 5GNKA 5KMLA 3ANQA 4YTIA 4X2JA 5B2MA 3DK3A 4L9IA 5I3OA 5IA5A 3KRRA 1XH7A 2EB2A 3KGAA 3GFEA 3CR0A 4D2VA 1R39A 4MD7E 3T3UA 4QMUA 2ZB1A 4FTLA 3O8PA 4AA0A 4JDIA 4AX8A 1SNXA 2W1EA 5E8TA 2W9ZB 1Y6AA 3D5VA 4FKRA 1E1VA 4BCQA 4GFMA 4FZAB 2X8IA 1GOLA 2BUJA 3CPBA 5M08A 4MBIA 3O50A 3KCFA 3VS6A 1OIUA 1M7NA 4U45A 4BI0A 2PY3A 3IOKA 4J8NA 4DAWA 1CKIA 4AA4A 5AA8A 2JC6A 1VZOA 3PUPA 3GOPA 3W18A 3AC1A 4H58A 3UJGA 4C3PA 5L2SA 3R63A 3DFCB 2Z7LA 4L3PA 1YI6A 3OCTA 4JQEA 3BHVA 3ACJA 5IQGA 2XM8A 1OIRA 4NTTA 3BWFA 2OIDA 5EI2A 1GIJA 3SRVB 4CCUA 2J2IB 3GQIA 3MWUA 1OPKA 2PVLA 2XRWA 4FZ7A 4RVLA 3ZOSA 5KMJA 4FODA 4JQ7A 5AIKA 4C2VA 4FV3A 4XP0A 5EH0A 2JBPA 4IZAA 3MTLA 4GMYA 4MD9E 3VS4A 3PTGA 2BDWA 3KL8A 3B2TA 3U87A 3JR1A 4USFA 2KULA 4FUYA 2OW3A 3AC5A 5KE0A 3TNWA 4EZ3A 3VUHA 5IA4A 2X6EA 4GFOA 4OTPA 2BR1A 2JITA 4IX3A 5DHJA 1KWPA 4CV8A 4DGNA 2X4ZA 5IQHA 2X8DA 3VS2A 4UWYA 2F7ZE 4E6QA 3QRIA 3PY1A 3PZEA 5CWZA 2JIUA 1O6LA 3MYGA 4BCKA 3BWJA 3BLQA 4P90A 5E92A 2V22A 3VUKA 4FIJA 3IS5A 2P2HA 5HX6A 3PIYA 4IANA 4IJ9A 2GNJA 4TTHB 4FV6A 3KN6A 4FV7A 4R3PA 4BHZA 2ZV9A 1JLUE 2Y4PA 4G34A 5AP4A 3UO4A 3I4BA 4ZZMA 5BVDA 3F3VA 3HMNA 2ITNA 4K2RA 1GIIA 2VAGA 5HCZA 2YERA 5GZ9A 5K0XA 3L1SA 1J7UA 5M07A 4E4LA 4LL0A 4MNEA 4PTGA 3UIXA 3BEAA 4U44A 4J1RA 3C51A 1F0QA 5HU9A 1R0EA 4X2KA 3UG2A 3GT8A 5DG5A 5FDXA 1XH8A 4UV0A 3R1SA 3G5DA 1OZ1A 3ZSGA 1Y6BA 4R7HA 4YLLA 3UODA 2WMTA 3A7FA 3ZC5A 3ZO2A 4ZZOA 3U9CA 2IZRA 3RK5A 2ZJWA 5F1ZA 3LFEA 2BHEA 2IPXA 1J1BA 1YI3A 2XIYA 4HCUA 4ERWA 4N57A 4Z55A 5CVHA 4BDHA 5HTIA 4QMMA 2BZJA 4YZNA 5DT4A 3GC0A 1Y8YA 5HCXA 4APPA 5IQBA 1YKRA 4GH2A 4BCIA 3F6XA 2OKRA 1ZYLA 3GC7A 3P4KA 1Q8YA 2WMUA 5HE3A 1EH4A 3JUHA 2C3JA 1KV1A 5DVRA 5IEVA 4QMTA 4NM3A 5IG1A 4FKLA 4IWOA 2ITOA 4G9CA 1UNLA 2BALA 4FSZA 2XMYA 3NW5A 4MD8E 2XNMA 2W4KA 5DPVA 1Z9XA 3VS3A 4A4XA 3G9LX 3NEWA 4KKHA 4EOIA 5CF5A 2XS0A 3UIMA 2CJMA 1G3NA 2B1PA 1YW2A 3I5ZA 3Q2JA 4K9YA 3W2SA 4MKCA 1UVRA 5CT0A 3W10A 3R1YA 2UZDA 5AUZA 5F9EA 3E8CA 4IAZA 2VWXA 4V01A 3WILA 2Y4IC 3O0GA 1QPJA 4KD1A 4PV0A 3WF9A 4DH5A 2FSTX 5AEPA 4DA5A 3TNHA 4O21A 3O71A 5FXQA 4BBMA 1PF8A 3I0QA 3D5XA 3H0ZA 3VO3A 2PZ5A 4BWKA 2GNIA 2JKQA 2BTSA 3DU8A 3LFDA 4ALVA 3L8XA 1W7HA 3CGOA 3R7OA 4CEGA 4OGRA 2R3OA 3EZRA 3W8LA 1XQZA 4ID7A 3FI3A 4V05A 4IWDA 5EG3A 4JDHA 4J98A 1W83A 3ZHPC 5AAGA 3UC4A 4HVIA 2BFXA 3VUTA 4C57A 4KIPA 4BTJA 2PE1A 2HWOA 4FSWA 4BKJA 3D83A 4AT4A 2R9SA 4ZMEA 3N4TA 4R3RA
chains in the Genus database with same CATH superfamily
1IR3A 4YBKA 5E8SA 3MGYA 5HNGA 1UU3A 3L9MA 4V0GA 1Q8TA 4IAAA 1TQPA 4P5QA 3DY7A 3F7ZA 1RQQA 1RW8A 2IO6A 4UXLA 3FQEA 3P5KA 4WNOA 3FC1X 4BGHA 3DCVA 3AC2A 3E7OA 2JEDA 4AT3A 2Y7JA 2V7OA 4Q2AA 4D9TA 4E73A 2QU5A 4HOKA 4L6QA 5EHLA 3BYVA 1GZOA 2IW6A 4LUDA 3R83A 3KF4A 4YZ9A 2OU7A 5FDPA 2GHGA 3NIEA 4QTBA 2ETRA 3RWQA 5ITAA 3V5QA 5A54A 5HEZA 4WRSA 3COHA 2DYLA 3HA8A 5GHVA 4TYEA 4BZDA 2XKCA 3PSCA 4RVTA 1DI9A 5M44A 5IQAA 4E5AX 5HIEA 5DR6A 1OUYA 5GIPE 1APME 3AT4A 4EH5A 2WB8A 2QO9A 2ETKA 1E1XA 3AT3A 3O23A 5IPJA 2PVMA 1WBWA 3TZ7A 4IE9A 2CKEA 2V7AA 4FV9A 1XHAA 2E9UA 4O22A 5IDNA 4CYJA 4S2ZA 4NWMA 2HZIA 1SZMA 4CSVA 3SD0A 3NVKI 3E5AA 2OFUA 1QPCA 1MQ4A 3IO7A 4O2ZA 3QC4A 4IX6A 3U4UA 4ASDA 4X2NA 4HCTA 3UIBA 4CT2A 3C0GA 4JR7A 4KS7A 1OBGA 3PXRA 2WTKC 3BV2A 2XNGA 3EQFA 1F5QA 5LOHA 3CIKA 4HNFA 3UZPA 5CX9A 2WTWA 1WCCA 3I7BA 4JAIA 4ZTQA 4EEVA 5CS6A 3LFBA 3QD4A 1OKZA 3PXYA 5K4IA 2XALA 4WNKA 3PP1A 4FSMA 3SC1A 4EYMA 3U6IA 3NSZA 3NUAA 4RVKA 2QKWB 4UZDA 3EHAA 2HK5A 3UYSA 5FM3A 5M55A 2ZDTA 3FXWA 2VWWA 2ZAZA 2GS6A 2W0JA 2Y6OA 3BGZA 5KMIA 1F3MC 2AUHA 3OT3A 3QQUA 4IFGA 4PDSA 2X2LA 5TT7A 4UXQA 4BYIA 5K5NA 5IQIA 4AW2A 4RX9A 2JLDA 2VTQA 1Q3WA 4U7ZA 4IB0A 4CMUA 2CKPA 1H1SA 4MQ2A 3RCDA 4FNXA 4EOPA 4OTFA 4I23A 3QQLA 4U80A 1RE8A 1WBVA 4BY9E 4IDTA 3A61A 4JX7A 3R8PA 4FNYA 4N6ZA 1Q61A 4X2FA 3OUNB 4R1VA 1K9AA 2ACXA 3C5UA 3HUBA 3MTFA 4M97A 1JNKA 4AQKA 2IJMA 4IB5A 3RCJA 4E4XA 2YWVA 5HGIA 2WNTA 1VR2A 4HCVA 2SRCA 3LVPA 3KXMA 3R22A 4EZ5A 4QDEA 3C13A 3FLNC 2GHLA 3VBQA 4C4GA 2FVDA 4FJVA 4QD6A 2XUUA 3K5UA 4NYEA 3V51A 2BTRA 4FSTA 3UO5A 2UW8A 3EFLA 2XP2A 1WBSA 4XG4A 3AC4A 4EBWA 3WZJA 5D7AA 3ZXZA 4DT9A 1PKDA 4ZTHA 3CTJA 3HMPA 3KY2A 1OBDA 2WKMA 1H00A 3OTUA 2XIXA 5E1SA 1NW1A 4FEXA 4FTCA 4FTNA 1UU9A 3OF0A 4RIOA 2WHBA 1DI8A 1PXOA 2O8YA 1H1PA 1W82A 3QTRA 4RIYB 4CMTA 1OECA 4WA9A 2W7XA 2ERZE 1HCLA 1T46A 2R3KA 3P78A 4FT5A 4NFMA 3ORIA 4Y95A 3UC3A 3UQFA 5FTGA 2O2UA 3EQIA 4EQCA 4EYJA 3DPKA 3QKMA 3LMHA 3FKLA 4XG9A 3QHWA 4EOSA 4BCNA 3U54A 1V1KA 4TYGA 4FTUA 4QMXA 1J91A 4Z7HA 3EOCA 5AJQA 3V8WA 4EHVA 3VRYA 2UUEA 3PWDA 3PIXA 4FTOA 3NNXA 3LMIA 2X4FA 5KX8A 3P7BA 3W16A 2P55A 1Z57A 4BBFA 3PIZA 2BDFA 2C3LA 2W5AA 2E9NA 2QVSE 4PX6A 4GK4A 2ZM4A 4CFVA 3HAVA 1GAGA 2W1FA 4FKTA 4FKSA 4RZVA 1Q99A 2R3MA 3ATTA 2WXVA 3UOLA 4M12A 2ITPA 4XEYA 4F9BA 1KE7A 5EQEA 4BICA 5J5TA 3DGKA 1J7LA 1PKGA 4XJ0A 2CLQA 4TWNA 3RM6A 4RJ6A 4AWIA 4LL5A 5CEQA 2VN9A 3D14A 3SXRA 3GCQA 5G6VA 2PVRA 5BUIA 3W2RA 5LVNA 1KSWA 5FXRA 5J7HA 3Q96A 2QOIA 1SVGA 2XZSA 3SXFA 4FKUA 2HY81 4ONAA 5J95A 5LVPA 4DFXE 3VONA 4EJ7A 2QQ7A 2Z7SA 2OXDA 4IVAA 1M2QA 4HJOA 2GTMA 4JL9A 3VRZA 4RJ8A 4A9TA 3AGLA 5ANJA 1YDTE 3E88A 5HNBA 4W4YA 5LVOA 5FM2A 3W0NA 4ZLOA 1PXPA 2R3RA 3ANRA 2QOCA 1JSVA 4IACA 3QRKA 4FV5A 3B8RA 4ACDA 3EQCA 5FBNC 2YIQA 3ROYA 5AMNA 3D7ZA 3L9LA 4TRLA 3UOKA 3TTJA 3VBTA 4D1SA 4FEVA 4O7ZA 3PDTA 2WOUA 4QYHA 4H39A 3S1HA 1GJOA 3PJ1A 3E8NA 2RFDA 5FEDA 5DI1A 3UQCA 3WYXA 3GC8A 4O82A 2WMWA 4IZ5A 3VBWA 3C7QA 4YLKA 5H2UA 4FTJA 5ANKA 5C4KA 4U40A 3GUBA 3F3UA 3QUPA 2WMAA 5D41A 2RSVA 1UKIA 2WTJA 2C5NA 3HX4A 3I5NA 3LJ0A 1B38A 1Y57A 3PE2A 5CI6A 4YC6A 3FDNA 5CAVA 4QMYA 3QRTA 3VW6A 4O38A 4MAOA 4O7RA 3QU0A 4P4CA 3FPQA 4ZS4A 4PMMA 4QO9A 4Y5QA 4YJRA 4YP8A 1H01A 4NSTA 2BAKA 4FT9A 5LMBA 5DT0A 5H8GA 2XRUA 5L8KA 3QUDA 1PMEA 1SVEA 2YM7A 4DGMA 4BDGA 3COIA 2G2IA 2NO3A 3FL5A 3RPYA 4DFLA 2VWIA 3UVQA 4F1TA 2FSOX 2W1CA 5HLWA 4QNYA 2YIRA 3RK7A 4H3PA 2G01A 4Y5HA 5FBOA 3EIDA 4JNWA 1O6KA 4FEUA 5FRIA 3CXWA 4O4DA 5EOLA 2VTJA 3TWJA 3VIDA 4JIKA 3VS0A 3O17A 4YJSA 4O7YA 5FP6A 3DS6A 4GUBA 1Q8UA 2B53A 2WEIA 2R3HA 3DBEA 4FIIA 4OAVB 2QR8A 3HV5A 3HMOA 4L7FA 4CCBA 5K0KA 4YMJA 2PVFA 1ZLTA 3QTQA 3C4FA 3DAEA 3NWWA 3HRCA 5LWMA 3I7CA 3BYOA 3C4WA 3E93A 4FVRA 3B8QA 3G0FA 4X3FC 1JKLA 2F7XE 4Y85A 4X21A 4DEGA 4RLKA 2QONA 4EC9A 4TWOA 4RWIA 4B8LA 5JFSA 1URCA 4TNBA 4GS6A 3ZUVA 3MFTA 2P33A 2J4ZA 2X8EA 3KRXA 2WTIA 4MXYA 4O0SA 3DJ6A 4ZEGA 4QYGA 5LJJA 3VNTA 4Z16A 5JQ5A 2XAMA 3WF5A 3BEGA 3CQWA 3NX8A 4GUEA 4BVUA 4ANQA 4F70A 4IVDA 4PQNA 1ZYJA 4IAIA 3ZM4A 1WMKA 1MRVA 3LXNA 4HZRA 4BI1A 3FZPA 4O27B 3RPSA 2P4IA 5LCKA 2X7OA 5JFWA 4MYGA 4AUAA 4NW5A 2VO6A 3FMHA 3EJ1A 3OWLA 2VTAA 4FG7A 4I6BA 5CZIA 4K77A 4PPCA 4C62A 4QQJA 4RQVA 5E1EA 4USEA 5HVJA 4YSJA 1OITA 5M53A 2X7GA 1OIQA 4I5CA 4JX3A 5CF4A 4FTMA 4IWQA 4D2RA 5BVFA 4AE9A 5HORA 3WE4A 2B4SB 3PRFA 5AUWA 2XARA 4AGUA 1QPEA 3LLAA 3PFYA 4U81A 5B2LA 3VS7A 3TJDA 1Y91A 5ANEA 4PL4A 4FTRA 4ZSGA 4ANMA 3HMIA 3A7HA 4GJ2A 2ERKA 3EN4A 3R8MA 4DG2E 3DB6A 3FY0A 2W9FB 3G9NA 4G2FA 2VX1A 1ZMUA 2IW8A 4DHJA 2UW4A 2HXLA 4WRGA 4L45A 4E4NA 3QQJA 2XH5A 3FWQA 3I1AA 3QQHA 2C3IB 2F7EE 2UVZA 2I0HA 4ACMA 5HIBA 4EOKA 3GQLA 1DAYA 3JPVA 5M51A 3KVWA 1U5QA 4XH6A 3FQHA 3D15A 4NKAA 3A99A 3Q3BA 4EK8A 5L8JA 4JRVA 3DXPA 3MA6A 2YM3A 4JG8A 4MBJA 3UOHA 5CU2A 3DJ7A 4RIYA 4BI2A 3UDBA 2GFCA 4PDPA 4BL1A 4U3YA 2VD5A 3LCOA 3R7VA 2WOTA 3TNIA 3NZ0A 1IAJA 4G6NA 3H9FA 4HNIA 2VTIA 2RF9A 2Y8OA 1SMHA 3QA0A 3BE2A 4B6LA 2EWAA 2J7TA 3NUPA 2BAQA 4PY1A 2XK9A 4CFNA 4KINA 4ALWA 4E8AA 3ACKA 1KOBA 3JYAA 4B0GA 4D28A 2YAAA 3HRBA 4GCJA 3VBVA 3OCSA 5L8LA 4JDKA 5TE0A 4BKYA 5LWNA 1G8KA 2PVYA 4BIEA 1YXVA 4PP9A 4EBVA 1NVQA 3WIGA 5KO1A 3A7IA 1H27A 1V0BA 3DT1A 1W2FA 3ORTA 2R3IA 3W2OA 4FG9A 4M0YA 3PRIA 3WBLA 5CU6A 4LM5A 4CNHA 3FC2A 2VNWA 4RJ4A 1U54B 2YABA 3K3IA 3QC9A 3FE3A 3R1NA 5LXMA 4ITJA 2I0YA 4FRFA 2OLCA 4DT8A 5H8BA 4YR8A 4I5HA 3NNUA 3HAMA 3V01A 3DXQA 5KBRA 3Q5ZA 4U9AA 4DH3A 3PP0A 3R9OA 4EUTA 5EM8A 2WO6A 5A3XA 1BI7A 1G8SA 3D7TB 4ANSA 5CXHA 2DQ7X 2GDOA 2WTKB 3GNIB 5T68A 4HGSA 3II5A 4IH8A 3THBA 5AUUA 5EK7A 2Z02A 4W8DA 2ITVA 5KMOA 4W8EA 3P79A 4KBCA 3NLBA 4OTIA 3FLQA 3ENHA 5CALA 4V0GB 3SHEA 5B7VA 4G31A 4AZEA 3KC3A 5DRBA 1OI9A 2WZJA 4FYOA 4O6LA 4I41A 1SM2A 2FSMX 3KULA 1STCE 3HECA 1YHSA 5AV1A 4EUUA 2F4JA 2IVVA 4D0XA 2A98A 3FAAA 2R3PA 3PA3A 1UNGA 3PXZA 4JJRA 3EFJA 4A7CA 3LM0A 4LV7A 4N6YA 5CU3A 4C36A 4ZLYA 3FYKX 2XF0A 3RZFA 3TDWA 4C38A 2Z2WA 4W4VA 5DOSA 3V6SA 2YFXA 4NIFA 3ZONA 5EYMA 3WZDA 5E8XA 4AGCA 2RIOA 4QPMA 2P2IA 5F95A 3V8SA 2OXYA 1JBPE 3HV7A 4FOBA 2EU9A 2JKOA 3AD4A 3SX9A 3A7JA 4GJ3A 4E6AA 3K5VA 4L3LA 5LMAA 4O4BB 3NS9A 2HXQA 2VTHA 4BCHA 3DTCA 3LLTA 3ZM9A 4RGJA 4YSMA 5AAEA 2FUMA 3E62A 5JRSA 2CNQA 3IONA 3NMUF 4IEBA 5EYDA 3OS3A 3SQQA 5LMKC 4K18A 4NJDA 1OL2A 4DGOA 5HD4A 3R01A 4IAYA 2IN6A 4OBOA 4LQMA 2X9FA 4ORKA 3BV3A 3AMBA 1ZXEA 2OJFE 3QZGA 4M67A 3QRJA 4PPAA 2XNEA 3A7GA 3OCGA 1OL6A 4ITIA 5AR5A 4QMSA 5BUJA 3F69A 2VV9A 3UNZA 4YLJA 2CNVA 5J1WA 1PXMA 3RM7A 3QX4A 4D4YA 5KUPA 3UOJA 1G8AA 4FBXA 4FGBA 3P1AA 3MSSA 3O7LD 3VC4A 2B9JA 1BUHA 1V0OA 4C35A 2BKZA 2VWVA 3TDVA 5JT2A 2BAJA 3FMNA 4PRJA 3OG7A 3FMJA 4AGWA 4HPUE 3GOKA 4FZFB 5T6KA 2R3QA 4O81A 2IVSA 3V6RA 4LGGA 4I94A 4G3EA 2CSNA 4A9SA 4GT5A 5ETIA 5F4NA 4YPDA 4IXPA 4AZTA 1GY3A 1KV2A 1E9HA 2C3KA 1TZDA 4FV2A 3O8UA 1XR1A 3FSFA 4KABA 3FZ1A 2W99B 3LMGA 2PMIA 5CVFA 3TKUA 2I6LA 4YTFA 4G16A 1FVRA 2YDJA 3QTZA 4IVCA 3ZLSA 4ZMFA 2CCHA 3EKNA 3JVRA 4BCPA 3ENMA 4BTMA 4YJUA 4DFNA 1FBNA 3ZRMA 3G51A 4HYIA 1CTPE 3GGFA 4KS8A 1OL1A 2ZVAA 2WU6A 4I0RA 3DLZA 3RALA 3UP2A 4ZY4A 3TV4A 4QEBA 2HELA 4N0SA 4A9RA 3NPCA 1SNUA 2OH4A 4O0XA 4FTAA 5F94A 3SVVA 3LFQA 3R21A 1JWHA 1ATPE 4GIHA 1ZY4A 2YITA 3S3IA 2G15A 4KBKA 4K0YA 3IW6A 4AP7A 2R64A 4O2PA 2OJJA 4WKQA 3UG1A 3ZYAA 4WD5A 4C4IA 3UIUA 3AC8A 3LFSA 4PMSA 3PXQA 2YA9A 5BVKA 5H9BA 5KBQA 3A4PA 2J0IA 3LXPA 4C58A 3BGQA 2YM5A 3BHYA 3NIZA 4W4XA 4KA3A 4ZJJA 3HLLA 2BMCA 4LMNA 4JQ8A 3GC9A 3TL8A 2C1BA 3ZDUA 2GCDA 1OM1A 3LFFA 3R04A 4QT1A 2F49A 4DGLC 2R7IA 1GNGA 2O65A 3LZBA 4I6QA 4CXAA 3LJ2A 4E6DA 2ESMA 3KK9A 1R78A 4I22A 1ZOGA 3R7IA 2WD1A 4CFUA 2YIWA 3U6HA 5A4QA 2O63A 4FKQA 3TCPA 4DDGA 4IADA 2XIKA 4RX7A 4QQTA 2YCSA 4LOPA 3POZA 4G1WA 4ANBA 2EXCX 4IFCA 2Q0BA 2PE2A 3TJCA 4NL0A 3AG9A 3M2WA 2E2BA 4J97A 3R7UA 4EOQA 4ZOGA 5C8NA 3S0OA 2JIVA 3EMGA 3E8EA 4CQGA 1ZYSA 3ITZA 2WELA 3PVUA 2I0EA 3NUYA 2WFYA 3UVPA 4EKKA 5CY3A 3ZLXA 5IQEA 4GU6A 3W2CA 4RC4A 3PY0A 1H1WA 4XCUA 5HLNA 3Q9WA 1ZY5A 3I0OA 1AD5A 5JFVA 4QOXA 5JH6A 1H1QA 2UZUE 3LOKA 2WQNA 2QG5A 2ZDUA 3DK6A 3QGYA 4D5KA 3F2AA 3TZ8A 2WIPA 3CTQA 4LFIA 3OD6X 2YM6A 4FL2A 4OW8A 5HQ0A 5HX8A 1LR4A 3DKGA 1FVTA 1XH4A 3QQFA 1YXXA 2W05A 5C8MA 5CU0A 3G2FA 4J96A 4QTCA 1S9JA 1M17A 1M14A 5IUHA 3COMA 4K1BA 5DE2A 3IPHA 1U5RA 3IW8A 3ERKA 3E63A 2X9EA 4FL3A 4DBNA 2WMXA 1QPDA 4ASEA 2B9FA 3HP2A 4LG4A 5AP0A 2JKKA 3SLSA 3SA0A 5L6PA 3TXOA 2EB3A 2OFVA 4F6UA 1JSUA 1U54A 1XJDA 5IZFA 4FF8A 3BYMA 4HGLA 4YC8A 5D7VA 5LVMA 4FVQA 3KXZA 4CLJA 3MH2A 3ODZX 3BHHA 3E92A 4RFYA 3VHKA 2XBAA 3G6GA 3D4QA 4LRKA 3BIZA 4KKGA 5ANGA 4M66A 5G1XA 4FL1A 3ORKA 3C50A 3UGCA 1YVJA 2IZUA 1CKJA 5E8VA 4DFZE 3ATSA 3HVCA 2JDTA 3D7TA 3MVMA 5BUEA 3QTXA 4F9YA 4K11A 4JS8A 5DFPA 4AW1A 2YN8A 4I0SA 3ZFMA 1Q3DA 2BRGA 2YLFA 2HCKA 1KE5A 3MV5A 5AWMA 4YPSA 4C0TA 4AXAA 3C5IA 2VX3A 1VEBA 3DBCA 3MY5A 3QCXA 4XMOA 4KB8A 4D1XA 4GIIA 4YZBA 2BILB 4G5JA 2W1DA 4RC3A 3QD0A 4HVSA 3RAKA 2QR7A 4EH8A 3FKOA 3QKKA 4QYYA 4EONA 2CKOA 1KE9A 3CCNA 3EN9A 4Z3VA 5KCVA 4G9RA 3FYJX 2JDRA 4A9UA 5EQYA 4J99A 4ACHA 3HV6A 4QP3A 5GZ8A 4BDJA 4AE6A 4RJ3A 5AR7A 4PDYA 3Q6WA 4IQ6A 4FKWA 4UYNA 3HA6A 3ZRLA 2YEXA 1WFCA 3HYHA 4JR3A 2PPQA 3FSKA 1OPJA 3OWKA 4EHEA 3W0QA 3NVMB 5FD2A 1OVEA 4EH3A 4FUXA 3Q5IA 4Y73A 3F66A 3GP0A 5T3QA 2VTMA 1U4DA 2ZOQA 2QD9A 5M56A 1YDSE 1W98A 3TACA 4MXZA 2EXEA 4R8QA 4Y72A 1ZZLA 3DFAA 5GJFA 3GU8A 4XG3A 4DEIA 3U9NA 2HOGA 3H10A 5CF6A 3R00A 4ZXTA 2B9IA 2VWUA 5DYJA 3UMWA 4MXOA 1YXUA 4A4LA 4AAYA 5KZ0A 2UZOA 1BKXA 4HW7A 4CKIA 3VN9A 2QLQA 1LEWA 2R0IA 3CEKA 4YJPA 4DE4A 3GENA 2BRMA 3NUXA 1NXKA 4IB1A 4ZTLA 3U55A 2AC5A 2PZIA 4O0UA 5D11A 5J9LA 2PUPA 2JDSA 3FI2A 2XAOA 4DEHA 3ROCA 4YTCA 3MVHA 2XBJA 2OIBA 3QTIA 5ETCA 3SOCA 4W4WA 3DBFA 5A4TA 4BJJB 2R7BA 3RTPA 4TPTA 2C6LA 3QTUA 3CD8A 3CBLA 4AW0A 2I0VA 2Z7RA 4LRJA 3W55A 2ZFYA 1FOTA 3GCUA 3D9VA 5GINE 1YWVA 4YUQA 3CGFA 3AXWA 1BYGA 3PPZA 4RWKA 3HKOA 2PVHA 2JDOA 5DN3A 3E7VA 5FWKK 5HESA 1G8JA 4X3JA 4O86A 4R77A 2JAVA 1CDKA 2UVYA 2OGVA 2QO2A 4I92A 1YXTA 1PMNA 2ONLC 3FLYA 4WO5A 4CQEA 1YQJA 3CC6A 2R5TA 4BDCA 3CPCA 4B9DA 3GU6A 3NUNA 4V04A 3K2LA 4ZP5A 4D4RA 3Q32A 3KQ7A 4E20A 4GVAA 2VTNA 1NY3A 2I1MA 2O5KA 2VGPA 4W9XA 2RG6A 1LPUA 2F9GA 3KVXA 4EH2A 5AADA 5AP7A 2X2MA 5ACBC 3Q4CA 4E5WA 3HV3A 4ZTNA 3NCGA 5JK3A 3DAJA 2XEYA 5AUVA 3LHJA 1M52A 2O64A 4UWBA 1OIYA 5A46A 5DEYA 3TUDA 2PHKA 3E8DA 4C2WA 3QX2A 3SGCA 3KREA 4NZWB 4XYFA 3LW0A 4EQMA 3P7AA 4NTSA 5AR8A 2VTSA 3NW6A 4DF3A 4WUNA 3ZU7A 3HP5A 3KA0A 4RX8A 4KIQA 5BMSA 5LVLA 2QOFA 1M7QA 2XM9A 4ZTRA 4O7LA 1P4OA 2J5EA 3MA3A 3V5WA 3TZ9A 4WSQA 2IZTA 2UZTA 4AQCA 2BIYA 3G6HA 1WVWA 2X6DA 2ITQA 3N9XA 4Y83A 4XG2A 4ANLA 4AZVA 3MPTA 2CHLA 1OUKA 2VTOA 3JS2A 3Q9YA 2BZIB 2WAJA 3PE1A 3B2WA 4IHPA 3KN5A 4TYHA 4H1MA 5CQWA 3VQUA 2XJ0A 4IBMA 4L3JA 5I9ZA 1IG1A 5FEQA 3PVGA 1U59A 4XBRA 5HTBA 4G3CA 2G2HA 4KIKA 5HBHA 4U5JA 3CS9A 3CJFA 3HUCA 2A2AA 3DTWA 4NM0A 4FSRA 2QOQA 3OHTA 4Z7GA 2IG7A 3DKFA 4XUFA 2XNPA 4FIGA 3W0PA 3F61A 3W2QA 1LUFA 3SXSA 2NYAA 3GXLA 4G3GA 4RX5A 3A4OX 4DH7A 3QQKA 3FQSA 4BBEA 3ZSIA 4R7BA 5IMXA 2V55A 4M14A 4G5PA 3R8VA 5LQFA 2WTDA 2Y0AA 2PVJA 4R6VA 1Y8GA 5HO6A 5I0BA 3DKCA 4F0FA 5CT7A 3HRFA 3O2MA 4EK3A 1IAHA 4NW6A 4QMQA 4RT7A 2HAKA 5F20A 2FB8A 4M68A 5FGKA 2CN5A 4L43A 2A27A 4R78A 3DZQA 4S31A 4L68A 3GB2A 4FYNA 4I24A 4XG8A 4KRCA 4HVHA 2NRYA 5J87A 3DDPA 1VJYA 4JBQA 4C33A 4DDIA 4E5BA 2VO7A 4F7JA 2YCRA 1JSTA 5CSHA 4ZK5A 2XJ1A 2WMQA 2OZOA 4J7BA 1UNHA 4QMZA 4RWJA 4BDIA 2BIKB 3PA5A 3CE3A 2J0JA 2XEZA 3DXNA 3F7WA 2CGXA 3D94A 4FK6A 4OBPA 4ENYA 3VBXA 5IUIA 4DYMA 3BBTB 2F2CB 2GPHA 2VTLA 3VHEA 3R71A 3FUPA 3QCYA 1YOMA 3KULB 2QG7A 5C1QB 4O6EA 3FXXA 4BWPA 5JGDA 3SG8A 3KF7A 2F57A 4FTKA 3ZBFA 3RPOA 4JLCA 3I6WA 3LXLA 3IOPA 2R3GA 3QXPA 2GS7A 2NPQA 2OWBA 2OZAB 3QCSA 2H9VA 4FMQA 4NIFB 2BROA 2CMWA 3DAKA 2IEWA 2UW3A 4AZFA 4X3FA 4PDOA 1OKVA 1UWJA 4Y8DA 3GVUA 2RFNA 4D0WA 1S9IA 3GCPA 3REPA 3VULA 4O0WA 2NP8A 4UMQA 3T3VA 5DT3A 4IX5A 1NVRA 1JKTA 1FPUA 2OF2A 3ZFXA 1Q8ZA 5CLPA 4ARKA 5AX3A 4C3FA 4CFMA 4AN2A 4AXCA 3NR9A 3EFKA 1Q24A 2UW7A 4DCAA 2VTRA 4QP9A 4OAUC 4JAJA 3EWHA 4QMNA 1ZRZA 3EB0A 3EL8A 5GZAA 5JRQA 3WZUA 3W2PA 2GU8A 2LAVA 3RZBA 4FIFA 1YWRA 4JOAA 4CRSA 3G15A 3KEXA 4R1YA 3FHRA 3FZOA 3MH0A 4NT4A 4RFMA 3K54A 4YU2A 3MI9A 3KRWA 1H1RA 5EW8A 4G3FA 4DC2A 1XMLA 3DBDA 2WPAA 3ZLWA 3MPMA 2E9OA 2B52A 2JBOA 2PL0A 3C0HA 4WNPA 1KE8A 4E3CA 4ZSAA 3BE9A 3BQCA 4FSYA 4CFWA 1ZOEA 4QMVA 5IA3A 5CAOA 2V5QA 5C27A 3TG1A 4ASXA 2JDVA 4KIOA 4TWPA 3AD5A 4RPVA 4UZHA 1JKKA 2HWPA 2PMNX 4DEBA 3R28A 4AU8A 4MF1A 4EH7A 2JIIA 5IDPA 3AD6A 2JAMA 4XHKB 3U51A 3GCVA 5BYLA 4F6SA 3QBNA 4BWXA 4FEQA 3GCSA 2ZV8A 4FVPA 2VGOA 3U8WA 1H26A 1WBTA 3OROA 1OPLA 4IC8A 2WTVA 3SV0A 5CU4A 5ACKA 2PVNA 3WF7A 4ANNA 5EM7A 4BJJA 2ZM3A 4G17A 1YWNA 5M09A 3Q04A 5BMMA 3PSDA 4FGRA 2B54A 3IGOA 2RGPA 1BX6A 4XBUA 2Z60A 4O7WA 4WOVA 3FLSA 4NUSA 1ZWSA 2WQEA 1OB3A 4R5YA 5KHWA 5ANDA 4DG3E 3PJ2A 4R7IA 3WYYA 4D1ZA 4U8ZA 3GFWA 3H0YA 3RK9A 1W2CA 2YJRA 2QO7A 2XKEA 3KMWA 1BI8A 4II5A 4TZRA 2C6TA 3S00A 5B0XA 3QAME 3R1QA 5L4QA 2W5BA 4E93A 4WG4A 5JSMA 4GU9A 4QMLA 4YC3A 5E4HA 5CENA 3V5PA 4U79A 4CYIA 2BPMA 5KMMA 4MBLA 2C30A 1PXKA 4PNKA 3Q4UA 5A4CA 5IEXA 1CKPA 3TNPC 1I09A 4RQKA 3BX5A 2J50A 4H05A 4CGAA 5DRDA 2Y4IB 2FYSA 3OP5A 4WNMA 3F5GA 3EKKA 2DWBA 5C01A 4XRLA 2G9XA 4QP8A 4O96A 1OKWA 2PMLX 1ZOHA 5H8EA 2C47A 3BPRA 2ZV7A 2XB7A 4WIHA 4PL5A 4IDVA 4EJNA 3AMAA 5JGAA 4TYJA 4YGAA 4YZDA 3IW5A 3HV4A 4RIWA 5HTCA 4EK4A 3CY2A 3ORPA 2C69A 3TZMA 4AS0A 1Q41A 3NDMA 5ETAA 2I7QA 2WQBA 4ACGA 5I3RA 2RG5A 3A8XA 4WT6A 3LQ3A 2QU6A 3AKKA 3SDJA 3PVBA 3ZDIA 4GKIA 4EK5A 3SW7A 3WE8A 3LCDA 4CG9A 3EH9A 1ERKA 2OXXA 2EXMA 2P0CA 1GZ8A 3CY3A 4IAFA 4QTDA 4OTDA 2IW9A 1MP8A 1R0PA 2V0DA 3LIJA 3FZRA 2OJIA 3IK3A 3L8VA 4FTTA 5FQDC 4NM7A 4HVGA 3MS9A