2HENA

Crystal structure of the ephb2 receptor kinase domain in complex with adp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
281
structure length
259
Chain Sequence
SKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRALAARNILVNSNLVCKVSDFGPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin type-B receptor 2
publication title A change in conformational dynamics underlies the activation of Eph receptor tyrosine kinases
pubmed doi rcsb
source organism Mus musculus
total genus 79
structure length 259
sequence length 281
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2henA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2henA01
4ZTSA 2PMNX 3FMKA 3QUPA 4FTTA 3VUGA 4NTTA 5HCZA 5EI6A 1BUHA 3D5WA 4YHFA 3HGKA 2Z8CA 4FT9A 4AE6A 3UO5A 1JSVA 1H27A 2IW9A 2G01A 4FSWA 3R8PA 1LUFA 3D5XA 1OB3A 2R0UA 2ACXA 1JKTA 2XYUA 1QCFA 1I44A 3R8ZA 4AFEA 4IWOA 4IDTA 2PE0A 2WTIA 2QOCA 3OWLA 4XG2A 3UOKA 3QTSA 3I6WA 4AUAA 2B4SB 2CHLA 4DH1A 2PVFA 3C4EA 3UQGA 4QMYA 3NCGA 3O96A 2P55A 3RPYA 5AA9A 3DQXA 4FOCA 2BZJA 3LQ3A 4HYUA 3OS3A 4WRSA 5ANEA 1FMOE 5TE0A 4EORA 2O65A 3V6RA 3TCPA 1SVEA 2ITTA 5M4FA 4P4CA 4JAIA 3KCFA 5IU2A 4TY1A 2F57A 3MBLA 4FEQA 4O6EA 4RVMA 3V3VA 2PZYA 3BYSA 2XK4A 2W1DA 1JKSA 4DITA 3H10A 4P7EA 3UO6A 3OD6X 4BHZA 4D2RA 5G1XA 3FHIA 5AIRA 4EH4A 4EK4A 3I5NA 3MY1A 4BI0A 3RCDA 3NIEA 4QP7A 2R3QA 3EZRA 3VJOA 3ODYX 5AUZA 3ATTA 4RZWA 3H9OA 4R5SA 2W05A 4FGRA 2OFUA 4GT3A 4HYHA 4EK5A 3C4ZA 3RNIA 4I4EA 3LFBA 4IX5A 4C34A 2HWPA 4CFVA 3ZLSA 2FSMX 2OJJA 1G8AA 2YISA 3S3IA 4U80A 2PVHA 4D4VA 4C36A 3IOPA 3ZRKA 3KU2A 5JMSA 4F6WA 3UYTA 4X0MA 1OL2A 5AUVA 1Q3WA 3TKUA 4BR3A 4XV1A 4NFMA 4FVPA 3OT3A 2OJFE 2GNIA 3LIJA 3DS6A 1OIUA 2RFSA 4KD1A 3TV4A 1GZKA 3AMAA 3O71A 4RIWA 1KWPA 2C47A 1DI8A 3Q9WA 4G3GA 2FGIA 3ENMA 2G2IA 3NNUA 5AR8A 4XP3A 4WT6A 3UOHA 3EJ1A 3QXPA 3R7IA 2WMRA 3S0OA 5K9IA 3JVRA 1Q41A 5HICA 2YWVA 3AMBA 4A9RA 5AAFA 2HAKA 3BLRA 4D4SA 5I3OA 5J5TA 4NJDA 3NEWA 4FSYA 2ITWA 4YJUA 4NIFB 2NP8A 2WQBA 4EOSA 2GQRA 2CLQA 3SG9A 1WBTA 4L44A 4FX3A 1KE9A 3QA8A 5AADA 2PE1A 3LFNA 3LFQA 3FZPA 4QMLA 4EJ7A 4KSPA 4JBOA 3Q04A 3KVXA 3ZLYA 1ZY5A 3QAME 3PXKA 4PL4A 4Q9ZA 3DK7A 2ZOQA 4L00A 5HKMA 4UMQA 3R22A 4EHGA 3W1FA 4N0SA 4ASDA 4DC2A 5I0BA 5GJDA 4F09A 2F4JA 4YTCA 4PWNA 2HYYA 4IVBA 5AFVA 1QMZA 3QTZA 2JKOA 4RJ7A 3VQHA 3NAYA 2J51A 3OZ6A 3AT4A 4FSRA 1YDTE 4BF2A 1VEBA 3DCVA 3QX4A 4IADA 1UKIA 5BUEA 4AOIA 2YDIA 3MFRA 4IZAA 4S30A 5FTGA 1V0OA 3A8WA 1OPJA 4FSMA 4CSVA 2OXYA 1M2QA 5CAPA 5IZFA 4IX4A 5M4UA 5AR3A 4QMSA 1OL1A 3ZYAA 3VS3A 4GJ2A 4IWDA 2OIBA 4ZTRA 5HBEA 5IISA 4G3EA 4EBVA 2R3NA 4MNFA 3TI1A 4BCKA 4FIGA 1W7HA 3L9PA 5HI2A 3N4UA 2JAMA 3H0YA 1WVYA 3G0FA 2W5HA 3VS5A 3T3VA 1R39A 4JG7A 4IB3A 3TUDA 2OKRA 5CEIA 4Z16A 4I0RA 2UZLA 3O7LB 4ANSA 2BIYA 4EWHA 4LM5A 2IZTA 3QGWA 4U45A 5EOLA 4EK6A 5K5NA 4DFZE 1IASA 3PVGA 3MWUA 2B1PA 4WD5A 5GJFA 4FNWA 4QP4A 3ZM4A 4JIAA 4CRSA 4C3RA 4RFYA 3W2RA 4AACA 5LMBA 2ONLC 3AD6A 4O81A 3PP0A 4XP2A 4FNYA 4IC8A 3AOXA 5TF9A 4GH2A 3NNWA 4EHZA 2QLQA 3D4QA 5BX0A 4HGLA 4AQCA 5KZ0A 4ZLYA 4H58A 4JIKA 3LPBA 2C0TA 2REIA 3WYXA 3U87A 3QQFA 4RFZA 4I6FA 3VS1A 2NRYA 4NKAA 4F9YA 4LV8A 1OL5A 3FI2A 3QC4A 3WARA 3T9TA 4DG2E 2Z7RA 3KB7A 3VHEA 2QOQA 1H8FA 3D15A 4YC3A 1T46A 4P2KA 2UW0A 4AT4A 1ZARA 1XBAA 2XJ0A 3H3CA 3MV5A 4RWJA 3MH1A 3SLSA 4CMTA 4F0IA 5K4IA 2VTHA 4RJ6A 3FC2A 3ZS5A 4EJNA 3UIXA 4J96A 4KBCA 5C8NA 3JS2A 2ITNA 5M4CA 4F4PA 2VO7A 3DA6A 3DDPA 4QQJA 4I21A 3QCSA 3L8XA 4FV9A 4FZ6A 4G31A 4JQ7A 3UNZA 5H8BA 5EYKA 5A4TA 5HU3A 3BHVA 2F2UA 5DFPA 5J7BA 2WOTA 2J0JA 4E26A 3W8QA 3R30A 3M11A 4UALA 4YJTA 1M7NA 4FZAB 2Y4PA 4ALUA 2B52A 1FBNA 3EYGA 3K54A 5HO8A 3FMHA 3OFMA 5JGBA 3CGFA 3OTVA 4F1MA 4DINA 4RVLA 3U9CA 2Z7LA 1Z9XA 3ZH8A 5C1QB 4AW5A 3EN9A 4ONAA 3DXQA 3A2CA 2QO7A 3PE1A 3POZA 3MPAA 4L9IA 5DIAA 4FKSA 4YMJA 4MAOA 2GMXA 4GT5A 4IM3A 1OL6A 2YCQA 5CNOA 5EW8A 3N51A 3ULIA 2O5KA 3KK8A 3RAIA 1IRKA 2X9FA 3QD3A 4NH1A 2YIXA 5J87A 3FZSA 3PJ3A 2OO8X 1YWRA 4Y83A 3IG7A 3DQWA 5AP2A 4GV1A 4APCA 3VUDA 3PWDA 3ZBFA 5L6OA 3GCUA 3EH9A 4RIXA 3G33A 4B99A 2JFMA 4LOPA 4KSQA 3VBYA 3E64A 5LCJA 3PA3A 2WMUA 4F99A 3QZGA 4FEWA 4ERKA 4QD6A 4N4SA 3GFEA 4MH7A 1L8TA 3CTHA 4XG4A 2OJ9A 3VS6A 1DAYA 4GT4A 4Q5HA 4QMPA 4GKIA 3BU6A 3UZPA 5EQYA 4W4YA 3FZOA 5EYCA 2LAVA 3BPRA 2VWXA 2BZIB 3HX4A 3FHRA 4FTKA 4AOTA 3G5DA 5CQUA 4BWXA 4EH3A 1MRUA 1U5RA 4YLLA 3TDVA 3DJ6A 4XP0A 4RQVA 2XEYA 3F7ZA 5IDPA 5DR6A 3C4WA 3FI4A 4HNFA 4ITIA 4QYEA 4EC9A 4AZSA 3D7TB 5JN2A 5AX9A 1JAMA 3BI6A 4JRNA 4WKQA 3PJ8A 3ZSGA 4P90A 5HLPA 5HVKA 4CQGA 2YCFA 4FZFB 2J90A 3FBVA 2A4LA 5E8SA 2W96B 4OBOA 3I4BA 4F6UA 5JFXA 4FV0A 3GENA 2J50A 3ZFMA 2I7QA 3E93A 1ZYDA 3HP2A 4CGAA 5M53A 5IQEA 2CN8A 5FLFA 1BX6A 4TKSA 1M2RA 2ERKA 4A4LA 3ACKA 4S34A 2FVDA 1XH5A 3DDQA 4L52A 1KUTA 1PKDA 4ARKA 4HVIA 2VNYA 1IA8A 3CD8A 4IACA 3R8UA 2XKEA 4IAIA 3OCTA 2IZUA 2R3HA 2HOGA 2XBAA 4LMNA 2QOFA 2PMLX 2BHEA 2BRHA 4IFCA 3UDBA 5ANKA 4B8MA 2AC5A 2WHBA 5CF8A 2QHNA 4Z3VA 5JK3A 4L68A 1JQHA 5HESA 3RI1A 2BUJA 4ANOA 4GVJA 4YZCA 4FTOA 2UW4A 4F08A 5IA1A 3FMMA 3OOGA 2VO6A 4IJPA 5HG8A 2WD1A 3KMMA 5L2SA 1X8BA 2Y6OA 1U46A 2PZ5A 4PY1A 3D83A 3H0ZA 2JIUA 1YWNA 2C4GA 3ZZEA 3M42A 3SC1A 3SHEA 3EN6A 1VYZA 3M1SA 1WCCA 4JT3A 4ZSGA 2UZTA 2X2LA 3K5VA 1GNGA 4RX9A 5EM6A 2ONLA 3HVCA 5CI7A 4LGGA 4AT5A 2C5YA 3GCVA 1TKIA 5FXRA 2ETRA 5DLSA 5A46A 2OI4X 2B9HA 3KRRA 2J0MB 3UYSA 5L2IA 3A99A 3QQLA 1OECA 2O0UA 4FC0A 4ANQA 3U54A 4QTBA 4EOKA 3IW8A 4PP9A 4DFBA 4D2VA 4BKZA 5M51A 3DK6A 3JY9A 3RZBA 4ZMEA 1U59A 2BAJA 2GNFA 3RP9A 2HCKA 4UYNA 1OVEA 4ANNA 4HW7A 4MEDA 2RGPA 2I0EA 4PDSA 2BHHA 4UMUA 3Q2MA 4ZK5A 1BI8A 4XV2A 3ID6C 4EH7A 4E4LA 4Z55A 1UA2A 1W84A 2ZYBA 1UU9A 4TN6A 2ZMCA 3EFKA 5CSWA 2ITQA 2WTDA 3R02A 5AX3A 4DEDA 5HTCA 1CTPE 2YM6A 5IMXA 3R04A 3AT2A 3PJCA 3PTGA 5K5XA 4JR3A 2B0QA 2QO9A 4CFMA 3E87A 4M69B 3L9NA 5BPYA 2BPMA 3I81A 1EH4A 5GJGA 3U6JA 2Y7JA 3BHHA 3TKIA 2R3KA 1OIYA 2BDJA 5LOHA 3HYHA 2PUNA 3SRVA 3Q5IA 3OXTA 1Q5KA 3EQDA 3KL8A 4GYGA 4ACDA 4BIEA 4DYMA 3QQHA 3AC5A 3RK5A 5AP6A 3KN6A 2A19B 3UP7A 3MTLA 5ANOA 4BYIA 3UNKA 1XQZA 4JG8A 5F94A 3MPMA 4FSQA 4XRJA 3NIZA 3LE6A 4U9AA 1XKKA 1YXSA 2F9GA 3W16A 4MBLA 4LRKA 4D4RA 3RPSA 3DXPA 4ZAUA 2V7AA 3IS5A 4DEBA 2PULA 4AW2A 2VWVA 4DGOA 3B2WA 1GOLA 3E8DA 3K2LA 5ACBC 3E3BX 4EOJA 2ITYA 3R83A 4QP3A 3F3UA 4KBAA 5A3XA 4ANMA 1YKRA 2IJMA 5CU3A 5JZJA 3BYVA 2JFLA 4OTHA 4M12A 3G6HA 4BDGA 3QTWA 5B2LA 5EW3A 1YWVA 3FLYA 1PF8A 4F1OA 4L3LA 3C4FA 3QRTA 3TTJA 3RZFA 1RE8A 1S9JA 2OXDA 1NVQA 5KUPA 5AUXA 2PTKA 4JLCA 4NFNA 2BKKA 5E92A 4FBXA 4FKWA 3NGAA 5HHWA 4E7WA 3IK3A 4IB0A 2EXCX 4BCHA 5L8LA 3NVMB 4GMYA 1J1CA 2OFVA 3F66A 4E4NA 4H1JA 4PDPA 3NNVA 4YU2A 2WTVA 2WTKC 3PXQA 4Y46A 2F7ZE 4A9SA 3ORXA 2J5EA 3NAXA 3Q9XA 4B7TA 4C4IA 3I79A 2XRWA 3GNIB 5FBNC 5CI6A 4X6RA 4RJ3A 4CG9A 3BU3A 4MKCA 3QQUA 4AE9A 4RPVA 3CD3A 4AW1A 4MD8E 3ZXZA 3MIYA 5A14A 3OUNB 5CY3A 3R8VA 1T45A 4NT4A 3SX9A 3FEGA 4WNOA 4XX9A 3U4UA 4D2WA 4X2KA 5CANA 3ZSHA 2ZDTA 3QTXA 3EFWA 3SV0A 4BIDA 3R9HA 3UMWA 4C61A 4YSMA 3V51A 5GHVA 2J0IA 5CEKA 2PZRA 4M13A 4BCMA 4IH8A 4M97A 4MXZA 3ZDUA 2XK9A 2ZV8A 5TOZA 3LM0A 4PPCA 3ZLXA 3SXSA 4YZMA 4C33A 4GUEA 4GJ3A 5HBHA 3QD2B 2IW8A 4TYIA 5HE1A 3FZ1A 4NCTC 4YPDA 5EKNA 1BLXA 2CCIA 1SVGA 2HW6A 3O8TA 4WBOA 5IUHA 5J9LA 1H1SA 3OY1A 3SQQA 1A06A 3IGOA 2UZOA 4B6LA 3IOKA 3PVWA 2OGVA 2GS2A 3GCPA 3OEZA 4HCUA 4BCOA 5IQDA 1OMWA 2JD5A 1URCA 2X4FA 2J2IB 2J0KA 1UNHA 3PJ2A 4OT6A 3I60A 4HJOA 4I93A 2GNGA 5JZNA 1FMKA 3DLZA 3NRMA 1G3NA 1P14A 2Z60A 4IAFA 2RL5A 4FV2A 4J53A 4RIYA 4M15A 2HZ4A 4U5JA 5CSHA 2YZAA 5DE2A 3PXZA 5EKOA 1OKZA 3PA4A 4LL5A 4HYIA 4XMOA 3EN7A 3G90X 4RG0A 2QD9A 5AJQA 3LFCA 1SYKA 1QPJA 4W4XA 2PE2A 3LJ0A 3QC9A 3OCGA 4AZFA 1PY5A 2QURA 2B9JA 2UZUE 4FV8A 4ZZOA 4IQ6A 1H0WA 3LM5A 3OF0A 1RQQA 3MESA 2BIKB 2W4KA 5LWMA 5ETIA 3QA0A 4WUNA 4MK0A 1XH4A 4RZVA 2OJGA 3R1QA 5E8TA 2QOIA 4FIEA 1OZ1A 4NW5A 5EFQA 3VS2A 4DT9A 2WOUA 2UZBA 2WPAA 4J71A 1BL7A 5HD7A 3TIZA 3VULA 4K0YA 1XH9A 5IQGA 3UIBA 4U40A 4FKTA 4OBPA 3MTFA 4YO6A 5J1WA 2ZJWA 1PXOA 3BEAA 4G6LA 4S2ZA 4BZNA 4RLLA 4FKOA 1H25A 3PY3A 5HIEA 1OGUA 3DKOA 1ZOGA 2H6DA 3ITZA 5HVJA 4RIWB 2OH0E 4DFLA 4FICA 1NA7A 4EK8A 4FGBA 2OF4A 4PDOA 4MQ1A 2EB3A 5DEWA 4K33A 2X0GA 2QOKA 3QZFA 3JYAA 4Y73A 4FKJA 4AGDA 4O83A 4F63A 2DYLA 2C6KA 1F3MC 4CLIA 5I3RA 4B9DA 3LXNA 3LJ2A 4N57A 3CY3A 4APPA 4UWYA 3DAKA 4UXLA 1UKHA 5L2QA 4QQ5A 4D0XA 3IW5A 4IWPA 2GQGA 4M0YA 3VBTA 5AAEA 1J7LA 2VTIA 3PUPA 3ZEWA 4K8AA 4QMWA 4QOXA 2QODA 2X39A 5IH4A 4L7SA 3K3IA 2C6TA 1B39A 2GTMA 2ZAZA 1FQ1B 3PJ1A 3P7AA 3ETAA 4RT7A 5D10A 5A4QA 4QT1A 3LW0A 5CAUA 4CV8A 2C30A 1I09A 2IZSA 3LMGA 1FVTA 2YLFA 5CU2A 3VBQA 4D9UA 4ZJJA 5A9UA 4IHPA 4ZS4A 5HBJA 3DZQA 3ORLA 1MP8A 4OUCA 4S31A 4PP7A 2X8EA 4I22A 3LQ8A 2GNLA 4ACGA 3QLFA 3ELJA 3BHTA 2XKCA 5IUIA 5BVWA 3POOA 4GFGA 4DFYA 4TXCA 5HTBA 3ALOA 5H8EA 4GS6A 3CPCA 4FTCA 3QHWA 3F5UA 3COMA 3NUUA 5AV1A 3ULZA 3D14A 3QXOA 2O2UA 4TYJA 4BTMA 4BDEA 2OJIA 3BQCA 4TNDA 3GOPA 1KOAA 3W2CA 4OAUC 2BVAA 5AP1A 4UWCA 2X6DA 1VYWA 5EQEA 2CMWA 4A07A 5CZIA 4H3PA 3VS0A 4R6VA 3U8WA 4AGWA 3HMPA 4BDHA 3R1SA 5HU9A 4WHZA 2YACA 3UTOA 4AA4A 3WI6A 2XF0A 2CNVA 4PDYA 3V5QA 5HO6A 4GFOA 4RWIA 1KSWA 1XO2B 3NR9A 1MUOA 4F6SA 3C7QA 4PF4A 2RF9A 4JDIA 5KNJA 1FPUA 3FV8A 4CCUA 5CXHA 4BTJA 4EKKA 3QRJA 3CQWA 4IVDA 4ACCA 2BRMA 3D2KA 3HV5A 3FLZA 3SOCA 5J8IA 3FWQA 3TNQB 1XH7A 4IAKA 4JDJA 5AAGA 5FXQA 5LQFA 2QKWB 3BGZA 4M0ZA 5E8VA 4WIHA 2VTSA 4IX3A 4UB7A 3EQPA 5E8UA 3P08A 4DGGA 3PLSA 5DPVA 3GU8A 3CLYA 2QOOA 3FQSA 3IONA 1JVPP 3D9VA 3PRIA 4O1OA 2O8YA 1OUYA 3HZTA 4LUDA 2WQEA 3QLGA 3WE8A 1A48A 1WVXA 3SA0A 4IEBA 3LHJA 3GFWA 4FV3A 4OTPA 5KMIA 3C1XA 4CD0A 2DS1A 4U79A 5CF5A 4NCTA 5KMLA 3UZTA 1M7QA 4CYJA 3OC1A 5AP3A 4FMQA 1Q62A 1Q3DA 5HIBA 2C1AA 3BKBA 2FSTX 3VJNA 5AV4A 3R9RA 4FKQA 2B9IA 1Q99A 3TUCA 5FEEA 2VWZA 2B55A 2W7XA 4E3CA 1OPKA 5GINE 3ZZWA 3IW7A 3H9FA 4YLKA 1RJBA 3BGQA 2JKQA 3OBJA 4L3JA 4MXOA 4QO9A 5E8YA 4PV0A 2OG8A 2R7IA 1YVJA 2I40A 3P86A 4K9YA 4YJQA 2BMCA 5AM6A 4EOLA 3HV6A 3NS9A 4XHKB 2UZDA 4FEVA 2R3GA 4E8AA 5CSPA 5CVFA 4QNAA 3H30A 4BBFA 5F9EA 4R78A 3R1YA 2VWWA 2AUHA 2XEZA 3ERKA 1XH8A 2PUUA 3BELA 3C50A 3DV3A 4NK9A 4NSTA 3Q3BA 5EDPA 5F20A 4UV0A 4W4WA 3R7VA 4JJRA 2QU6A 3ZO1A 2W1CA 5AEPA 3ZCLA 2HZIA 4BCNA 4CFUA 5IQAA 3CP9A 3K3JA 5HVYA 1OBGA 4FG8A 4YHJA 4CQEA 2JKKA 5CSVA 3NW5A 1CKJA 3PG3A 3UPXA 2Y4IC 4U81A 5L2TA 3QKLA 2WGJA 5HE2A 4MVFA 5I5ZA 3EN4A 3COIA 4NYEA 3NCZA 3E5AA 3R63A 3LLTA 4YP8A 3A60A 4YJPA 3RCJA 3T8OA 4DTKA 2VTJA 4LL0A 1ZY4A 3HP5A 2W1HA 4QMZA 2UW7A 4BDDA 3ALNA 1SNUA 3MVJA 2X1NA 4II5A 4BFMA 4BDIA 4RIXB 2R0IA 2WZJA 5E4HA 1BKXA 3C4CA 5AR5A 2W1FA 2Q0NA 4KIPA 5IMEA 1GZNA 4O82A 4EONA 2YDKA 5IA0A 5AR4A 2RFNA 3HAMA 4ZEGA 4J7BA 4AP7A 5J9YA 4ZY5A 2BDWA 2KULA 4ENXA 1PXLA 2ZDUA 1ZMVA 1UU3A 2OIQA 3DAEA 2XBJA 3NPCA 3W8LA 2VTOA 3MS9A 1STCE 2BR1A 2YFXA 5HGIA 4AN9A 2XK6A 5BYYA 4CKJA 5K0KA 1R0EA 2GFCA 3HMMA 4LGHA 2R7BA 1SMHA 5IQHA 3OHTA 3DFCB 1G5SA 4KS8A 3P78A 4BCJA 1JNKA 3PY1A 3KXMA 3R6XA 4L7FA 2IO6A 5KHWA 3SW4A 3SG8A 1H01A 2YITA 4L53A 3N4VA 4GK2A 4I5CA 4NZWB 4FTRA 5M55A 3I7BA 3L9MA 2CCHA 5M57A 5FEQA 1H08A 4M8TA 5KMKA 4F9CA 2VGPA 2ZB0A 3Q5ZA 2YAAA 3HV4A 4CZUA 5IA4A 5DT4A 4I1ZA 3G0EA 2BTRA 3TWJA 3FJQE 5EI2A 4USFA 4C58A 4BCGA 4I6HA 4FNZA 4QYYA 3W2SA 4AGUA 4TTHB 4BZOA 4CKRA 3KXGA 3ORKA 3EQBA 3DPKA 4J97A 3QTUA 5FTQA 4AXAA 1V0PA 1PXMA 5IEVA 3DOGA 3I6UA 4BY9E 3Q4TA 4D28A 3DBFA 3MH2A 4FKGA 3OP5A 4G34A 1Q8ZA 4LOOA 3JPVA 3UNJA 4KIQA 2IVUA 4I23A 2E9VA 3IDCA 5J79A 4XOYA 4Y5HA 4IBMA 3E8NA 5C01A 4W8EA 3IKAA 4PPAA 2DUVA 2IN6A 3W2PA 3KK9A 5FDPA 3TJCA 1CSNA 4AZTA 2W5AA 3AC4A 5AV0A 3NYOA 1PXKA 3ZMMA 2HZ0A 5IQFA 4C0TA 4GSBA 4KRDA 1UNGA 2B53A 4XLVA 3FSKA 3HEGA 2E2BA 3R8LA 3F9NA 1GIIA 3TZ8A 2BDFA 1FOTA 4EUUA 3QTRA 2W1IA 5FDXA 2ITVA 2VNWA 2OF2A 4W9WA 2C6DA 4NTSA 4QTEA 4XCUA 3ROYA 2W0JA 4WO5A 5LVLA 4QMVA 5LVMA 3QUEA 2FYSA 3CBLA 3KGAA 3KXXA 3R73A 1PXIA 3TNHA 2UVZA 4V01A 3N9XA 3P79A 4L6QA 2YJRA 2AC3A 4ZTQA 4CT1A 4ORKA 4CFWA 3KKVA 4ZTLA 4BKJA 4MQ2A 4NL0A 4A4XA 4I5HA 4BBEA 2PVLA 3A7JA 5A4CA 5M08A 4J98A 2NO3A 2WMBA 3QF9A 4EZ5A 3OXZA 3RTPA 4AN3A 3NYXA 4HCVA 3O23A 4CLJA 2JGZA 3V6SA 5IF1A 5B2KA 4KUJA 5IEYA 3W33A 3AD4A 3OMVA 3ZSIA 2WMSA 5AUWA 1YRPA 4O7VA 2UVYA 4GCJA 4R1YA 1BI7A 1W98A 3ROCA 2UZWE 4YGAA 3S4QA 3V5JA 4GW8A 3SOAA 3LCOA 2XUUA 4H1MA 1ZYLA 2VTMA 3W2OA 2YWPA 2QLUA 4RX5A 4XG3A 1PKGA 3UQCA 4BHNA 3LFAA 4FG9A 1U5QA 4BTFA 4E5WA 4LFIA 4S32A 3UODA 4TPTA 3Q96A 3SRVB 1Q61A 4LG4A 5L8KA 3HKOA 4L45A 4RC2A 5J7HA 5IA5A 1Y6AA 2XZSA 4LYNA 3C9WA 2BROA 4O27B 4YJVA 2CNUA 5DG5A 3MIAA 1IEPA 2J5FA 2QHMA 4ALWA 4OW8A 3OBGA 3OEFX 3R71A 3NSZA 4ZTHA 3F2NA 2QR8A 4BWPA 3OG7A 2R5TA 4B8LA 4OTQA 2C5XA 2C0IA 2W1ZA 3TJDA 3FY2A 2PYWA 1K2PA 4FR4A 4ZOGA 4CTBA 4EH8A 2C3IB 1WFCA 3NLBA 2CDZA 4LGDA 4YZDA 4EBWA 4FE2A 2VTLA 5F95A 3S1HA 3D5UA 3HECA 3PPKA 3GCSA 2UW8A 3DT1A 5A6NA 3MJ2A 3EQGA 3A7IA 3QU0A 4MHAA 5E8WA 1Q97A 3CCNA 3ENHA 2OW3A 3F5XA 2BAKA 2FH9A 3SW7A 3FY0A 5FRIA 3UPZA 2ITZA 5DEYA 4C4JA 3THBA 3F69A 3BHYA 4J52A 3G9LX 4JR7A 2BKZA 3IW6A 2FO0A 2GU8A 2GSFA 1JPAA 5DR2A 4DTAA 1PW2A 4IFGA 3TZ7A 3F5PA 4YBJA 2HXQA 4F65A 3KF7A 2YDJA 5EHOA 1IA9A 4C57A 4EEVA 4FKIA 5TT7A 3LLAA 2NPQA 2WO6A 4MTAA 2WU7A 3WIGA 3CS9A 3DBEA 4CFFA 4ZTMA 5HQ0A 4FT5A 3GGFA 1XWSA 4IB1A 4BC6A 5EW9A 4F0GA 3P7CA 5BYLA 4XJ0A 4K6ZA 3WIKA 5DVRA 3QZIA 4X3FC 4L67A 2X6EA 5H2UA 1O6YA 4QP8A 1R1WA 3WF7A 1OPLA 1ZAOA 4I0SA 5JGAA 2V7OA 2IPXA 4FF8A 4G6OA 2EVAA 5HTIA 1PMUA 4DEAA 5C26A 4AF3A 3KCKA 3UE4A 1GIJA 1MQBA 1LPUA 1DM2A 4WSQA 3KFAA 4ZTNA 2O3PA 2LGCA 2YIWA 3FMEA 3QYZA 4N70A 3ZUTA 4DH8A 5E9EA 3VS4A 5ANDA 4IX6A 3TG1A 3TZMA 2YLEA 5CF4A 2ZM3A 4QP1A 3F61A 4I3ZA 5HO7A 1PJKA 5EDRA 3ZTXA 2VAGA 3IW4A 2XS0A 3F7WA 4KAOA 3R7UA 3N4TA 4GG5A 5KO1A 4RIYB 4F9WA 5CEOA 2CPKE 1YI6A 1YXVA 3LJ1A 3ORNA 3UGCA 3VWAA 2OK1A 3CKWA 3QFVA 3VIDA 4RJ5A 2PSQA 3RHKA 3JR1A 4RGJA 1PXJA 4I6BA 4TT7A 4EZ7A 5GIPE 5BUIA 4AA0A 2Z7SA 4ZMFA 3QHRA 4HGTA 2C5VA 3O0GA 5E1SA 3RM7A 1XH6A 5KCVA 1Q4LA 1QL6A 4F9BA 1IR3A 5EYMA 3TV6A 3C0HA 3EFJA 3RK7A 3UP2A 3QBNA 4ASEA 3FMLA 3RVGA 2QG7A 2C1BA 3E7VA 3RWPA 3OCSA 3P9JA 4MBIA 3Q60A 4E6CA 4IW0A 4EHEA 2YM5A 3GP0A 5HE0A 3COHA 3Q9YA 4O96A 2VD5A 2W06A 2JKMA 2X7FA 4ID7A 4RA5A 4E6QA 4G3DA 4EUTA 3GU5A 5CAQA 4ZP5A 4XOZA 4A9TA 3VW6A 3VUMA 5HLNA 1KE5A 4BDCA 4BL1A 5FQDC 3EIDA 3CSVA 3UQFA 5KKRC 2Y6MA 2C5OA 5EK7A 3FI8A 4MNEA 3ZFYA 3A8XA 4BBMA 4DN5A 2JDRA 3DTCA 4HZRA 3ZM9A 2Y8OA 4M68A 4ZY6A 4HCTA 5B7VA 2PVRA 3A4PA 5IPJA 3P5KA 4FTJA 2WKMA 3HDMA 4PL3A 3ZOSA 2F2CB 2CKQA 5E7RA 4XBRA 4YC6A 1NVSA 2GHLA 3EKKA 3ZHPC 3BYUA 3R2BA 4AS0A 4AX8A 4TWOA 3TZ9A 2O63A 3ZRLA 2WIPA 4F70A 4TWCA 4BKYA 4ZLOA 5K4JA 5LVNA 3A62A 2R3FA 4D2TA 2XNMA 5CF6A 3QQKA 4GEOA 2BTSA 2OSCA 2VRXA 4CFXA 2Q83A 4O6LA 2R3IA 4DGLC 4DA5A 1CMKE 2EB2A 4TL0A 2Z2WA 3C5UA 5I9UA 5C03A 3FZTA 4YJNA 4FIIA 5HD4A 3L9LA 5HZNA 2BCJA 4L46A 2YJSA 3Q2JA 3LAUA 4NUSA 4U97A 1HCKA 4JXFA 4GRBA 2JDTA 3QCXA 3SDJA 4WUAA 2WMQA 4PMSA 5CVHA 3OOMA 2A27A 4FV1A 4PTGA 3ACJA 5GZ9A 3F88A 1YXXA 3OVVA 3FLWA 1VJYA 2GQSA 3IPHA 5ETAA 4D5KA 5AA8A 1M52A 2P0CA 1IAJA 5EI8A 5LMKC 2ZV7A 4MBJA 5HOAA 3LFEA 2C6OA 3H9RA 2WTKB 2G9XA 5FWKK 3OTUA 5KZIA 4FIJA 2JITA 2EWAA 3KEXA 1Z5MA 2RG5A 2YM4A 3BBTB 2ETKA 4FUXA 3R0TA 5FGKA 2PY3A 3FL5A 3KXZA 3QD0A 4GVAA 2XM8A 2OZOA 3MY0A 3BV2A 4U44A 4IC7A 1H24A 3RNYA 1ZMWA 2JAVA 3E62A 3BQRA 5E1EA 5CVGA 4O0XA 2FB8A 2JIIA 3NW6A 5BVKA 4X3FA 2QG5A 3CQEA 3W18A 5J95A 1PYXA 5KX8A 4G16A 4ZJVA 4L8MA 3CR0A 1H4LA 4O21A 2AYPA 1CM8A 1Q8WA 4DEEA 4I0TA 5AWMA 5L3AA 1YXTA 4C38A 4IVCA 3JXWA 3O50A 4ENYA 4WRGA 4OTDA 3KRXA 4F7NA 4FA2A 1JSUA 4A4OA 3CXWA 3OT8A 4DCAA 2F49A 3A4OX 4FTUA 5CEPA 1J7UA 2WNTA 3GU6A 3U51A 3OXIA 3PIZA 4KWPA 2VZ6A 3AMYA 3A7GA 4XG6A 4WG5A 1REJA 5M44A 3PSBA 3NYVA 1AQ1A 1QPDA 1VR2A 5J5SA 4EYMA 2JLDA 4YSJA 4FEUA 3LXLA 2B54A 4G6NA 1H1RA 1S9IA 3D7ZA 3CEKA 5I9YA 4DE4A 4H3QA 5IG1A 3E8EA 4CYIA 3DLSA 2E9UA 2VTAA 3P1AA 3AD5A 4EOIA 3PG1A 4HVSA 4R7IA 3NUYA 3OROA 4XG7A 4J1RA 2CGXA 4D2SA 3FI3A 2YIYA 4ANLA 3FQHA 3EHAA 4YNEA 4BDAA 5AR2A 5FG8A 3AC2A 4CZTA 4B4LA 1Z57A 4X2GA 4XBUA 2RG6A 2V62A 4MWHA 4IE9A 5J9ZA 5CYIA 4O0RA 5AIKA 3LQ5A 2CN5A 1PMNA 2G2HA 1H1PA 4ITJA 5H9BA 3VRYA 4K2RA 1GY3A 5IDNA 4GKHA 1HCLA 5L8JA 1Y91A 3KVWA 3RHXA 2QVSE 4HYSA 4IWQA 3VS7A 3RAWA 4ANBA 4QRCA 4DG0E 4BYJA 2G2FA 2R3JA 3FKNA 4GYIA 3B8RA 2HK5A 4TYHA 3O2MA 2OU7A 3BLQA 4PNIA 4DBXA 3LCSA 5JGDA 4PL5A 3PXFA 3GC8A 3U6IA 5CEQA 2WQOA 3L8VA 5CSXA 4KIKA 2H34A 4TWPA 4OBQA 2JBOA 5FP5A 1E9HA 3CC6A 2RKUA 5DOSA 3V8TA 4C3PA 1ZYSA 3CY2A 2X7GA 4PRJA 2FSOX 2PMOX 2BILB 4OGRA 5E8XA 2CLXA 3TV7A 1ZZ2A 3V5PA 4O0UA 4E93A 3GC9A 1RW8A 1TQPA 5AV2A 5GIOE 2UZVA 5FM3A 3VVHA 3KRJA 2B9FA 3BBWA 4QQTA 2ESMA 4BB4A 1U54A 2XMYA 1CDKA 4FT7A 2R3OA 3EQHA 1RDQE 2ZMDA 1KV2A 3MA3A 3NX8A 2GHGA 4W8DA 4XG8A 3KXNA 5C8MA 2PUPA 5JRSA 3PPJA 3T9IA 3Q4UA 5FEDA 3DTWA 3Q6WA 4DGMA 3C13A 4BVUA 4ZSEA 4EZ3A 4FYOA 2ITUA 2OBJA 4RVTA 2A1AB 4FL1A 4H3BA 4YTIA 3RK9A 4RFMA 3KQ7A 3MB6A 3TEIA 4FK6A 2W1EA 3KRLA 1Q8TA 2V22A 4C4FA 4WA9A 4XLIA 4JAJA 4J95A 4FI1A 4E6AA 5ITAA 4R3RA 3NWWA 3ORMA 4C35A 3SAYA 5JFSA 3II5A 4QPAA 3CIKA 4UMRA 1FVVA 4IZ7A 5JQ8A 4NM3A 2J7TA 5TR6A 5HCXA 5HEZA 1QPEA 1R0PA 3HMOA 1ZOEA 4NW6A 1TQMA 5AP7A 3PYYA 4ZIMA 1J7IA 5HNBA 4A06A 5LMKA 2GCDA 3QQGA 5DR9A 2RSVA 5EQPA 4IVAA 3UJGA 2VTNA 4JDHA 2V0DA 4EC8A 4HGEA 4FV6A 3F6XA 3L8SA 5H3QA 2WIHA 5K3YA 2XNBA 3R1NA 4V04A 3LCKA 2HY0A 4G9CA 4M84A 4RA4A 4HVGA 3MYGA 4YTHA 4G17A 3R7EA 5HIDA 5KMJA 3G9NA 3ANQA 3BGPA 4OR5A 4HOKA 5L4QA 4DTBA 3U9NA 3OY3A 3I7CA 1OBDA 3TNWA 3BRBA 3TIYA 4FSZA 4E4MA 2WQMA 5AUUA 1SNXA 2WTJA 2X2KA 2X81A 3PIXA 1YHSA 5CT7A 1R78A 3D0EA 5LXMA 3HRCA 1ZWSA 3OWJA 2PVMA 2XCHA 2PZIA 4GU6A 3C0IA 3BZ3A 5DRBA 4DLIA 3QRUA 2VX0A 4EHVA 1VZOA 4GG7A 3KA0A 4A9UA 4C7TA 3Q4CA 3HAVA 1YI3A 3FYKX 4MF1A 3FPMA 2JBPA 3EQFA 4XG9A 4W4VA 1GJOA 4I20A 3QL8A 3NZ0A 5BVFA 4YTFA 4BICA 3DY7A 5BUJA 3COKA 2JDOA 5A6OA 3MVLA 2PUIA 1TQIA 3AGLA 5HX6A 4KIOA 2ZV9A 2X2MA 3NMUF 4DT8A 3O7LD 3TN8A 4Q2AA 4C4GA 1W0XC 2QCSA 2ETMA 3PVUA 4GIIA 3TNIA 5A4EA 4M66A 4KNBA 1UVRA 4ACMA 4DBNA 4YNOA 2EU9A 5CX9A 1OITA 4KKHA 3E63A 2X8DA 4FKVA 3DBQA 1XHAA 3ORPA 5LJJA 3QD4A 4Q5EA 3WZEA 4GK4A 2ZB1A 4DH3A 4G3FA 4DLJA 3IECA 5AR7A 3C5IA 3G15A 3CGOA 3QALE 2PZPA 2IWIA 4NJ3A 4CRLA 5DN3A 3MJ1A 2A0CX 3F3WA 3FL4A 1AD5A 3R01A 3NUNA 4G5JA 2HZNA 2Y4IB 4IDVA 3AC8A 2WTWA 5M06A 4MXXA 1ERKA 3IDPA 4NWMA 4UWBA 4CTCA 3C4XA 1V0BA 4FTQA 3HMNA 5F1ZA 4DH5A 2E9OA 4Z7GA 4HGSA 3PZEA 3SXFA 4TZRA 4BIBA 5FBOA 4PMPA 5JRQA 1MQ4A 1K9AA 4IAZA 4N6YA 4KBKA 4WNMA 5M07A 2C68A 4C59A 4WNPA 4R3CA 4YPSA 3DB6A 2W4JA 4JI9A 1UU7A 3WF6A 4D2PA 2WMTA 3PXRA 3VW8A 2BFYA 2GS6A 2B7AA 4O0YA 2VN9A 2X9EA 3HV7A 1M17A 4WBBB 5FP6A 4DFXE 2OZAA 5LARA 3RM6A 2YZLA 4AG8A 2HW7A 3ZO4A 3A61A 3QUDA 4EOPA 4BTKA 4O7NA 3ORZA 4FZDB 2WMXA 4QMUA 2O64A 5DHJA 2IVTA 3SKCA 4DEHA 4F9AA 1OUKA 4HVDA 3W10A 1WBNA 2W9FB 4XYFA 2C3JA 3MB7A 1OL7A 5AV3A 2W9ZB 4YLJA 5IA2A 1CKIA 5HNIX 4YZBA 4UZDA 1J91A 1O6LA 3PP1A 4FV5A 3F5GA 2XIZA 4XH6A 4AA5A 4YR8A 4YJSA 1OKYA 5BMMA 4BCPA 3BYMA 1PYEA 3BEGA 5HLWA 3Q53A 1XR1A 2XP2A 3QTIA 4FKLA 4FEXA 5IQCA 4EYJA 3DK3A 1H0VA 5DNRA 4HVHA 1F0QA 4BN1A 4B0GA 5IA3A 3R28A 3GBZA 2HXLA 5KHXA 1O9UA 2V55A 4BCIA 4FSUA 1H26A 5D7AA 5GNKA 5E91A 1MRYA 1R3CA 1YXUA 2X7OA 4DCEA 4UN0C 5AP5A 4OTRA 1ZRZA 1H1QA 5HG9A 4HPUE 3PSDA 1JSTA 4UXQA 4E5BA 3ORIA 2NNWB 4QYHA 4FKPA 4ITHA 3F82A 4DEGA 4C37A 3HUBA 4U0IA 5IQIA 2H96A 5H8GA 3LXKA 1ATPE 4RLKA 3MI9A 3VUIA 1Y8YA 5M56A 3MH3A 2YIQA 4FKRA 3PXYA 4EH2A 4U7ZA 3AQVA 3LCTA 4OTGA 2PL0A 2XRUA 4O7RA 3BYOA 2ZM4A 2GS7A 3RKBA 3QCQA 3EB0A 4AWIA 3DBCA 1WBWA 3GC0A 2VTQA 4PPBA 1OM1A 4C02A 2QO2A 3BU5A 4AZVA 2WTCA 2UZEA 4F7LA 3FLQA 4UX9A 1Y8GA 1BYGA 4BI2A 4HPTE 4QMTA 4YJOA 3VUHA 2W99B 5B0XA 1J3HA 4CT2A 4ZSAA 1L3RE 3HMIA 4K18A 5EM7A 3UOJA 1J1BA 2JIVA 2I0HA 4BWKA 1FVRA 4CCBA 3P23A 3R7YA 5M09A 4CFNA 3DU8A 5JT2A 2YAKA 4NM7A 3OUKA 5HG7A 1JBPE 4O0SA 5EG3A 2QQ7A 4AAAA 2ZM1A 3CKXA 4X21A 5L6PA 3PPZA 1UU8A 3GU7A 3RAKA 1FGKA 5AUTA 3B8QA 5CEMA 3UZRA 4BDKA 1YQJA 3BHUA 4D1SA 1YHWA 3UO4A 3AXWA 4QTAA 5HCYA 4D58A 5JH6A 4OTFA 2EXEA 3LVPA 4Y72A 4FT0A 4ZZNA 2PHKA 3C0GA 5DMZA 2PPQA 1ZXEA 3PY0A 4CVAA 3WF5A 2JEDA 3BWFA 1XBBA 4UEUA 3WBLA 4O7TA 1O6KA 2VGOA 2WXVA 5E8ZA 3DAJA 3QKKA 4TRLA 3GB2A 5LVPA 4DFUA 3Q32A 2CGUA 4MNEB 3VF8A 2BZHB 5BVDA 3QCYA 4R77A 2J4ZA 4ACHA 2GPHA 3JY0A 2OICA 4O0VA 5CAOA 3VBXA 5M4IA 2CJMA 1A9UA 1YI4A 1Q8YA 4X2NA 3RINA 3U4WA 5CASA 2WEVA 3V5TA 4V0GA 4EH5A 5DT3A 4BGGA 4E20A 4RX7A 2QOHA 5LVOA 4RWLA 3R9DA 1XJDA 4O7ZA 2YM8A 1ND4A 2UUEA 3LCDA 1OIQA 3S2PA 2VX3A 2Q0BA 3GXLA 4D4YA 4XS2A 1UV5A 3HA8A 4QMMA 2BRNA 4LMUA 5T6KA 3VAPA 3OWPA 4QYFA 5CWZA 1WZYA 4AGCA 3Q9ZA 3UG1A 1V1KA 3V8WA 4WG3A 2C0OA 3G2FA 4FL2A 3OCBA 3P0MA 5LWNA 4UMTA 3WILA 2XK8A 3EL7A 2CGVA 2WB8A 2VWIA 4O38A 3VN9A 4JQEA 4R7HA 3WZDA 2QR7A 4KINA 4MXCA 4XUFA 1TVOA 3EKNA 3EYHA 4O22A 4ZJIA 4D5HA 4X6QC 5EM5A 1JWHA 4LRJA 4MYGA 5TO8A 4CKIA 2OH4A 1PXPA 2UVXA 3FXWA 4D55A 4X2JA 4EOOA 2SRCA 1YDRE 2Y9QA 3TM0A 4AZEA 1M14A 2YEXA 2VU3A 5LMAA 3JVSA 4LRMA 2XK7A 3MVHA 4LV5A 3NW7A 4PTCA 5IH6A 4FSTA 1WBOA 4FUYA 3VO3A 4YHTA 1WBPA 5CT0A 5AM7A 1G8SA 3KC3A 4E4XA 3SD0A 5EM8A 2R9SA 5C27A 4IM0A 4I92A 3RBWA 3PDTA 3WF9A 4GL9A 4QMOA 5DI1A 5C8KA 3AC3A 1QPCA 4J8MA 4RX8A 2R64A 5EH0A 5C4LA 4WG4A 3KULA 4X3FB 3QX2A 2ITOA 4NU1A 5HORA 3DKFA 1YHVA 1W82A 1IG1A 4UBAA 4X3JA 4Z7HA 1AGWA 2R4BA 5IQBA 2WU6A 4KA3A 3TT0A 4F7JA 4O2ZA 4BGQA 1REKA 5KMMA 3DNEA 2ZVAA 2Z7QA 3A7FA 2JDVA 4U3ZA 2UV2A 3CE3A 4U6RA 3ZXTA 5CU0A 3LMHA 3WYYA 4IAAA 3QWKA 3GT8A 3Q52A 4RSSA 3CQUA 3WZUA 4CG8A 3DKCA 3W2QA 2FA2A 2HWOA 3PFQA 4M67A 4PMTA 3T3UA 2YCRA 4Y95A 4EKLA 1K3AA 4D9TA 3QKMA 3U55A 4QP2A 3NUPA 1E1VA 1OKVA 2YM7A 2GNJA 4DHFA 2P2IA 1DS5A 4ZSJA 3FPQA 4AT3A 3ORTA 2RIOA 4QPMA 5ANJA 3R7GA 3HA6A 4NEUA 2XIRA 1WMKA 2HELA 3VUKA 3K5UA 2UW6A 3UBDA 2WELA 4PNKA 3I0QA 3I1AA 3IQ7A 4C3FA 2C5NA 2G15A 2P3GX 3FC1X 4Z9LA 3B2TA 2W5BA 4H39A 3G6GA 1PMEA 5JEBA 5CQWA 3RPOA 3DBDA 3DJ7A 3KMWA 2XVDA 3M2WA 5ANIA 1LP4A 1YOJA 4PMMA 5I9VA 2XIYA 3FKLA 3WOWA 5HNGA 3FLNC 5KBQA 3TKHA 3AC1A 4C4EA 2UW5A 4JNWA 3DJ5A 4QMQA 4OTWA 3FMNA 4FTMA 3ZLWA 3WF8A 3LOKA 1Y6BA 4MXYA 3CJGA 2HY81 3L1SA 3HRBA 4K1BA 2GFSA 3F3ZA 4MX9A 4BDJA 4CMOA 5T68A 4FODA 4BDBA 2VO3A 4ZS0A 3Q6UA 5A54A 3AT3A 3C51A 4TYHB 3NUAA 1GAGA 2X4ZA 1DAWA 4KKGA 3HRFA 3PSCA 3O17A 4EOQA 3EQCA 4L01A 1NT2A 4J8NA 4BZDA 5KKRB 5CS6A 3MSSA 3CTJA 4KIKB 3ZBXA 4Y85A 4RVKA 3REPA 1LEZA 3GC7A 5C9CA 3E92A 3H4JA 3NYNA 4X2FA 4RRVA 2PWLA 3AGMA 4O7LA 3D2IA 3LFSA 4YZ9A 5CTPA 4FYNA 3HUCA 4YZNA 2CKPA 3NNXA 2P33A 5BMSA 2C3LA 3NUXA 5BVOA 3DKGA 1U54B 4M7IA 1LEWA 5D1JA 4ZZMA 4FZ7A 3UC3A 3WZJA 3FXZA 4FNXA 2XNEA 3V8SA 4P5ZA 2XKFA 4FV4A 4LQMA 5ETCA 3O8PA 4RC3A 5CALA 5I9ZA 5A4LA 3S00A 3SVVA 4FTLA 4NIFA 2CKOA 4JRVA 1Q24A 2YN8A 2YABA 4GFMA 3R9NA 3RWQA 3TDWA 4X7QA 3TUBA 2WMVA 3V5LA 4TYEA 4W9XA 4BRXA 2VO0A 2WQNA 5KMOA 3BE9A 4TWNA 3G51A 4CXAA 1YOLA 3WE4A 4KABA 5BVNA 3FKOA 4E73A 2WAJA 3R2YA 2H8HA 4I41A 3MGYA 3R21A 4I5PA 5AUYA 4A7CA 4E1ZA 1W83A 4CV9A 4L42A 4C62A 5JFWA 4BI1A 2R3MA 5HG5A 2VWBA 2Z02A 3QGYA 1P5EA 1CKPA 4TW9A 3R7OA 3F3VA 5CAVA 5AP0A 1ZLTA 1OIRA 2WMAA 1B6CB 4QNYA 1H07A 5BQ0A 3E3PA 2XNPA 3IO7A 4JG6A 4JBQA 3LKMA 4E5AX 4MCVA 2VWYA 1KV1A 3FQEA 2PVYA 3D5VA 3I5ZA 3TXOA 3FSFA 5CZHA 3RGFA 3V01A 3V5WA 4C8BA 2ERZE 3EZVA 3MA6A 3ZUVA 3I0OA 2WFYA 5F4NA 2QNJA 4AZWA 4R7BA 2CGWA 3PA5A 3MFSA 3PRFA 1GIHA 4KKEA 5EHYA 3KXHA 2QOBA 2XK3A 5EYDA 3E88A 3FMDA 5EDQA 3LZBA 5JSMA 2Y0AA 5FXSA 2OXXA 2YCSA 5L6WL 5CU4A 3ZEPA 2NRUA 2R3LA 1MRVA 1YW2A 4HZSA 4IIRA 4ZXTA 3F2AA 4U41A 3EFLA 4JX3A 3MPTA 1UWHA 2W1GA 4JDKA 4EWQA 2I1MA 5I9WA 5JQ5A 2W17A 4O0TA 3V04A 3TNPC 1HOWA 4EQUA 4QP6A 4ALVA 2QOLA 2C6EA 1YDSE 2C6IA 3QTQA 4MD7E 1NVRA 4FTNA 4QYGA 3ZFXA 4BCFA 2CSNA 4QTDA 5KE0A 4EQMA 3ZUUA 4D0WA 2FSLX 3GUBA 5LCKA 4IZYA 2J6MA 4KB8A 5DBXA 5AMNA 3TL8A 3ATSA 1IAHA 4L3PA 4EI4A 5L2WA 4GIHA 3SXRA 4NM0A 2JC6A 3P7BA 4QPSA 2XIKA 2ZV2A 1F5QA 1PHKA 4G5PA 4F64A 2BALA 4U42A 1ZYCA 2XA4A 4JL9A 4F1TA 4O7WA 2R3PA 4JOAA 2CKEA 4G9RA 2YHVA 4O1PA 2RFEA 5DA3A 4ZLZA 1P4FA 1ZYJA 3EQRA 2PVKA 4M14A 2WEIA 5I4NA 5KBRA 4BDFA 3RJCA 3KMUA 4NKSA 3MFUA 4PQNA 5DH3A 4AU8A 4IM2A 3D94A 4EQCA 3FMJA 5D11A 5ETFA 2XYNA 4R8QA 4U43A 4V05A 3RMFA 3HDNA 3DB8A 3EQIA 4RMZA 3PE2A 1LR4A 5ANGA 3E7OA 3FAAA 4UYAA 3VBVA 3VNTA 1DI9A 1GZ8A 2I0VA 2BRGA 2YIRA 3CJFA 3ZO3A 3DGKA 3GI3A 3MY5A 3LMIA 3HL7A 3ODZX 3DZOA 5BNJA 2PMIA 3ZONA 4R1VA 4FTAA 2F7XE 3FZRA 4UZHA 5EHLA 1OKWA 3CPBA 4WNKA 2PU8A 1NXKA 5GZ8A 4QMNA 2DWBA 3F3TA 4AN2A 2PK9A 3FUPA 4FK3A 4QTCA 4RJ4A 4BCQA 4WSYA 3RALA 3ZC6A 1WAKA 4ERWA 3KRWA 5DWRA 3EL8A 3JUHA 2OZAB 4I6QA 3ZO2A 4YC8A 3BWJA 4Y5QA 3EN5A 4UMPA 4RJ8A 5BYZA 4PTEA 1JKKA 5TKDA 2BZKB 2OLCA 1FGIA 3VRZA 5E90A 2IVVA 5DYJA 3R00A 4JVGA 4PX6A 3LFDA 4EH6A 3ZRMA 5IKWA 3QYWA 3PLAE 3S95A 4G1WA 3RAHA 3KF4A 1SZMA 1H00A 4P5QA 4IANA 4O84A 2QI8A 5EOBA 3UIMA 5D9HA 3NDMA 3OW4A 4DG3E 2P2HA 5CU6A 1JKLA 3IDBA 2A2AA 2HIWA 2UZNA 3BLHA 3EWHA 2KTYA 3O51A 1ZOHA 4C2VA 4O0WA 4R3PA 4AFJA 2C69A 1PRYA 3D7TA 4H36A 3ZC5A 2CNQA 2RFDA 3MDYA 2C3KA 2FUMA 5IUGA 2W4OA 5CXZA 3RPVA 2BAQA 2IVSA 1H28A 2GNHA 4IZ5A 5BVEA 1KE8A 4ASZA 4XEYA 3UMXA 5FTOA 3P4KA 3SGCA 2VTRA 4L43A 1UNLA 4DGNA 3TTIA 3OWKA 2XIXA 5G6VA 4FSNA 4JBVA 4RQKA 3RPRA 5DT0A 4D1ZA 4O7YA 3GVUA 3VQUA 4FIFA 2XB7A 2HENA 4CNHA 4I24A 1SM2A 2BFXA 2UW3A 4FVRA 4NM5A 3GCQA 3HLLA 4R5YA 1OI9A 2V5QA 3ANRA 5FUTA 3MH0A 2P4IA 2XKDA 2EUFB 3OW3A 4F0FA 4F7SA 5D41A 2XNNA 2PVNA 1SVHA 4JBPA 5B2MA 4AOJA 4XRLA 3W32A 4FV7A 3VBWA 4IXPA 1KOBA 2UW9A 3UVPA 2ITXA 4GU9A 2VTPA 4QMXA 2BRBA 5T3QA 4E6DA 2GHMA 3UOLA 2J9MA 4IAYA 3VHKA 4EK3A 4QP9A 3L8PA 4DAWA 1U4DA 1URWA 4I5MA 4RC4A 5JFVA 1NY3A 4EL9A 2C6LA 3PVBA 5DRDA 4MXAA 3UVRA 4C4HA 4DH7A 3BE2A 3UVQA 4DEIA 3CTQA 4K77A 3A7HA 2XCKA 3DFAA 3HNGA 4M3QA 3E8CA 1APME 2C6MA 4C2WA 4ZY4A 5ICPA 3KN5A 4XNEA 5FD2A 4O7SA 2VX1A 2WMWA 3GOKA 4FL3A 3ET7A 4O91A 3FDNA 4U3YA 2J0LA 2F7EE 4YBKA 3R9OA 4USDA 3FXXA 3KY2A 4DFNA 2VV9A 1XBCA 3PIYA 2VWUA 5KMNA 5J1VA 2YA9A 5CLPA 2XM9A 1WVWA 2XJ2A 4GUBA 4RWKA 5D12A 3F2RA 2GDOA 5C4KA 5HE3A 2IW6A 3QWJA 4FT3A 3UG2A 3ZU7A 4FVQA 3GQIA 2I0YA 5IEXA 4IB5A 4I4FA 3GEQA 3DXNA 4MF0A 4G3CA 4TYGA 1Q8UA 1B38A 3UC4A 4IJ9A 4GK3A 1W8CA 3PWYA 5FM2A 3EOCA 4IMYA 3MFTA 4OTIA 1JOWB 1WBSA 2QKRA 1PXNA 2G1TA 3GQLA 3QQJA 4OAVB 4V0GB 4CEGA 4OLIA 4YJRA 4H05A 2R3RA 3MVMA 3Q4ZA 4M69A 5CNNA 5AP4A 4CZYB 2H9VA 3O8UA 4FIHA 4BGHA 2E9NA 3BCEA 4RIOA 4U8ZA 2E9PA 2R2PA 2QC6A 3FE3A 4KS7A 4KRCA 4G2FA 4UY9A 5GZAA 3IGGA 4Q9SA 3BX5A 4JQ8A 4USEA 2EXMA 2VTTA 4JX7A 3VUTA 2XH5A 3MW1A 3ZDIA 3EMGA 3LFFA 4LI5A 5DGZA 3R8MA 4MD9E 3U6HA 5ACKA 3NVKI 2QU5A 2OIDA 5IH5A 3MN3A 4FKUA 4OT5A 4S33A 3W55A 4AW0A 1FINA 4XV3A 2JDSA 2ITPA 3PZHA 5HX8A 4N6ZA 4A9YA 1YOMA 1P2AA 4Y8DA 3QRIA 5CENA 4O2PA 1PMVA 4DF3A 2YM3A 4XV9A 3TACA 4EOMA 4JS8A 1P4OA 4FTIA 4I94A 4J99A 1M2PA 4K11A 3FYJX 2X8IA 4LUEA 2XNGA 1H1WA 2QONA 3FLSA 5I9XA 4ZSLA 3VF9A 1UWJA 3NUSA 1JLUE 4RBLA 1KE7A 4HNIA 4FOBA 3QRKA 2PVJA 3DNDA 4TNBA 3VC4A 1BMKA 4EH9A 1NW1A 2XNOA 4YUQA 2IG7A 4QQCA 3HV3A 2GTNA 4FG7A 4ASXA 1ZMUA 3AG9A 1GZOA 5D7VA 4O86A 2OWBA 2I6LA 3UIUA 2YERA 4MWIA 3BIZA 4YO4A 4D1XA 2VUWA 4YURA 3GU4A 5K0XA 3WZKA 4LOQA 3KREA 2DQ7X 1E1XA 3QZHA 4PUZA 1Y57A 2XJ1A 4WOVA 3BV3A 5JKGA 1ZZLA 1KE6A 1BL6A 3LXPA 4CMUA 1WBVA 2IZRA 3KULB
chains in the Genus database with same CATH superfamily
4ZTSA 2PMNX 3FMKA 3QUPA 4FTTA 3VUGA 4NTTA 5HCZA 5EI6A 1BUHA 3D5WA 4YHFA 3HGKA 2Z8CA 4FT9A 4AE6A 3UO5A 1JSVA 1H27A 2IW9A 2G01A 4FSWA 3R8PA 1LUFA 3D5XA 1OB3A 2R0UA 2ACXA 1JKTA 2XYUA 1QCFA 1I44A 3R8ZA 4AFEA 4IWOA 4DHJA 4IDTA 2PE0A 2WTIA 3W0RA 2QOCA 3OWLA 4XG2A 3UOKA 3QTSA 3I6WA 4AUAA 2B4SB 2CHLA 4DH1A 2PVFA 3C4EA 3UQGA 4QMYA 3NCGA 3O96A 2P55A 3RPYA 5AA9A 3DQXA 4FOCA 2BZJA 3LQ3A 4HYUA 3OS3A 4WRSA 5ANEA 1FMOE 5TE0A 4EORA 2O65A 3V6RA 3TCPA 1SVEA 2ITTA 5M4FA 1TFFA 4P4CA 4JAIA 3KCFA 5IU2A 4TY1A 2F57A 3MBLA 4FEQA 4O6EA 4RVMA 3V3VA 2PZYA 3BYSA 2XK4A 2W1DA 1JKSA 4DITA 3H10A 4P7EA 3UO6A 3OD6X 4BHZA 4D2RA 5G1XA 3FHIA 5AIRA 4EH4A 4EK4A 3I5NA 3MY1A 4BI0A 3RCDA 3NIEA 4QP7A 2R3QA 3EZRA 3VJOA 3ODYX 5AUZA 3ATTA 4RZWA 3H9OA 4R5SA 2W05A 4FGRA 2OFUA 4GT3A 4HYHA 4EK5A 3C4ZA 3RNIA 4I4EA 3LFBA 4IX5A 4C34A 2HWPA 4CFVA 3ZLSA 2FSMX 2OJJA 1G8AA 2YISA 3S3IA 4U80A 2PVHA 4D4VA 4C36A 3IOPA 3ZRKA 3KU2A 5JMSA 4F6WA 3UYTA 4X0MA 1OL2A 5AUVA 1Q3WA 3TKUA 4BR3A 4XV1A 4NFMA 4FVPA 3OT3A 2OJFE 2GNIA 3LIJA 3DS6A 1OIUA 2RFSA 4KD1A 3TV4A 1GZKA 3AMAA 3O71A 4RIWA 1KWPA 2C47A 1DI8A 3Q9WA 4G3GA 2FGIA 3ENMA 2G2IA 3NNUA 5AR8A 4XP3A 4WT6A 3UOHA 3EJ1A 3QXPA 3R7IA 2WMRA 3S0OA 5K9IA 3JVRA 1Q41A 5HICA 2YWVA 3AMBA 4A9RA 5AAFA 2HAKA 3BLRA 4D4SA 5I3OA 5J5TA 4AQKA 4NJDA 4DDGA 3NEWA 4FSYA 2ITWA 4YJUA 4NIFB 2NP8A 2WQBA 4EOSA 2GQRA 2CLQA 3SG9A 1WBTA 4L44A 4FX3A 1KE9A 3QA8A 5AADA 2PE1A 3LFNA 3LFQA 3FZPA 4QMLA 4EJ7A 4KSPA 4JBOA 3Q04A 3KVXA 3ZLYA 1ZY5A 3QAME 3PXKA 4PL4A 4Q9ZA 3DK7A 2ZOQA 4L00A 5HKMA 4UMQA 3R22A 4EHGA 3W1FA 4N0SA 4ASDA 4DC2A 5I0BA 5GJDA 4F09A 2F4JA 4YTCA 4PWNA 2HYYA 4IVBA 5AFVA 1QMZA 3QTZA 2JKOA 4RJ7A 3VQHA 3NAYA 2J51A 3OZ6A 3AT4A 4FSRA 1YDTE 4BF2A 1VEBA 3DCVA 3QX4A 4IADA 1UKIA 5BUEA 4AOIA 2YDIA 3MFRA 4IZAA 4S30A 5FTGA 1V0OA 3A8WA 1OPJA 4FSMA 4CSVA 2OXYA 1M2QA 5CAPA 5IZFA 4IX4A 5M4UA 5AR3A 4QMSA 1OL1A 3ZYAA 3VS3A 4GJ2A 4IWDA 2OIBA 4ZTRA 5HBEA 5IISA 4G3EA 4EBVA 2R3NA 4MNFA 3TI1A 4BCKA 4FIGA 1W7HA 3L9PA 5HI2A 3N4UA 2JAMA 3H0YA 1WVYA 3G0FA 2W5HA 3VS5A 3T3VA 1R39A 4JG7A 4IB3A 3TUDA 2OKRA 5CEIA 4Z16A 1ST4A 4I0RA 2UZLA 3O7LB 4ANSA 2BIYA 4EWHA 4LM5A 2IZTA 3QGWA 4U45A 5EOLA 4EK6A 5K5NA 4DFZE 1IASA 3PVGA 3MWUA 2B1PA 4WD5A 5GJFA 4FNWA 4QP4A 3ZM4A 4JIAA 4CRSA 4C3RA 4RFYA 3W2RA 4AACA 5LMBA 2ONLC 3AD6A 4O81A 3PP0A 4XP2A 4FNYA 4IC8A 3AOXA 5TF9A 4GH2A 3NNWA 4EHZA 2QLQA 3D4QA 5BX0A 4HGLA 4AQCA 5KZ0A 4ZLYA 4H58A 4JIKA 3LPBA 2C0TA 2REIA 3WYXA 3U87A 3QQFA 4RFZA 4I6FA 3VS1A 2NRYA 4NKAA 4F9YA 4LV8A 1OL5A 3FI2A 3QC4A 3WARA 3T9TA 4DG2E 2Z7RA 3KB7A 3VHEA 2QOQA 1H8FA 3D15A 4YC3A 1T46A 4P2KA 2UW0A 4AT4A 1ZARA 1XBAA 2XJ0A 3H3CA 3MV5A 4RWJA 3MH1A 3SLSA 4CMTA 4F0IA 5K4IA 2VTHA 4RJ6A 3FC2A 3ZS5A 4EJNA 3UIXA 4J96A 4KBCA 5C8NA 3JS2A 2ITNA 5M4CA 4F4PA 2VO7A 3DA6A 3DDPA 4QQJA 4I21A 3QCSA 3L8XA 4FV9A 4FZ6A 4G31A 4JQ7A 3UNZA 5H8BA 5EYKA 5A4TA 5HU3A 3BHVA 2F2UA 5DFPA 5J7BA 2WOTA 2J0JA 4E26A 3W8QA 3R30A 3M11A 4UALA 4YJTA 1M7NA 4FZAB 2Y4PA 4ALUA 2B52A 1FBNA 3EYGA 3K54A 5HO8A 3FMHA 3OFMA 5JGBA 3CGFA 3OTVA 4F1MA 4DINA 4RVLA 3U9CA 2Z7LA 1Z9XA 3ZH8A 5C1QB 4AW5A 3EN9A 4ONAA 3DXQA 3A2CA 2QO7A 3PE1A 3POZA 3MPAA 4L9IA 5DIAA 4FKSA 4YMJA 4MAOA 2GMXA 4GT5A 4IM3A 1OL6A 2YCQA 5CNOA 5EW8A 3N51A 3ULIA 2O5KA 3KK8A 3RAIA 1IRKA 2X9FA 3QD3A 4NH1A 2YIXA 5J87A 3FZSA 3PJ3A 2OO8X 1YWRA 4Y83A 3IG7A 3DQWA 5AP2A 4GV1A 4APCA 3VUDA 3PWDA 3ZBFA 5L6OA 3GCUA 3EH9A 4RIXA 3G33A 4B99A 2JFMA 4LOPA 4KSQA 3VBYA 3E64A 5LCJA 3PA3A 2WMUA 4F99A 3QZGA 4FEWA 4ERKA 4QD6A 4N4SA 3GFEA 4MH7A 1L8TA 3CTHA 4XG4A 2OJ9A 3VS6A 1DAYA 4GT4A 4Q5HA 4QMPA 4GKIA 3BU6A 3UZPA 5EQYA 4W4YA 3FZOA 5EYCA 2LAVA 3BPRA 2VWXA 2BZIB 3HX4A 3FHRA 4FTKA 4AOTA 3G5DA 5CQUA 4BWXA 4EH3A 4AXCA 1MRUA 1U5RA 4YLLA 3TDVA 3DJ6A 4XP0A 4RQVA 2XEYA 3F7ZA 5IDPA 5DR6A 3C4WA 3FI4A 4HNFA 4ITIA 4QYEA 4EC9A 4AZSA 3D7TB 5JN2A 5AX9A 3AKJA 1JAMA 3BI6A 4JRNA 4WKQA 3PJ8A 3ZSGA 4P90A 5HLPA 5HVKA 4CQGA 2YCFA 4FZFB 2J90A 3FBVA 2A4LA 5E8SA 2W96B 4OBOA 3I4BA 4F6UA 5JFXA 4FV0A 3GENA 2J50A 3ZFMA 2I7QA 3E93A 1ZYDA 3HP2A 4CGAA 5M53A 5IQEA 2CN8A 5FLFA 1BX6A 4TKSA 1M2RA 2ERKA 4A4LA 3PUFC 3ACKA 4S34A 2FVDA 1XH5A 3DDQA 4L52A 1KUTA 1PKDA 4ARKA 4HVIA 2VNYA 1IA8A 3CD8A 4IACA 3R8UA 2XKEA 4IAIA 3OCTA 2IZUA 2R3HA 2HOGA 2XBAA 4LMNA 2QOFA 2PMLX 2BHEA 2BRHA 4IFCA 3UDBA 1OGYA 5ANKA 4B8MA 2AC5A 2WHBA 5CF8A 2QHNA 4Z3VA 5JK3A 4L68A 1JQHA 5HESA 3RI1A 2BUJA 4ANOA 4GVJA 4YZCA 4FTOA 2UW4A 4F08A 5IA1A 2X0PA 3FMMA 3OOGA 2VO6A 4IJPA 5HG8A 2WD1A 3KMMA 5L2SA 1X8BA 2Y6OA 1U46A 2PZ5A 4PY1A 3D83A 3H0ZA 2JIUA 1YWNA 2C4GA 3ZZEA 3M42A 3SC1A 3SHEA 3EN6A 1VYZA 3M1SA 1WCCA 4JT3A 4ZSGA 2UZTA 2X2LA 3K5VA 1GNGA 4RX9A 5EM6A 2ONLA 3HVCA 5CI7A 4LGGA 4AT5A 2C5YA 3GCVA 1TKIA 5FXRA 2NYAA 2ETRA 5DLSA 5A46A 2OI4X 3P5JC 4F78A 2B9HA 3KRRA 2J0MB 3UYSA 5L2IA 3A99A 3QQLA 1OECA 2O0UA 4FC0A 4AXDA 4ANQA 3U54A 4QTBA 4EOKA 3IW8A 4PP9A 4DFBA 4D2VA 4BKZA 5M51A 3DK6A 3JY9A 3RZBA 4ZMEA 1U59A 2BAJA 2GNFA 3RP9A 2HCKA 4UYNA 1OVEA 4ANNA 4HW7A 4MEDA 2RGPA 2I0EA 4PDSA 2BHHA 4UMUA 3Q2MA 4ZK5A 1BI8A 4XV2A 3ID6C 4EH7A 4E4LA 4Z55A 1UA2A 1W84A 2ZYBA 1UU9A 4TN6A 2ZMCA 3EFKA 5CSWA 2ITQA 2WTDA 3R02A 5AX3A 4DEDA 5HTCA 1CTPE 2YM6A 5IMXA 3R04A 3AT2A 3PJCA 3PTGA 5K5XA 4JR3A 2B0QA 2QO9A 4CFMA 3E87A 4M69B 3L9NA 5BPYA 2BPMA 3I81A 1EH4A 5GJGA 3U6JA 2Y7JA 3BHHA 3TKIA 2R3KA 1OIYA 2BDJA 5LOHA 3HYHA 2PUNA 3SRVA 3Q5IA 3OXTA 1Q5KA 3EQDA 3KL8A 4GYGA 4ACDA 4BIEA 4DYMA 3QQHA 3AC5A 3RK5A 5AP6A 3KN6A 2A19B 3UP7A 3MTLA 5ANOA 4BYIA 3UNKA 1XQZA 4JG8A 5F94A 3MPMA 4FSQA 4XRJA 3NIZA 3LE6A 4U9AA 1XKKA 1YXSA 2F9GA 3W16A 4MBLA 4LRKA 4D4RA 3RPSA 3DXPA 4ZAUA 2V7AA 3IS5A 4DEBA 2PULA 4AW2A 2VWVA 4DGOA 3B2WA 1GOLA 3E8DA 3K2LA 5ACBC 3E3BX 4EOJA 2ITYA 3R83A 4QP3A 3F3UA 4KBAA 5A3XA 4ANMA 1YKRA 2IJMA 5CU3A 5JZJA 3BYVA 2JFLA 4OTHA 4M12A 3G6HA 4BDGA 3QTWA 5B2LA 5EW3A 1YWVA 3FLYA 1PF8A 4F1OA 4L3LA 3C4FA 3QRTA 3TTJA 3VONA 3RZFA 1RE8A 1S9JA 2OXDA 1NVQA 5KUPA 5AUXA 2PTKA 4JLCA 4NFNA 2BKKA 5E92A 4FBXA 4FKWA 3NGAA 5HHWA 4E7WA 3IK3A 4IB0A 2EXCX 4BCHA 5L8LA 3NVMB 4GMYA 1J1CA 2OFVA 3F66A 4E4NA 4H1JA 4PDPA 3NNVA 4YU2A 2WTVA 2WTKC 3PXQA 4Y46A 2F7ZE 4A9SA 3ORXA 2J5EA 3NAXA 3Q9XA 4B7TA 4C4IA 3I79A 2XRWA 3GNIB 5FBNC 5CI6A 4X6RA 4RJ3A 4CG9A 3BU3A 4MKCA 3QQUA 4AE9A 4RPVA 3CD3A 4AW1A 4MD8E 3ZXZA 3MIYA 5A14A 3OUNB 5CY3A 3R8VA 1T45A 4NT4A 3SX9A 3FEGA 4WNOA 4XX9A 3U4UA 4D2WA 4X2KA 5CANA 3ZSHA 2ZDTA 3QTXA 3EFWA 3SV0A 4BIDA 3R9HA 3UMWA 4C61A 4YSMA 3V51A 5GHVA 2J0IA 5CEKA 2PZRA 4M13A 4BCMA 4IH8A 4M97A 4MXZA 3ZDUA 2XK9A 2ZV8A 5TOZA 3LM0A 4PPCA 3ZLXA 3SXSA 4YZMA 4C33A 4GUEA 4GJ3A 5HBHA 3QD2B 2IW8A 4TYIA 5HE1A 3FZ1A 4NCTC 4YPDA 5EKNA 1BLXA 2CCIA 1SVGA 2HW6A 3O8TA 4WBOA 5IUHA 5J9LA 1H1SA 3OY1A 3SQQA 1A06A 3IGOA 2UZOA 4B6LA 3IOKA 3PVWA 2OGVA 2GS2A 3GCPA 3OEZA 4HCUA 4BCOA 5IQDA 1OMWA 2JD5A 1URCA 2X4FA 2J2IB 2J0KA 1UNHA 3PJ2A 4OT6A 3I60A 4HJOA 4I93A 2GNGA 5JZNA 1FMKA 3DLZA 3NRMA 1G3NA 1P14A 2Z60A 4IAFA 2RL5A 4FV2A 4J53A 4RIYA 4M15A 2HZ4A 4U5JA 5CSHA 2YZAA 5DE2A 3PXZA 5EKOA 1OKZA 3PA4A 4LL5A 4HYIA 4XMOA 3EN7A 3G90X 4RG0A 2QD9A 5AJQA 3LFCA 1SYKA 1QPJA 4W4XA 2PE2A 3LJ0A 5BV3A 3QC9A 3OCGA 4AZFA 1PY5A 2QURA 2B9JA 2UZUE 4FV8A 4ZZOA 4IQ6A 1H0WA 3LM5A 3OF0A 1RQQA 3MESA 2BIKB 2W4KA 5LWMA 2X0QA 3QA0A 4WUNA 4MK0A 5ETIA 1XH4A 4RZVA 2OJGA 3R1QA 5E8TA 2QOIA 4FIEA 1OZ1A 4NW5A 5EFQA 3VS2A 4DT9A 2WOUA 2UZBA 2WPAA 4J71A 1BL7A 5HD7A 3TIZA 3VULA 4K0YA 1XH9A 5IQGA 3UIBA 4U40A 4FKTA 4OBPA 3MTFA 4YO6A 5J1WA 2ZJWA 1PXOA 3BEAA 4G6LA 4S2ZA 4BZNA 4RLLA 4FKOA 1H25A 3PY3A 5HIEA 1OGUA 3DKOA 1ZOGA 2H6DA 3ITZA 5HVJA 4RIWB 2OH0E 4DFLA 3O5AA 4FICA 1NA7A 4EK8A 4FGBA 2OF4A 4PDOA 4MQ1A 2EB3A 5DEWA 4K33A 2X0GA 2QOKA 3QZFA 3JYAA 4Y73A 4FKJA 4AGDA 4O83A 4F63A 2DYLA 2C6KA 1F3MC 4CLIA 5I3RA 4B9DA 3LXNA 3LJ2A 4N57A 3CY3A 4APPA 4UWYA 3DAKA 4UXLA 1UKHA 5L2QA 4QQ5A 4D0XA 3IW5A 4IWPA 2GQGA 4M0YA 3VBTA 5AAEA 1J7LA 2VTIA 3PUPA 3ZEWA 4K8AA 4QMWA 4QOXA 2QODA 2X39A 5IH4A 4L7SA 3K3IA 2C6TA 1B39A 2GTMA 2ZAZA 1FQ1B 3PJ1A 3P7AA 3ETAA 4RT7A 5D10A 5A4QA 4QT1A 3LW0A 5CAUA 4CV8A 2C30A 1I09A 2IZSA 3LMGA 1FVTA 2YLFA 5CU2A 3VBQA 4D9UA 4ZJJA 5A9UA 4IHPA 4ZS4A 5HBJA 3DZQA 3ORLA 1MP8A 4OUCA 4S31A 4PP7A 3TMOA 2X8EA 4I22A 3LQ8A 2GNLA 4ACGA 3QLFA 3ELJA 3BHTA 2XKCA 5IUIA 5BVWA 3POOA 4GFGA 4DFYA 4TXCA 5HTBA 3ALOA 5H8EA 4GS6A 3CPCA 4FTCA 3QHWA 3F5UA 3COMA 3NUUA 5AV1A 3ULZA 3D14A 3QXOA 2O2UA 4TYJA 4BTMA 4BDEA 2OJIA 3BQCA 4TNDA 3GOPA 1KOAA 3W2CA 4OAUC 2BVAA 5AP1A 4UWCA 2X6DA 1VYWA 5EQEA 2CMWA 4A07A 5CZIA 4H3PA 3VS0A 4R6VA 3U8WA 4AGWA 3HMPA 4BDHA 1G8JA 3R1SA 5HU9A 4WHZA 2YACA 3UTOA 4AA4A 3WI6A 2XF0A 2CNVA 4PDYA 3V5QA 5HO6A 4GFOA 4RWIA 1KSWA 1XO2B 3NR9A 1MUOA 4F6SA 3C7QA 4PF4A 2RF9A 4JDIA 5KNJA 1FPUA 3FV8A 4CCUA 5CXHA 4BTJA 4EKKA 3QRJA 3CQWA 4IVDA 4ACCA 2BRMA 3D2KA 3HV5A 3FLZA 3SOCA 5J8IA 3FWQA 3TNQB 1XH7A 4IAKA 4JDJA 5AAGA 5FXQA 5LQFA 2QKWB 3BGZA 4M0ZA 5E8VA 4WIHA 2VTSA 4IX3A 4UB7A 3EQPA 5E8UA 3P08A 4DGGA 2XAMA 3PLSA 5DPVA 3GU8A 3CLYA 2QOOA 3FQSA 3IONA 4LDTA 1JVPP 3D9VA 3PRIA 4O1OA 2O8YA 1OUYA 3HZTA 4LUDA 2WQEA 3QLGA 3WE8A 1A48A 1WVXA 3SA0A 4IEBA 3LHJA 3GFWA 4FV3A 4OTPA 5KMIA 3C1XA 4CD0A 2DS1A 4U79A 5CF5A 4NCTA 5KMLA 3UZTA 1M7QA 4CYJA 3OC1A 5AP3A 4FMQA 1G8KA 1Q62A 1Q3DA 5HIBA 2C1AA 3BKBA 2FSTX 3VJNA 5AV4A 3R9RA 4FKQA 2B9IA 1Q99A 3TUCA 5FEEA 2VWZA 2B55A 2W7XA 4E3CA 1OPKA 5GINE 3ZZWA 3IW7A 3H9FA 4YLKA 1RJBA 3BGQA 2JKQA 3OBJA 4L3JA 4MXOA 4QO9A 5E8YA 4PV0A 2OG8A 2R7IA 1YVJA 2I40A 3P86A 4K9YA 4YJQA 2BMCA 5AM6A 4EOLA 3HV6A 3NS9A 4XHKB 2UZDA 4FEVA 2R3GA 4E8AA 5CSPA 5CVFA 4QNAA 3H30A 4BBFA 5F9EA 4R78A 3R1YA 2VWWA 2AUHA 2XEZA 3ERKA 1XH8A 2PUUA 3BELA 3C50A 3DV3A 4NK9A 4NSTA 3Q3BA 5EDPA 5F20A 4UV0A 4W4WA 3R7VA 4JJRA 2QU6A 3ZO1A 2W1CA 5AEPA 3ZCLA 2HZIA 4BCNA 4CFUA 5IQAA 3CP9A 3K3JA 5HVYA 1OBGA 4FG8A 4YHJA 4CQEA 2JKKA 5CSVA 4DHZA 3NW5A 1CKJA 4LV7A 3PG3A 3UPXA 2Y4IC 4U81A 5L2TA 3QKLA 2WGJA 5HE2A 4MVFA 5I5ZA 3EN4A 3COIA 4NYEA 3NCZA 3E5AA 3R63A 3LLTA 4YP8A 3A60A 4YJPA 3RCJA 3T8OA 4DTKA 2VTJA 4LL0A 1ZY4A 3HP5A 2W1HA 4QMZA 2UW7A 4BDDA 3ALNA 1SNUA 3MVJA 2X1NA 4II5A 4BFMA 4BDIA 4RIXB 2R0IA 2WZJA 5E4HA 1BKXA 3C4CA 5AR5A 2W1FA 2Q0NA 4KIPA 5IMEA 1GZNA 4O82A 4EONA 2YDKA 5IA0A 4AXEA 5AR4A 2RFNA 3HAMA 4ZEGA 4J7BA 4AP7A 5J9YA 4ZY5A 2BDWA 2KULA 4ENXA 1PXLA 2ZDUA 1ZMVA 1UU3A 2OIQA 3DAEA 2XBJA 3NPCA 3W8LA 2VTOA 3MS9A 1STCE 2BR1A 2YFXA 5HGIA 4AN9A 2XK6A 5BYYA 4CKJA 5K0KA 1R0EA 2GFCA 3HMMA 4LGHA 2R7BA 1SMHA 5IQHA 3OHTA 3DFCB 1G5SA 4KS8A 3P78A 4BCJA 1JNKA 3PY1A 3KXMA 3R6XA 4L7FA 2IO6A 3ML1A 5KHWA 3SW4A 3SG8A 1H01A 2YITA 4L53A 4BJJA 3N4VA 4GK2A 4I5CA 4NZWB 4FTRA 5M55A 3I7BA 3L9MA 2CCHA 5M57A 5FEQA 1H08A 4M8TA 5KMKA 4F9CA 2VGPA 2ZB0A 3Q5ZA 2YAAA 3HV4A 4CZUA 5IA4A 5DT4A 4JMQA 4I1ZA 3G0EA 2BTRA 3TWJA 3FJQE 5EI2A 4USFA 4C58A 4BCGA 4I6HA 4FNZA 4QYYA 3W2SA 4AGUA 4TTHB 4BZOA 4CKRA 3KXGA 3ORKA 3EQBA 3DPKA 4J97A 3QTUA 5FTQA 4AXAA 1V0PA 1PXMA 5IEVA 3DOGA 3I6UA 4BY9E 3Q4TA 4D28A 3DBFA 3MH2A 4FKGA 3OP5A 4G34A 1Q8ZA 4LOOA 3JPVA 3UNJA 4KIQA 2IVUA 4I23A 2E9VA 3IDCA 5J79A 4XOYA 4Y5HA 4IBMA 3E8NA 5C01A 4W8EA 3IKAA 4PPAA 2DUVA 2IN6A 3W2PA 3KK9A 5FDPA 3TJCA 1CSNA 4AZTA 2W5AA 3AC4A 5AV0A 3NYOA 1PXKA 3ZMMA 2HZ0A 5IQFA 4C0TA 4GSBA 4KRDA 1UNGA 2B53A 4XLVA 3FSKA 3HEGA 2E2BA 3R8LA 3F9NA 1GIIA 3TZ8A 2BDFA 1FOTA 4EUUA 3QTRA 2W1IA 5FDXA 2ITVA 2VNWA 2OF2A 4W9WA 2C6DA 4NTSA 4QTEA 4XCUA 3ROYA 2W0JA 4WO5A 5LVLA 4QMVA 5LVMA 3QUEA 2FYSA 3CBLA 3KGAA 3KXXA 3R73A 1PXIA 3TNHA 2UVZA 4V01A 3N9XA 3P79A 4L6QA 2YJRA 2AC3A 4ZTQA 4CT1A 4ORKA 4CFWA 3KKVA 4ZTLA 4BKJA 4MQ2A 4NL0A 4A4XA 4I5HA 4BBEA 2PVLA 3A7JA 5A4CA 5M08A 4J98A 2NO3A 2WMBA 3QF9A 4EZ5A 3OXZA 3RTPA 4AN3A 3NYXA 4HCVA 3O23A 4CLJA 2JGZA 3V6SA 5IF1A 5B2KA 4KUJA 5IEYA 3W33A 3AD4A 3OMVA 3ZSIA 2WMSA 5AUWA 1YRPA 4O7VA 2UVYA 4GCJA 4R1YA 1BI7A 1W98A 3ROCA 2UZWE 4YGAA 3S4QA 3V5JA 4GW8A 3SOAA 3LCOA 2XUUA 4H1MA 1ZYLA 2VTMA 3W2OA 2YWPA 2QLUA 4RX5A 4XG3A 1PKGA 3UQCA 4BHNA 3LFAA 4FG9A 1U5QA 4BTFA 4E5WA 4LFIA 4S32A 3UODA 4FJVA 4TPTA 3Q96A 3SRVB 1Q61A 4LG4A 5L8KA 3HKOA 4L45A 4RC2A 5J7HA 5IA5A 1Y6AA 2XZSA 4LYNA 3C9WA 2BROA 4O27B 4FRFA 4YJVA 2CNUA 5DG5A 3MIAA 1IEPA 2J5FA 2QHMA 4ALWA 4OW8A 3OBGA 3OEFX 3R71A 3NSZA 4ZTHA 3F2NA 2QR8A 4BWPA 3OG7A 2R5TA 4B8LA 4OTQA 2C5XA 2C0IA 2W1ZA 3TJDA 3FY2A 2PYWA 1K2PA 4FR4A 4ZOGA 4CTBA 4EH8A 2C3IB 1WFCA 3NLBA 2CDZA 4LGDA 4YZDA 4EBWA 4FE2A 2VTLA 5F95A 3S1HA 3D5UA 3HECA 3PPKA 3GCSA 2UW8A 3DT1A 5A6NA 3MJ2A 3EQGA 3A7IA 3QU0A 4MHAA 5E8WA 1Q97A 3CCNA 3ENHA 2OW3A 3F5XA 2BAKA 2FH9A 3SW7A 3FY0A 5FRIA 3UPZA 2ITZA 5DEYA 4C4JA 3THBA 3W0SA 3F69A 3BHYA 4J52A 3G9LX 4JR7A 2BKZA 3IW6A 2FO0A 2GU8A 2GSFA 1JPAA 5DR2A 4DTAA 1PW2A 4IFGA 3TZ7A 3F5PA 4YBJA 2HXQA 4F65A 3KF7A 2YDJA 5EHOA 1IA9A 4C57A 4EEVA 4FKIA 5TT7A 3LLAA 2NPQA 2WO6A 4AXFA 4MTAA 2WU7A 3WIGA 3CS9A 3DBEA 4CFFA 4ZTMA 5HQ0A 4FT5A 3GGFA 1XWSA 4IB1A 4BC6A 5EW9A 4F0GA 3P7CA 5BYLA 4XJ0A 4K6ZA 3WIKA 5DVRA 3QZIA 4X3FC 4L67A 2X6EA 5H2UA 1O6YA 4QP8A 1R1WA 3WF7A 1OPLA 1ZAOA 4I0SA 5JGAA 2V7OA 2IPXA 4FF8A 4G6OA 2EVAA 5HTIA 1PMUA 4DEAA 5C26A 4AF3A 3KCKA 3UE4A 1GIJA 1MQBA 1LPUA 1DM2A 4WSQA 3KFAA 4ZTNA 2O3PA 2LGCA 2YIWA 3FMEA 3QYZA 4N70A 3ZUTA 4DH8A 5E9EA 3VS4A 5ANDA 4IX6A 3TG1A 3TZMA 2YLEA 5CF4A 2ZM3A 4QP1A 3F61A 4I3ZA 5HO7A 1PJKA 5EDRA 3ZTXA 2VAGA 3IW4A 2XS0A 3F7WA 4KAOA 3R7UA 3N4TA 4GG5A 5KO1A 4RIYB 4F9WA 5CEOA 2CPKE 1YI6A 1YXVA 3LJ1A 3ORNA 3UGCA 3VWAA 2OK1A 3CKWA 1W2DA 3QFVA 3VIDA 4RJ5A 2PSQA 3RHKA 3JR1A 4RGJA 1PXJA 4I6BA 4TT7A 4EZ7A 5GIPE 5BUIA 4AA0A 2Z7SA 4ZMFA 3QHRA 4HGTA 2C5VA 3O0GA 4O4BB 5E1SA 3RM7A 1XH6A 5KCVA 1Q4LA 1QL6A 4O4EA 4F9BA 1IR3A 5EYMA 3TV6A 3C0HA 3EFJA 3RK7A 3UP2A 3QBNA 4ASEA 3FMLA 3RVGA 2QG7A 2C1BA 3E7VA 3RWPA 3OCSA 3P9JA 4MBIA 3Q60A 4E6CA 4IW0A 4EHEA 2YM5A 3GP0A 5HE0A 3COHA 3Q9YA 4O96A 2VD5A 4QEBA 2W06A 2JKMA 2X7FA 4ID7A 4RA5A 4E6QA 3PFYA 4G3DA 4EUTA 3GU5A 5CAQA 4ZP5A 4XOZA 4A9TA 3VW6A 3VUMA 5HLNA 1KE5A 3AKKA 4BDCA 4BL1A 5FQDC 3EIDA