2HENA

Crystal structure of the ephb2 receptor kinase domain in complex with adp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
281
structure length
259
Chain Sequence
b'SKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRALAARNILVNSNLVCKVSDFGPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-B receptor 2
publication title A change in conformational dynamics underlies the activation of Eph receptor tyrosine kinases
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 79
structure length 259
sequence length 281
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2henA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2henA01
1W0XC 1VJYA 2QOKA 4D9TA 2HZNA 2BRHA 5EI2A 4PDOA 5GJDA 4YSJA 4B99A 4OLIA 3EQRA 1J7IA 3ANRA 4C59A 4UY9A 4U5JA 2BZIB 4I5HA 3WF5A 4C4IA 4IWOA 4DEBA 3OOGA 5LWMA 4LUEA 3HA8A 2Z60A 4GSBA 3ZUUA 5IF1A 2JDOA 3U54A 2AC5A 2C3KA 2V22A 4B0GA 5EHLA 2HXLA 2QKRA 2J0IA 2UZUE 2BUJA 2Z7QA 4ZK5A 3TKIA 3P78A 3LM0A 3WBLA 1Q8UA 4N4SA 1JBPE 2RG5A 2ZYBA 4KB8A 3L9NA 5FXSA 4FBXA 5CSVA 1O9UA 2VO0A 2Y6MA 2OF2A 3R00A 1U54A 4JBPA 4BCNA 4EK5A 1YHVA 4QYGA 5TT7A 4CKRA 1HCLA 2XIKA 5LVOA 3F3VA 5EH0A 3V5PA 1OB3A 2C5XA 1OPKA 3D2IA 3HNGA 4FV0A 4C0TA 4ZTMA 3I81A 3O50A 1ND4A 3FPQA 4RC3A 2VTSA 4Y46A 4HVIA 1CKJA 4IFGA 1UA2A 3A60A 2RIOA 3EZRA 3LFAA 4UYAA 1IR3A 2PK9A 4AZEA 3CTQA 1FMOE 3FMKA 5FTGA 4JQ7A 1PMNA 1CDKA 2NRYA 4U40A 2XNNA 4XH6A 3ROYA 3LCKA 2HY81 3FC1X 1YDRE 3HX4A 2IVVA 3VUHA 4I5CA 4PPAA 3ALOA 1H1PA 3AMAA 3DBQA 4I6HA 2VWYA 5CEKA 3CC6A 4XLVA 5IQFA 1RDQE 3DNEA 3LJ2A 2CN5A 3KXXA 4YHJA 2J4ZA 4EONA 4L01A 3LFFA 3LHJA 4R7HA 5ANOA 3REPA 4FSUA 3LE6A 3MW1A 3UG1A 4D2PA 4TTHB 4Z55A 1HCKA 3RCJA 1YQJA 3BCEA 3GCVA 5FEQA 3UYSA 4FL3A 4XP2A 2CGXA 3WF9A 5G1XA 5DR6A 3U9CA 2C6MA 4YJVA 2QU6A 3F7WA 2DUVA 4PL4A 4I0RA 3ZRMA 2QG7A 5CY3A 5EK7A 2V7AA 5IDNA 3CR0A 2EXCX 1GZ8A 3NUNA 5IKWA 3ORXA 2YLFA 5HORA 3ZM9A 1I09A 2QO7A 4H3PA 1G8AA 3HVCA 4JQ8A 4EOIA 3ATTA 3PYYA 1YDTE 4ACGA 5JQ5A 4O7WA 3PSBA 1H00A 2C6LA 1NW1A 1APME 5HVKA 2BFYA 1F5QA 1BX6A 4AAAA 4EC8A 2NNWB 4NL0A 3GFWA 1XR1A 3NIEA 4KAOA 4FSZA 3QQLA 3PPZA 4O2ZA 4RX5A 2PUNA 2VZ6A 4MBIA 2XF0A 4FODA 4AACA 3BE2A 5EQEA 4KIKB 2ZVAA 3BQCA 2XP2A 4H3BA 4E4MA 4U3ZA 3MWUA 4FSMA 2W4JA 4FV8A 4NK9A 1ZXEA 3BV2A 4S32A 5GIOE 2G2HA 4LGHA 3THBA 3EL8A 2ZM4A 1XH7A 3A4OX 4KWPA 5IA5A 4C3FA 3R0TA 2W1DA 4EK8A 4TRLA 4HVDA 1YW2A 4E4XA 1WBTA 3KRRA 4IB0A 3ZEPA 2PVRA 4DA5A 3ODZX 3MYGA 4TYEA 2J51A 4EH6A 5CAQA 2PMIA 5DYJA 3SDJA 1H24A 4BC6A 4AUAA 5AA8A 3FDNA 4O0XA 5L2SA 5EDRA 4FV2A 1UU8A 2GSFA 2HYYA 4IFCA 5AP0A 1JKSA 3E7VA 4IE9A 5DHJA 3UVQA 5FXQA 5IQGA 4BDIA 3MY1A 3PIYA 3LMGA 2YCQA 4OTRA 4EH7A 4FYOA 2VV9A 3I79A 2C6DA 3R63A 3TJCA 3DNDA 4AE9A 4PTEA 4HZRA 5G6VA 5I0BA 3TV6A 4RLKA 3G51A 3JR1A 2UZLA 4ENYA 2W1CA 2CKPA 2YM5A 2UW7A 3TZMA 4FMQA 1VR2A 4EKLA 3V8WA 3IOPA 3A61A 3R1NA 4BGQA 1J7LA 4W4XA 1MQBA 2Y9QA 4RGJA 2HW7A 4JS8A 3R04A 1JSUA 4AE6A 5DNRA 4BL1A 5GZ8A 5JMSA 3DKFA 4BDAA 4JDJA 4LGDA 3UYTA 1Q4LA 3KULB 5BVFA 5CEOA 3F5XA 2LAVA 3OTUA 5DT0A 3VQUA 4R6VA 3N4VA 2OIQA 4FTKA 1IAJA 1A9UA 4QMMA 1OUYA 3QALE 4TZRA 4X6RA 1R0EA 3ZLSA 3T3VA 3CPBA 4EHVA 1PRYA 2G15A 5E4HA 4R8QA 3SXRA 5HESA 5EM5A 5CAOA 5K3YA 4IX5A 4X3FB 3VBTA 4DFBA 3ZO3A 3PVGA 5KMLA 3O17A 3KEXA 3PY1A 2R5TA 4UXQA 4WNKA 4JDHA 5B2MA 4I22A 5M51A 3H10A 4IC7A 4GRBA 2XNPA 5E1EA 1T45A 3FHIA 3I4BA 4FUYA 4IB3A 2WNTA 5HCYA 3VBYA 4ALWA 5KKRB 4ZSJA 2FSLX 2GNIA 1PXJA 2QNJA 2W5AA 2X81A 4XV9A 4TNBA 5E1SA 2BZHB 4YJSA 3GU5A 4ZY4A 2JAMA 3PIXA 1OIRA 5HIEA 5LMAA 3B2TA 3BYSA 3NW5A 3GC7A 4MAOA 3A4PA 1WBVA 2CHLA 2QOQA 1PYEA 3Q4TA 4J95A 5E8VA 4AXAA 4FG8A 3KXGA 4HW7A 3MTFA 3OBJA 3SKCA 3OWJA 1KE6A 4G5JA 3RPYA 3C4XA 5J7HA 4AFEA 1PXPA 4OUCA 2WMBA 2BIKB 3JYAA 3EJ1A 4R78A 4AZWA 3D5XA 4JIKA 4OTDA 5E8ZA 2GU8A 1YWVA 1QPEA 3H9OA 4AA4A 3F3WA 3KC3A 4ACDA 3P7AA 3CKXA 2QKWB 4U43A 2YCFA 4DFLA 5CU0A 4ZP5A 2C3JA 5AV1A 1OL1A 2IN6A 5A4CA 4USEA 1DAWA 2YLEA 2ZOQA 4EHEA 5GJGA 1V0PA 3ZM4A 2XK3A 2O64A 3S3IA 3KN6A 5EKOA 3DZQA 4F1MA 2C6OA 2WMRA 2NRUA 3TIYA 3DBEA 5L2WA 4MD9E 1KSWA 2R3LA 1YDSE 4N70A 3WI6A 3OP5A 4QPSA 4RIYB 3GBZA 3II5A 3WZUA 5EYDA 4N6YA 5FGKA 3RM6A 5JFVA 3NMUF 3PXRA 4FTLA 1PMVA 3MBLA 4ALUA 3Q9WA 3ORPA 4LMUA 1UNLA 2Z2WA 2OO8X 1E9HA 2QOIA 2VX1A 3KY2A 4FZFB 4HYSA 5BVNA 2PULA 4M15A 3QZHA 3IW4A 1YHWA 4J52A 4FICA 2F49A 2BHHA 2G1TA 4D1XA 4J71A 3Q6WA 3C4CA 1PXLA 3R7GA 4M67A 3N51A 1YOJA 2ZDUA 3MFTA 5CT0A 3MFSA 2Y0AA 3LAUA 1BKXA 4L8MA 3RK9A 4BDEA 4QNAA 3U6IA 3PLAE 3PY0A 3VS6A 5HG9A 2PY3A 4G17A 3PA5A 4O7YA 1B6CB 4FKTA 4XUFA 5ANJA 3R71A 4OT6A 3SXSA 5KMIA 3Q9ZA 4R3CA 3RVGA 1FVVA 2WHBA 3QKLA 3KXNA 3LOKA 4ITHA 3CPCA 4CXAA 4F63A 2EWAA 4XBUA 1ZZ2A 4Y5QA 3VN9A 4BIEA 4DT9A 4ANSA 1V1KA 3MTLA 5FDXA 3RMFA 5A6OA 1KV2A 2IVUA 3E92A 3OWLA 1H07A 4L7SA 5IMEA 5KMKA 5KUPA 3JY0A 2YCSA 1WCCA 4QOXA 3HMPA 4FGBA 2OKRA 4O7SA 4EUUA 2R3IA 4K77A 3QU0A 3QKKA 4R1YA 1O6LA 3BHVA 3LMHA 3RPVA 1V0BA 3QTXA 2I0VA 2WU7A 3DB6A 1XH8A 3VJOA 4CTCA 4EH8A 3R2BA 3FI2A 3SHEA 4RVKA 2WMWA 2YCRA 5CI7A 5A4EA 2X6EA 1H1SA 2OJ9A 3ORTA 3OT3A 2A19B 4U97A 3CXWA 4FEVA 2JKMA 2UW8A 2WMVA 5EM8A 5C4KA 4BCPA 4CMOA 2BKZA 4S30A 4MQ1A 1M2PA 1R78A 2BROA 4G2FA 4PPCA 3CJFA 3FYJX 3RZBA 3JXWA 1H4LA 5E9EA 2NO3A 4LMNA 3ZDIA 3W2RA 4MK0A 5C9CA 3ZMMA 2VNYA 3VC4A 4X2KA 3T8OA 4IEBA 2C6EA 5A14A 4O86A 4OW8A 3QWJA 2E9OA 2Z7RA 4IWQA 5GJFA 3EN7A 1SNXA 4O0VA 4V05A 4IWDA 3EKKA 4FTIA 3ZOSA 2C5OA 4FF8A 3E8CA 3TTJA 3UZTA 3HKOA 2PVMA 4RJ3A 2XEZA 4BGHA 4FTAA 4BY9E 3D15A 2A4LA 3QTQA 1YI4A 2C47A 3HA6A 5CSHA 3FY2A 5KBRA 2VX3A 3E63A 3QHRA 3L8SA 3ZUVA 3TCPA 5E92A 3EQCA 3RINA 5A6NA 4HYHA 4NCTC 4A07A 4I6FA 2X1NA 2OICA 3FMNA 4MF0A 4GMYA 2GNHA 3HDNA 3K3IA 1S9IA 4FTTA 3ZLWA 4PP7A 2W9ZB 3W8QA 4F6WA 4W8EA 3ZC6A 3ZLYA 3AMBA 4DE4A 1P2AA 3PRIA 3ZCLA 5AV2A 3K5VA 5C01A 3IW6A 2P0CA 4MCVA 5CF6A 3HECA 2FUMA 4IM2A 4ANOA 4FZ6A 2XVDA 1XH9A 4DEIA 4AU8A 4II5A 5DG5A 4D5KA 4FA2A 3MGYA 3RAIA 1ZAOA 1Y8GA 2XKDA 3W2CA 4DBNA 5GNKA 3I6WA 3PTGA 2SRCA 4FVPA 4GG7A 5JRSA 2J6MA 2WOUA 4AN3A 2BRMA 3LXNA 3MH2A 4IAAA 4JVGA 4U45A 1YVJA 3DS6A 2XYNA 3QYWA 3WIKA 3B8QA 3QKMA 4FV1A 5K0KA 4EHGA 3HMOA 4BIBA 4ZZMA 5IEYA 4IHPA 1URWA 2XB7A 2W1EA 1OIUA 5DEYA 4ZY6A 4D4VA 4BDFA 2EB2A 3PRFA 4ERKA 5KNJA 3ELJA 4K2RA 4LRMA 4BDKA 3TUBA 3MPTA 3QRTA 2OZAB 2WTVA 2HWOA 4U7ZA 5CS6A 5H3QA 3RP9A 3ZFYA 3F9NA 5F20A 2R3HA 4UMPA 4QMUA 2QVSE 3PJCA 4G3FA 1FBNA 3LJ0A 4RJ4A 3VS2A 4P2KA 3JUHA 3ZRKA 4RIWA 4QTCA 4RZWA 4BTMA 3F2NA 5CQUA 5BNJA 4K0YA 2YDKA 2ERKA 2JBOA 3V6RA 5KO1A 5LCJA 5L8LA 3LM5A 4FKSA 3VF8A 1XBAA 3BLQA 4KS8A 3C4ZA 4LV5A 5AIRA 3Q60A 5I9YA 3DXPA 4YLKA 4AP7A 5FBNC 3E3PA 4FT3A 3BKBA 2XM8A 5IEVA 4MBLA 3R1SA 3GT8A 3PDTA 3G2FA 2VTNA 2Z8CA 4FL2A 1GNGA 2R3PA 4IACA 3HMNA 3F69A 1XKKA 3LQ3A 3FZ1A 4GU6A 4QMWA 2VNWA 4QMPA 3TG1A 3EYGA 3SD0A 1PYXA 2BMCA 4OBPA 5FEEA 2JITA 1YKRA 2FVDA 4JG6A 2RFDA 3FXWA 4H05A 2JKKA 5CSPA 4BN1A 2Z02A 4EKKA 3BYOA 3OG7A 4DFNA 1ZYLA 3TEIA 2BALA 3R9OA 2OJJA 1ZWSA 5FBOA 5K5NA 2XNMA 5L6OA 3FMEA 3BEGA 3WZDA 5ETFA 3LFEA 2B55A 3DK7A 3TN8A 3R02A 2J90A 1Z5MA 3C4WA 3I5NA 3ZSGA 3R8ZA 5D7VA 4FSTA 3HEGA 3SGCA 4ACHA 3ZZWA 5IA4A 1ZOGA 1UNHA 1OL7A 5KHXA 4FI1A 4HVSA 3GC8A 2WEIA 2Y4PA 3E87A 3F3TA 4BTJA 4FT0A 5HU9A 2JEDA 4Q9ZA 3TDWA 5HO6A 3MA3A 1YXVA 3QX4A 5IG1A 3G0FA 3KU2A 4I24A 4KBKA 3RZFA 3ZZEA 3K5UA 4JRVA 2YM4A 2GFCA 2B0QA 4ZJJA 4BI1A 4BZDA 2YIYA 5D11A 4F64A 4WNMA 2X2KA 3BLRA 4BDHA 2Q0NA 4FIEA 4QYEA 4OTHA 2ESMA 2BHEA 4XNEA 3EKNA 2YIWA 4RJ8A 2V55A 3F66A 1P5EA 3G90X 1JKLA 5LMKC 2XKEA 3K2LA 3NUPA 3SAYA 1G3NA 1GIJA 3RM7A 3F5UA 4FKPA 4UN0C 4YZMA 4PDYA 4YPDA 5L6PA 2PZPA 3W8LA 5C8KA 1TQPA 4O81A 4FL1A 4CT2A 4FT9A 2PVJA 3U8WA 4QMLA 2QO2A 3UC3A 4M13A 4ZTLA 4R77A 3EFLA 1WBNA 2WQEA 3L8VA 4ZSEA 4C2WA 5LOHA 2VWZA 2VWBA 4LOQA 4U81A 1OL5A 4YURA 4FOBA 3NLBA 5H9BA 4DEDA 1U4DA 3O7LD 4FTMA 4EH3A 2X2LA 5LCKA 3SOAA 3GU6A 3EOCA 4J53A 3QBNA 2OJGA 3VW6A 4M0ZA 3GVUA 4J7BA 4HYIA 5DE2A 4EQMA 4F99A 3KF7A 2JIVA 3LCSA 4QMNA 5K0XA 5T68A 3SX9A 2HZ0A 3PZEA 4X2FA 4KBCA 4IX3A 2HWPA 3OD6X 2JBPA 3ZBFA 1IASA 3ITZA 4L42A 5HNBA 3FLYA 1K2PA 3R01A 4TY1A 5HLNA 3ENHA 4AOIA 3UOKA 5IEXA 5HGIA 4L68A 3TKHA 4BCMA 3TDVA 4JAJA 3BV3A 3UO4A 3QRIA 1Y6AA 4GIIA 2B9HA 3DLZA 4AT4A 5FM2A 3DXQA 4AGDA 3RKBA 4KSQA 5AAEA 1E1VA 3LFDA 1FGKA 3LXKA 4ANMA 4AZVA 2IZSA 3VS3A 3PJ8A 4WRSA 4WRGA 4EK4A 1OKZA 4EBWA 1OITA 2JDRA 3QTUA 4ZOGA 3NUUA 2A2AA 4L67A 5HCXA 4M66A 5LVLA 3ZSIA 4BWKA 5LJJA 2VWVA 4FV9A 3ZO4A 2E2BA 3R8LA 4Y95A 2H96A 2CCIA 3O8PA 4YJOA 4C34A 4K8AA 4O83A 5DN3A 4DBXA 3RNIA 3UO6A 4PTGA 3C0IA 4V0GA 2ITVA 5HBEA 4F9CA 2UZBA 4MD8E 2BTSA 1OVEA 3QCXA 1Q8TA 4ORKA 5HX6A 4DH3A 3CJGA 2R0IA 3PVWA 5FM3A 5L8JA 3TZ9A 4EL9A 5KMJA 3GB2A 2CKOA 1U46A 2ZB1A 3AQVA 3I7BA 3MDYA 4JAIA 4X3JA 4FSQA 5HTBA 4CEGA 5LARA 1Z9XA 4K33A 4EOJA 1KOBA 3AT3A 3AT2A 5JT2A 5LQFA 2GS2A 4GIHA 4YJTA 2EUFB 2GHMA 4A9UA 2CN8A 3DGKA 3GP0A 4CFXA 5KMOA 4FGRA 4DCAA 3TJDA 3OBGA 4KRDA 3TIZA 2O8YA 4NH1A 2WELA 5EDQA 4ASEA 4BDBA 3U6JA 4CD0A 4EQUA 3IONA 3ZLXA 4DGLC 3VBVA 4RG0A 4FNXA 5TR6A 3RTPA 3CY2A 1ZYSA 3VQHA 2Z7LA 4UALA 5IPJA 4QMSA 2JGZA 2W1IA 2Z7SA 3NYOA 5A9UA 1LUFA 2F7EE 4C7TA 4EWQA 5AAFA 4ANLA 4NT4A 5HI2A 3KL8A 1OUKA 4FSNA 4QT1A 4FNYA 2RFNA 3QTRA 1SVEA 3AC2A 4DYMA 3Q9YA 4M97A 3EQHA 3GU7A 4K6ZA 1WVXA 1ZOEA 3HAMA 1H0WA 4FVQA 4HCUA 1PXKA 4WOVA 2HENA 3QTSA 4RA4A 3KK9A 1OPLA 2OH4A 3WZJA 4PNIA 1P14A 4AX8A 1Y91A 1Q62A 3H9FA 2CKEA 4YC8A 4D4RA 2B54A 3IKAA 4CGAA 3NX8A 3LLTA 3CS9A 3Q5IA 3UOJA 2VTHA 4UMUA 2I0YA 1BL7A 2QONA 3BU5A 4G34A 2QHNA 2WGJA 1MRYA 2GNFA 3DK3A 4PMTA 4ASDA 4FKRA 5CEIA 2XIYA 4AW2A 4NJ3A 2BAKA 3VS4A 4BDJA 3OY3A 2B52A 3HV7A 2EVAA 2ZV8A 5IA0A 3BWJA 4EOOA 3FI3A 3HMMA 5IZFA 2IO6A 2OJFE 4BDCA 4XG7A 2PMNX 4TYHA 3ORZA 3RBWA 4DF3A 3D14A 1Q61A 5TE0A 3EMGA 5TF9A 5I9WA 5J9ZA 3Q53A 4DG0E 4TNDA 4ACCA 4RIXB 2BILB 3ZXTA 3KN5A 3KRLA 3PP0A 3ZBXA 5DFPA 1HOWA 3UIBA 4O0UA 3NGAA 1OBDA 2JFLA 4IDTA 4FKIA 5T3QA 4RMZA 4XLIA 3FAAA 5AUYA 5IU2A 2VTPA 2W7XA 2F57A 4TYIA 2B1PA 3R9DA 5H2UA 2YFXA 4RWIA 4YJRA 3A2CA 4MTAA 4XBRA 4ZLZA 3U4WA 1DI8A 4EOMA 4A7CA 3NUAA 2CKQA 3C50A 5AAGA 4IB5A 2VGPA 3UIUA 4C38A 3FHRA 3DV3A 3SXFA 4GK4A 2OG8A 3S95A 5BVEA 4AZFA 4ZSAA 4AG8A 4ZS4A 3ZHPC 4UWBA 3H3CA 1ZARA 3D4QA 5A4TA 2PYWA 4FV3A 1XO2B 2VTTA 2WMUA 1U54B 2VTLA 2C5VA 3L1SA 1XQZA 4I5MA 4EK3A 4U0IA 5A4LA 4QP4A 4BKZA 2FYSA 4C35A 2AYPA 4AFJA 2JDVA 4W9WA 3CGOA 2JLDA 2R9SA 2OH0E 3QD2B 4CLJA 1SVGA 4IVCA 2OXYA 4WSYA 2CLQA 4GYGA 2OK1A 5AADA 5CU3A 4LOPA 4ANQA 2UW0A 1KUTA 3QLGA 4HVHA 2ZMCA 3MVHA 4CV9A 2X4ZA 4BI2A 4G9RA 2Y4IB 5M06A 5KZIA 4U8ZA 3P08A 2CNVA 3VBXA 1WBPA 4AW5A 4U80A 5CANA 5M09A 5E8YA 2UW9A 2IW8A 4M12A 5M56A 3UQCA 5ACKA 5I4NA 5E90A 5HLWA 4V04A 5F4NA 4D1SA 4FTQA 4ZIMA 3HV6A 4XRLA 2F7XE 4YU2A 4X3FC 4EJ7A 5T6KA 1PKGA 5DMZA 4FEXA 3KRXA 4NEUA 4UMRA 2XIXA 3RPOA 3QF9A 4PUZA 2V0DA 4N6ZA 1PKDA 1B38A 5AP6A 3UPXA 4Z3VA 1T46A 3R6XA 2I0EA 3GQLA 5TKDA 2PE0A 4WT6A 5DT4A 5H8EA 5J87A 3UTOA 1JVPP 3TM0A 5KKRC 5DVRA 5AUWA 2C6TA 2QR7A 3NUXA 4YO6A 2RKUA 2WTJA 4OT5A 2J50A 2VGOA 1W82A 3E8EA 3WILA 4EH9A 4W4WA 3W2QA 1J1CA 5C8MA 1Y8YA 2BCJA 2RGPA 3AC1A 3PZHA 4GK3A 4I4EA 4M0YA 3JY9A 4EZ7A 1IA8A 4RWKA 1BYGA 2RL5A 2YJRA 4E3CA 3D2KA 3NNXA 3W2PA 4AGUA 3A7GA 3H0ZA 4HGLA 2XK8A 4HOKA 5AIKA 2ETMA 2P3GX 2QR8A 2FSMX 2BZKB 2E9UA 3CTHA 3GI3A 5AWMA 4IVDA 4ANNA 4FKOA 5IISA 4IC8A 4WUNA 2YN8A 4ZTNA 5M08A 4GT5A 5CYIA 4EYMA 5FEDA 4B9DA 3BBTB 4XCUA 4FTOA 4GK2A 4I94A 2J0MB 4NZWB 4LRKA 1P4OA 4RJ5A 4BCKA 4CZUA 3FPMA 3EN5A 3Q32A 2UVYA 3TWJA 5BX0A 5J5SA 3UQFA 4CG9A 4RA5A 3HLLA 3PG1A 4L7FA 2XM9A 3VRYA 1SZMA 3LFBA 4IZAA 5FP5A 2W5HA 4L9IA 4C36A 4JXFA 3R7IA 3OOMA 1ZMWA 4ZS0A 2BR1A 5HIBA 3S00A 5FG8A 5I9ZA 4GFOA 4BGGA 3OY1A 4S2ZA 3HV5A 1W83A 5HVJA 1GAGA 3O0GA 3P4KA 2QI8A 3A7HA 2GQRA 1H1QA 3FSFA 5CU6A 2GNLA 5DT3A 5HE1A 2W06A 4C57A 4H1MA 4EQCA 4XV1A 3WF6A 3MPAA 2UZVA 5FP6A 3C51A 4G3DA 4E6CA 4AA5A 5EQPA 4GT4A 3OXTA 3KCFA 3NAXA 3UG2A 3JVSA 3U6HA 4QTEA 4L3LA 3MH0A 3EQBA 3OUNB 4KIOA 3O7LB 4BKJA 3I0OA 2QQ7A 3PXZA 4I92A 4CQEA 4CRSA 1PMEA 4QO9A 2CNUA 4ZZNA 2VTQA 1H25A 4GEOA 3W18A 4IAZA 5E7RA 4H58A 3Q96A 4WD5A 3P9JA 2C0OA 5CEMA 4AF3A 4G3GA 5EYCA 4GV1A 3PA4A 5C26A 4DCEA 2J9MA 4DTKA 2XNGA 4FZ7A 1UU9A 3Q04A 4Q2AA 4XG3A 3UZPA 4EC9A 4ZAUA 2Y7JA 2OWBA 3N9XA 3LW0A 2IZUA 3NDMA 2WMXA 4U44A 3EYHA 3GCPA 1R1WA 2VTRA 2VO6A 5KZ0A 3HV4A 1WBOA 3DT1A 5HZNA 3PXKA 4BTKA 1YOLA 3BHTA 3OCBA 1M17A 4C3PA 1OKVA 4HGSA 4EH4A 5L3AA 1LEWA 1W98A 2GNGA 3BYMA 3NRMA 4R7BA 4LQMA 4B8LA 4RVLA 3LJ1A 3NYNA 4EH2A 4GVAA 5CENA 4NKSA 3VHKA 4F6SA 5IH6A 4BRXA 4CG8A 4ID7A 3AG9A 2GDOA 3RGFA 5HU3A 3OVVA 4HZSA 3W2OA 5EG3A 4PY1A 4NIFA 4YTCA 3UZRA 2OZOA 3QC9A 4EBVA 3UP7A 3WE8A 5EKNA 4LM5A 1PXNA 5I9XA 1REJA 2UW3A 2YWVA 2YAKA 4GUEA 4ZJVA 3NW7A 3IG7A 1KE5A 3QQHA 3R28A 3ZC5A 3DCVA 3I0QA 1H8FA 4PTCA 4YHFA 3PVBA 2IG7A 5GINE 1MQ4A 3ULIA 2BDFA 3BLHA 3E64A 3ORIA 4TWNA 2PVYA 5AR5A 4QMQA 1WFCA 1W8CA 2WZJA 2PUPA 2XS0A 2J5FA 3PSDA 2C69A 3GGFA 3CBLA 4PPBA 5EM6A 3D5WA 5CX9A 3WYXA 4E93A 3VUTA 3PA3A 4P90A 1M2RA 4RQVA 4R5SA 5HE0A 5H8GA 4F9YA 5HTIA 3BU6A 5AR4A 4OAVB 3W32A 4O27B 4WG4A 4O84A 3DDPA 3KVWA 2J0LA 2J5EA 2ONLC 3OHTA 4G6LA 4KKEA 2RFEA 4DFYA 1OZ1A 4F09A 3V8TA 2LGCA 2IVTA 2W99B 3CQWA 4D2WA 2RFSA 4BIDA 3UODA 2FSOX 4LUDA 3VAPA 2C5NA 3PWDA 5DBXA 2OLCA 2JDTA 4GJ3A 4L43A 3Q4CA 4EOKA 2R2PA 2PVHA 3NYXA 1OKWA 4IANA 4XG6A 4QNYA 4FTUA 2AC3A 2FSTX 3FZRA 5HNIX 3UOLA 4YBJA 4ZXTA 4QMYA 1RJBA 2IW6A 3C4EA 4D4SA 3NSZA 4JX3A 2XYUA 3KMMA 3DQXA 4F0IA 4L00A 4H3QA 3AGLA 3LFNA 1H28A 4J1RA 4M84A 3VS1A 4F4PA 3SV0A 2DWBA 3O51A 3W2SA 3TACA 2X0GA 4YTFA 3CQUA 3TNPC 3KREA 3OF0A 4KKHA 3P5KA 3OTVA 3TV4A 3QL8A 3C13A 2W9FB 3PUPA 3DAJA 4RLLA 5ANIA 2PWLA 1YI6A 3RCDA 3ACJA 3DFCB 4MYGA 4P5ZA 2WQMA 5L4QA 4QP6A 5ETAA 2ITYA 3LKMA 4ZSLA 4TW9A 2A0CX 3ANQA 3FI4A 3TNIA 1IEPA 3PJ3A 3KVXA 4OTQA 4Z7HA 3FLSA 3DAKA 4X21A 4FSRA 3RAWA 5A46A 3FI8A 4QTAA 2VRXA 5CXHA 4IB1A 4LV8A 5AV0A 5JGBA 3IDBA 5IUHA 5IQCA 4MXZA 4D1ZA 4CTBA 3NZ0A 5J79A 3G33A 2C3LA 4C8BA 5KCVA 4NM5A 4DH1A 3UO5A 5M44A 4K18A 4O7LA 1H0VA 1M14A 2UZOA 4PL3A 1M7QA 4QQJA 5DPVA 5C27A 4EH5A 4FEUA 5CTPA 1FQ1B 3C7QA 1WVWA 3NW6A 4PDSA 4YGAA 4DFXE 1WBSA 2QOHA 4OGRA 2I0HA 1AD5A 5C4LA 3M11A 2QC6A 1VEBA 5C03A 1NVQA 2OXDA 3GCUA 3ORLA 1YXXA 3QWKA 2R3GA 3CSVA 2BPMA 4BFMA 1PY5A 5EOLA 3FLZA 2YIRA 3OC1A 4IZ5A 3BELA 4E6QA 1UKIA 5HTCA 5M4UA 4YC6A 4RFYA 4QQTA 4CSVA 4JL9A 4M68A 1FMKA 2J0JA 4A9SA 4DGOA 4IJPA 2E9VA 4FK3A 1UU3A 2P2HA 3VNTA 4R3PA 3DK6A 1AQ1A 4KIQA 3H0YA 3DA6A 4IX6A 2XJ1A 3Q2MA 3AD6A 3EN9A 4OTPA 2VWWA 3FZPA 4GH2A 4NJDA 5BYZA 1MRUA 3T9TA 5EHOA 5JN2A 5EYKA 4PF4A 2ITTA 2W1ZA 4D9UA 4BF2A 1OI9A 3H30A 3TI1A 4U41A 3O8TA 5A54A 3RJCA 3T9IA 4MNEA 2HOGA 2QG5A 3NYVA 4C4HA 2WFYA 3EWHA 2IWIA 5HE2A 2J7TA 3OXZA 4PMMA 4EI4A 2OZAA 3GOPA 3HGKA 4GU9A 4YTIA 2HY0A 4LI5A 2ITPA 4UWYA 4GS6A 4CCUA 4CFFA 4O0YA 4U79A 1NXKA 1M2QA 4QQCA 5JH6A 5AP1A 4U42A 3SRVA 5M07A 1DS5A 5I9UA 2X8IA 3MB7A 3TNHA 3RPRA 4I5PA 4TT7A 5JKGA 3DTWA 4F7JA 1YWRA 2WB8A 3CD8A 2QOOA 1QPJA 1H08A 2QOLA 1OL6A 2YDJA 3QXOA 2JKQA 3VS5A 1ZYJA 3FMHA 3IW8A 1WVYA 2VTMA 3DBDA 3OS3A 1KWPA 4BCJA 4BKYA 2QU5A 4HGEA 3FC2A 4NTTA 3KF4A 4YJUA 4QP9A 2YM8A 4AQCA 4ZY5A 4KS7A 2YZLA 4L44A 4L6QA 2UZEA 4BCOA 2GTMA 2Y8OA 5M53A 5F9EA 4AS0A 1I44A 2FH9A 5D12A 2BDJA 4E73A 2X4FA 2PUUA 3OUKA 5CEQA 3EN4A 3QD4A 3FZOA 4GYIA 2OBJA 4EOPA 3BHHA 2JIIA 4FSWA 4C4JA 4I20A 2RG6A 4JOAA 4IZ7A 4AGCA 3L9LA 4A06A 4G9CA 2XK9A 2Q0BA 4OR5A 4DHFA 4RIWB 1BUHA 4IZYA 3ZXZA 3ENMA 3DKOA 4Z7GA 4DG3E 3WYYA 4BCQA 1UU7A 2R3JA 3DKCA 3FLQA 3UGCA 2OFVA 1U5QA 4W4YA 4BBFA 2ITXA 5FD2A 3RHXA 4IWPA 3BZ3A 3UQGA 5FDPA 3EZVA 5AR2A 2I40A 3D94A 1WBWA 4CFMA 2XIRA 2GCDA 3ZO1A 2ZAZA 4BZNA 4JNWA 2BRBA 3CLYA 5E8XA 3HL7A 3TT0A 5B2KA 1QPDA 2ITUA 2WD1A 2XCHA 4EEVA 1FVTA 4HNFA 4UZDA 2C4GA 4N57A 3I7CA 4MBJA 2BAJA 3TNQB 5HD7A 4NFMA 3DFAA 2B9FA 3GC9A 1KE9A 1VYWA 3LXLA 4TXCA 3RWQA 3V51A 5IQBA 1F3MC 3D7TA 3MJ1A 1OL2A 3PP1A 4L53A 4L45A 4F7LA 5JK3A 3CD3A 3A7IA 3EFKA 3S2PA 3VIDA 2HXQA 3NIZA 4MVFA 3RWPA 2PZYA 3FWQA 5CLPA 2G9XA 2HAKA 4YJNA 2GS6A 2UZDA 2X9EA 3IO7A 5CQWA 3FMMA 2VO7A 3NVKI 4P5QA 2ZB0A 3GQIA 1S9JA 4DAWA 3IW5A 3MY5A 5EI6A 3IPHA 2YHVA 3TNWA 4D0XA 4XG9A 3GCQA 3KQ7A 3RAKA 5EW3A 3DLSA 2PUIA 3QTIA 4FKLA 4IAYA 4OBQA 2R3OA 3KA0A 2YZAA 5BPYA 1ZMVA 3HUBA 3KXHA 2EB3A 4BDGA 2WXVA 4CFWA 4FTCA 2ZJWA 5HEZA 2WMTA 4FEQA 4YPSA 3MSSA 5HO7A 3TUDA 4GVJA 5CI6A 5EQYA 5CT7A 3KFAA 2GQSA 1GIIA 3I60A 2R3RA 4USFA 2C30A 2CSNA 2XRWA 4XG4A 3KCKA 2XK7A 2R0UA 2XBAA 4GG5A 4EOQA 1VYZA 5DLSA 3W33A 3FSKA 5HBJA 1H01A 4YUQA 4FUXA 4IVBA 3V01A 2IJMA 2F2UA 5AUTA 1UWJA 1XWSA 4OTWA 4QRCA 3EB0A 2QLQA 4CMUA 4LRJA 2R3NA 5LVPA 5DA3A 2W96B 4IMYA 3IK3A 4JBQA 5EDPA 1J3HA 2HZ4A 3JVRA 4WNOA 5M57A 2ZV7A 1GZNA 3F7ZA 1R3CA 5CSWA 2ETRA 5HG5A 3ET7A 5TO8A 3OEFX 2WQOA 4AT5A 2O65A 4F0FA 2NPQA 5JSMA 4FE2A 3F3UA 1L3RE 2O5KA 4RBLA 5HE3A 2CNQA 4YMJA 3VW8A 5AUZA 5L6WL 1CKIA 3EFJA 4FIHA 4PRJA 1O6YA 4NKAA 5HG8A 2WIPA 4O0TA 4X2JA 1U5RA 5DGZA 4KBAA 1P4FA 1YI3A 2WTDA 4E20A 3LLAA 3HP5A 3GU4A 3FZTA 4N0SA 4O0WA 2WMSA 2F2CB 1DM2A 1QPCA 2X6DA 4DG2E 1XJDA 3KXZA 4DH5A 1K9AA 5LMKA 1IRKA 3POOA 1Q97A 5KMNA 4M8TA 4Y73A 3G0EA 3QQGA 3MJ2A 3BHYA 3PXYA 4RRVA 4MXAA 2IPXA 4S33A 3JS2A 4PDPA 1KOAA 3F61A 2ZM1A 4KNBA 4DTBA 3CY3A 2R7IA 3PSCA 4FX3A 1BL6A 4IBMA 2IW9A 2XIZA 1MRVA 3EIDA 5AM6A 4G16A 5L8KA 2W0JA 1OIQA 3LCOA 5AR8A 3QXPA 1XH6A 5DIAA 1M7NA 1H1RA 4UZHA 3LQ5A 4AW0A 4FTJA 4QMVA 4CMTA 2WIHA 2B53A 1Q8ZA 3ZTXA 2C3IB 4V0GB 5GIPE 4MD7E 2BTRA 3AC3A 3NNWA 4EOSA 3E62A 5CVHA 4RVTA 1XH4A 4GFGA 3OROA 2XA4A 4IM0A 2H6DA 3OZ6A 4IAKA 3JPVA 2C0IA 1STCE 3QQJA 4OBOA 4USDA 2BRGA 1LR4A 3GEQA 3KGAA 3QQUA 3FMJA 3KMWA 4J8MA 1Q99A 2OF4A 4CYIA 1GOLA 2PVLA 3EHAA 3KMUA 4NFNA 4HGTA 5FUTA 3R8VA 5J1VA 2PHKA 3IGOA 4TPTA 2W1HA 3LZBA 2OU7A 2W05A 4M69B 1BMKA 2WMAA 2Y4IC 1CTPE 1ZY4A 2WPAA 3FE3A 3LFQA 4XP0A 4AOTA 3SA0A 3UNKA 3DY7A 5FTOA 3DOGA 4J98A 2OJIA 3PE1A 4KIPA 2YM6A 1Q8YA 2QO9A 1F0QA 2ETKA 1Q3DA 2JKOA 3LCTA 4ZTSA 5J95A 4O96A 4CFUA 3ZS5A 3MI9A 3R7UA 3AXWA 3AC8A 4FKJA 2QOFA 4QP7A 4DLJA 4F9WA 3V5JA 4YR8A 4O1OA 1PMUA 5KHWA 3C0GA 4CNHA 1OGUA 3P7BA 3R8MA 3ZYAA 1KV1A 3U87A 3F3ZA 5I5ZA 1BI8A 3MESA 5HNGA 4IH8A 4G3CA 2I1MA 3CCNA 4JBVA 3FKNA 3U9NA 4Q5HA 1RQQA 3FYKX 4F6UA 2X7FA 3E8DA 3CKWA 3FV8A 4FV4A 2ITWA 2XKCA 3MA6A 2R64A 2YITA 3DU8A 1FINA 2BVAA 2VAGA 2WMQA 5HKMA 4C33A 5ICPA 4FEWA 1ZRZA 3OMVA 2GFSA 3NNUA 2W1FA 4O1PA 4Z9LA 4ANBA 4PX6A 2AUHA 2C1BA 3Q4ZA 4CLIA 4FNWA 4MH7A 3ULZA 3VUMA 3HV3A 3BYVA 1YHSA 2PVNA 3PJ1A 3M2WA 4EOLA 4UMTA 4NW5A 3SQQA 5IH5A 2WQBA 3SG8A 1R39A 3GFEA 3PY3A 3BHUA 3ACKA 4XV2A 1XBCA 2BFXA 3DJ6A 4ITIA 2B9IA 2CJMA 1TQIA 4IADA 2PVFA 4TYHB 3OFMA 3L9PA 5HVYA 4C4EA 4E1ZA 3DBCA 2X8DA 3DJ5A 3FKOA 4L46A 3R9HA 4DH7A 2WTCA 2ZV9A 5AP4A 4ARKA 4M14A 4ITJA 4CZYB 3PLSA 4IX4A 3UNJA 4PMPA 4BI0A 1VZOA 5EOBA 5D1JA 3CTJA 2REIA 2XCKA 1M52A 4MXXA 2GNJA 4C58A 5CWZA 3PXFA 4IJ9A 4GKIA 3F2AA 3QUEA 2QURA 3A8XA 4NW6A 3AC4A 4KINA 3N4TA 4DINA 1AGWA 4BTFA 4UB7A 5BVOA 2ZDTA 4FNZA 4FYNA 5M4FA 1SNUA 3NNVA 4NM3A 2VTOA 5H8BA 2ITOA 2YAAA 4XOZA 2W4OA 5DEWA 3SC1A 1JLUE 2WU6A 5AMNA 2QODA 4FG7A 4B6LA 4E26A 3FMDA 2PMOX 4RIOA 3PXQA 4DGGA 3B2WA 4PL5A 4EORA 5JRQA 4JR3A 4FK6A 4BWPA 3UP2A 2HIWA 4MXCA 3FQHA 3RALA 2CGWA 2H9VA 3MY0A 3BI6A 3FZSA 4L3JA 2C1AA 4WIHA 1ZYCA 4MWIA 3F5GA 5F94A 5BVDA 3S1HA 3LMIA 3U55A 2XJ0A 5AUVA 4FKGA 4Y72A 4GUBA 3R83A 4BVUA 5C8NA 2F4JA 1EH4A 5AP2A 2YM7A 3VUIA 4APCA 5IA2A 5CAVA 2B7AA 4F08A 3ORNA 1JPAA 4YC3A 2VO3A 1LP4A 2YM3A 3A8WA 3I6UA 4FZDB 4KIKA 4WG3A 5FTQA 3R9NA 3VVHA 4HYUA 4D0WA 4FVRA 4E8AA 4P7EA 4YLJA 2H8HA 3TTIA 4ZMFA 2HW6A 2EU9A 4IDVA 1JSTA 4YNEA 3QA8A 3QAME 3VS0A 1QL6A 2YISA 3LIJA 4FSYA 4C62A 5A4QA 4YZNA 5CF4A 3V5LA 3GU8A 5IA1A 5EFQA 4XYFA 4Y83A 4BYJA 1FPUA 4LFIA 4CQGA 1JWHA 1DI9A 3DPKA 4XP3A 4GKHA 4CCBA 2ERZE 1PXMA 4EWHA 3I5ZA 5CXZA 3FJQE 5AP3A 2F7ZE 3OW4A 3TXOA 3E7OA 1BI7A 3GCSA 2YA9A 3FLNC 3LCDA 4GW8A 4HJOA 5IQHA 3WZEA 4FIFA 4ENXA 2R7BA 4NTSA 5DWRA 5C1QB 2O3PA 2YWPA 3BRBA 5FQDC 3H4JA 3ZUTA 3K3JA 5CSXA 3V5TA 3D83A 4JBOA 1XBBA 4BCFA 4PV0A 4AZTA 2BAQA 4KKGA 4X7QA 3SOCA 3CEKA 3NR9A 5TOZA 4FOCA 2NP8A 2OSCA 2C5YA 4I23A 3R9RA 2UW5A 4E4NA 4QP8A 1YXTA 1MP8A 2PMLX 2ZV2A 2B4SB 4LL0A 4R7IA 3QZFA 4FKUA 4NSTA 4A4XA 2HCKA 3KULA 1NT2A 4E5WA 4KSPA 3UPZA 1BLXA 3MFUA 1G5SA 4AZSA 5IQIA 2WO6A 3HRCA 5GZ9A 4EZ5A 3MS9A 4GJ2A 4HPTE 4XMOA 5JFXA 1Q41A 1XHAA 2VUWA 3FL4A 3WIGA 3EH9A 3FQEA 5M55A 4DT8A 3ORMA 4LYNA 4JJRA 2UW4A 3W16A 4QTDA 3BU3A 2CGVA 4CKIA 4F70A 1A06A 5BUIA 3LFCA 4ASZA 4O7ZA 4TYJA 3EQFA 2R3KA 4X3FA 3RK7A 3O96A 3D5UA 4FKQA 3R22A 5J1WA 3IGGA 4W8DA 4KUJA 4PWNA 2UV2A 3GC0A 3H9RA 5AM7A 3AD4A 3M42A 4JRNA 2XH5A 5I3OA 3RAHA 3TV7A 4LOOA 4UV0A 3MN3A 3EQPA 4FV5A 3NVMB 5BYLA 2W17A 3DXNA 4D55A 2J0KA 1W7HA 3COHA 4YBKA 5J8IA 4CZTA 5CALA 4D2TA 2BRNA 5E8UA 5IUIA 4I1ZA 4IW0A 4DGNA 2X8EA 4C02A 3C1XA 4C4FA 5BUEA 4CVAA 2XKFA 4I0TA 1GJOA 1KE8A 3E5AA 4O6LA 4QYHA 2GTNA 4R5YA 2OIDA 3VBQA 5JGAA 3OXIA 4QMTA 5JGDA 3ATSA 3KKVA 2F9GA 3QLFA 4S31A 5EYMA 3U4UA 4IAIA 2BKKA 1UNGA 4JR7A 4EHZA 2R3QA 4X0MA 4WKQA 5CZIA 1JQHA 3V8SA 4K11A 4ZTRA 2XEYA 4NM0A 1PXIA 2FGIA 4E5AX 2Q83A 2OI4X 5IDPA 3NS9A 4NYEA 3OT8A 3O71A 4RT7A 4YZ9A 5AFVA 4OTGA 3HUCA 5CU4A 2RF9A 1X8BA 5DR9A 3BYUA 3E93A 1GIHA 2IZTA 3DKGA 3MH3A 3QRJA 5ITAA 3EQDA 4R1VA 5IA3A 1OBGA 4XG8A 5FWKK 3QA0A 4WUAA 3QD3A 3IW7A 3QTWA 2CCHA 5AJQA 2KULA 4BB4A 4XV3A 2X2MA 2YABA 3FEGA 3FUPA 5CVGA 4I4FA 4AOJA 2H34A 2OIBA 5FLFA 5HBHA 5I3RA 2PPQA 4RIYA 3QZIA 3GXLA 2XNOA 3DDQA 1CMKE 3FY0A 3WF8A 4O7NA 1KE7A 3W1FA 4D58A 5FXRA 3P0MA 4XEYA 3R8PA 3WZKA 3NUYA 4BWXA 4ONAA 1B39A 2GHLA 1ZOHA 4U3YA 2X39A 4XG2A 2XUUA 5ANEA 1OECA 2FA2A 2J2IB 4PMSA 4UYNA 4ZTQA 4NIFB 4O22A 5JQ8A 4JI9A 1J7UA 2ITZA 1O6KA 3WOWA 3GOKA 2JD5A 3MH1A 5CVFA 4BCHA 5HD4A 3ERKA 3KXMA 1OIYA 3G15A 1IA9A 4RFZA 4DFZE 2JAVA 2VTJA 4MNFA 1Z57A 3OW3A 1IG1A 4HCTA 4QYYA 3Q2JA 4FG9A 4S34A 4G3EA 3PG3A 4YSMA 4B4LA 3QYZA 5DOSA 2A27A 3VUDA 4F1OA 3P86A 4QQ5A 4JG8A 4O91A 4QD6A 4UBAA 4BICA 4X2NA 5HICA 4D5HA 3E8NA 2C68A 2XJ2A 3BX5A 4MXOA 3HYHA 3QFVA 4C3RA 2WOTA 4DEGA 3QD0A 3F88A 4MX9A 5ANDA 5HG7A 4OAUC 3R21A 5AEPA 3S4QA 1J91A 3NAYA 4L3PA 3DBFA 4ZLOA 1JOWB 2YEXA 2I6LA 3Q9XA 2UW6A 2DS1A 3FKLA 4MEDA 3PVUA 5D7AA 1YXUA 4PQNA 4G5PA 1UV5A 2XMYA 3G5DA 5L2QA 3R7OA 5L2TA 3FQSA 3P1AA 3IOKA 4XS2A 2QCSA 3SVVA 2VWUA 3KB7A 5A3XA 3OWKA 4O7TA 4RVMA 2ACXA 5DR2A 4BDDA 5J9YA 1OPJA 1LEZA 4ZMEA 3AMYA 4TYGA 4RX9A 2V5QA 3R30A 4XHKB 3HZTA 4HCVA 5AP7A 5AX9A 5M4CA 5CF8A 3RNYA 3BEAA 3POZA 4JDIA 2HK5A 5E8SA 3QC4A 5HOAA 1WAKA 4UEUA 3V04A 4D2SA 5K4JA 1NY3A 3EN6A 4I21A 1V0OA 2VTAA 2CMWA 3BIZA 1ZY5A 3MPMA 4UWCA 2BIYA 5BVWA 4BHZA 4O7VA 5AX3A 2YDIA 4RPVA 3HP2A 2GS7A 4TWCA 2XRUA 4ZSGA 3ZFMA 3SG9A 2WEVA 4FC0A 4F65A 3MVMA 3NCZA 1OMWA 3DZOA 4NM7A 4JG7A 3VJNA 2RSVA 3WF7A 5LVNA 2BZJA 1OM1A 1GZKA 3LQ8A 2C6IA 4H1JA 4IAFA 4UMQA 1K3AA 3DAEA 2VU3A 4JDKA 3COMA 5BMMA 4E4LA 3QQKA 5K9IA 3R7YA 3KK8A 3IECA 1GZOA 3O23A 1UWHA 4O38A 4RWLA 4BYIA 3DQWA 3G6HA 2XNEA 3NUSA 2ONLA 1PW2A 3CQEA 1OKYA 3GENA 3P23A 4XOYA 5HCZA 2DQ7X 4KD1A 4YZBA 3VUKA 2WTWA 4AN2A 5LMBA 4EJNA 3DB8A 4E6DA 3Q4UA 3QGYA 4CRLA 4O7RA 1R0PA 4Q9SA 4P4CA 3PPJA 2DYLA 4A4LA 4I6BA 3PIZA 4F9BA 1E1XA 3PJ2A 3ZDUA 5FRIA 3VULA 5I9VA 4QP2A 3QX2A 3MB6A 4XX9A 5KX8A 4B7TA 4FT7A 1Q8WA 1WMKA 2CLXA 3P79A 1FVRA 4DLIA 1QMZA 3CE3A 4QMZA 4V01A 4A9TA 4DTAA 5J7BA 3CGFA 1TVOA 2FO0A 2W4KA 4JQEA 2O63A 4BBEA 5CEPA 4M3QA 1YOMA 4GL9A 3VRZA 3V3VA 5AA9A 3HDMA 2PZIA 5CAPA 2GQGA 3FBVA 1JAMA 5DRBA 3VWAA 3V5QA 2P33A 1W84A 2CPKE 5ETIA 3QUDA 3U51A 3AOXA 4YLLA 5D41A 3TZ8A 5EW9A 1URCA 3MV5A 3F5PA 3R2YA 2YACA 4IXPA 2P4IA 1ERKA 4D28A 5EM7A 4Y8DA 5JZNA 3EL7A 4QPMA 5DH3A 4NWMA 1A48A 5IUGA 3R73A 5LWNA 2JDSA 2G01A 2E9PA 3VHEA 4Z16A 3C5IA 3L9MA 3MVJA 2WKMA 3R1QA 2WTKC 4DFUA 3QTZA 3N4UA 4X6QC 3Q5ZA 4AA0A 2G2FA 3CIKA 1G8SA 1Q24A 3WE4A 3PE2A 4MNEB 3R1YA 2VTIA 4CFNA 4TL0A 3ID6C 2UZTA 5L2IA 3F2RA 4I0SA 4DC2A 2A1AB 4ASXA 4OTFA 3ORKA 4UXLA 3ZEWA 4EZ3A 4E7WA 5E91A 3C4FA 4I93A 3DTCA 3GUBA 5EHYA 4W9XA 4YTHA 4O21A 5D10A 3V6SA 5JEBA 1RE8A 2JIUA 3ETAA 4FZAB 4FIGA 4G6OA 3SRVB 2QLUA 4WG5A 5AV3A 4EYJA 3BWFA 4ZLYA 2OW3A 2HELA 4RJ7A 4YHTA 5BYYA 2FB8A 1L8TA 3TZ7A 2B9JA 4F7SA 1ZLTA 2QOCA 4NCTA 4OTIA 4YZDA 3HRFA 4A9RA 1JNKA 2V62A 4I3ZA 2VX0A 4WSQA 4YJPA 2JC6A 5KMMA 4KA3A 3WARA 2PSQA 1UVRA 3VO3A 3R8UA 3UDBA 3HMIA 4ZEGA 2XK6A 3LXPA 4RFMA 5M4IA 3AT4A 4Y5HA 5IQAA 3BBWA 3BGZA 4MF1A 5K4IA 5CU2A 2R4BA 4BCIA 3O8UA 1GY3A 3ZH8A 4PNKA 2R3FA 3MIYA 4XJ0A 4NUSA 1TQMA 5EW8A 2WTIA 3BQRA 5HO8A 4QP3A 4DN5A 3D0EA 4IM3A 5DI1A 4WNPA 3A7JA 3MVLA 4GFMA 4Q5EA 5AR3A 3NWWA 3BGQA 3CP9A 4CYJA 3COKA 3BPRA 4RX7A 3NCGA 3LFSA 4JLCA 4DGMA 4HVGA 4IVAA 3HRBA 5LVMA 3QRKA 5ACBC 3B8RA 3NPCA 4GCJA 4J8NA 2QHMA 4U6RA 3G6GA 3PPKA 3OCTA 4M7IA 4TKSA 3G9NA 2XNBA 4FIJA 2GHGA 5BUJA 4K1BA 5KBQA 2O0UA 3ROCA 2WQNA 1NA7A 3O2MA 2UZNA 4PP9A 1SVHA 4YZCA 5GHVA 4G31A 4CKJA 5K5XA 1Y57A 3E88A 4ERWA 3KRJA 4ACMA 2PE2A 4BCGA 5HX8A 4H39A 2CGUA 2XK4A 3A62A 4IIRA 4K9YA 4MQ2A 5KE0A 3FL5A 1CSNA 2GPHA 4AN9A 4YO4A 4GT3A 2UZWE 1SMHA 5BVKA 4J96A 5JFWA 3GNIB 3HAVA 4RC2A 3EQIA 4O2PA 4R3RA 3UE4A 4UX9A 3UMXA 2E9NA 2W1GA 2YERA 3AD5A 3KRWA 3RI1A 4LGGA 3A7FA 3FXZA 1NVRA 2WTKB 3C5UA 3D7TB 3W10A 5IQEA 4XRJA 3AC5A 4RSSA 3G9LX 1DAYA 2I7QA 4ZZOA 3C0HA 3SW7A 3Q52A 3M1SA 4F1TA 4F7NA 1Q5KA 5B2LA 1YXSA 3QZGA 3IDPA 4RC4A 4FR4A 4QTBA 3PWYA 3UIMA 1YWNA 4FIIA 4MHAA 3DJ7A 1RW8A 4FV7A 1MUOA 2YIQA 5F1ZA 5J5TA 4A9YA 3IQ7A 3NEWA 3IDCA 4WA9A 4BR3A 1JSVA 2WAJA 2UUEA 2G2IA 1FGIA 3ZU7A 4TWPA 4F0GA 4QPAA 3OWPA 4O82A 1WZYA 3D5VA 4LL5A 1ATPE 3RHKA 4BBMA 2CDZA 1H1WA 5AUXA 3UBDA 1SM2A 2GMXA 3TUCA 5IMXA 4JIAA 4X2GA 3MIAA 2KTYA 2XZSA 4QMXA 4G1WA 5D9HA 3MFRA 5LXMA 3RK5A 3PFQA 5CNNA 4AGWA 4BZOA 4TWOA 4B8MA 3BGPA 4C61A 3QCSA 5EI8A 5GZAA 4W4VA 4IQ6A 4Y85A 1PXOA 3P7CA 1ZYDA 3COIA 2P55A 3F6XA 1ZZLA 2QOBA 1CKPA 1H27A 3BE9A 1ZMUA 2EXMA 4D2VA 5B0XA 2XBJA 5B7VA 4H36A 1FOTA 3ODYX 5F95A 2C0TA 1PF8A 3UJGA 3L8XA 5HLPA 5ANKA 2Y6OA 4WO5A 4ZTHA 2PE1A 3OEZA 3Q6UA 5E8WA 3C9WA 3VF9A 2PZRA 2YJSA 2VWXA 3D9VA 3QCQA 1U59A 3TKUA 3FXXA 3F82A 4TN6A 3UVRA 3ZRLA 4EK6A 5J9LA 2V7OA 1UKHA 4MXYA 3V5WA 4AWIA 3S0OA 3RPSA 1REKA 2QD9A 2HZIA 3R7VA 4CV8A 5AV4A 5BQ0A 5CZHA 1YRPA 2PVKA 3ZONA 3QCYA 1SYKA 2IZRA 2ZMDA 4U9AA 4D2RA 4JT3A 2PU8A 4FTNA 4C4GA 4ALVA 2PL0A 4RJ6A 5JZJA 3UC4A 4G6NA 2VN9A 1XH5A 3QRUA 5AP5A 5HHWA 4HPUE 4QP1A 2X9FA 4A4OA 3ZO2A 2W5BA 2OXXA 4C37A 3QUPA 4YJQA 3EFWA 3OCSA 4F9AA 3EQGA 4YP8A 3UIXA 2R3MA 3Q3BA 1JKTA 3VBWA 1QCFA 4FKVA 1J1BA 4FV6A 4KRCA 5BMSA 2VWIA 4JX7A 4NU1A 4O0RA 4MKCA 5ETCA 3SW4A 3T3UA 1NVSA 2BDWA 3QHWA 5JFSA 1CM8A 2JFMA 2UVZA 3R7EA 3VUGA 3IS5A 1PJKA 4CT1A 3QGWA 3ZSHA 2X7OA 1TKIA 1PHKA 4O0SA 4WBOA 3QQFA 2X7GA 3I1AA 3LVPA 3ZFXA 4BHNA 1LPUA 3K54A 3W55A 4DEEA 2ITNA 4WBBB 4M69A 1Y6BA 5DRDA 2C6KA 4I41A 4AT3A 3LPBA 4DH8A 4RX8A 5IH4A 4APPA 5CASA 3OCGA 2ITQA 4QMOA 5AUUA 3SLSA 3UVPA 1JKKA 4E5BA 2PTKA 2OFUA 2O2UA 4AW1A 5CF5A 4J99A 4RWJA 4CFVA 3ALNA 2ZM3A 4J97A 3VS7A 4I6QA 5AR7A 3TL8A 4YNOA 3UNZA 3D7ZA 4LG4A 5CNOA 3AGMA 4E6AA 1H26A 5CAUA 5IQDA 4D4YA 2IVSA 3L8PA 2OGVA 4WHZA 3A99A 4MWHA 2EXEA 2PZ5A 3FMLA 4QYFA 2P2IA 4KABA 5E8TA 4FKWA 4DITA 4O6EA 5ANGA 2VD5A 4RQKA 4DEAA 4RZVA 1Q3WA 4L52A 3UMWA 3UOHA 4DEHA 4ZJIA 2YIXA 4EUTA 4RIXA 2UVXA 3E3BX 1IAHA 4C2VA 5HIDA 3FLWA 5HQ0A 4FT5A 4FTRA 4HNIA
chains in the Genus database with same CATH superfamily
1W0XC 1VJYA 2QOKA 4D9TA 3ML1A 2HZNA 2BRHA 5EI2A 4PDOA 5GJDA 4YSJA 4B99A 4OLIA 3EQRA 1J7IA 3ANRA 4C59A 4UY9A 4U5JA 2BZIB 4I5HA 3WF5A 4C4IA 4IWOA 4DEBA 3OOGA 5LWMA 4LUEA 3HA8A 2Z60A 4GSBA 3ZUUA 5IF1A 3UDSA 2JDOA 3U54A 2AC5A 2C3KA 2V22A 4B0GA 5EHLA 2HXLA 2QKRA 2J0IA 2UZUE 2BUJA 2Z7QA 4ZK5A 3TKIA 3P78A 3LM0A 3WBLA 1Q8UA 4N4SA 1JBPE 2RG5A 2ZYBA 4KB8A 3L9NA 5FXSA 4FBXA 5CSVA 1O9UA 2VO0A 2Y6MA 2OF2A 3R00A 1U54A 4JBPA 4BCNA 4EK5A 1YHVA 4QYGA 5TT7A 4CKRA 1HCLA 2XIKA 5LVOA 3F3VA 5EH0A 3V5PA 1OB3A 2C5XA 1OPKA 3D2IA 3HNGA 4FV0A 4C0TA 4ZTMA 3I81A 3O50A 1ND4A 3FPQA 4RC3A 2VTSA 4Y46A 4HVIA 1CKJA 4IFGA 1UA2A 3A60A 2RIOA 3EZRA 3LFAA 4UYAA 1IR3A 2PK9A 4AZEA 3CTQA 1FMOE 3FMKA 5FTGA 4JQ7A 1PMNA 1CDKA 2NRYA 4U40A 2XNNA 4XH6A 3ROYA 3LCKA 2HY81 3FC1X 1YDRE 3HX4A 2IVVA 3VUHA 4I5CA 4PPAA 3ALOA 1H1PA 3AMAA 3DBQA 4I6HA 2VWYA 5CEKA 3CC6A 4XLVA 5IQFA 1RDQE 3DNEA 3LJ2A 2CN5A 3KXXA 4YHJA 2J4ZA 4EONA 4L01A 3LFFA 3LHJA 4R7HA 5ANOA 3REPA 4FSUA 3LE6A 3MW1A 3UG1A 4D2PA 4TTHB 4Z55A 1HCKA 3RCJA 1YQJA 3BCEA 3GCVA 5FEQA 3UYSA 4FL3A 4XP2A 2CGXA 3WF9A 5G1XA 5DR6A 3U9CA 2C6MA 4YJVA 2QU6A 3F7WA 2DUVA 4PL4A 4I0RA 3ZRMA 2QG7A 5CY3A 5EK7A 2V7AA 5IDNA 3CR0A 2EXCX 1GZ8A 3NUNA 5IKWA 3ORXA 2YLFA 5HORA 3ZM9A 1I09A 2QO7A 4H3PA 1G8AA 3HVCA 4JQ8A 4EOIA 3ATTA 3PYYA 1YDTE 4ACGA 5JQ5A 4O7WA 3PSBA 1H00A 2C6LA 1NW1A 1APME 5HVKA 2BFYA 1F5QA 1BX6A 2XAMA 4AAAA 4EC8A 2NNWB 4NL0A 3GFWA 4O4CA 1XR1A 3NIEA 4KAOA 4FSZA 3QQLA 3PPZA 4O2ZA 4RX5A 2PUNA 2VZ6A 4MBIA 2XF0A 4FODA 4AACA 3BE2A 5EQEA 4KIKB 2ZVAA 3BQCA 3NFFB 2XP2A 4H3BA 4E4MA 4U3ZA 3MWUA 4FSMA 2W4JA 4FV8A 4NK9A 1ZXEA 3BV2A 4LDTA 4S32A 5GIOE 2G2HA 4LGHA 3THBA 3EL8A 2ZM4A 1XH7A 3A4OX 4KWPA 5IA5A 4C3FA 3R0TA 2W1DA 4EK8A 4TRLA 4HVDA 1YW2A 4E4XA 1WBTA 3KRRA 4IB0A 3ZEPA 4I6LA 2PVRA 4DA5A 3ODZX 3MYGA 4TYEA 2J51A 4EH6A 5CAQA 2PMIA 5DYJA 3SDJA 1H24A 4BC6A 4AUAA 5AA8A 3FDNA 4O0XA 5L2SA 5EDRA 4FV2A 1UU8A 2GSFA 2HYYA 4IFCA 5AP0A 1JKSA 3E7VA 4IE9A 5DHJA 3UVQA 5FXQA 5IQGA 4BDIA 3MY1A 3PIYA 3LMGA 2YCQA 4OTRA 4EH7A 4FYOA 2VV9A 3I79A 2C6DA 3R63A 3TJCA 3DNDA 4AE9A 4PTEA 4O4FA 4HZRA 5G6VA 5I0BA 3TV6A 4QEBA 4RLKA 3G51A 3JR1A 2UZLA 4ENYA 2W1CA 2CKPA 2YM5A 2UW7A 3TZMA 4FMQA 1VR2A 4EKLA 3V8WA 3IOPA 3A61A 3R1NA 4BGQA 1J7LA 4W4XA 1MQBA 2Y9QA 4RGJA 2HW7A 4JS8A 3R04A 1JSUA 4AE6A 5DNRA 4BL1A 5GZ8A 5JMSA 3DKFA 4BDAA 4JDJA 4LGDA 3UYTA 1Q4LA 3KULB 5BVFA 5CEOA 1G8JA 3F5XA 2LAVA 5BV3A 3OTUA 5DT0A 3VQUA 4R6VA 3N4VA 2OIQA 4FTKA 1IAJA 1A9UA 4QMMA 1OUYA 3QALE 4TZRA 4X6RA 1R0EA 3ZLSA 3T3VA 3CPBA 4EHVA 1PRYA 2G15A 5E4HA 4R8QA 3SXRA 5HESA 5EM5A 5CAOA 5K3YA 4IX5A 4X3FB 3VBTA 4DFBA 3ZO3A 3PVGA 5KMLA 3O17A 3KEXA 3PY1A 2R5TA 4UXQA 4WNKA 4JDHA 5B2MA 4I22A 5M51A 3H10A 4IC7A 4GRBA 2XNPA 5E1EA 1T45A 3FHIA 3I4BA 4FUYA 4IB3A 2WNTA 5HCYA 3VBYA 4ALWA 5KKRB 4ZSJA 2FSLX 2GNIA 1PXJA 2QNJA 2W5AA 2X81A 4XV9A 4TNBA 5E1SA 2BZHB 4YJSA 3GU5A 4ZY4A 2JAMA 3PIXA 1OIRA 5HIEA 5LMAA 3B2TA 3BYSA 3NW5A 3GC7A 4MAOA 3A4PA 1WBVA 2CHLA 2QOQA 1PYEA 3Q4TA 4J95A 5E8VA 4AXAA 4FG8A 3KXGA 4HW7A 3MTFA 3OBJA 3SKCA 3AKKA 3OWJA 1KE6A 4G5JA 3RPYA 3C4XA 5J7HA 4AFEA 1PXPA 4OUCA 2WMBA 2BIKB 3JYAA 3EJ1A 4R78A 4AZWA 3D5XA 4JIKA 4OTDA 5E8ZA 2GU8A 1YWVA 1QPEA 3H9OA 4AA4A 3F3WA 3KC3A 4ACDA 3P7AA 3CKXA 2QKWB 4U43A 2YCFA 4DFLA 5CU0A 4ZP5A 2C3JA 5AV1A 1OL1A 2IN6A 5A4CA 4USEA 1DAWA 4AXFA 2YLEA 2ZOQA 4EHEA 5GJGA 1V0PA 3ZM4A 2XK3A 2O64A 3S3IA 3KN6A 5EKOA 3DZQA 4F1MA 2C6OA 2WMRA 2NRUA 3TIYA 3DBEA 5L2WA 3O5AA 4MD9E 1KSWA 2R3LA 1YDSE 4N70A 3WI6A 3OP5A 4QPSA 4RIYB 3GBZA 3II5A 3WZUA 5EYDA 4N6YA 5FGKA 3RM6A 5JFVA 3NMUF 3PXRA 4FTLA 1PMVA 3MBLA 4ALUA 3Q9WA 3ORPA 4LMUA 1UNLA 2Z2WA 2OO8X 1E9HA 2QOIA 2VX1A 3KY2A 4FZFB 4HYSA 5BVNA 2PULA 4M15A 3QZHA 3IW4A 1YHWA 4J52A 4FICA 2F49A 2BHHA 2G1TA 4D1XA 4J71A 3Q6WA 3C4CA 1PXLA 3R7GA 4M67A 3N51A 1YOJA 2ZDUA 3MFTA 5CT0A 3MFSA 2Y0AA 3LAUA 1BKXA 4L8MA 3RK9A 4BDEA 4QNAA 3U6IA 3PLAE 3PY0A 3VS6A 5HG9A 3PFYA 2PY3A 4G17A 3PA5A 4O7YA 1B6CB 4FKTA 4XUFA 5ANJA 3R71A 4OT6A 3SXSA 5KMIA 3Q9ZA 4R3CA 3RVGA 1FVVA 2WHBA 3QKLA 3KXNA 3LOKA 4ITHA 3CPCA 4CXAA 4F63A 2EWAA 4XBUA 1ZZ2A 4Y5QA 3VN9A 4BIEA 4DT9A 4ANSA 1V1KA 3MTLA 5FDXA 3RMFA 5A6OA 4DHJA 1KV2A 2IVUA 3E92A 3OWLA 1H07A 4L7SA 5IMEA 5KMKA 5KUPA 3JY0A 2YCSA 1WCCA 4QOXA 3HMPA 4FGBA 2OKRA 4O7SA 4EUUA 2R3IA 4K77A 3QU0A 3QKKA 4R1YA 1O6LA 3BHVA 3LMHA 3RPVA 1V0BA 3QTXA 2I0VA 2WU7A 3DB6A 1XH8A 3VJOA 4CTCA 4EH8A 3R2BA 3FI2A 3SHEA 4RVKA 2WMWA 2YCRA 5CI7A 5A4EA 2X6EA 1H1SA 2OJ9A 3ORTA 3OT3A 2A19B 4U97A 3CXWA 4FEVA 2JKMA 2UW8A 2WMVA 5EM8A 5C4KA 4BCPA 4CMOA 2BKZA 4S30A 4MQ1A 1M2PA 1R78A 2BROA 4G2FA 4PPCA 3CJFA 3FYJX 3RZBA 3JXWA 1H4LA 5E9EA 2NO3A 4LMNA 3ZDIA 3W2RA 4MK0A 5C9CA 3ZMMA 2VNYA 3VC4A 4X2KA 3T8OA 4IEBA 2C6EA 5A14A 4O86A 4OW8A 3QWJA 2E9OA 2Z7RA 4IWQA 5GJFA 3EN7A 1SNXA 4O0VA 4V05A 4IWDA 3BLAA 3EKKA 4FTIA 3ZOSA 2C5OA 4FF8A 3E8CA 3TTJA 3UZTA 3HKOA 2PVMA 4RJ3A 2XEZA 4BGHA 4FTAA 4BY9E 3D15A 2A4LA 3QTQA 1YI4A 2C47A 3HA6A 5CSHA 3FY2A 5KBRA 2VX3A 3E63A 3QHRA 3L8SA 3ZUVA 3TCPA 5E92A 3EQCA 3RINA 5A6NA 4HYHA 4NCTC 4A07A 4I6FA 2X1NA 2OICA 3FMNA 4MF0A 4GMYA 2GNHA 3HDNA 3K3IA 1S9IA 4FTTA 3ZLWA 4PP7A 2W9ZB 3W8QA 4F6WA 4W8EA 3ZC6A 3ZLYA 3AMBA 4DE4A 1P2AA 3PRIA 3ZCLA 5AV2A 3K5VA 5C01A 3IW6A 2P0CA 4MCVA 5CF6A 3HECA 2FUMA 4IM2A 4ANOA 4FZ6A 2XVDA 1XH9A 4DEIA 4AU8A 4II5A 5DG5A 4D5KA 4FA2A 3MGYA 3RAIA 1ZAOA 1Y8GA 2XKDA 3W2CA 4DBNA 5GNKA 3I6WA 3PTGA 2SRCA 4FVPA 4GG7A 5JRSA 2J6MA 2WOUA 4AN3A 2BRMA 3LXNA 3MH2A 4IAAA 4JVGA 4U45A 1YVJA 3DS6A 2XYNA 3QYWA 3WIKA 3B8QA 3QKMA 4FV1A 5K0KA 4EHGA 3HMOA 4BIBA 4AQKA 4ZZMA 5IEYA 4IHPA 1URWA 2X0QA 2XB7A 2W1EA 1OIUA 5DEYA 4ZY6A 4D4VA 4BDFA 2EB2A 3PRFA 4ERKA 5KNJA 3ELJA 4K2RA 4LRMA 4BDKA 3TUBA 3MPTA 3QRTA 2OZAB 2WTVA 2HWOA 4U7ZA 5CS6A 5H3QA 3RP9A 3ZFYA 3F9NA 5F20A 2R3HA 4UMPA 4QMUA 2QVSE 3PJCA 4G3FA 1FBNA 3LJ0A 4RJ4A 3VS2A 4P2KA 3JUHA 3ZRKA 4RIWA 4QTCA 4RZWA 4BTMA 3F2NA 5CQUA 5BNJA 4K0YA 2YDKA 2ERKA 2JBOA 3V6RA 4DDGA 5KO1A 5LCJA 5L8LA 3LM5A 4FKSA 3VF8A 1XBAA 3BLQA 4KS8A 3C4ZA 4LV5A 5AIRA 3Q60A 5I9YA 3DXPA 4YLKA 4AP7A 5FBNC 3E3PA 4FT3A 3BKBA 2XM8A 5IEVA 4MBLA 3R1SA 3GT8A 3PDTA 3G2FA 2VTNA 2Z8CA 4FL2A 1GNGA 2R3PA 4IACA 3HMNA 3F69A 1XKKA 3LQ3A 3FZ1A 4GU6A 4QMWA 2VNWA 4QMPA 3TG1A 3EYGA 3SD0A 1PYXA 2BMCA 4OBPA 5FEEA 2JITA 1YKRA 2FVDA 4JG6A 2RFDA 3FXWA 4H05A 2JKKA 5CSPA 4BN1A 3AKJA 2Z02A 4EKKA 3BYOA 3OG7A 4DFNA 1ZYLA 3TEIA 2BALA 3R9OA 2OJJA 1ZWSA 5FBOA 5K5NA 2XNMA 5L6OA 3FMEA 3BEGA 3WZDA 4BJJA 5ETFA 3LFEA 2B55A 3DK7A 3TN8A 3R02A 2J90A 1Z5MA 3C4WA 3I5NA 3ZSGA 3R8ZA 5D7VA 4FSTA 3HEGA 3SGCA 4ACHA 3ZZWA 5IA4A 1ZOGA 1UNHA 1OL7A 5KHXA 4FI1A 4HVSA 3GC8A 2WEIA 2Y4PA 3E87A 3F3TA 4BTJA 4FT0A 5HU9A 2JEDA 4Q9ZA 3TDWA 5HO6A 3MA3A 1YXVA 3QX4A 5IG1A 3G0FA 3KU2A 4I24A 4KBKA 3RZFA 3ZZEA 3K5UA 4JRVA 2YM4A 2GFCA 2B0QA 4ZJJA 4BI1A 4BZDA 2YIYA 5D11A 4FJVA 4F64A 4WNMA 2X2KA 3BLRA 4BDHA 2Q0NA 4FIEA 4QYEA 4OTHA 2ESMA 2BHEA 4XNEA 3EKNA 2YIWA 4RJ8A 2V55A 3F66A 1P5EA 3G90X 1JKLA 5LMKC 2XKEA 3K2LA 3NUPA 3SAYA 1G3NA 1GIJA 3RM7A 3F5UA 4FKPA 4UN0C 4YZMA 4PDYA 4YPDA 5L6PA 2PZPA 3W8LA 5C8KA 1TQPA 4O81A 4FL1A 4CT2A 4FT9A 2PVJA 3U8WA 4QMLA 2QO2A 3UC3A 4M13A 4ZTLA 4R77A 1XMLA 3EFLA 4LV7A 1WBNA 2WQEA 3L8VA 4ZSEA 4C2WA 5LOHA 2VWZA 2VWBA 4LOQA 4U81A 1OL5A 4YURA 4FOBA 3NLBA 5H9BA 4DEDA 1U4DA 3O7LD 4FTMA 4EH3A 2X2LA 5LCKA 3SOAA 3GU6A 3EOCA 4J53A 3QBNA 2OJGA 3VW6A 3VONA 4M0ZA 3GVUA 4J7BA 4HYIA 5DE2A 4EQMA 4F99A 3KF7A 2JIVA 3LCSA 4QMNA 5K0XA 5T68A 3SX9A 2HZ0A 3PZEA 4DDIA 4X2FA 4KBCA 2A98A 2HWPA 3OD6X 4IX3A 2JBPA 3ZBFA 1IASA 3ITZA 4L42A 5HNBA 3FLYA 1K2PA 3R01A 4TY1A 5HLNA 3ENHA 4AOIA 3UOKA 5IEXA 5HGIA 4L68A 3TKHA 4BCMA 3TDVA 4JAJA 3BV3A 3UO4A 3QRIA 1Y6AA 4GIIA 2B9HA 3DLZA 4AT4A 5FM2A 3DXQA 4AGDA 3RKBA 4KSQA 5AAEA 1E1VA 3LFDA 1FGKA 3LXKA 4FRFA 4ANMA 4AZVA 2IZSA 3VS3A 3PJ8A 4WRSA 4WRGA 4EK4A 1OKZA 4EBWA 1OITA 2JDRA 3QTUA 4ZOGA 3NUUA 2A2AA 4L67A 5HCXA 4M66A 5LVLA 3ZSIA 4BWKA 5LJJA 2VWVA 4FV9A 3ZO4A 2E2BA 3R8LA 4Y95A 2H96A 2CCIA 3O8PA 4YJOA 4C34A 4K8AA 4O83A 5DN3A 4DBXA 3RNIA 3UO6A 4PTGA 3C0IA 4V0GA 2ITVA 5HBEA 4F9CA 2UZBA 4MD8E 2BTSA 1OVEA 3QCXA 1Q8TA 4ORKA 5HX6A 4DH3A 3CJGA 2R0IA 3PVWA 5FM3A 5L8JA 3TZ9A 4EL9A 5KMJA 3GB2A 2CKOA 1U46A 2ZB1A 3AQVA 3I7BA 3MDYA 4JAIA 2ZFYA 4X3JA 4FSQA 5HTBA 4CEGA 5LARA 1Z9XA 4K33A 4EOJA 1KOBA 3AT3A 3AT2A 5JT2A 5LQFA 2GS2A 4GIHA 4YJTA 2EUFB 2GHMA 4A9UA 2CN8A 3DGKA 3GP0A 4CFXA 5KMOA 4FGRA 4DCAA 3TJDA 3OBGA 4KRDA 3TIZA 2O8YA 4NH1A 2WELA 5EDQA 4ASEA 4BDBA 3U6JA 4CD0A 4EQUA 3IONA 3ZLXA 4DGLC 3VBVA 4RG0A 4FNXA 5TR6A 3RTPA 3CY2A 1ZYSA 3VQHA 2Z7LA 4UALA 5IPJA 4QMSA 2JGZA 2W1IA 2Z7SA 3NYOA 5A9UA 1LUFA 2F7EE 4C7TA 4EWQA 5AAFA 4ANLA 4NT4A 5HI2A 3KL8A 1OUKA 4FSNA 4QT1A 4FNYA 2RFNA 3QTRA 1SVEA 3AC2A 4DYMA 3Q9YA 4M97A 3EQHA 3GU7A 4K6ZA 1WVXA 1ZOEA 3HAMA 1H0WA 4FVQA 4HCUA 1PXKA 4WOVA 2HENA 3QTSA 4RA4A 3KK9A 1OPLA 2OH4A 3WZJA 4PNIA 1P14A 4AX8A 1Y91A 1Q62A 3H9FA 2CKEA 4YC8A 4D4RA 2B54A 3IKAA 4CGAA 3NX8A 3LLTA 3CS9A 3Q5IA 3UOJA 2VTHA 4UMUA 2I0YA 1BL7A 2QONA 3BU5A 4G34A 2QHNA 2WGJA 1MRYA 2GNFA 3DK3A 4PMTA 4ASDA 1TFFA 4FKRA 5CEIA 2XIYA 4AW2A 4NJ3A 2BAKA 3VS4A 4BDJA 3OY3A 2B52A 3HV7A 2EVAA 2ZV8A 5IA0A 3BWJA 4EOOA 3FI3A 3HMMA 5IZFA 2IO6A 2OJFE 4BDCA 4XG7A 2PMNX 4TYHA 3ORZA 3RBWA 4DF3A 3D14A 1Q61A 5TE0A 3EMGA 5TF9A 5I9WA 5J9ZA 3Q53A 4DG0E 4TNDA 4ACCA 4RIXB 2BILB 3ZXTA 3KN5A 3KRLA 3PP0A 3ZBXA 5DFPA 1HOWA 3UIBA 4O0UA 3NGAA 1OBDA 2JFLA 4IDTA 4FKIA 5T3QA 4RMZA 4XLIA 3FAAA 5AUYA 5IU2A 2VTPA 2W7XA 2F57A 4TYIA 2B1PA 3R9DA 5H2UA 2YFXA 4RWIA 4YJRA 3A2CA 4MTAA 4XBRA 4ZLZA 3U4WA 1DI8A 4EOMA 4A7CA 3NUAA 2CKQA 3C50A 5AAGA 4IB5A 2VGPA 3UIUA 4C38A 3FHRA 3DV3A 3SXFA 4GK4A 2OG8A 3S95A 5BVEA 4AZFA 4ZSAA 4AG8A 2IEWA 4ZS4A 3ZHPC 4UWBA 3H3CA 1ZARA 3D4QA 5A4TA 2PYWA 4FV3A 1XO2B 2VTTA 2WMUA 1U54B 2VTLA 2C5VA 3L1SA 1XQZA 4I5MA 4EK3A 4U0IA 5A4LA 4QP4A 4BKZA 3W0PA 4DHZA 2FYSA 4C35A 3W0OA 2AYPA 4AFJA 2JDVA 4W9WA 3CGOA 2JLDA 2R9SA 2OH0E 3QD2B 4CLJA 1SVGA 4IVCA 2OXYA 4WSYA 2CLQA 4GYGA 2OK1A 5AADA 5CU3A 4LOPA 4ANQA 2UW0A 1KUTA 3QLGA 4HVHA 2ZMCA 3MVHA 4CV9A 2X4ZA 4BI2A 4G9RA 2Y4IB 5M06A 5KZIA 4U8ZA 3P08A 2CNVA 3VBXA 1WBPA 4AW5A 4U80A 5CANA 5M09A 5E8YA 4F78A 2UW9A 2IW8A 4M12A 5M56A 3UQCA 5ACKA 5I4NA 5E90A 5HLWA 4V04A 5F4NA 4D1SA 4FTQA 4ZIMA 1VLRA 3HV6A 4XRLA 2F7XE 4YU2A 4X3FC 4EJ7A 5T6KA 1PKGA 5DMZA 4FEXA 3KRXA 4NEUA 4UMRA 2XIXA 3RPOA 3QF9A 4PUZA 2V0DA 4N6ZA 1PKDA 1B38A 5AP6A 3UPXA 4Z3VA 1T46A 3R6XA 2I0EA 3GQLA 5TKDA 2PE0A 4WT6A 5DT4A 5H8EA 5J87A 3UTOA 1JVPP 3TM0A 5KKRC 5DVRA 5AUWA 2C6TA 2QR7A 3NUXA 4YO6A 2RKUA 2WTJA 4OT5A 2J50A 2VGOA 1W82A 3E8EA 3WILA 4EH9A 4W4WA 3W2QA 1J1CA 5C8MA 1Y8YA 2BCJA 2RGPA 3AC1A 3PZHA 4GK3A 4I4EA 4M0YA 3JY9A 4EZ7A 1IA8A 4RWKA 1BYGA 2RL5A 2YJRA 4E3CA 3D2KA 3NNXA 3W2PA 4AGUA 3A7GA 3H0ZA 4HGLA 2XK8A 4HOKA 5AIKA 2ETMA 2P3GX 2QR8A 2FSMX 2BZKB 2E9UA 3CTHA 3GI3A 5AWMA 4IVDA 4ANNA 4FKOA 5IISA 4IC8A 4WUNA 2YN8A 4ZTNA 5M08A 4DHIB 4GT5A 5CYIA 4EYMA 5FEDA 4B9DA 3BBTB 4XCUA 4FTOA 4GK2A 4I94A 2J0MB 4NZWB 4LRKA 1P4OA 4RJ5A 4BCKA 4CZUA 3FPMA 3EN5A 3Q32A 2UVYA 3TWJA 5BX0A 5J5SA 3UQFA 4CG9A 4RA5A 3HLLA 3PG1A 4L7FA 2XM9A 3VRYA 1SZMA 3LFBA 4IZAA 5FP5A 2W5HA 4L9IA 4C36A 4JXFA 3R7IA 3OOMA 1ZMWA 3TYKA 4ZS0A 2BR1A 5HIBA 3S00A 5FG8A 5I9ZA 4GFOA 4BGGA 3OY1A 4S2ZA 3HV5A 1W83A 5HVJA 1GAGA 3O0GA 3P4KA 2QI8A 3A7HA 2GQRA 1H1QA 3FSFA 5CU6A 2GNLA 5DT3A 5HE1A 2W06A 4C57A 4H1MA 4EQCA 4XV1A 3WF6A 3MPAA 2UZVA 5FP6A 3C51A 4G3DA 4E6CA 4AA5A 5EQPA 4GT4A 3OXTA 3KCFA 3NAXA 3UG2A 3JVSA 3U6HA 4QTEA 4L3LA 3MH0A 3EQBA 3OUNB 4KIOA 3O7LB 4BKJA 3I0OA 2QQ7A 3PXZA 4I92A 4CQEA 4CRSA 1PMEA 4QO9A 2CNUA 4ZZNA 2VTQA 1H25A 4GEOA 3W18A 4IAZA 5E7RA 4H58A 3Q96A 4WD5A 3P9JA 2C0OA 5CEMA 4AF3A 4G3GA 5EYCA 4GV1A 3PA4A 5C26A 4DCEA 2J9MA 4DTKA 2XNGA 4FZ7A 1UU9A 3Q04A 4Q2AA 4XG3A 3UZPA 4EC9A 4ZAUA 2Y7JA 2OWBA 3N9XA 3LW0A 2IZUA 3NDMA 2WMXA 4U44A 3EYHA 3GCPA 1R1WA 2VTRA 2VO6A 5KZ0A 3HV4A 1WBOA 3DT1A 5HZNA 3PXKA 4BTKA 1YOLA 3BHTA 3OCBA 3W0RA 1M17A 4C3PA 1OKVA 4HGSA 4EH4A 5L3AA 1LEWA 1W98A 2GNGA 3BYMA 3NRMA 4R7BA 4LQMA 4O4DA 4RVLA 3LJ1A 3NYNA 4B8LA 4EH2A 4GVAA 5CENA 4NKSA 3VHKA 4F6SA 5IH6A 4BRXA 4CG8A 4ID7A 3AG9A 2GDOA 3RGFA 5HU3A 3OVVA 4HZSA 3W2OA 5EG3A 4PY1A 4NIFA 4YTCA 3UZRA 2OZOA 3QC9A 3BL9A 4EBVA 3UP7A 3WE8A 5EKNA 4LM5A 1PXNA 5I9XA 1REJA 2UW3A 2YWVA 2YAKA 4GUEA 4ZJVA 3NW7A 3IG7A 1KE5A 3QQHA 3R28A 3ZC5A 3DCVA 3I0QA 1H8FA 4PTCA 4YHFA 3PVBA 2IG7A 5GINE 1MQ4A 3ULIA 2BDFA 3BLHA 3E64A 3ORIA 4TWNA 2PVYA 5AR5A 4QMQA 1WFCA 1W8CA 2WZJA 2PUPA 2XS0A 2J5FA 3PSDA 2C69A 3GGFA 3CBLA 4PPBA 5EM6A 3D5WA 5CX9A 3WYXA 4E93A 3VUTA 3PA3A 4P90A 1M2RA 4RQVA 4R5SA 5HE0A 5H8GA 4F9YA 5HTIA 3BU6A 5AR4A 1OGYA 4OAVB 3W32A 4O27B 4WG4A 4O84A 3DDPA 3KVWA 2J0LA 2J5EA 2ONLC 3OHTA 4G6LA 4KKEA 2RFEA 4DFYA 1OZ1A 4F09A 3V8TA 2LGCA 2IVTA 2W99B 3CQWA 4D2WA 2RFSA 4BIDA 3UODA 2FSOX 4LUDA 3VAPA 2C5NA 3PWDA 5DBXA 2OLCA 2JDTA 4GJ3A 4L43A 3Q4CA 4EOKA 2R2PA 2PVHA 3NYXA 1OKWA 4IANA 4XG6A 4QNYA 4FTUA 2AC3A 2FSTX 3FZRA 5HNIX 3UOLA 4YBJA 4ZXTA 4QMYA 1RJBA 2IW6A 3C4EA 4D4SA 3NSZA 4JX3A 2XYUA 3KMMA 3DQXA 4F0IA 4L00A 4H3QA 3AGLA 3LFNA 1H28A 4J1RA 4M84A 3VS1A 4F4PA 3SV0A 2DWBA 3O51A 3W2SA 3TACA 2X0GA 4YTFA 3CQUA 3TNPC 3KREA 3OF0A 4KKHA 3P5KA 3OTVA 3TV4A 3QL8A 3C13A 2W9FB 3PUPA 3DAJA 4RLLA 5ANIA 2PWLA 1YI6A 3RCDA 3ACJA 3DFCB 4MYGA 4P5ZA 2WQMA 5L4QA 4QP6A 5ETAA 2ITYA 3LKMA 4ZSLA 4TW9A 2A0CX 3ANQA 3FI4A 3TNIA 1IEPA 3PJ3A 3KVXA 4OTQA 4Z7HA 3FLSA 3DAKA 4X21A 4FSRA 3RAWA 5A46A 3FI8A 4QTAA 2VRXA 5CXHA 2AQXA 4IB1A 4LV8A 5AV0A 5JGBA 3IDBA 5IUHA 5IQCA 4MXZA 4D1ZA 4CTBA 3NZ0A 5J79A 3G33A 2C3LA 4C8BA 5KCVA 4NM5A 4DH1A 3UO5A 5M44A 4K18A 4O7LA 1H0VA 1M14A 2UZOA 4PL3A 1M7QA 4QQJA 5DPVA 5C27A 4EH5A 4FEUA 5CTPA 1FQ1B 3C7QA 1WVWA 3NW6A 4PDSA 4YGAA 4DFXE 1WBSA 2QOHA 4OGRA 2I0HA 1AD5A 5C4LA 3M11A 2QC6A 1VEBA 5C03A 1NVQA 2OXDA 3GCUA 3ORLA 1YXXA 3QWKA 2R3GA 3CSVA 2BPMA 4BFMA 1PY5A 5EOLA 3FLZA 2YIRA 3OC1A