2DYLA

Crystal structure of human mitogen-activated protein kinase kinase 7 activated mutant (s287d, t291d)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
300
structure length
272
Chain Sequence
TGYLTIGGQRYQAEINDLENLGEMQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISCAAYMAPERIDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 7
publication title Crystal structure of human mitogen-activated protein kinase kinase 7 activated mutant (S287D, T291D)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 272
sequence length 300
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2dylA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2dylA01
2E9OA 3R7UA 3DK3A 3GOKA 3L8XA 3BHYA 3V6RA 1OITA 3VJOA 5HX8A 2QOFA 3A4PA 3W2PA 4D0XA 3GC7A 3N4TA 2BIYA 4FVPA 2O64A 4L6QA 4QT1A 2WMTA 3KXGA 1YXUA 4O38A 1FVTA 5FLFA 3OT8A 2CKOA 4J99A 3HGKA 3ULZA 5DH3A 2PE2A 3F88A 1IEPA 4LGHA 2JC6A 3O51A 1WCCA 5EM5A 5KZIA 3ZSHA 5IDNA 2DWBA 3TUBA 3OWLA 2BKZA 4IX4A 5CNNA 4PTCA 4EQCA 2DUVA 1QPEA 4OBOA 4D4VA 1KE9A 3FE3A 3H9OA 3EQDA 4FIFA 2XEYA 4O6LA 4WSYA 2FUMA 2PL0A 4B8MA 4BGGA 4EOIA 3FHRA 4TW9A 4ANNA 3VUTA 5FRIA 3IGGA 4FG9A 2IZTA 2WAJA 5AA8A 5DVRA 2X0GA 4BCNA 3KMMA 3F5PA 3LJ0A 4FOCA 3KB7A 2QD9A 3TNWA 4ZLYA 3QZFA 4EC8A 4QP8A 4IW0A 3D5UA 5ANDA 3PSBA 5IMXA 1PF8A 3CEKA 3GUBA 2QR7A 4UMUA 2WQEA 2XIKA 2WNTA 3UG2A 2R3MA 3DJ6A 3RPYA 1Z9XA 4RC3A 4RQVA 4GEOA 4CQEA 1WBVA 5JN2A 3P23A 4YJUA 1G8AA 1BLXA 1JKKA 1QPDA 3HX4A 4L67A 4UWYA 4AE9A 3QTWA 1MUOA 4RWJA 4XHKB 4XUFA 3EQRA 4MNEA 3WIGA 4DEHA 5AWMA 5HNIX 2ITNA 2QO9A 2ITVA 3NLBA 1JPAA 4GIIA 3W2CA 4L8MA 1UA2A 4FUYA 2KULA 3SGCA 4N6ZA 2VWIA 3L8SA 4TTHB 4H05A 5FP6A 2F49A 4F65A 5AUWA 3DAKA 3HUCA 5I9XA 4WUAA 4QNAA 4QYFA 4B6LA 3JR1A 3V8TA 4O2ZA 5H9BA 4ANSA 5HEZA 5JFSA 4FX3A 2WKMA 1CKPA 2NPQA 2C5XA 5CEIA 2XKFA 3HRFA 4IJ9A 3K5UA 2DS1A 4WNMA 5CU6A 2VX1A 4I4EA 4A07A 3KRJA 1CMKE 4TYHA 4EQUA 5JZJA 4CG8A 4RQKA 3O2MA 4EBWA 3M2WA 2EB2A 3IW4A 4ITHA 4YU2A 5DYJA 3KVWA 4Y73A 3EWHA 4IWPA 3QA0A 5B0XA 5EYMA 3ZCLA 3QALE 4WG4A 2OKRA 3FLYA 3IW7A 1FPUA 4F9AA 5LVNA 3UOJA 5EM7A 2C5OA 3L9LA 2B52A 4FSYA 3TKIA 4PTEA 1ND4A 4OAVB 2CN5A 3KRWA 3CKXA 4PMMA 4PX6A 4EOMA 5LVMA 4CFVA 4GUEA 4ZSAA 5LMKA 4HVGA 4IAIA 4X2JA 4EK3A 1YDSE 5ANOA 3SOCA 3PVUA 4GG5A 1M2QA 3CCNA 5A3XA 3ORPA 3LFSA 4FTQA 2I40A 3QAME 4XLIA 2ZM1A 5E7RA 5EI2A 5DGZA 4W4WA 4C57A 4PY1A 2W4JA 3EB0A 5BUEA 3SD0A 4AW0A 3DV3A 5DWRA 2Q0BA 4BDKA 1YXVA 1V0OA 4P90A 1U59A 4HCVA 5KKRC 3ATSA 4BWXA 2JAMA 2YM7A 4FE2A 3I1AA 3P5KA 4EOOA 4B4LA 1H1PA 2WMWA 2VWVA 3BX5A 4FSMA 4XG2A 5KNJA 3V01A 2ZMCA 3HL7A 4U41A 2B1PA 3M11A 1XBCA 5CVHA 4B8LA 2UW4A 3D2KA 4YTCA 4YZMA 4L9IA 4BICA 2AYPA 2H34A 4O7LA 3EQBA 3I6UA 4ARKA 4DFZE 1J7IA 1YQJA 2I0HA 5EYCA 2VUWA 2C6LA 4QQCA 2O8YA 4C37A 4EC9A 2HZ4A 3EQPA 3OXTA 4ZEGA 3UMWA 3IONA 1P5EA 1UU3A 4KRDA 2A0CX 3F2AA 3FMNA 4UBAA 2J0IA 3FSFA 3KRRA 4CFNA 3PJ1A 4R5YA 3SC1A 3GOPA 4EYJA 4QP3A 5CAPA 4V01A 3C9WA 4BZOA 1ZY4A 3AQVA 4RX5A 4DTAA 1UWJA 5FM3A 2RIOA 3MBLA 4CT2A 3FY2A 4C58A 5HNBA 2WMSA 4J96A 2YM3A 1H8FA 4F6SA 3CKWA 3R1YA 4QMYA 5I9ZA 2Y9QA 3E7OA 4B99A 2XNEA 4BY9E 1Q8UA 1U46A 3KF7A 2JFLA 2JGZA 3HDNA 4JX3A 4F9WA 2ZV8A 2LGCA 4U42A 4A7CA 3RINA 5HGIA 3PXZA 5KHWA 3S00A 3F2RA 2UZBA 3FZ1A 4KBKA 4LFIA 4ALUA 3VUHA 2QG7A 4MVFA 1K9AA 1FQ1B 4IVAA 5I9VA 5E1SA 1PXPA 3KMWA 2W1FA 4FT9A 5CU4A 4IB5A 4BI1A 4XV2A 3H10A 4XS2A 3GU7A 3OCBA 3MV5A 2XM8A 4FKOA 5C1QB 3LZBA 3FV8A 4CGAA 1JKTA 4YZCA 4FV7A 4Q9ZA 4FNYA 3MTFA 2GNJA 3ORKA 3SXFA 3M1SA 3DTWA 3EN5A 4RBLA 2CPKE 2XRWA 3ULIA 5C4LA 3CIKA 4RZWA 2W5AA 3GU4A 3VRYA 1KWPA 3BQCA 4YUQA 4U3ZA 5FTGA 2GQGA 4G16A 4E4XA 3I81A 4FICA 4O7YA 4NIFA 5IZFA 2BCJA 3RP9A 5T68A 1ZMUA 3MVJA 4DT8A 1OKYA 4YHTA 1GZOA 1AGWA 3HMPA 2OZAB 3ACKA 4BWPA 4FTAA 5AUTA 4F70A 3KA0A 4YO6A 3RAKA 2OI4X 5M44A 3DQXA 2FSOX 5GNKA 4Y5QA 4WIHA 2GHLA 4ZJIA 2G01A 1ZYJA 3VBQA 3MVLA 4H3PA 4QPMA 4R3PA 4F08A 3C0GA 3KF4A 3NYVA 4KKEA 2Y6OA 3CSVA 4IVDA 3P7BA 4FKQA 3LCTA 2P2IA 2XNMA 4BHNA 3DXPA 4R77A 3ZXTA 3VF8A 1DAWA 4YJNA 3T9IA 4V0GA 4DYMA 4WSQA 1KOAA 3ZLYA 2YN8A 3WE4A 3E8CA 4JIKA 2OXDA 2QOLA 4CTCA 3NCZA 1PXMA 1AD5A 4QQTA 5ETAA 4CYIA 5ETFA 5C27A 2C5NA 5CI7A 2X9EA 5H8BA 1OIQA 4EH5A 4NCTC 4E8AA 1OBGA 4BCFA 3OHTA 3R1QA 4H3QA 4DH8A 5HNGA 1PHKA 1SMHA 2HCKA 3MIAA 2CJMA 4DBNA 5AP4A 5DPVA 3TT0A 3K2LA 3O8UA 4ACDA 2I0EA 5AAGA 2QOBA 4U5JA 2ZAZA 4TXCA 2I0VA 2V55A 3E87A 4IX6A 5KO1A 4MNFA 3UO5A 3OEFX 5IUIA 4JQEA 2C6KA 4XJ0A 4O7NA 2C68A 4M69B 4IDTA 3JXWA 1H26A 1WZYA 4X21A 5E8XA 5D9HA 4ZTQA 3V04A 4C02A 1NY3A 3HZTA 4EUTA 4QMQA 1IG1A 4HGTA 3EQHA 4CRSA 3TTIA 4G34A 1U54B 5LOHA 4AOIA 2ZDTA 5HLNA 2X6DA 2P4IA 4WT6A 1XH7A 5D10A 2BRNA 4IQ6A 3LJ2A 3AT4A 3FY0A 5EKNA 3R73A 4ZTNA 5TOZA 3V5QA 3ZBXA 4EORA 3MJ1A 4EOPA 4BR3A 3FMEA 4O0VA 3V51A 3QXOA 3R01A 3Q4TA 4BB4A 3R7YA 4D2WA 3R04A 4BZNA 3QQFA 3GU5A 5GZ9A 4L00A 3PRIA 3W2RA 4FT0A 4G3GA 2W1CA 3B2TA 2W1HA 4FL3A 4FTOA 3IW6A 1XBAA 3W32A 4U81A 5EDPA 4WNKA 4R78A 2PULA 3JY0A 1JQHA 4B9DA 2C3JA 2FB8A 2B9HA 4RX8A 4ALWA 5J9LA 2A1AB 3FJQE 3DJ5A 2I7QA 3DK7A 3QU0A 2ITQA 2R4BA 2WTIA 2OK1A 3DBCA 2W9ZB 2ZM4A 1ZYCA 3E88A 3FLZA 4OTRA 2G9XA 2PZ5A 2YAAA 3F3ZA 2UVZA 2YFXA 3JUHA 3R7IA 5ACKA 4ZMFA 2FGIA 2ITUA 2X4ZA 4RA5A 5BMSA 3LFNA 1R0EA 4HZSA 3R8UA 5KBQA 1JWHA 1IA9A 5JKGA 5A54A 2YDJA 3B8QA 3BWJA 4BCIA 3KC3A 4D2VA 3HV6A 3PZEA 1YHSA 4AZTA 3PXYA 3JYAA 4RVMA 5HO8A 1H1WA 2REIA 4CKIA 3IQ7A 5CQUA 5IEYA 4P4CA 3P4KA 3RVGA 1JKLA 5M4UA 2YM8A 4IAKA 3F7ZA 5F9EA 3D5WA 4LG4A 4MD8E 5A6NA 2ZYBA 2HOGA 4L46A 1FGKA 2YIRA 5BVDA 1UV5A 1H07A 4FVQA 4R7HA 3TUDA 5JGAA 4A9TA 3ANQA 1XO2B 1Q8YA 4BCOA 2J5FA 4MXZA 3VVHA 4A9SA 1WBWA 2HYYA 3IO7A 1ZMWA 4GW8A 3UIUA 5DT4A 4UV0A 5BVEA 3NVKI 2R0IA 1P4OA 2JBPA 4EWQA 3E92A 4I22A 5CVGA 3RAWA 2X39A 4WNOA 4IZAA 1V0PA 4ACGA 4O86A 3HRBA 4JI9A 4PRJA 1UU9A 4O0UA 3TV4A 2IW9A 3WBLA 2F7XE 5CT0A 3SKCA 2CGXA 2R9SA 1OB3A 4AACA 3LCOA 2WU6A 3RCJA 4FGBA 4ASDA 4D5HA 3NUNA 4HNIA 5FQDC 4Y95A 2XS0A 4EL9A 4FL1A 2ZJWA 2WMUA 1APME 3JS2A 2W1GA 3P7CA 5DE2A 3QD4A 4TYEA 5M56A 5DOSA 2YCQA 3PP0A 1Y6AA 2UV2A 2VX0A 4IH8A 4DH7A 5CAOA 1M14A 4AZFA 3VC4A 3MS9A 4YJSA 5LMBA 3OW4A 3OXZA 2NRYA 3BU6A 5FDPA 3ZRLA 2WXVA 3ZSIA 4IAZA 3QFVA 4XG8A 5A14A 3DB8A 4FSWA 3LFFA 5D12A 3DKFA 3Q52A 4MYGA 4UWCA 3NSZA 4YTFA 3NW7A 5JH6A 4ONAA 3DXQA 2B9FA 2C6OA 5BYZA 3A60A 4F7SA 5EW9A 3UZPA 3ORIA 4YGAA 5K4JA 3P7AA 4NM7A 3OEZA 3EN4A 5DR9A 3G9NA 3MY1A 4USDA 1M7QA 2BROA 1HCLA 2WPAA 3MVHA 2UW9A 4LOQA 3MW1A 3PYYA 4TNBA 4YC8A 2GU8A 3WZDA 4BCHA 4BCGA 2CLQA 3ZRMA 4L45A 1ZZLA 5C8MA 3V3VA 4AA0A 5IH4A 1L8TA 1YWVA 2XK6A 3HV5A 4G3CA 5HORA 3NYNA 4FTIA 5DNRA 4J97A 3LE6A 4WKQA 3HNGA 3A99A 3IDPA 2ZDUA 3O23A 4AUAA 1YWRA 4ZTRA 5HE2A 2R3LA 3JVSA 5FWKK 5AUYA 5HTBA 5CEKA 4KS8A 4C4HA 5CWZA 1UVRA 5A4QA 3TM0A 4L3PA 4X6QC 4FL2A 5HIBA 3IG7A 3ZUUA 4F63A 5CSWA 5IH5A 1Q41A 4QQ5A 4OTIA 3TUCA 3NNXA 4LL5A 2VTPA 2ONLC 3TNPC 2BRBA 4DN5A 4FKJA 2ESMA 2ERZE 2PZPA 4NM5A 1H0VA 5L8JA 1BMKA 3DAJA 4MD9E 4HVHA 4RVLA 3VO3A 1SVHA 3CJFA 4ZTLA 2YABA 4H1MA 3ZFYA 2ZV9A 1NT2A 2J9MA 3DBFA 4GFMA 3QYWA 4YBKA 2WOTA 4D4RA 4CV8A 5IMEA 1M2PA 4GG7A 3BELA 2C4GA 3OMVA 4XOZA 1H27A 1MRVA 2PWLA 2YLFA 4KABA 5TKDA 4YPSA 4YLJA 4OTWA 5AP0A 4ZTHA 4KUJA 4CTBA 4PV0A 3MDYA 3QQUA 2YDIA 4I41A 5LJJA 5CTPA 5C26A 4BCMA 4QMSA 3COKA 2X2LA 2VTIA 4MWIA 5EI8A 4AN3A 3DGKA 4IB0A 2HXQA 3FMKA 3HMMA 3ZFXA 5M07A 3N9XA 3HAVA 2YM4A 3S1HA 2XK9A 3BYOA 2GNLA 2IG7A 2R7IA 4C3RA 1YI3A 3QTSA 4L3JA 1NXKA 4FSZA 4U40A 2GQSA 5J5TA 5H8GA 4FTJA 3W8QA 2C47A 4BTKA 2JDVA 3C51A 3LXKA 2IN6A 1STCE 4FEQA 2VO3A 5J79A 4R7BA 4TWCA 2GHGA 4E6CA 4S32A 3L8VA 4G2FA 1OPLA 2EXMA 4YJVA 1OVEA 4M8TA 4DG0E 2RKUA 3GEQA 3FYJX 3W2SA 2WEVA 4CYJA 2RSVA 4D0WA 4UEUA 3PIZA 3A7HA 4E93A 1REKA 2W5HA 4FZDB 2OIQA 3AT2A 4GRBA 4RGJA 2P0CA 4KIQA 3R2BA 4PNIA 4AGCA 2O63A 5M55A 3P1AA 1QCFA 3RALA 4DITA 1Q24A 3MH3A 5B2MA 2QR8A 4X3FB 5ANEA 1U5RA 2CKQA 3QBNA 2QODA 4IAFA 2ETKA 3TCPA 3Q4ZA 5BUJA 4KA3A 3KXXA 4NFNA 4OBPA 3VS0A 3C4ZA 4EH9A 5HE3A 3BEGA 4FV6A 3E3PA 3IKAA 3L9NA 4AT3A 4ZIMA 4R6VA 5DA3A 2XNOA 4BCQA 4EOKA 5HBHA 1W98A 4NEUA 4AF3A 3VS7A 3I79A 4DFUA 2WFYA 3TACA 5IQCA 3CS9A 5J5SA 4QYYA 4QP9A 3RNYA 3RZBA 1S9IA 2X8EA 1W82A 3KK9A 3TZ9A 4O1PA 4D4SA 4EH3A 3R0TA 4AX8A 4ZZOA 2ETMA 5HLPA 1JOWB 5DIAA 5IA4A 4ZZMA 5CEPA 2ITXA 3GB2A 2X8IA 5HICA 3ZFMA 3ZOSA 5DR2A 3RPSA 2XYUA 1BL7A 3Q6WA 4G9CA 3CTHA 4Z16A 1URCA 5I3OA 4D2SA 3GCSA 1H0WA 4XNEA 4ZJVA 3R8PA 1P4FA 5E8UA 4G31A 4I20A 4JT3A 3FI3A 5AR8A 4W4YA 4U9AA 3C7QA 3F7WA 1OM1A 3QRUA 4ZSLA 1CSNA 4NW6A 3WARA 5IQAA 2F2CB 2YHVA 2QI8A 3TEIA 4JL9A 4K8AA 2YIXA 2QC6A 4NL0A 1V0BA 5H8EA 5E8SA 3TI1A 2R3KA 4L3LA 3WF9A 4L01A 3TDVA 2OGVA 3QWKA 4MBJA 2R3HA 4BDFA 3PJCA 4OT6A 5DT0A 3NYOA 5C9CA 5IQIA 4LUEA 4BN1A 3PPJA 3OXIA 3V6SA 5JFVA 4O2PA 3VBTA 3SVVA 5EQYA 3KEXA 5GJDA 4CMOA 4X2NA 4UWBA 2BMCA 4Z7GA 4D55A 1PRYA 4XV1A 3BZ3A 4F09A 3R9HA 5KMMA 4G6LA 4HPTE 4M13A 1XBBA 2OXXA 2VWZA 4IAAA 1OL6A 3AMBA 4R3RA 4QPAA 2UZTA 3BHTA 3OFMA 3UOLA 2GS7A 4UYAA 2NO3A 4IEBA 4RMZA 4RX7A 5AV0A 2R3QA 4CZYB 1JSVA 1KV1A 4AA4A 2OZAA 4GKHA 2W06A 3R7GA 2JITA 3Q4UA 4H39A 3HP2A 3IK3A 3MJ2A 3RM7A 4LOPA 4G6OA 4ANMA 4AN2A 4EBVA 3FZOA 3VBYA 2W17A 3MESA 3ZDIA 3QD2B 3KXZA 2H8HA 2F7EE 4RT7A 2BFYA 5TO8A 3ZEPA 1YOMA 2VTAA 4O22A 3AD4A 4QMZA 3VUGA 3JPVA 4C3FA 4CXAA 4ZLZA 4U3YA 2J7TA 3W2OA 3U54A 4O0TA 5E8TA 2BZJA 3AC1A 3LFEA 2CNVA 5AUUA 4JRNA 1O9UA 3GQIA 3ATTA 2B54A 4TL0A 5JRQA 2ZOQA 2BILB 4RPVA 4TY1A 4GT4A 2C0OA 5DHJA 3Q5IA 4ANLA 5IPJA 5E4HA 4IB3A 3LQ3A 3MYGA 3TIYA 4C7TA 4IX3A 4QMUA 5CENA 1YDRE 1LP4A 4AQCA 4FZAB 4IANA 4EOJA 3NS9A 4AAAA 5A4TA 5AR2A 5A4EA 4Z55A 3UTOA 3DFCB 5AR7A 3PIYA 5IA1A 4FOBA 4BFMA 2PUUA 4I92A 4G5PA 2JIVA 2HY81 2OFUA 2YIQA 2XJ0A 3E62A 3VS6A 4AOTA 4FVRA 1VZOA 3C50A 4RJ3A 3RTPA 3BBTB 1LPUA 2CGWA 2G1TA 4JQ8A 4K2RA 2Z7RA 4M69A 3EQCA 4YZBA 4YNOA 3AC8A 4FKVA 3ZBFA 2OJIA 5K0KA 2YERA 1U54A 3IOPA 5DT3A 4XP2A 4S33A 4X2GA 2PMNX 3F69A 5I0BA 4FKSA 4DTKA 3QWJA 3SA0A 5HESA 4G3FA 4IWDA 4GL9A 2R5TA 2VZ6A 3G90X 4OTDA 1G8SA 2OIDA 2XRUA 3F3WA 4FTRA 4L42A 4U97A 4UYNA 2YM6A 2CHLA 3IW5A 3F66A 4RFZA 2VWUA 4U8ZA 5L6WL 5JGDA 3LCDA 1JVPP 5FD2A 4FKIA 4F0FA 1UU8A 4E5BA 2W1ZA 4IE9A 3VAPA 2BAKA 1PXLA 2DQ7X 3C4CA 3FZRA 3BYMA 4LGDA 1R39A 2XKEA 2J0KA 4II5A 2IO6A 4A9UA 4KSPA 3VHKA 5EHOA 4CSVA 4E7WA 4N57A 3TXOA 1NW1A 2VWXA 2ERKA 3UQCA 1PKGA 4QTEA 3VS2A 3ZRKA 1DI9A 3Q6UA 2X7GA 5LMKC 3BGPA 3MH1A 4QYEA 5FTOA 4EWHA 5K5NA 2CKEA 3UVQA 3U87A 3FC2A 4FK6A 2ETRA 4BKJA 3I0QA 4BDJA 3FUPA 3ZZEA 1UKIA 3QKLA 3C0HA 3OBGA 3P78A 3VS1A 3SDJA 3U51A 5DEYA 4QMTA 1Q3WA 4Q5HA 5E91A 3VBWA 4E6AA 3BV3A 4QMVA 2CLXA 3ODZX 4BTJA 4ZTMA 2PVKA 2UVYA 4FUXA 1Y91A 2J51A 1FMKA 3DOGA 3QQJA 5DFPA 1G5SA 2O3PA 2QHNA 2UW7A 2P33A 5AR4A 4XH6A 3WZJA 4DFLA 3QTZA 4NZWB 3TV7A 5J7HA 4FV5A 2Z2WA 5C8KA 3R22A 3FKOA 3JVRA 4NH1A 5GINE 2P55A 2VWWA 1J3HA 4TKSA 4EH7A 2G2IA 3BU3A 3UODA 4U79A 2X4FA 4QQJA 5GJFA 5B7VA 4HYUA 4NFMA 3TNQB 2VAGA 2A27A 3FLQA 4LGGA 4FMQA 2HY0A 5HOAA 3D5XA 2YACA 4OTPA 5A4CA 1WVXA 4G1WA 5HG7A 1FVRA 3FZSA 4EEVA 1FBNA 1P14A 3ZLXA 3AC4A 5EK7A 1QMZA 4BF2A 2PVJA 5HBJA 5C03A 4ZSGA 2X1NA 2YZLA 3KN5A 1BL6A 3ZXZA 5IUGA 3R6XA 4XEYA 3P86A 4FSQA 3PTGA 4Q9SA 4KBCA 3OOMA 4IBMA 1B6CB 4QMWA 5J1VA 3FL5A 3I0OA 4CMUA 1J91A 3IW8A 3OTVA 3FQSA 4L7FA 3WI6A 5BVKA 3HV3A 4IZ5A 3QUPA 3PXRA 1ZYSA 4J71A 3HP5A 3V5LA 4DT9A 4FKRA 2XK8A 5I9UA 4BHZA 3AT3A 5CF5A 1W0XC 1QPCA 2FVDA 4JDJA 5AAFA 4EI4A 5LVPA 4X2KA 4BBEA 3BU5A 5HBEA 2OO8X 4K9YA 3OVVA 2VX3A 4TYIA 4EHVA 4EHGA 3R9DA 2WTKC 5HE1A 5L2SA 5CF8A 4K6ZA 4NU1A 4JBVA 4X7QA 3R1NA 5CALA 3ZLWA 1GIHA 5IF1A 5CASA 3AG9A 3NNVA 2X9FA 2JDTA 3R8VA 1KOBA 2UZUE 3RHKA 2XEZA 3D5VA 4EOQA 5J7BA 2YWVA 3OY1A 5DI1A 4KS7A 3UNJA 3OS3A 1ZZ2A 1LEZA 3EFKA 3NDMA 3OWPA 1XH9A 4FTUA 3DNDA 4LMNA 1ZARA 3BHUA 3FMJA 4QTAA 4IVCA 4LRMA 2VTSA 4UY9A 4XG6A 4ZSJA 4CCUA 5JEBA 5DG5A 3RM6A 4EUUA 2A2AA 2G2FA 2CN8A 1B39A 4LV8A 4O0XA 4D4YA 5GZAA 2UZNA 4BTFA 1R3CA 4I6QA 2HW7A 3ROCA 3BQRA 3OD6X 4A9YA 5CSXA 4A4OA 2C6MA 2WO6A 4OAUC 4YZNA 4O7TA 1Q8WA 3WF5A 2BDJA 3W16A 4AN9A 4BVUA 3GBZA 3FEGA 4FTMA 1Q3DA 4FIJA 5HE0A 5AAEA 2UZWE 3NIZA 4QNYA 5I9WA 3ORZA 3A61A 3KXHA 4F1MA 1CTPE 2XP2A 5JT2A 3MB7A 3ID6C 3EHAA 4AGDA 2WU7A 3UOKA 3PY3A 4YZDA 2BAQA 5AUXA 4YTHA 2W99B 5KBRA 4ITJA 2R3GA 3EN6A 3QUDA 4QO9A 1SNUA 4BCPA 5LXMA 2WMAA 4GMYA 1ZOHA 4D9UA 2HZIA 1OZ1A 4IDVA 5CXZA 4WRGA 3C0IA 5ANKA 5EM6A 1SYKA 3SOAA 2WOUA 4JR3A 4J8MA 2ITOA 2VWBA 3POOA 3UZTA 3PA4A 2UZEA 3DLSA 4GH2A 4ITIA 2RG6A 3FAAA 3NRMA 2VTTA 3AC2A 3A7FA 4MKCA 4TNDA 3U4UA 4EH2A 5FBNC 1JBPE 3CE3A 1I09A 4UZDA 5H2UA 1W8CA 3ORMA 4L43A 1WAKA 3BWFA 3UNZA 3VS4A 4MXOA 4M84A 5AFVA 4FSNA 2C0IA 2BDWA 1JLUE 4FKPA 4PTGA 4A4LA 1Z57A 3I7BA 5ICPA 2ITTA 3QZIA 4O7SA 4BDBA 3DBDA 4RWKA 5JMSA 3ET7A 3G6HA 4XLVA 2IWIA 4CFFA 3QX2A 2UW0A 4J98A 5AMNA 2V7AA 3B2WA 3QKMA 3PDTA 1YVJA 3QD0A 3HEGA 3ZMMA 5AX9A 2W9FB 4EZ3A 5EHLA 3NEWA 3Q60A 2B55A 3EKKA 3BEAA 3PPZA 2FSMX 4O0SA 4L52A 5AR3A 1ZAOA 5HG5A 4AWIA 4C33A 3COHA 1H1QA 3DK6A 2PVYA 1OIUA 3F5XA 4AW1A 3UZRA 3MIYA 1OI9A 3HLLA 5HVJA 5CSPA 1WFCA 5M09A 3QKKA 3CBLA 4EONA 2Q83A 3DBEA 4Q5EA 4QMOA 4K77A 2UW6A 5DR6A 4UMRA 3GT8A 2BALA 3WE8A 3LMIA 4DAWA 2V22A 4X3FA 4BIEA 3E5AA 5CYIA 3QD3A 4EKLA 2C6TA 3S2PA 1OL2A 2P2HA 3E93A 4GYGA 4U0IA 5FBOA 4R8QA 5KZ0A 1BKXA 3AGLA 3OT3A 1M17A 2XIYA 3EFJA 4CKJA 5TT7A 3TWJA 2HW6A 2JDOA 5IA5A 1Z5MA 2BUJA 4RSSA 3W10A 4ZLOA 4FV2A 4BCJA 4RJ7A 4M15A 3U6JA 3CTJA 1VJYA 3BHVA 2GS2A 3ITZA 2WMXA 4IC7A 4L68A 4QRCA 4TWNA 3NWWA 3QRKA 2R3IA 1KE5A 2J0LA 4TZRA 4BKZA 3RNIA 3ZO2A 2R3OA 3QA8A 4JBPA 4AT4A 4GVAA 3D83A 3WZEA 4D5KA 3UPZA 3NZ0A 4D2RA 1ZMVA 4OR5A 3QCQA 1YOJA 1YXSA 4PL3A 5DLSA 4BTMA 2YCRA 4U7ZA 3LJ1A 4PPCA 4X3JA 4EQMA 3DDQA 4MXXA 2O2UA 2BRMA 4AP7A 5HX6A 4S31A 1MQBA 2F9GA 2CKPA 1OL1A 5HG8A 1BI7A 5BVWA 4FV0A 4R7IA 1U4DA 2IZSA 3H0YA 4FTTA 1YI6A 4MQ2A 2BRGA 2QG5A 4O21A 4RIOA 5AJQA 4CEGA 4DC2A 2QCSA 4FGRA 5CLPA 4GFGA 4DG3E 2RGPA 2FSLX 4M0ZA 3AD5A 3G9LX 3BRBA 3Q2JA 2AC3A 5D41A 5E8VA 2C5VA 4QYHA 5AIRA 5IA3A 3KL8A 3KRXA 3M42A 4M14A 4PQNA 4PMPA 4F6WA 2EXCX 1IASA 4M68A 5LVLA 3LAUA 5CEOA 5I3RA 4FEUA 1OKWA 3HKOA 4MWHA 3UVRA 2VGOA 5D7AA 5EYDA 1WVYA 2Z7SA 3K5VA 3EFWA 4JLCA 4YC3A 3QTQA 1OGUA 5BX0A 5JQ8A 3D15A 3C5UA 2WELA 1ZOEA 2IW8A 1URWA 1Q8ZA 3B8RA 3BE2A 3FBVA 2PZRA 3O17A 3LMHA 4G3EA 2BFXA 4I1ZA 4PDYA 5J95A 5E92A 3ZO3A 3ZDUA 3VRZA 3CPBA 2X2KA 4CCBA 3GC0A 2VO0A 3S4QA 4F9BA 3QTUA 1OPJA 1J1BA 5HIDA 3T3UA 3HMIA 4FV4A 3CP9A 2OWBA 1PXNA 4IM0A 4ZS0A 1OBDA 4G3DA 4LM5A 2UZVA 2PHKA 3VIDA 4FG8A 2LAVA 3HAMA 2VTNA 3R2YA 5F20A 1E1VA 4E5AX 3OWJA 3PG3A 3AGMA 3F3VA 3FI4A 4E6DA 2GHMA 3UQGA 2WTDA 3VWAA 2RG5A 3O0GA 3AMYA 4HGLA 3HA8A 4IVBA 2PZIA 5FG8A 3MN3A 2JKQA 1PMVA 2WEIA 4I0TA 5HVKA 1Y6BA 1VYZA 5BYYA 3HVCA 3E63A 1I44A 2OBJA 5AUZA 4BIDA 3KXNA 3WOWA 5M06A 1M2RA 2AC5A 3TN8A 4DEAA 4HVIA 4RIYB 3HMNA 1ZYLA 4BL1A 4FKUA 3O8PA 2OXYA 4JNWA 1M52A 4KWPA 5KHXA 3I5ZA 2BKKA 4DCAA 5IQEA 2B4SB 4I5CA 3FXWA 4I5PA 4FTLA 3U9NA 2ZVAA 3G15A 1LEWA 3UMXA 3MFSA 3QCSA 1GOLA 3LQ5A 2BZHB 4D1XA 3BBWA 1DI8A 3CQWA 3G0EA 3G33A 1K2PA 4W9WA 4O7ZA 1PMUA 2ZB1A 4I6FA 2XM9A 4ID7A 4I0SA 2Y7JA 4FKLA 4W4VA 3UP2A 2XIXA 3L9PA 2C1BA 4LYNA 3OTUA 3KREA 4MXAA 4HOKA 3RMFA 3ZM4A 2XNBA 3I60A 3DLZA 3FZPA 3QQLA 4RVKA 3TZ7A 4DGMA 1Y8YA 4WBBB 3VBXA 4RJ6A 1M7NA 2CGUA 4G6NA 4PPAA 4UMTA 4WBOA 5EHYA 5E9EA 2E9PA 3DT1A 4QP7A 3CGOA 3RK5A 5CY3A 3C4EA 4QMNA 4E20A 2BVAA 4GV1A 3UC4A 3DTCA 3F2NA 2J5EA 4Y5HA 3SXSA 3VN9A 5A4LA 2VTMA 3PA5A 1BI8A 1XWSA 4O0YA 4U6RA 2J0MB 4H3BA 3UIBA 4C2WA 4KKGA 3C5IA 3N4VA 2QKWB 2JIIA 3ZO4A 4ALVA 1RDQE 3D14A 4FIHA 4MCVA 3O50A 5LARA 3K54A 3Q5ZA 3SW4A 5L8KA 4RLLA 3ORTA 4YLKA 4JAJA 3MA3A 4I5MA 4J52A 5E8ZA 3FKLA 4F1OA 5IA2A 4USFA 1K3AA 1ZWSA 2A4LA 4BBFA 3LFAA 3SW7A 3QXPA 3LIJA 3CD3A 4BWKA 2XBAA 4NWMA 3PE1A 3E64A 4P2KA 5F4NA 4IHPA 4I6HA 3TV6A 5FTQA 2EUFB 3BLQA 2XIRA 2R3PA 2WQMA 4N70A 3RWQA 4IADA 2WIHA 3EKNA 3FLNC 2YAKA 2B7AA 2ZV2A 2OJ9A 4RZVA 5BUIA 1W7HA 4Z3VA 2QLQA 4YHFA 2EVAA 3I7CA 3D7TB 2OZOA 5I5ZA 3U8WA 2CCHA 3O7LB 3R28A 2Z02A 4FODA 3H9RA 4YJPA 4DBXA 4GU6A 4QTBA 1RE8A 3IDBA 3RBWA 5CVFA 5K5XA 1H4LA 1VR2A 3QTRA 3EQFA 4KIPA 1RW8A 4MBLA 5DN3A 3CPCA 5E8WA 5L8LA 2BHHA 2BTSA 2XBJA 4W8DA 5AP6A 4KIKB 4O84A 5BQ0A 4CT1A 5EDQA 3CD8A 1GZKA 4U80A 4JX7A 2QOKA 4AOJA 3MY5A 4IFGA 5KCVA 2BHEA 1T46A 1ZLTA 3RGFA 2WMVA 3ORLA 4HYIA 3RCDA 4C35A 4O6EA 1XH8A 3O8TA 4LRKA 5AV2A 3WF6A 1F0QA 5KMLA 2IVSA 3QUEA 4OLIA 5HI2A 4MEDA 3ZEWA 1E1XA 4XYFA 3QGWA 4XCUA 5EDRA 2C3KA 3BV2A 3KK8A 4J8NA 5IKWA 1SVGA 3ZH8A 2PVNA 4O83A 4O7WA 4ZY5A 3PLAE 1KE8A 4RRVA 1R78A 2XNNA 1MQ4A 4O1OA 4W9XA 1ZRZA 3GNIB 3PJ3A 3D94A 5M4CA 2GCDA 5FEQA 4F7NA 5EM8A 2GMXA 3W18A 3ZZWA 2UUEA 3UNKA 4DFBA 4F4PA 3FDNA 1J7LA 4PP9A 3LOKA 4FKGA 4YMJA 5HO6A 4HYHA 4QMXA 4DEEA 4EHEA 2HIWA 4ZTSA 1JSUA 3ERKA 2C6IA 4DH3A 2FH9A 3LW0A 2XCKA 4NJ3A 4QP4A 2H96A 5AP1A 3SV0A 3ALNA 3WF7A 5LQFA 2X8DA 3VW8A 3RAHA 3H30A 2RL5A 3NR9A 4MHAA 4UB7A 3ZYAA 3F5UA 4FT5A 2WMQA 4ZSEA 4AG8A 3A4OX 4B7TA 3LCSA 4FKWA 2JBOA 2BZIB 2HAKA 3MSSA 3OUNB 4FV9A 2OW3A 4QTCA 4AFJA 5HO7A 3LFCA 3LLAA 2C0TA 3E8NA 3LQ8A 4USEA 5CAUA 5KMOA 1F5QA 3BKBA 4FYOA 4QP2A 2XCHA 4FSRA 4RG0A 3OP5A 4GCJA 4EYMA 4TYJA 2XKCA 4TWOA 2B53A 2IZRA 5AX3A 4UX9A 4OTGA 3OCSA 2XNGA 3L9MA 1XH6A 4JIAA 4M3QA 3UE4A 2BIKB 1V1KA 4C4GA 4X0MA 4APCA 3NCGA 4A9RA 1O6YA 3CJGA 3Q4CA 3ZTXA 4W4XA 2E9UA 2H9VA 3SG8A 3VBVA 4AZEA 1CDKA 4ACHA 2C30A 3PUPA 3LVPA 3GCPA 2JLDA 4MBIA 4YLLA 3OF0A 2O0UA 3Q9WA 2W1DA 4YO4A 1QL6A 2V62A 2OU7A 4KRCA 5L2TA 3FXZA 3BYVA 4NM3A 1YW2A 3KGAA 2F7ZE 2W0JA 4I21A 4J53A 5JQ5A 4FZFB 1H28A 3FLSA 5TE0A 4Z9LA 3SX9A 4U45A 4P5QA 4ZMEA 5LWNA 3EIDA 4AZVA 1WBOA 4F9YA 4DLJA 4G5JA 2I1MA 5CAQA 2EWAA 2QOCA 5I4NA 2GTMA 3PZHA 5ANGA 3V5TA 2YM5A 3UG1A 5IG1A 2W1EA 3F3TA 5LMAA 4GJ2A 3RPOA 2XIZA 2PUNA 3V5JA 4FNXA 1Y8GA 4LRJA 5CU3A 5CF6A 3CLYA 2GPHA 3ENMA 4NW5A 3FC1X 1H01A 3R63A 3MFUA 3PLSA 4KAOA 4BYIA 1S9JA 4DGGA 4DH1A 3TZMA 4Z7HA 2GDOA 4N4SA 4OT5A 1XH5A 2Y8OA 3R9NA 2XZSA 4EZ7A 4FTNA 4F99A 3QCXA 3UC3A 3KMUA 5GZ8A 3FI8A 1A48A 4FZ7A 2ZB0A 4FTCA 3OZ6A 5J9YA 3MA6A 5LCKA 2J2IB 4RJ8A 5CZHA 3N4UA 3NUSA 4Y8DA 2WMBA 5AR5A 3PG1A 3K3JA 3HMOA 1ZYDA 2YWPA 4AZWA 3BLRA 2QONA 2WZJA 5ETIA 2XA4A 3F5GA 3OY3A 3GFEA 3QZGA 3LLTA 3W33A 4K11A 5H3QA 4A06A 2R3NA 1OPKA 1PXKA 4KBAA 5HVYA 1Q4LA 1Q5KA 1TQPA 3QF9A 3EYHA 4E3CA 3MPTA 5GIOE 5JZNA 2IVUA 4NTSA 5CZIA 2WTJA 4JG6A 1B38A 4NUSA 4PDOA 4QP1A 4PP7A 1OECA 1FINA 5M4FA 3PSCA 1H1SA 2AUHA 4DFXE 3SG9A 1TKIA 3LM0A 1XR1A 3ETAA 5F95A 2V0DA 3KN6A 1OKVA 1FOTA 1G3NA 1WBNA 5M53A 3GC8A 3AD6A 1XHAA 1O6KA 4LQMA 2IW6A 3KRLA 4I23A 4OUCA 5HU3A 1PXOA 2J0JA 3NUUA 4BDCA 1DAYA 3TNIA 5EQEA 4I24A 3NAYA 2XNPA 4FT3A 3A8WA 4PPBA 1FVVA 3UIMA 3FPQA 1OIYA 2WTCA 1WBSA 3UYTA 2CNQA 5A9UA 4ANBA 3R8ZA 2JDRA 1GZ8A 2XB7A 3NX8A 4AU8A 5K9IA 3MB6A 2YLEA 4IB1A 4EJNA 3S0OA 4LV5A 4PUZA 3BHHA 3RHXA 3P79A 4IM3A 4QP6A 3AC3A 5J9ZA 3C13A 1UNHA 3EZRA 3EL7A 3FMLA 2KTYA 1PXJA 2J4ZA 2XK7A 4AGUA 4ZZNA 2PU8A 3Q04A 4FA2A 3DY7A 4HPUE 3MWUA 3QHWA 3P08A 3DDPA 3NUAA 3NIEA 3QQHA 3LHJA 1YRPA 3KY2A 1WMKA 3MPMA 5CF4A 4G9RA 4Q2AA 1OUYA 3BYSA 5CAVA 2YCSA 2JKOA 4XG3A 5L6OA 4YSMA 1Q97A 4XRJA 5AV4A 2PUIA 4XG9A 4FC0A 4C8BA 2UW5A 5TR6A 4LMUA 1HOWA 1JNKA 1PW2A 2OJJA 2W5BA 3GFWA 1W84A 2XYNA 3P9JA 4LUDA 3TTJA 4APPA 4CZUA 2CDZA 4EHZA 3PP1A 5CT7A 4ANQA 3F9NA 5KMNA 2JFMA 4DE4A 5EOBA 4BI2A 3GENA 1P2AA 3E7VA 3I6WA 2BRHA 1E9HA 5M57A 5KMKA 3VUMA 5AM6A 4CFMA 3RK9A 3TZ8A 2CMWA 3ZC6A 4FI1A 3EQIA 2PMLX 2O5KA 2Z8CA 2UW8A 3CR0A 4ENYA 5BNJA 3NW6A 4X2FA 4M0YA 3SLSA 4GIHA 5JSMA 3EOCA 4JOAA 3IOKA 4ACMA 3BYUA 5K4IA 2GNHA 3NNWA 5C8NA 4J95A 3SHEA 4DEGA 4KKHA 2VTQA 3AXWA 4S2ZA 3P0MA 4BI0A 4OBQA 3ZO1A 3PWYA 4E4LA 4FEXA 5FDXA 4RIXB 4EH8A 5A46A 3TDWA 2QOOA 4GKIA 4M12A 3LM5A 2QKRA 3N51A 3O71A 3R8LA 5CNOA 4FKTA 4DCEA 3DB6A 4QMLA 5L3AA 3A2CA 2JEDA 3QQGA 5GHVA 4FIGA 3DKCA 4MQ1A 5CI6A 3HDMA 4XG7A 5FM2A 4UXLA 2UZLA 5FEEA 5J87A 3A7JA 2PUPA 2J50A 2Y6MA 3UBDA 5KUPA 4GVJA 5L4QA 5F94A 2PMOX 2C3LA 3T9TA 4R5SA 4BBMA 2X81A 4JAIA 4HVSA 5FGKA 3SXRA 1Q8TA 5EI6A 4JXFA 4JBOA 1UNLA 5DMZA 3F6XA 5D1JA 4CFUA 4O81A 2BPMA 4NYEA 4RIWB 2VTJA 4WHZA 4M67A 5IUHA 1A06A 3PPKA 2GNFA 1BYGA 1DS5A 3GU8A 2YEXA 4JBQA 4PL5A 4S34A 4ZY4A 5BPYA 2BAJA 4RIYA 1ZXEA 5HD4A 4C36A 1SZMA 3NMUF 3DKOA 4TN6A 4GSBA 4GYIA 4ZXTA 4HVDA 3EFLA 4EK6A 4H58A 3UJGA 1T45A 3V8WA 4BDAA 3QTIA 1FMOE 4UZHA 4ASXA 4AXAA 4JRVA 2W4KA 1DM2A 4MX9A 2YITA 4Y85A 3R7OA 4IACA 3QRIA 4JG7A 2VTRA 4RX9A 4P7EA 5HQ0A 2HK5A 1YDTE 2UW3A 2QURA 3U6HA 1JSTA 1IAHA 4AZSA 3ZLSA 1RQQA 3PY0A 3D4QA 5HHWA 4MXCA 1JAMA 1Y57A 2JAVA 3TKUA 3WZKA 4FEWA 2WQNA 4CV9A 1PJKA 4JDIA 2W4OA 5JGBA 3REPA 5HTCA 2YDKA 3DU8A 4JDKA 4EZ5A 1YWNA 2VD5A 3E8EA 2YA9A 2J90A 4JR7A 1PYXA 2HZ0A 3C1XA 3W55A 4CG9A 4E4MA 3A8XA 4FV3A 3T3VA 4DINA 3II5A 3I4BA 3MPAA 4TRLA 4DGLC 3LXLA 4HW7A 4YSJA 2ZM3A 4D9TA 2O65A 3A62A 4PMSA 1OMWA 1YHWA 2VNYA 3Q9XA 4LI5A 2W96B 3KQ7A 1UKHA 3Q53A 2ZV7A 4I0RA 3RAIA 4FIEA 3PRFA 1OL5A 2FYSA 5DRDA 4DFNA 4EOLA 3LXPA 2Y0AA 5E8YA 5IQFA 3OCGA 2Y4IB 4QYGA 3E8DA 2UZOA 1J1CA 4W8EA 5AP2A 2PYWA 4JQ7A 2HELA 4OTFA 5CS6A 3LXNA 4BDIA 2G15A 3GQLA 4WNPA 3OG7A 3DNEA 4E26A 1WBPA 5CX9A 4NKAA 4K1BA 4D2TA 2BTRA 3FKNA 3QZHA 3PY1A 5AIKA 2OF4A 4KNBA 2XMYA 3MY0A 4TPTA 5AEPA 3G5DA 5FXRA 1AQ1A 4FTKA 3CY2A 5CU2A 4FSTA 1NVQA 4MXYA 2Z7QA 2ITWA 2QHMA 4R1VA 1CM8A 4U43A 3R7EA 3LMGA 4WD5A 5DEWA 3SRVA 3VNTA 3CQUA 2R7BA 3D7ZA 4XP0A 4BDHA 4KD1A 3Q9YA 3WF8A 3VS3A 2QOHA 3V5PA 3ZC5A 3FMHA 3U55A 4OTHA 1IRKA 1OL7A 4C2VA 3RJCA 1IA8A 3POZA 3AMAA 2PVHA 3QL8A 4IFCA 1Q61A 4C4IA 1GJOA 2R3RA 3D7TA 3A7IA 5CQWA 4FBXA 2WTVA 3NYXA 4FT7A 3AC5A 4Y83A 5BVFA 1Q99A 5HLWA 2ITPA 4JG8A 4X3FC 3WZUA 2OICA 2OJFE 2VO7A 2HENA 1ATPE 3KULB 3KXMA 4IZ7A 3WYXA 4AGWA 5M51A 4ASEA 4F7LA 4G17A 1J7UA 5CU0A 4RWIA 2QO2A 5JK3A 3R83A 3ENHA 4MAOA 4CKRA 4ZOGA 2X7FA 3ZSGA 5L2IA 4KIKA 2JKKA 3MTLA 3UO4A 3UYSA 4E73A 1EH4A 2WTWA 2OIBA 3LFDA 4UXQA 3VUDA 4ORKA 3MH2A 2QOQA 3S3IA 3Q9ZA 2NP8A 3NAXA 5FP5A 3NUXA 4P5ZA 4DF3A 2HXLA 2G2HA 5JFXA 5KX8A 2GSFA 4IC8A 4GFOA 3OW3A 2YIWA 4IXPA 2YJSA 3HYHA 5IISA 2QU6A 4CD0A 5JRSA 3AOXA 3R02A 4F7JA 5AM7A 5E1EA 4C4FA 4F1TA 3ORNA 5A6OA 5EW8A 4GU9A 3LPBA 3ZU7A 3ZS5A 2OJGA 1GNGA 2E9NA 3G6GA 4HZRA 4WOVA 3VF9A 2FSTX 4UN0C 3UDBA 4HGSA 5C01A 3DFAA 2I6LA 4D1SA 5K0XA 5JFWA 5IQGA 3KCKA 5ANIA 3QRJA 3GVUA 3OC1A 4MD7E 2C6DA 3BIZA 2P3GX 1YOLA 5GJGA 4FG7A 2HWOA 2VWYA 4HNFA 5HTIA 3TIZA 3PE2A 2QO7A 1FGIA 3NUYA 4CNHA 5C4KA 3BPRA 3OBJA 3PSDA 2F4JA 5CXHA 4RC2A 4WUNA 4YJRA 3DPKA 3HA6A 2EU9A 1PMEA 4F9CA 2R0UA 2X2MA 3G2FA 5HZNA 1WVWA 3GP0A 3QRTA 4NCTA 2C3IB 2VV9A 4MH7A 2XF0A 4NM0A 5J1WA 4ASZA 4M97A 3FSKA 4O0RA 4F6UA 2JIUA 4R1YA 4O7RA 1KE6A 1YKRA 3DQWA 4EH6A 3UP7A 4XV3A 4CZTA 3VHEA 5HIEA 3OOGA 4XMOA 3NVMB 2XK4A 2OLCA 2RF9A 4O91A 2X7OA 4F64A 5DBXA 4MNEB 3CQEA 4EOSA 1NVSA 1R1WA 2GTNA 4BDDA 5IDPA 3UQFA 3KFAA 5EQPA 4WA9A 4CLJA 3BLHA 2X6EA 3C4XA 5D11A 5DRBA 3CY3A 4JDHA 4JS8A 2VU3A 2YCFA 2Y4PA 4C0TA 5IEXA 2QQ7A 3VQHA 3QC4A 4FIIA 4MTAA 5KMJA 2QNJA 2XUUA 2GS6A 1UU7A 3MFRA 3ACJA 4CFXA 1O6LA 4YPDA 4BGHA 2WQOA 4D1ZA 3IGOA 2R3FA 4ZK5A 3BE9A 4FSUA 3UIXA 4KB8A 4MF1A 3EL8A 5T3QA 3NUPA 3F3UA 1H24A 5L2QA 3QLGA 3LFBA 4FNWA 4GT5A 4HGEA 4O27B 3ROYA 4L53A 3C4WA 3CGFA 3GI3A 4TYHB 3R7VA 4YR8A 4N0SA 4Y46A 2OH0E 2IZUA 3H4JA 3GCUA 4DHFA 5CEMA 4DEBA 3QC9A 1XKKA 2XJ2A 5IQBA 2E9VA 3A7GA 4GUBA 4XOYA 4I3ZA 2BZKB 1HCKA 4K18A 4I5HA 2DYLA 4PDPA 2XJ1A 4ANOA 1GAGA 4O82A 4CQGA 2VN9A 2VRXA 2ZMDA 4XG4A 5AV1A 2UZDA 4ZJJA 1H08A 5EW3A 4M66A 1OKZA 2JDSA 4ZP5A 4DFYA 3GC9A 5AUVA 4UMQA 4BIBA 4XX9A 1IR3A 2PY3A 2VTHA 3QX4A 3MFTA 1REJA 4V05A 3U6IA 2W05A 4I93A 4DH5A 2WMRA 4YJOA 4PMTA 3VJNA 5CEQA 4E4NA 3IPHA 3ZHPC 3R9RA 4RJ5A 3IS5A 3R30A 2IJMA 5CSVA 4PF4A 3IECA 5IU2A 3RPVA 2RFDA 2ITZA 4AA5A 4KINA 3CTQA 3PWDA 3FQEA 4XV9A 4E1ZA 1F3MC 4F0GA 4O96A 4QOXA 4ERWA 3FQHA 2PMIA 1BUHA 4FR4A 4C38A 4I94A 4IX5A 4GT3A 1YI4A 2OH4A 3DAEA 4IIRA 1PKDA 1GZNA 1QPJA 2QLUA 4H1JA 4YHJA 2R3JA 3R1SA 1YHVA 2E2BA 3QCYA 5F1ZA 3DJ7A 4YNEA 1NA7A 2HWPA 4AS0A 4ZAUA 4RFYA 4WO5A 3HECA 3E3BX 4BDEA 3Q2MA 4YJQA 2FO0A 5LWMA 3Q96A 4C34A 4L7SA 1GY3A 1PYEA 4E6QA 5IA0A 3F82A 3PXFA 2BDFA 4FZ6A 5IQHA 3G51A 2NRUA 4MK0A 3TJDA 3DZQA 3VUKA 5KKRB 3BI6A 2GNIA 2PSQA 3QGYA 4O7VA 2XVDA 3CC6A 4J1RA 5HCZA 5AADA 3C4FA 3HUBA 4AW2A 3LCKA 4GS6A 3U9CA 3DCVA 4KIOA 4J7BA 3OWKA 1GIJA 1GIIA 4IM2A 1H1RA 3FPMA 3H3CA 3KCFA 3RI1A 4FEVA 3SAYA 3D2IA 3V8SA 4PWNA 3F61A 4QTDA 3L1SA 3LFQA 4HCTA 2PZYA 4DG2E 5KMIA 4TYGA 3EQGA 3PFQA 3ZUTA 4NK9A 4RLKA 4U44A 4FK3A 5M08A 2WTKB 2GNGA 4WG5A 3DKGA 4QMMA 5AP3A 5BVNA 1U5QA 4CFWA 3VULA 4CLIA 4EK4A 1KE7A 4S30A 3V5WA 4C61A 2IPXA 1JKSA 3UVPA 4B0GA 2QVSE 2W1IA 3D0EA 3QHRA 3WIKA 2YIYA 4IWQA 3WYYA 3UGCA 4K33A 4I6BA 3DBQA 5FUTA 5K3YA 2YJRA 3VQUA 3ZM9A 1PXIA 3PXKA 2PVLA 3NGAA 5HCYA 3SRVB 3UO6A 3VW6A 3W8LA 5CANA 2XKDA 4YJTA 3S95A 5IH6A 3NPCA 2OF2A 3EH9A 4NJDA 4QPSA 4GK2A 2PTKA 4I4FA 3DS6A 3DA6A 1TQMA 5CSHA 4UMPA 4NIFB 4RJ4A 2GFSA 4D2PA 3RWPA 3KVXA 4NTTA 1IAJA 2F2UA 5ITAA 1PY5A 2JD5A 5EH0A 3JY9A 5EYKA 2PVRA 1UWHA 1OIRA 4OTQA 4GJ3A 4HCUA 2NNWB 4GK3A 2C6EA 1SVEA 4RWLA 5D7VA 4FV1A 3BGZA 1OUKA 3THBA 3TJCA 3ZONA 5L6PA 2BR1A 4BCKA 1XH4A 5T6KA 2ONLA 3O7LD 4FV8A 4DEIA 3PIXA 4RIXA 2HZNA 4V0GB 3COMA 2I0YA 1UNGA 4UALA 2VTOA 4ZY6A 4LOOA 4JVGA 4AE6A 3PA3A 3FL4A 4WRSA 3VUIA 2ITYA 5HCXA 1ZOGA 3KKVA 3NW5A 2VGPA 5FXQA 4H36A 4K0YA 2ACXA 4HYSA 3BCEA 5HU9A 3G0FA 3W1FA 3Q32A 5FEDA 3TNHA 4Y72A 3R21A 3HRCA 3ODYX 3GU6A 2QOIA 4BRXA 2B0QA 3RK7A 1A9UA 4EJ7A 3MGYA 4L44A 3EMGA 2YZAA 3RKBA 4TT7A 4EK8A 5B2LA 3EYGA 1H00A 3PJ8A 2Q0NA 4IWOA 5ETCA 5G1XA 5J8IA 5B2KA 4BGQA 5FXSA 2OG8A 2YISA 5AP5A 4DGOA 1R0PA 3PXQA 4RIWA 2UVXA 2WIPA 1YXTA 4XBUA 3TG1A 4YZ9A 2WB8A 4ERKA 3H0ZA 4IAYA 3R00A 1CKJA 4YP8A 5AV3A 1TQIA 4WG3A 4CMTA 2B9JA 4O0WA 4HJOA 3DZOA 3MVMA 4AFEA 4D58A 3OUKA 2OSCA 2A19B 3EJ1A 5GIPE 2QU5A 4YURA 5G6VA 4PL4A 4AW5A 4PNKA 3QLFA 4TWPA 2PVFA 4C3PA 2CSNA 2B9IA 1SM2A 2V7OA 1SNXA 4EH4A 1ZY5A 2F57A 3FMMA 3LKMA 3EN9A 3OROA 1ERKA 3KU2A 3I5NA 4IMYA 2CNUA 3GGFA 1YXXA 2Y4IC 5EG3A 3FZTA 5AA9A 4GK4A 4DEDA 5IEVA 3FI2A 2PPQA 5EKOA 1KV2A 2EXEA 2C5YA 1MRUA 4M7IA 3FHIA 4RVTA 2XH5A 3Q3BA 3TKHA 3U4WA 3HV7A 1RJBA 3FWQA 2C69A 3ZUVA 5HD7A 4BDGA 5M4IA 2WD1A 4MF0A 4KSQA 1NVRA 3T8OA 2PE0A 2JKMA 2EB3A 3MI9A 3RPRA 4NSTA 4BKYA 4NKSA 2GFCA 5BYLA 2V5QA 4EK5A 3ANRA 1L3RE 3ORXA 3FMDA 3QYZA 4YTIA 4C59A 1KSWA 1VEBA 2OFVA 4YC6A 3FYKX 4ZS4A 2IVTA 5LVOA 1TVOA 2RFNA 4IZYA 4RC4A 3EN7A 4OW8A 4OGRA 3DXNA 3GCQA 5EOLA 2WGJA 4F0IA 2CGVA 3GXLA 3L8PA 4FYNA 5EFQA 3R8MA 2C1AA 4ACCA 4LL0A 1H25A 3PVGA 3PVBA 2VO6A 3W2QA 2J6MA 4IJPA 4AT5A 5HKMA 2FA2A 4D28A 3OCTA 3UOHA 4CRLA 5I9YA 1XJDA 3PVWA 4FF8A 4XRLA 2PVMA 1LR4A 3ELJA 4RFMA 3R9OA 3NNUA 1XQZA 4E5WA 2Z60A 4QD6A 3SQQA 1MP8A 2PE1A 3H9FA 2IVVA 2CCIA 3D9VA 5BMMA 2R64A 3RZFA 4C62A 3K3IA 1PMNA 3COIA 1MRYA 4EKKA 1W83A 4DGNA 1KUTA 3R71A 4YBJA 2WHBA 5AP7A 3EZVA 3VS5A 3O96A 4X6RA 2WQBA 1WBTA 3ALOA 5ANJA 3WILA 4BC6A 2GQRA 4JJRA 3HV4A 2R2PA 3PJ2A 2RFEA 5LCJA 5TF9A 3QQKA 4ENXA 4XP3A 3KULA 3FXXA 4CVAA 4FNZA 2H6DA 3CXWA 5L2WA 4PDSA 3GCVA 3FLWA 5ACBC 4DTBA 2RFSA 4XBRA 3UPXA 2SRCA 2XK3A 3MH0A 3TL8A 4R3CA 2VTLA 4NT4A 3BGQA 4C4JA 1CKIA 1VYWA 4V04A 1Q62A 5BVOA 2PK9A 4BZDA 4A4XA 3IDCA 4BYJA 1BX6A 1LUFA 1X8BA 4C4EA 5HG9A 5KE0A 4DA5A 3QTXA 4N6YA 4DLIA 5E90A 2Z7LA 2W7XA 2VNWA 5IQDA 4RA4A 4QMPA
chains in the Genus database with same CATH superfamily
2E9OA 3R7UA 3DK3A 3GOKA 3L8XA 3BHYA 3V6RA 1OITA 3VJOA 5HX8A 2QOFA 3A4PA 3W2PA 4D0XA 3GC7A 3N4TA 2BIYA 4FVPA 2O64A 4L6QA 5BV3A 4QT1A 2WMTA 3KXGA 1YXUA 4O38A 1FVTA 5FLFA 3OT8A 2CKOA 4J99A 3HGKA 3ULZA 5DH3A 2PE2A 3F88A 1IEPA 4LGHA 2JC6A 3O51A 1WCCA 5EM5A 5KZIA 3ZSHA 5IDNA 2DWBA 3TUBA 3OWLA 2BKZA 4IX4A 5CNNA 4PTCA 4EQCA 2DUVA 1QPEA 4OBOA 4D4VA 1KE9A 3FE3A 3H9OA 3EQDA 4FIFA 2XEYA 4O6LA 4WSYA 2FUMA 2PL0A 4B8MA 4BGGA 4EOIA 3FHRA 4TW9A 3W0QA 4ANNA 3VUTA 5FRIA 3IGGA 4FG9A 2IZTA 2WAJA 5AA8A 5DVRA 3UDTA 2X0GA 4BCNA 3KMMA 3F5PA 3LJ0A 4FOCA 3KB7A 2QD9A 3TNWA 4ZLYA 3QZFA 4EC8A 4QP8A 4IW0A 3D5UA 5ANDA 3PSBA 5IMXA 1PF8A 3CEKA 3GUBA 2QR7A 4UMUA 2WQEA 2XIKA 2WNTA 3UG2A 2R3MA 3DJ6A 3RPYA 1Z9XA 4RC3A 4RQVA 4GEOA 4CQEA 1WBVA 5JN2A 3P23A 4YJUA 1G8AA 1BLXA 1JKKA 1QPDA 3HX4A 4L67A 4UWYA 4AE9A 3QTWA 1MUOA 4RWJA 4XHKB 4XUFA 3EQRA 4MNEA 3WIGA 4DEHA 5AWMA 5HNIX 2ITNA 2QO9A 2ITVA 3NLBA 1JPAA 4GIIA 3W2CA 4L8MA 1UA2A 4FUYA 2KULA 3SGCA 4N6ZA 2VWIA 3L8SA 4TTHB 4H05A 5FP6A 2F49A 4F65A 5AUWA 3DAKA 3HUCA 5I9XA 4WUAA 4QNAA 4QYFA 4B6LA 3JR1A 3V8TA 4O2ZA 5H9BA 4ANSA 5HEZA 5JFSA 4FX3A 2WKMA 1CKPA 2NPQA 2C5XA 5CEIA 2XKFA 3HRFA 4IJ9A 3K5UA 2DS1A 4WNMA 5CU6A 2VX1A 4I4EA 4A07A 3KRJA 1CMKE 4TYHA 4EQUA 5JZJA 3P5JC 4RQKA 3O2MA 4CG8A 4EBWA 3M2WA 2EB2A 3IW4A 4ITHA 4YU2A 5DYJA 3KVWA 4Y73A 3EWHA 4IWPA 3QA0A 5B0XA 5EYMA 3ZCLA 3QALE 4WG4A 2OKRA 3FLYA 3IW7A 1FPUA 4F9AA 5LVNA 3UOJA 5EM7A 2C5OA 3L9LA 2B52A 4FSYA 3TKIA 4PTEA 1ND4A 4OAVB 2CN5A 3KRWA 3CKXA 4PMMA 4PX6A 4EOMA 5LVMA 4CFVA 4GUEA 4ZSAA 5LMKA 4HVGA 4IAIA 4X2JA 4EK3A 1YDSE 5ANOA 3SOCA 3UDZA 3PVUA 4GG5A 1M2QA 3CCNA 5A3XA 3ORPA 3LFSA 4FTQA 2I40A 3QAME 4XLIA 2ZM1A 4AXFA 5E7RA 5EI2A 5DGZA 4W4WA 4C57A 4PY1A 2W4JA 3EB0A 5BUEA 3SD0A 4AW0A 3DV3A 5DWRA 2Q0BA 4BDKA 1YXVA 1V0OA 4P90A 1U59A 4HCVA 5KKRC 3ATSA 4BWXA 2JAMA 2YM7A 4FE2A 3I1AA 3P5KA 4EOOA 4B4LA 1H1PA 2WMWA 2VWVA 3BX5A 4FSMA 4XG2A 5KNJA 3V01A 2ZMCA 3HL7A 4U41A 2B1PA 3M11A 1XBCA 5CVHA 4B8LA 2UW4A 2A98A 3D2KA 4YTCA 4YZMA 4L9IA 4BICA 2AYPA 2H34A 4O7LA 3EQBA 3I6UA 4ARKA 4DFZE 1J7IA 1YQJA 2I0HA 5EYCA 2VUWA 2C6LA 4QQCA 2O8YA 4C37A 4EC9A 2HZ4A 3EQPA 3OXTA 4ZEGA 3UMWA 3IONA 1P5EA 1UU3A 4KRDA 2A0CX 3F2AA 3FMNA 4UBAA 2J0IA 3FSFA 3KRRA 3O5AA 4CFNA 3PJ1A 4R5YA 3SC1A 3GOPA 4EYJA 4QP3A 5CAPA 3AKJA 4V01A 3C9WA 4BZOA 1ZY4A 3AQVA 4RX5A 3PUFC 1UWJA 4DTAA 5FM3A 2RIOA 3MBLA 4CT2A 3FY2A 4C58A 5HNBA 2WMSA 4J96A 2YM3A 1H8FA 4F6SA 3CKWA 3R1YA 4QMYA 5I9ZA 2Y9QA 3E7OA 4B99A 2XNEA 4BY9E 1Q8UA 1U46A 3KF7A 2JFLA 2JGZA 3HDNA 4JX3A 4F9WA 2ZV8A 2LGCA 4U42A 4A7CA 3RINA 5HGIA 3PXZA 5KHWA 3S00A 3F2RA 2UZBA 3FZ1A 4KBKA 4LFIA 4ALUA 3VUHA 2QG7A 4MVFA 1K9AA 1FQ1B 4IVAA 5I9VA 5E1SA 1PXPA 3KMWA 2W1FA 4FT9A 5CU4A 4IB5A 4BI1A 4XV2A 3H10A 4XS2A 3GU7A 3OCBA 3MV5A 2XM8A 4FKOA 5C1QB 3LZBA 3FV8A 4CGAA 1JKTA 4YZCA 4FV7A 4Q9ZA 4FNYA 3MTFA 2GNJA 3ORKA 3SXFA 3M1SA 3DTWA 3EN5A 4RBLA 2CPKE 2XRWA 3ULIA 5C4LA 3CIKA 4RZWA 2W5AA 3GU4A 3VRYA 1KWPA 3BQCA 4YUQA 4U3ZA 5FTGA 2GQGA 4G16A 4E4XA 3I81A 4FICA 4O7YA 4NIFA 5IZFA 2BCJA 3RP9A 5T68A 1ZMUA 3MVJA 4DT8A 1OKYA 4YHTA 1GZOA 1AGWA 3HMPA 2OZAB 3ACKA 4BWPA 4FTAA 5AUTA 4F70A 3KA0A 4YO6A 3RAKA 2OI4X 5M44A 3DQXA 2FSOX 5GNKA 4Y5QA 4WIHA 2GHLA 4ZJIA 2G01A 1ZYJA 3VBQA 3MVLA 4H3PA 4QPMA 4R3PA 4F08A 3C0GA 3KF4A 3NYVA 4KKEA 2Y6OA 3CSVA 4IVDA 3P7BA 4FKQA 3LCTA 2P2IA 2XNMA 4BHNA 3DXPA 4R77A 3ZXTA 3VF8A 1DAWA 4YJNA 3T9IA 4V0GA 4DYMA 4WSQA 1KOAA 3ZLYA 2YN8A 3WE4A 3E8CA 4JIKA 2OXDA 2QOLA 4CTCA 3NCZA 1PXMA 1AD5A 4QQTA 5ETAA 4CYIA 5ETFA 5C27A 2C5NA 5CI7A 2X9EA 5H8BA 1OIQA 4EH5A 4NCTC 4E8AA 1OBGA 4BCFA 3OHTA 3R1QA 4H3QA 4DH8A 5HNGA 1PHKA 1SMHA 2HCKA 3MIAA 2CJMA 4DBNA 5AP4A 5DPVA 3TT0A 3K2LA 3O8UA 4ACDA 2I0EA 5AAGA 2QOBA 4U5JA 2ZAZA 4TXCA 2I0VA 2V55A 3E87A 4IX6A 5KO1A 4MNFA 3UO5A 3OEFX 5IUIA 4JQEA 2C6KA 4XJ0A 4O7NA 2C68A 4M69B 4IDTA 3JXWA 1H26A 1WZYA 4X21A 5E8XA 5D9HA 4ZTQA 3V04A 4C02A 1NY3A 3HZTA 4EUTA 4QMQA 1IG1A 4HGTA 3EQHA 4CRSA 3TTIA 4G34A 1U54B 5LOHA 4AOIA 2ZDTA 5HLNA 2X6DA 2P4IA 4WT6A 1XH7A 5D10A 2BRNA 4IQ6A 3LJ2A 4QEBA 3AT4A 3FY0A 5EKNA 3R73A 4ZTNA 5TOZA 3V5QA 3ZBXA 4EORA 3MJ1A 4EOPA 4BR3A 3FMEA 4O0VA 3V51A 3QXOA 3R01A 3Q4TA 4BB4A 3R7YA 4D2WA 3R04A 4BZNA 3QQFA 3GU5A 5GZ9A 4L00A 2X0QA 3PRIA 3W2RA 4FT0A 4G3GA 2W1CA 3B2TA 2W1HA 4FL3A 4FTOA 3IW6A 1XBAA 3W32A 4U81A 5EDPA 4WNKA 4R78A 2PULA 3JY0A 1JQHA 4B9DA 2C3JA 2FB8A 2B9HA 4RX8A 4ALWA 5J9LA 2A1AB 3FJQE 3DJ5A 2I7QA 3DK7A 3QU0A 2ITQA 2R4BA 2WTIA 2OK1A 3DBCA 2W9ZB 2ZM4A 1ZYCA 3E88A 3FLZA 4OTRA 2G9XA 2PZ5A 2YAAA 3F3ZA 2UVZA 2YFXA 3JUHA 3R7IA 5ACKA 4ZMFA 2FGIA 2ITUA 2X4ZA 4RA5A 5BMSA 3LFNA 1R0EA 4HZSA 3R8UA 5KBQA 1JWHA 1IA9A 5JKGA 5A54A 2YDJA 3B8QA 3BWJA 4BCIA 3KC3A 4D2VA 3HV6A 3PZEA 1YHSA 4AZTA 3PXYA 3JYAA 4RVMA 5HO8A 1H1WA 2REIA 4CKIA 3IQ7A 5CQUA 5IEYA 4P4CA 3P4KA 3RVGA 1JKLA 5M4UA 2YM8A 4IAKA 3F7ZA 5F9EA 3D5WA 4LG4A 4MD8E 5A6NA 2ZYBA 2HOGA 4L46A 1FGKA 2YIRA 5BVDA 1UV5A 1H07A 4FVQA 4R7HA 3TUDA 5JGAA 4A9TA 3ANQA 1XO2B 1Q8YA 4BCOA 2J5FA 4MXZA 3VVHA 4A9SA 1WBWA 2HYYA 3IO7A 1ZMWA 4GW8A 3UIUA 5DT4A 4UV0A 5BVEA 3NVKI 2R0IA 1P4OA 2JBPA 4EWQA 3E92A 4I22A 5CVGA 3RAWA 2X39A 3BL9A 4WNOA 4IZAA 1V0PA 4ACGA 4O86A 3HRBA 4JI9A 4PRJA 1UU9A 4O0UA 3TV4A 2IW9A 3WBLA 2F7XE 5CT0A 3SKCA 2CGXA 2R9SA 1OB3A 4AACA 3LCOA 2WU6A 3RCJA 4FGBA 4ASDA 4D5HA 3NUNA 4HNIA 5FQDC 4Y95A 2XS0A 4EL9A 4FL1A 2ZJWA 2WMUA 1APME 3JS2A 2W1GA 3P7CA 5DE2A 3QD4A 4TYEA 5M56A 5DOSA 2YCQA 3PP0A 1Y6AA 2UV2A 2VX0A 4IH8A 4DH7A 5CAOA 1M14A 4AZFA 3VC4A 3MS9A 4YJSA 5LMBA 3OW4A 3OXZA 2NRYA 3BU6A 5FDPA 3ZRLA 2WXVA 3ZSIA 4IAZA 3QFVA 4XG8A 5A14A 3DB8A 4FSWA 3LFFA 5D12A 3DKFA 3Q52A 4MYGA 4UWCA 3NSZA 4YTFA 3NW7A 5JH6A 4ONAA 3DXQA 2B9FA 2C6OA 5BYZA 3A60A 4F7SA 5EW9A 3UZPA 3ORIA 4YGAA 5K4JA 3P7AA 4NM7A 3OEZA 3EN4A 5DR9A 3G9NA 3MY1A 4USDA 1M7QA 2BROA 1HCLA 2WPAA 3MVHA 2UW9A 4LOQA 1G8JA 3MW1A 3PYYA 4TNBA 4YC8A 2GU8A 3WZDA 4BCHA 4BCGA 2CLQA 3ZRMA 4L45A 1ZZLA 5C8MA 3V3VA 4AA0A 5IH4A 1L8TA 1YWVA 2XK6A 3HV5A 4G3CA 5HORA 3W0SA 3NYNA 4FTIA 5DNRA 4J97A 3LE6A 4WKQA 3HNGA 3A99A 3IDPA 2ZDUA 3O23A 4O4FA 4AUAA 1YWRA 4ZTRA 5HE2A 2R3LA 3JVSA 5FWKK 5AUYA 5HTBA 5CEKA 4KS8A 4C4HA 5CWZA 1UVRA 5A4QA 3TM0A 4L3PA 4X6QC 4FL2A 5HIBA 3IG7A 3ZUUA 4F63A 5CSWA 5IH5A 1Q41A 4QQ5A 4OTIA 3TUCA 3NNXA 4LL5A 2VTPA 2ONLC 3TNPC 2BRBA 4DN5A 4FKJA 2ESMA 2ERZE 2PZPA 4NM5A 1H0VA 5L8JA 1BMKA 3DAJA 4MD9E 4HVHA 4RVLA 3VO3A 1SVHA 3CJFA 1G8KA 4ZTLA 2YABA 4H1MA 3ZFYA 2ZV9A 1NT2A 2J9MA 3DBFA 4GFMA 3QYWA 4YBKA 2WOTA 4D4RA 4CV8A 5IMEA 1M2PA 4GG7A 3BELA 2C4GA 3OMVA 4XOZA 1H27A 1MRVA 2PWLA 2YLFA 4KABA 5TKDA 4YPSA 4YLJA 4OTWA 5AP0A 4ZTHA 4KUJA 4CTBA 4PV0A 3MDYA 3QQUA 2YDIA 4I41A 5LJJA 5CTPA 5C26A 4BCMA 4QMSA 3COKA 2X2LA 2VTIA 4MWIA 5EI8A 4AN3A 3DGKA 4IB0A 2HXQA 3W0PA 3FMKA 3HMMA 3ZFXA 5M07A 3N9XA 3HAVA 2YM4A 3S1HA 2XK9A 3BYOA 2GNLA 2IG7A 2R7IA 4C3RA 1YI3A 3QTSA 4L3JA 1NXKA 4FSZA 4U40A 2GQSA 5J5TA 5H8GA 4FTJA 3W8QA 2C47A 4BTKA 2JDVA 3C51A 3LXKA 2IN6A 1STCE 4FEQA 2VO3A 5J79A 4R7BA 4TWCA 2GHGA 4E6CA 4S32A 4FJVA 3L8VA 4G2FA 1OPLA 2EXMA 4YJVA 1OVEA 4M8TA 4DG0E 2RKUA 3GEQA 3FYJX 3W2SA 2WEVA 4CYJA 2RSVA 4D0WA 2ZFYA 4UEUA 3PIZA 3A7HA 4E93A 1REKA 2W5HA 4FZDB 2OIQA 3AT2A 4GRBA 4RGJA 2P0CA 4KIQA 3R2BA 4PNIA 4AGCA 2O63A 5M55A 3P1AA 1QCFA 3RALA 4DITA 1Q24A 3MH3A 5B2MA 2QR8A 4X3FB 5ANEA 1U5RA 2CKQA 3QBNA 2QODA 4IAFA 2ETKA 3TCPA 3Q4ZA 5BUJA 4KA3A 3KXXA 4NFNA 4OBPA 3VS0A 3C4ZA 4EH9A 5HE3A 4DDIA 3BEGA 4FV6A 3E3PA 3IKAA 3L9NA 4AT3A 4ZIMA 4R6VA 5DA3A 2XNOA 4BCQA 4EOKA 5HBHA 1W98A 4NEUA 4AF3A 3VS7A 3I79A 4DFUA 2WFYA 3TACA 5IQCA 3CS9A 5J5SA 4QYYA 4QP9A 3RNYA 3RZBA 1S9IA 2X8EA 1W82A 3KK9A 3TZ9A 4O1PA 4D4SA 4EH3A 3R0TA 4AX8A 4ZZOA 2ETMA 5HLPA 1JOWB 5DIAA 5IA4A 4ZZMA 5CEPA 2ITXA 3GB2A 2X8IA 5HICA 4FRFA 3ZFMA 3ZOSA 5DR2A 3RPSA 2XYUA 1BL7A 3Q6WA 4G9CA 3CTHA 4Z16A 1URCA 5I3OA 4D2SA 3GCSA 1H0WA 4XNEA 4ZJVA 3R8PA 1P4FA 5E8UA 4G31A 4I20A 4JT3A 3FI3A 5AR8A 4W4YA 4U9AA 3C7QA 3F7WA 1OM1A 3QRUA 4ZSLA 1CSNA 4NW6A 3WARA 5IQAA 2F2CB 2YHVA 2QI8A 4BJJB 3TEIA 4JL9A 4K8AA 2YIXA 2QC6A 4NL0A 1V0BA 5H8EA 5E8SA 3TI1A 2R3KA 4L3LA 3WF9A 4L01A 3TDVA 2OGVA 3QWKA 4MBJA 2R3HA 4BDFA 3PJCA 4OT6A 5DT0A 3NYOA 5C9CA 5IQIA 4DHJA 4LUEA 4BN1A 3PPJA 3OXIA 3V6SA 5JFVA 4O2PA 3VBTA 3SVVA 5EQYA 3KEXA 5GJDA 4CMOA 4X2NA 4UWBA 2BMCA 4Z7GA 4D55A 1PRYA 4XV1A 3BZ3A 4F09A 3R9HA 5KMMA 4G6LA 4HPTE 4M13A 1XBBA 2OXXA 2VWZA 4IAAA 1OL6A 3AMBA 4R3RA 4QPAA 2UZTA 3BHTA 3OFMA 3UOLA 2GS7A 4UYAA 2NO3A 4IEBA 4RMZA 4RX7A 5AV0A 2R3QA 4CZYB 1JSVA 1KV1A 4AA4A 2OZAA 4GKHA 2W06A 3R7GA 2JITA 3Q4UA 4H39A 3HP2A 3IK3A 3MJ2A 3RM7A 4LOPA 4G6OA 4ANMA 4AN2A 4EBVA 3FZOA 3VBYA 2W17A 3MESA 3ZDIA 3QD2B 3KXZA 2H8HA 2F7EE 4RT7A 2BFYA 5TO8A 3ZEPA 1YOMA 2VTAA 4O22A 3AD4A 4QMZA 3VUGA 3JPVA 4C3FA 4CXAA 3PFYA 4ZLZA 4U3YA 2J7TA 3W2OA 3U54A 4O0TA 5E8TA 2BZJA 3AC1A 3LFEA 2CNVA 5AUUA 4JRNA 1O9UA 3GQIA 3ATTA 2B54A 4TL0A 5JRQA 2ZOQA 2BILB 4RPVA 4TY1A 4GT4A 2C0OA 5DHJA 3Q5IA 4ANLA 5IPJA 5E4HA 4IB3A 3LQ3A 3MYGA 3TIYA 4C7TA 4IX3A 4QMUA 5CENA 1YDRE 1LP4A 4AQCA 4FZAB 4IANA 4EOJA 3NS9A 4AAAA 5A4TA 5AR2A 5A4EA 4Z55A 3UTOA 3DFCB 5AR7A 3PIYA 5IA1A 4FOBA 4BFMA 2PUUA 4I92A 4G5PA 2JIVA 2HY81 2OFUA 2YIQA 2XJ0A 3E62A 3VS6A 4AOTA 4FVRA 1VZOA 3C50A 4RJ3A 3RTPA 3BBTB 1LPUA 2CGWA 2G1TA 4JQ8A 4K2RA 2Z7RA 4M69A 3EQCA 4YZBA 4YNOA 3AC8A 4FKVA 3ZBFA 2OJIA 5K0KA 2YERA 1U54A 3IOPA 5DT3A 4XP2A 4S33A 4X2GA 2PMNX 3F69A 5I0BA 4FKSA 4DTKA 3QWJA 3SA0A 5HESA 2XARA 4G3FA 4IWDA 4GL9A 2R5TA 2VZ6A 3G90X 4OTDA 1G8SA 2OIDA 2XRUA 3F3WA 4FTRA 4L42A 4U97A 4UYNA 2YM6A 2CHLA 3IW5A 3F66A 4RFZA 2VWUA 4U8ZA 5L6WL 5JGDA 3LCDA 1JVPP 5FD2A 4FKIA 4F0FA 1UU8A 4E5BA 2W1ZA 4IE9A 3VAPA 2BAKA 4QDVA 1PXLA 2DQ7X 3C4CA 3FZRA 3BYMA 4LGDA 1R39A 2XKEA 2J0KA 4II5A 2IO6A 4A9UA 4KSPA 3VHKA 5EHOA 4CSVA 4E7WA 4N57A 3TXOA 1NW1A 2VWXA 2ERKA 3UQCA 1PKGA 4QTEA 3VS2A 3ZRKA 1DI9A 3Q6UA 2X7GA 5LMKC 3BGPA 3MH1A 4QYEA 5FTOA 4EWHA 5K5NA 2CKEA 3UVQA 3U87A 3FC2A 4FK6A 2ETRA 4BKJA 3I0QA 4BDJA 3FUPA 3ZZEA 1UKIA 3QKLA 3C0HA 3OBGA 3P78A 3VS1A 3SDJA 3U51A 5DEYA 4QMTA 1Q3WA 4Q5HA 5E91A 3VBWA 4E6AA 3BV3A 4QMVA 2CLXA 3ODZX 4BTJA 4ZTMA 4O4DA 2PVKA 2UVYA 4FUXA 1Y91A 2J51A 1FMKA 3DOGA 3QQJA 5DFPA 1G5SA 2O3PA 2QHNA 2UW7A 2P33A 5AR4A 4XH6A 3WZJA 4DFLA 3QTZA 4NZWB 3TV7A 5J7HA 4FV5A 2Z2WA 5C8KA 3R22A 3FKOA 3JVRA 4NH1A 5GINE 2P55A 2VWWA 1J3HA 4TKSA 4EH7A 2G2IA 3BU3A 3UODA 4U79A 2X4FA 4QQJA 4I6LA 3W0MA 5GJFA 5B7VA 4HYUA 4NFMA 3TNQB 2VAGA 2A27A 3FLQA 4LGGA 4FMQA 2HY0A 5HOAA 3D5XA 2YACA 4OTPA 5A4CA 1WVXA 4G1WA 5HG7A 1FVRA 3FZSA 4EEVA 1FBNA 1P14A 3ZLXA 3AC4A 5EK7A 1QMZA 4BF2A 2PVJA 5HBJA 5C03A 4ZSGA 2X1NA 2YZLA 3KN5A 1BL6A 3ZXZA 5IUGA 3R6XA 4XEYA 3P86A 4FSQA 3PTGA 4Q9SA 4KBCA 3OOMA 4IBMA 1B6CB 4QMWA 5J1VA 3FL5A 3I0OA 4CMUA 1J91A 3IW8A 3OTVA 3FQSA 4L7FA 3WI6A 5BVKA 3HV3A 4IZ5A 3QUPA 3PXRA 1ZYSA 3W0RA 4J71A 3HP5A 3V5LA 1OGYA 4DT9A 4FKRA 2XK8A 5I9UA 4BHZA 3AT3A 5CF5A 1W0XC 1QPCA 2FVDA 4JDJA 5AAFA 4EI4A 5LVPA 4X2KA 4BBEA 3BU5A 5HBEA 2OO8X 4K9YA 3OVVA 2VX3A 4TYIA 4EHVA 4EHGA 3R9DA 2WTKC 5HE1A 5L2SA 5CF8A 4K6ZA 4NU1A 4JBVA 4X7QA 3R1NA 5CALA 3ZLWA 1GIHA 5IF1A 5CASA 3AG9A 3NNVA 2X9FA 2JDTA 3R8VA 1KOBA 2UZUE 3RHKA 2XEZA 3D5VA 4EOQA 5J7BA 2YWVA 3OY1A 5DI1A 4KS7A 1W2DA 3UNJA 3OS3A 1ZZ2A 4O4EA 1LEZA 3EFKA 3NDMA 3OWPA 1XH9A 4FTUA 3DNDA 4LMNA 1ZARA 3BHUA 3FMJA 4QTAA 4IVCA 4LRMA 2VTSA 4UY9A 4XG6A 4ZSJA 4CCUA 5JEBA 5DG5A 3RM6A 4EUUA 2A2AA 2G2FA 2CN8A 1B39A 4LV8A 4O0XA 4D4YA 5GZAA 2UZNA 4BTFA 1R3CA 4I6QA 4AXCA 2HW7A 3ROCA 3BQRA 3OD6X 4A9YA 5CSXA 4A4OA 2C6MA 2WO6A 4OAUC 4YZNA 4O7TA 1Q8WA 3WF5A 2BDJA 3W16A 4AN9A 4BVUA 3GBZA 3FEGA 4AAYA 4FTMA 1Q3DA 4FIJA 5HE0A 5AAEA 2UZWE 3NIZA 4QNYA 5I9WA 4DDGA 3ORZA 3A61A 3KXHA 4F1MA 1CTPE 2XP2A 5JT2A 3MB7A 3ID6C 3EHAA 4AGDA 2WU7A 3UOKA 3PY3A 4YZDA 2BAQA 5AUXA 4YTHA 2W99B 5KBRA 4ITJA 2R3GA 3EN6A 3QUDA 4QO9A 1SNUA 4BCPA 5LXMA 2WMAA 4GMYA 1ZOHA 4D9UA 2HZIA 1OZ1A 4IDVA 5CXZA 4WRGA 3C0IA 5ANKA 5EM6A 1SYKA 3SOAA 3AKKA 2WOUA 4JR3A 4J8MA 2ITOA 2VWBA 3POOA 3UZTA 3PA4A 2UZEA 3DLSA 4GH2A 4ITIA 2RG6A 3FAAA 3NRMA 2VTTA 3AC2A 3A7FA 4MKCA 4TNDA 3U4UA 4EH2A 5FBNC 1JBPE 3CE3A 1I09A 4UZDA 5H2UA 1W8CA 3ORMA 4L43A 1WAKA 3BWFA 3UNZA 3VS4A 4MXOA 4M84A 5AFVA 4FSNA 2C0IA 2BDWA 1JLUE 4FKPA 4PTGA 4A4LA 1Z57A 3I7BA 5ICPA 2ITTA 3QZIA 4O7SA 4BDBA 3DBDA 4RWKA 5JMSA 3ET7A 3G6HA 4XLVA 2IWIA 4CFFA 3QX2A 2UW0A 4J98A 5AMNA 2V7AA 3B2WA 3QKMA 3PDTA 1YVJA 3QD0A 3HEGA 3ZMMA 5AX9A 2W9FB 4EZ3A 5EHLA 3NEWA 3Q60A 2B55A 3EKKA 3BEAA 3PPZA 2FSMX 4O0SA 4L52A 5AR3A 1ZAOA 5HG5A 4AWIA 4C33A 3COHA 1H1QA 3DK6A 2PVYA 1OIUA 3F5XA 4AW1A 3UZRA 3MIYA 1OI9A 3HLLA 5HVJA 5CSPA 1WFCA 5M09A 3QKKA 3CBLA 4EONA 2Q83A 3DBEA 4Q5EA 4QMOA 4K77A 2UW6A 5DR6A 4UMRA 3GT8A 2BALA 3WE8A 3LMIA 4DAWA 2V22A 4X3FA 4BIEA 3E5AA 5CYIA 3QD3A 4EKLA 2C6TA 3S2PA 1OL2A 2P2HA 3E93A 4GYGA 4U0IA 5FBOA 4R8QA 5KZ0A 1BKXA 3AGLA 3OT3A 1M17A 2XIYA 3EFJA 4CKJA 5TT7A 3TWJA 2HW6A 2JDOA 5IA5A 1Z5MA 2BUJA 4RSSA 3W10A 4ZLOA 4FV2A 4BCJA 4RJ7A 4M15A 3U6JA 3CTJA 1VJYA 3BHVA 2GS2A 3ITZA 2WMXA 4IC7A 4L68A 4QRCA 4TWNA 3NWWA 3QRKA 2R3IA 1KE5A 2J0LA 4TZRA 4BKZA 3RNIA 3ZO2A 2R3OA 3QA8A 4JBPA 4AT4A 4GVAA 3D83A 3WZEA 4D5KA 3UPZA 3NZ0A 4D2RA 1ZMVA 4OR5A 3QCQA 1YOJA 1YXSA 4PL3A 5DLSA 4BTMA 2YCRA 4U7ZA 3LJ1A 4PPCA 4X3JA 4EQMA 3DDQA 4MXXA 2O2UA 2BRMA 4AP7A 5HX6A 4S31A 1MQBA 2F9GA 2CKPA 1OL1A 5HG8A 1BI7A 5BVWA 4FV0A 4R7IA 1U4DA 2IZSA 3H0YA 4FTTA 1YI6A 4MQ2A 2BRGA 2QG5A 4O21A 4RIOA 5AJQA 4CEGA 4DC2A 2QCSA 4FGRA 5CLPA 4GFGA 4DG3E 2RGPA 2FSLX 4M0ZA 3AD5A 3G9LX 3BRBA 3Q2JA 2AC3A 5D41A 5E8VA 2C5VA 4QYHA 5AIRA 5IA3A 3KL8A 3KRXA 3M42A 4M14A 4PQNA 4PMPA 4F6WA 2EXCX 4BJJA 1IASA 4M68A 5LVLA 3LAUA 5CEOA 5I3RA 4FEUA 1OKWA 3HKOA 4MWHA 3UVRA 2VGOA 5D7AA 5EYDA 1WVYA 2Z7SA 3K5VA 3EFWA 4JLCA 4YC3A 3QTQA 1OGUA 5BX0A 5JQ8A 3D15A 3C5UA 2WELA 1ZOEA 2IW8A 1URWA 1Q8ZA 3B8RA 3BE2A 3FBVA 2PZRA 3O17A 3LMHA