2DYLA

Crystal structure of human mitogen-activated protein kinase kinase 7 activated mutant (s287d, t291d)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
300
structure length
272
Chain Sequence
TGYLTIGGQRYQAEINDLENLGEMQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISCAAYMAPERIDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 7
publication title Crystal structure of human mitogen-activated protein kinase kinase 7 activated mutant (S287D, T291D)
rcsb
source organism Homo sapiens
total genus 85
structure length 272
sequence length 300
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2dylA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2dylA01
5A3XA 4OT5A 1UU9A 4U3YA 2WMSA 1VYWA 4OUCA 2G2IA 3U6JA 2JITA 2C47A 3SRVA 2I1MA 2QG5A 3U9CA 4E5WA 1X8BA 4EOJA 3FYJX 4D1SA 1BKXA 2W1CA 1Y6AA 5D7AA 4XP3A 4AWIA 3FKOA 3UIMA 4FT7A 3DJ5A 4FIHA 2Y4IC 4XBUA 2VZ6A 3FBVA 1FQ1B 2X7OA 2WMAA 3TEIA 4CTBA 4MBLA 5ANIA 5E1EA 2XM9A 3AC3A 3QHWA 5I4NA 4CZUA 3HA8A 5AUTA 4RIWB 4Q9SA 3C1XA 4KWPA 5A54A 1H0WA 1JKTA 4FZ7A 4MNFA 3EHAA 3UPZA 5CQUA 4KBKA 4BBFA 2WMXA 2XK9A 1PMEA 4D2TA 2QG7A 1SNUA 3O71A 4GYIA 3PY1A 4DBXA 5BQ0A 5TE0A 4X3JA 1UWHA 3D7ZA 2GQRA 5AAGA 3NEWA 1WBOA 3NYOA 4M68A 4FV0A 1CM8A 4GCJA 4Y5QA 4E73A 5EDPA 4EUUA 5CSXA 2QR8A 4M13A 2CLQA 3LCDA 2XNNA 4JQEA 3Q60A 5CU0A 5FXRA 4ZTSA 1GIJA 3RAKA 2PVRA 3LCOA 3DA6A 1H1WA 4CT2A 4O7VA 3E63A 4CZTA 4WO5A 3L9LA 3LFQA 5LVPA 4MCVA 3QGWA 4FSWA 4XOYA 1XWSA 3HMNA 4MQ2A 3NNXA 3RHXA 1R3CA 2VO3A 5K5NA 4I94A 3FMEA 4PPCA 1IRKA 1Q3DA 3WARA 4BR3A 2XB7A 3QTSA 5E1SA 3V01A 2YZAA 3QRIA 5C26A 3TZ9A 3BWFA 5HOAA 3O8TA 5E92A 4YO6A 1OL7A 5CU3A 3TI1A 3UDBA 2GCDA 3OWLA 4FTUA 4BHZA 4UMPA 4FKTA 5CASA 3MIYA 4TRLA 4XHKB 3RK9A 3ZUTA 2PZIA 1OVEA 4E20A 2QO7A 4KA3A 2V5QA 2OJFE 4GRBA 2NO3A 1EH4A 1JSTA 1IR3A 3IGGA 1ZRZA 1PMUA 3JVRA 2R3LA 3PP0A 3OP5A 5IG1A 5EYCA 4F09A 4FEXA 2CKEA 3C50A 1U59A 1TKIA 4O7LA 4ANLA 2J0MB 2W0JA 3DOGA 4N70A 3KQ7A 3R7GA 4FKJA 4IDVA 4G5PA 4F1OA 4XP0A 2UZOA 4DH8A 2X81A 4FL2A 3VO3A 2Z7SA 2OJJA 4FTNA 2I0VA 2XK6A 4R6VA 1YXVA 4S32A 1JLUE 5HCZA 2OJIA 4ITJA 1XR1A 5DR6A 4ZLYA 4RVTA 1BI8A 3COMA 4RVLA 3ZDIA 5A9UA 2W5BA 4H05A 2C4GA 2PVHA 4GG7A 3TL8A 1R39A 3FC2A 4K77A 3KRLA 2UW0A 3P7CA 4DFNA 2VWIA 4MNEA 1YDRE 3UYSA 2YIWA 4IVDA 3EQHA 4H58A 4QPAA 3GB2A 4FV5A 5HBHA 2G9XA 4J7BA 5AV2A 1YDSE 1UU3A 2OI4X 4O6LA 4IDTA 3AQVA 3L9PA 3R22A 2IW8A 3TV7A 5AM7A 5J7BA 2QVSE 2Y6OA 3GVUA 2UW7A 3LM5A 5C8NA 1G8AA 3WE8A 3DXQA 1PYXA 2BROA 2OIBA 3DK7A 1YRPA 3O8PA 2PVYA 4GKHA 2I0EA 4IAYA 4L3LA 4N4SA 1QPDA 3NRMA 2PUUA 3QC9A 3QXOA 4G34A 2WMQA 3LQ3A 5ANDA 2EXMA 3PVGA 2CGWA 4L01A 2QU6A 2CN8A 3D9VA 4D2WA 4U0IA 4TNBA 4C2VA 4CNHA 5IA2A 4YPSA 5HE3A 4D9TA 5IQDA 3V5TA 5CAPA 2PYWA 2B9IA 3MTFA 3JR1A 4YJQA 2EVAA 1H27A 1TQIA 4BIDA 3EQIA 2E9VA 3GU7A 4IQ6A 3VUKA 2BFYA 4I6HA 3SKCA 2JAVA 1YI4A 2JDOA 3HL7A 3KGAA 4GMYA 3R2YA 5DI1A 4FG8A 2YLEA 4JT3A 1WAKA 3COIA 4QYEA 5CNNA 3CIKA 3VWAA 4FV1A 4NJ3A 2XNEA 1VR2A 3CPBA 2OWBA 5CI7A 5AR8A 3KN6A 1MUOA 3ET7A 4IW0A 3ORNA 4I0RA 2C0IA 4PDPA 4E26A 4F7SA 2XYNA 5BVWA 3F66A 3NUXA 1OPJA 4XEYA 3QX2A 3MH0A 5BNJA 4EONA 3C5IA 1NVRA 1PXNA 2C6MA 3ZRKA 4QP6A 4RC3A 2VO0A 4C0TA 4ZLOA 4F63A 1LUFA 1OB3A 1R0EA 2R3MA 4KRDA 4AN2A 4XG9A 4E7WA 4EEVA 1Q3WA 4TL0A 3UZPA 4I3ZA 3OD6X 4R7IA 5HLPA 1YXSA 3EQGA 3D5XA 3I1AA 3JYAA 4RC2A 4ASXA 4F1TA 4KBCA 3QHRA 3IO7A 4FT5A 1PXOA 2R3KA 4MEDA 5BMMA 2AC3A 4B7TA 3HAMA 2VTRA 1M14A 2W7XA 3AC4A 5AM6A 4ACCA 1KSWA 2ITZA 1MRVA 2C3IB 4PP9A 3RPVA 3BZ3A 3DB8A 4B0GA 3ACJA 4DCAA 4GSBA 3I5NA 4O7NA 4XV2A 2HWOA 3FY0A 3DCVA 3VC4A 2OJ9A 3AC2A 3ORLA 5LMAA 4TWCA 2O0UA 5BUJA 4XCUA 2HW6A 3BLHA 4V0GA 3H0YA 3VBTA 2XA4A 4NM0A 4ZJVA 4KINA 4GV1A 1Y57A 3MFSA 5EOBA 2XKEA 4JAJA 4WNKA 3W33A 1DS5A 4C2WA 2X2KA 2W96B 1FBNA 1XQZA 4CFVA 3EQCA 3IDBA 2R3PA 5BX0A 1IASA 1PY5A 4AGWA 2JBPA 3W10A 5AAEA 1K9AA 2WAJA 3OEZA 3QTZA 3TNWA 3GUBA 2JIVA 3JS2A 2ZB1A 4QP9A 4JIKA 4HW7A 1JSVA 5EOLA 2C0TA 4BDDA 1PJKA 3RPYA 3PPZA 5M56A 4EZ7A 3PZEA 3R1QA 3IOPA 2A4LA 4AW0A 3CQWA 4CFXA 3R01A 5E7RA 2ITTA 3BCEA 3QFVA 2YABA 4J1RA 2Z7QA 1UVRA 4FKOA 4FK6A 4WUAA 4ANMA 4BGGA 3II5A 3DV3A 4GU6A 4XS2A 4YJUA 1FMOE 2BDWA 2IVTA 3ZSHA 4DEHA 1FGIA 3PWDA 1NW1A 5HIBA 3CJFA 3IGOA 4KIOA 5AP4A 1JQHA 3RP9A 2NPQA 5FGKA 2B52A 3T3UA 4A4XA 4EH2A 4O7RA 4LRJA 3FLZA 4QT1A 3ZSGA 4APCA 2ZDTA 4IWOA 4UV0A 2PVLA 4FR4A 3EFWA 3MVJA 4BCFA 1ZMWA 2JFMA 1FVRA 4HVIA 4FIJA 2BZJA 4XYFA 4BCJA 5ANGA 4IVAA 4JX3A 4YZ9A 3DY7A 3QRJA 4CFUA 5CSVA 2R3IA 4C61A 5CT0A 2F2UA 3ATTA 3GOPA 3DGKA 4YHJA 2XEYA 5AV1A 2YLFA 1WFCA 3C4ZA 4HYUA 5H3QA 2OSCA 2YIRA 4AOJA 4AT3A 5CEIA 3TXOA 4BZDA 2OIQA 5DOSA 1Y6BA 3PXZA 5E8TA 3Q04A 4CRLA 5C8KA 4FSRA 4MTAA 2OBJA 2KULA 2WQMA 3ZSIA 3GCQA 5EM6A 4Q9ZA 3R1NA 2WMTA 5H2UA 5CAVA 4R7BA 5KMKA 5M07A 1JPAA 3L9MA 3KL8A 5LVLA 2W4JA 3R71A 4EQUA 4Z16A 1YI6A 2B9JA 1AQ1A 5DYJA 4FX3A 5C4LA 4QYHA 4RX9A 3ZFMA 3VUMA 3PLSA 5DHJA 4FTJA 5CU4A 4A9RA 4MKCA 2QOKA 5JSMA 4D55A 4V04A 3G0FA 1IAHA 4NYEA 3CS9A 4EBWA 5K5XA 4H3QA 4DEIA 3VJNA 1ZZ2A 4YC3A 3OEFX 4EK8A 2RL5A 2UZEA 2OGVA 4JDHA 3F9NA 4FTTA 2WELA 1WBWA 5CU2A 2R0IA 4R5SA 2F9GA 3PPJA 1YVJA 1Z9XA 4XH6A 2YAKA 2G2HA 2F4JA 2R4BA 4G9CA 4AZFA 2HCKA 3IW8A 1P4FA 2WD1A 3BE2A 4NT4A 2OU7A 3AT2A 1OIUA 2PHKA 3TNPC 1YHWA 2W4KA 1RDQE 3QKMA 4OTPA 3TNQB 4JLCA 3F2RA 4BI1A 2ITWA 3D7TA 4LG4A 4U42A 3Q6WA 4GH2A 4DGNA 4S33A 3C0GA 5DR9A 5LWMA 3W55A 3TJCA 3CSVA 5J95A 4EORA 3M2WA 4AX8A 3ORTA 4F0FA 1ERKA 3OBGA 4NUSA 3HLLA 3KRXA 2X8IA 3O7LD 4JG6A 1YHSA 4H1MA 5EW3A 2OH0E 3UOHA 4TYJA 5AUZA 5ETCA 4J8NA 4NCTA 2ZM3A 5AP5A 1M2PA 4NM7A 3UOKA 5B2MA 3PRFA 4FF8A 4K11A 4ZJJA 1SYKA 1GIHA 2OJGA 4RIXB 5AX9A 4KIPA 4G2FA 4F6SA 2BAQA 2OKRA 3OCBA 4OR5A 4TWNA 3WF6A 3WBLA 2JKMA 1QMZA 3KU2A 3VW8A 3SXSA 2ETKA 2QQ7A 4NSTA 4RZVA 4QMTA 3R7YA 4Z55A 5HU3A 1J7UA 3F3VA 3FL5A 3DKOA 2H6DA 3FZOA 3O8UA 2AUHA 3BQRA 2WTWA 3QALE 2OFUA 4HPTE 4AACA 5KKRB 3AXWA 4FEUA 4ACDA 2QHNA 4MK0A 1SVEA 1PW2A 4GW8A 2ZM1A 4PX6A 5DVRA 5CF8A 3E8DA 1O6KA 3JXWA 1U54B 4YJTA 2X9FA 5EHLA 3NNVA 3SW4A 4FKQA 5EHOA 2JEDA 4CGAA 3R8LA 4AUAA 3LJ1A 3LXNA 5FWKK 4L42A 4FKGA 3BEAA 2HZIA 3PFQA 5HE0A 3A7HA 1YXUA 2YCSA 1CTPE 4UX9A 1H0VA 5LQFA 2WMRA 3ZONA 4CZYB 3U6HA 4CG9A 4X3FB 4L00A 4F64A 5I5ZA 2BVAA 2JDTA 3LVPA 4ITIA 2YZLA 3TDWA 4CKJA 4D2SA 4ZS4A 5LXMA 3WYYA 2X6EA 4WNMA 2R2PA 1Y91A 1K3AA 4MXAA 3AT3A 2PY3A 4YNEA 2YA9A 3FUPA 4X2JA 4O7ZA 2WHBA 1PYEA 4DF3A 4JBPA 4M8TA 4ZTLA 4C59A 5CF6A 3LE6A 3OTVA 1MRUA 3F7ZA 4MXOA 2GTMA 5E8WA 1Z5MA 4Q2AA 3ORKA 1YWNA 3R8UA 3PWYA 4MHAA 4EC9A 4L9IA 5HD4A 1BYGA 2YHVA 1R1WA 3Q2MA 4Y5HA 4AGUA 5EI6A 1OBGA 3SGCA 4DTBA 3IDCA 3EOCA 4LV8A 2J5EA 2XKDA 4TYIA 1Q5KA 3D15A 2DUVA 5HVJA 2OLCA 4ZMEA 1HCKA 1OL6A 1JKLA 1UKIA 3UC3A 2IJMA 4XJ0A 3AGLA 3ORMA 3PY0A 3ZM4A 2I0YA 4DFLA 3UIXA 2A27A 4NIFA 4AOIA 3H0ZA 3OC1A 4CSVA 2CKPA 3I79A 3FMMA 4C62A 1NY3A 2J7TA 1Q99A 3QQGA 2VTQA 5CSWA 4N57A 4L44A 4BB4A 4EH3A 5FTQA 3O2MA 4U81A 5TOZA 4RJ5A 3B8QA 4ID7A 5D10A 1MP8A 1J7IA 5CVHA 5JT2A 4EH6A 4IBMA 3UVPA 5LCKA 2OF2A 3FDNA 3GU8A 2CKQA 3QCQA 4ZXTA 4EKLA 2XK3A 4PL5A 1ZZLA 5HD7A 2GNHA 4B99A 2QOOA 1YDTE 3DS6A 3HP2A 3D5UA 3EQFA 4YURA 2BUJA 5FBOA 3KXMA 4AQCA 3F6XA 3R7UA 3R8PA 1KV2A 4IH8A 1M7NA 4R3PA 4DGMA 3D83A 3BEGA 2R9SA 5DR2A 1KE8A 4X3FC 2G01A 2C1AA 3SA0A 2QKWB 3G51A 3LLTA 4M7IA 4UYAA 3VQHA 2V7OA 2PWLA 4EYJA 2EXCX 2J90A 2YIYA 4Y83A 5BYLA 3E93A 5CZHA 3VS4A 4RIYA 2XNOA 5AR5A 3ANQA 2CLXA 5IF1A 4RA4A 2VTHA 2W1GA 5L8KA 5J87A 3E3PA 4NKSA 5JZNA 4QMXA 4FC0A 1PXMA 2PVKA 2XIYA 5CF5A 3B2TA 3GBZA 4RWKA 3R9RA 4ZY4A 4NEUA 1JBPE 3SOCA 2VX1A 3MGYA 2QO2A 2GU8A 4B6LA 4KKEA 3P4KA 5BVEA 3OVVA 4EOLA 3BHUA 3L8PA 5K4IA 4F9CA 4FMQA 3GNIB 4M84A 3ALNA 3VVHA 3LKMA 2C6OA 3R0TA 3ZZWA 4OTHA 3C0HA 2P2IA 3ROCA 3SX9A 4KAOA 2YAAA 2YDKA 1OPLA 3FKLA 4ERKA 2C5VA 4TNDA 4UWBA 3SQQA 4UMTA 4FIEA 1R0PA 3TUCA 4KSQA 2WQNA 3FZTA 1W84A 4CD0A 4ZZOA 4LL0A 3O23A 2X6DA 3OG7A 5FEEA 4BZOA 3O17A 4UXQA 2HAKA 5BUIA 4TYHA 5GZAA 1H1PA 3AD5A 3MWUA 5B0XA 3R1YA 1ZWSA 4OTRA 5EKOA 4YTIA 5L8JA 3SRVB 4IANA 4ZSJA 2GS2A 3SAYA 1VEBA 3LFEA 4FKSA 5JFVA 1P2AA 4YGAA 2P4IA 3OXTA 3PIXA 2CGUA 3W1FA 2EUFB 2PMOX 2VX0A 3DNDA 5I3OA 4ANQA 4DLJA 5LMBA 4QMPA 4OTQA 4A9UA 4BC6A 4JRVA 3UNKA 4PUZA 4WD5A 4F0IA 4C57A 2GNLA 4HNIA 4ZSGA 4M69A 2WTCA 4Z3VA 3K5UA 5DN3A 4MXZA 2PULA 3HUBA 3P86A 4FSYA 3VULA 2P3GX 5B2KA 2ERKA 4G5JA 3ERKA 2W1DA 3POZA 4S34A 4DAWA 5D1JA 4W4YA 4IACA 3U54A 2VV9A 5HLWA 3UZRA 2OXDA 5CEQA 4IB5A 3F69A 4C35A 4CKIA 2YACA 4DFBA 2RFEA 3QKKA 4IAIA 2XF0A 4S31A 2CNQA 1GZOA 3PSCA 4YJVA 3ZM9A 5CENA 3AG9A 3JVSA 4RT7A 2V22A 5J9LA 3OCTA 5GJGA 4F65A 2CHLA 3EN6A 4MWIA 4F7JA 2NRUA 3MV5A 4IVCA 2R3GA 3A7IA 3G6GA 4XG7A 5T6KA 5AV0A 4E5BA 2Z02A 1ZY4A 4TWOA 4I93A 4UWCA 4FICA 1STCE 4O21A 5IKWA 4ALVA 5M4CA 2X7GA 1H8FA 3NR9A 3R7VA 4D5HA 5J9ZA 4ORKA 4DFUA 3CPCA 5HKMA 3F3UA 4GFGA 3Q4ZA 1PXLA 3BYOA 3Q6UA 1NXKA 4R1VA 4F08A 4BY9E 5DFPA 3UQGA 4IZYA 4C58A 1V0BA 3QQKA 3RCDA 3S00A 3PUPA 3DKCA 4X2NA 4F7NA 3L8VA 5A4QA 5CLPA 1NVQA 3ORIA 1BX6A 1E1VA 3PIZA 3MB6A 5IA1A 4DLIA 4KIKA 3CCNA 2IPXA 3KRRA 3QAME 5KNJA 4PMSA 1L3RE 3WF9A 4YSJA 3MS9A 4RQVA 3LFSA 3JPVA 4BRXA 3FMDA 5HE2A 4XP2A 2JDRA 5L2TA 3Q53A 3ZYAA 4AA4A 3DBDA 4AZSA 2CPKE 4OTWA 5HCXA 3E87A 3FZSA 2W1ZA 3G9LX 1IEPA 5E90A 1SZMA 5E8XA 4OTFA 1SNXA 3R21A 3TUBA 3LFCA 3A8WA 4RC4A 3LFAA 3LCTA 4RFYA 4M67A 3KXZA 3M42A 1KOBA 3NUNA 3E7VA 3F5XA 5AUYA 1DAWA 4RX5A 3N4TA 5JH6A 2Q0NA 2UZTA 4DBNA 3LMHA 4MNEB 4XG2A 2VWZA 4AG8A 4RZWA 2VTTA 4ZOGA 4F1MA 4B8MA 3BGPA 4I6FA 5EI2A 3GU4A 3U4WA 2BILB 3P79A 2CNUA 1DM2A 3TIZA 3TZMA 4O0WA 5D41A 2C3LA 5IA4A 4DEGA 3CKWA 2F7ZE 2P0CA 2CCIA 5C27A 3ZRLA 5CSPA 4D0XA 1Q61A 1PF8A 4YC6A 3W8QA 5AUVA 4HVHA 2HWPA 4EH7A 5ITAA 1U5RA 2UW9A 3LJ0A 4OW8A 2J0JA 3PJ2A 3ZCLA 1OGUA 3PE2A 5M4IA 4YJNA 4C7TA 3IDPA 5FTOA 3BYVA 4AZEA 2ZOQA 5AA9A 4ZZMA 2UV2A 4XV9A 1WMKA 3KKVA 4QYFA 4IXPA 2X8DA 3CEKA 4FSZA 4RQKA 3FSKA 1ZYDA 4FKRA 4L7FA 2ZDUA 3MA3A 1E9HA 2UZWE 3QTRA 3EWHA 2G15A 2VGOA 4GT4A 3I6WA 4FKLA 4EH9A 3C4CA 3UP7A 5CQWA 5FEQA 3N4UA 5AIKA 5JFWA 2GDOA 4AOTA 5A4LA 3W32A 3OY1A 1U5QA 4Q5EA 2AC5A 4XNEA 4U43A 5A14A 4IFCA 4RG0A 3ORZA 4E93A 1OECA 2E2BA 3GCPA 4RJ3A 5LMKA 3COKA 4G3EA 5JGAA 3IONA 4P90A 3HRFA 5KMOA 3SC1A 4EOMA 5IQGA 4BFMA 5TO8A 4LFIA 5GNKA 2PTKA 4BTKA 1J1CA 1JNKA 4Z7HA 3E62A 4XLIA 2FUMA 4PPAA 3DKFA 3GGFA 3GENA 2W17A 2PVJA 5M51A 4XRLA 1PRYA 4M97A 3VHKA 4BN1A 2YM6A 1YWVA 2EWAA 2YCFA 2QKRA 3SHEA 4UMRA 3ZLXA 4DG2E 2YCRA 1PXJA 4I21A 4I23A 4I4FA 2GNJA 2BRMA 2ITQA 4CMOA 2RKUA 2R3FA 4NU1A 3A61A 1T45A 3DK6A 3GP0A 1IG1A 2F7XE 4U5JA 2VWVA 4QMOA 4Y95A 3FMHA 5LARA 4ZK5A 5HVYA 3I6UA 4X2FA 5T3QA 5JFSA 2WNTA 5AFVA 4ZTNA 4PP7A 4D4RA 3UIBA 3HMIA 4IIRA 4EC8A 1IA8A 4JRNA 1OUKA 2W1EA 1Q24A 4V0GB 5HG5A 4CFFA 4FUYA 4EUTA 4FV9A 5HGIA 1MQBA 1WBVA 5ETFA 4UBAA 2QOBA 2ZJWA 4D0WA 2C5OA 3VUGA 3BU6A 3UNJA 3ZTXA 1WVXA 3ALOA 3QQJA 1DI9A 3BGZA 3G15A 2LAVA 2C3KA 1HOWA 4GU9A 1OIYA 3IOKA 4C4IA 2PU8A 4X2GA 4O7YA 3MN3A 5HX8A 3R7IA 4KUJA 3LZBA 4N0SA 3ZBXA 3FLYA 2XIKA 3ZXTA 3DXNA 4MVFA 3RGFA 5J5SA 4QMWA 3F3TA 2HELA 2WQBA 2Z8CA 2YDJA 4O2PA 1M2RA 3IPHA 2WOUA 4FODA 2X4ZA 2Y7JA 3OCSA 5IQFA 4F9AA 5A6NA 3DJ7A 4F7LA 4GYGA 2WPAA 2VTSA 1Q8ZA 3PY3A 4EWQA 4O0TA 5KMNA 3JY0A 5IISA 1ZAOA 1VJYA 4X21A 4HVSA 4G3FA 4E1ZA 3BYMA 3R7EA 4A9TA 4CEGA 5DG5A 1B6CB 4ZSLA 4WG3A 4RVMA 3TZ7A 1Q97A 3DAJA 2FSMX 4I1ZA 1S9IA 3UPXA 4YBKA 2OIDA 3NMUF 3FY2A 4C8BA 5FRIA 4JR3A 3U6IA 4ZAUA 2Y8OA 4W4XA 3R8ZA 4K1BA 3VIDA 2FSOX 4DG3E 3DBCA 4AT5A 4YJOA 3FXWA 2JKQA 3RK5A 5AUWA 1H07A 4M66A 4AA0A 4TYGA 4QP2A 3VUIA 1ZMVA 4R5YA 3RKBA 4JG7A 1XKKA 4WG5A 2RF9A 3IS5A 4JG8A 3MDYA 5EYMA 5TKDA 3SW7A 3QGYA 5JEBA 3I0OA 2ESMA 3FWQA 4O96A 3ZO2A 2XJ1A 4EH5A 3PVUA 4L3JA 5KCVA 3P5KA 2IG7A 4L6QA 4PMTA 4I6QA 3H3CA 4FA2A 5EQEA 4R1YA 2B54A 1ZY5A 5IZFA 2FH9A 4GVJA 4X2KA 1H00A 4PQNA 2XH5A 5DEYA 3WI6A 2BTSA 1W83A 2Z7LA 3CQUA 1REJA 2GHLA 3BGQA 3VN9A 4CCBA 2WEIA 3NCZA 4FTMA 3R8VA 4O7SA 4RVKA 2ONLA 4ACGA 5CS6A 4JDKA 3ATSA 3OOMA 3AC5A 4HGTA 3K5VA 5H8GA 3TCPA 4GK4A 3DU8A 4U7ZA 1NA7A 5IUIA 4ZY6A 2CJMA 4WKQA 3PSDA 4DEDA 3NVKI 2XIZA 3OWJA 3HV4A 4WSYA 5H8EA 2IWIA 5GZ8A 5IH4A 2WQEA 3F3WA 3SLSA 2OG8A 3POOA 4QQTA 4B4LA 2JDVA 2WIPA 4X6RA 4EJ7A 4FYOA 2BR1A 3V5PA 4ACMA 4L67A 2PE1A 3LFBA 2UZNA 4K6ZA 3QBNA 4GT3A 1L8TA 1CDKA 4YZMA 1V0OA 3QTUA 3RPSA 5M06A 5KZIA 1FVTA 2IW9A 4EYMA 5A4EA 2EB2A 5IA5A 5I9VA 3TTIA 3QRKA 4FNYA 4MBJA 5EDRA 4FEVA 4HVGA 5JK3A 5KE0A 1KUTA 4QOXA 4TTHB 2ITXA 4HJOA 3L8SA 4CMUA 4DC2A 4BKYA 2O8YA 4D4YA 2EU9A 4FL3A 2FGIA 3TZ8A 3D7TB 2BRHA 4JXFA 4EZ3A 2IW6A 3HAVA 3DBFA 2WMUA 2QR7A 3ORPA 3R8MA 3UIUA 3OBJA 2PUPA 2R3JA 5KBRA 2YJSA 3UVRA 5J1WA 3RNIA 5HZNA 4GKIA 4FZDB 1WVWA 3KEXA 2QC6A 4MF1A 3HUCA 5AP2A 1LEZA 3EQBA 3FMNA 4IZAA 1W98A 4R3CA 5KMJA 3BYUA 2BALA 2JIIA 3CLYA 3UODA 3VF9A 5E9EA 2R3HA 4NM5A 2XK7A 5F20A 3W2SA 5CEKA 4M0ZA 1GIIA 4O0UA 3SXFA 2YEXA 5TR6A 4FKUA 3TKIA 3R6XA 4QP1A 4EHZA 2GSFA 4YC8A 4L53A 5AWMA 2YIQA 5ETIA 5AX3A 5FLFA 2ZAZA 4GJ3A 4DITA 2PVNA 4YJRA 1UNGA 3MTLA 2VWWA 4IAZA 3AGMA 5I9WA 3ZU7A 3DZQA 4F9WA 4DE4A 3BWJA 2E9NA 5BPYA 1BI7A 4CKRA 3QUDA 2C6IA 3FMJA 5BYYA 4NM3A 5D11A 3BV2A 2VNYA 3FHIA 4GFMA 4FT0A 4E4MA 3MY5A 2BKZA 4V01A 3LAUA 3D14A 4LGHA 4AFJA 5D9HA 1UU7A 3HA6A 2PE2A 3RVGA 2QODA 4HGLA 4HCTA 5EW8A 2V55A 3WOWA 2ZV2A 3EN7A 1H24A 1Q41A 2WU6A 3QYWA 1G3NA 4FTCA 2QOQA 2UVZA 3HRBA 1TQPA 3E8NA 3EKNA 4LUDA 4E3CA 2JD5A 3CGFA 2I0HA 3FYKX 4BGQA 5G6VA 2H8HA 3HDNA 4J8MA 1U46A 3PIYA 1PKDA 4UY9A 4Y85A 4RPVA 3UBDA 3WZUA 4ZMFA 5CX9A 4G1WA 4B9DA 3QTXA 1ZOEA 4O38A 4J98A 2UW6A 4LOQA 4OTGA 5CF4A 3MPTA 3ENMA 5M53A 1XH9A 3AOXA 2A19B 2R3RA 2XBJA 3FPQA 4LOOA 5I9XA 5HO6A 5HBEA 1OMWA 5K3YA 4NCTC 3QRTA 4BGHA 3KA0A 2NNWB 3W16A 4FNXA 4EZ5A 3EN4A 4DA5A 2PZRA 3PVWA 2J51A 4A4LA 4UALA 4RJ6A 5JKGA 3FZ1A 2A2AA 3FXZA 2UUEA 3QZHA 4PL4A 2VNWA 2W9ZB 3NDMA 4NIFB 3TTJA 2CSNA 4KNBA 4FV4A 4FV6A 4ZZNA 3LFFA 2QOFA 3FV8A 2HXLA 1UU8A 5KZ0A 2I40A 4LV5A 4MXXA 4KS7A 5L2QA 4D5KA 2HOGA 3K2LA 3V8TA 3BYSA 4XG6A 5EDQA 3FI3A 4R77A 3C5UA 4FT9A 1YXTA 4IB3A 1M2QA 4D2PA 2VWXA 4D58A 2FSLX 3EL7A 4U3ZA 5CU6A 3R9NA 2Q83A 5C01A 4ANSA 3RAIA 2J50A 1Y8GA 4EHVA 2JKOA 4BDIA 4EK3A 3HKOA 4QMNA 3E8EA 3PLAE 5ACBC 3VS1A 2LGCA 4FSNA 3MW1A 3RAHA 3V6RA 2P2HA 2IVVA 4IAKA 4E8AA 3DFAA 3KB7A 3OTUA 4BTFA 3R7OA 3PG1A 4YZCA 4IJPA 2VTIA 3WZEA 5KBQA 5M4FA 2GNGA 4FSUA 4YLLA 4APPA 2B9FA 2QI8A 4GUEA 1FGKA 5ACKA 3RM7A 2WTJA 2FO0A 4PMMA 3R04A 1TQMA 4RLLA 1UNLA 3A7JA 3PJ3A 3FXXA 4BHNA 4QMQA 3A62A 4NTTA 2VX3A 5JGDA 4RIYB 5IEVA 4OAVB 2PZYA 3ODZX 4MQ1A 3RWQA 2QNJA 1UV5A 2C6TA 3JY9A 4F9YA 3FL4A 3BU5A 4A9SA 1JSUA 2VTPA 4M0YA 3VF8A 3F88A 4ZS0A 5E8SA 5TF9A 4EHEA 3NPCA 3JUHA 4QTAA 5EM8A 1OBDA 3EIDA 5AP0A 2VTLA 1FINA 3ZFXA 4BL1A 3OCGA 1RE8A 5FP6A 1ZLTA 4QP7A 2VGPA 4O1PA 5AMNA 2ETMA 2JGZA 4Z9LA 3ZO4A 2B0QA 3SG8A 3EQDA 5IUHA 3HZTA 4KD1A 2R64A 4FGBA 4IEBA 4CT1A 1SVHA 1URWA 2EXEA 2ITUA 1U4DA 4Y72A 1OL1A 3D4QA 3NNUA 1YKRA 4RWIA 5L8LA 4L3PA 4A7CA 2O64A 5AR7A 1Q8WA 4FUXA 3NYVA 3OS3A 4G6LA 2BCJA 2BKKA 4IVBA 5HEZA 4TKSA 3EH9A 3SDJA 4DHFA 3VS3A 3SVVA 1H08A 3B2WA 4EKKA 5FDPA 3EN5A 4E6CA 1KE5A 4WUNA 5HESA 3F5UA 4QQ5A 3V8SA 4EOKA 3RINA 4TYHB 2R5TA 2UW8A 2W9FB 3HDMA 1Q8YA 1QCFA 2XP2A 3KMMA 3RPRA 4WNPA 4G3GA 4FZAB 3T9TA 5EH0A 4XBRA 5GIOE 3UYTA 1OL5A 4K0YA 4O7TA 4F99A 3WF7A 5BMSA 2P33A 2C6KA 4HPUE 4WSQA 3KXNA 4XUFA 3K3JA 1GAGA 4QP3A 4IWQA 3LW0A 4RJ4A 3G9NA 4AU8A 3DFCB 2W05A 4TZRA 1BMKA 4R7HA 1YQJA 2XNBA 4M69B 3R2BA 2WTIA 5KKRC 2ZV9A 2VWYA 2SRCA 3AMYA 3CTQA 3NUUA 3ZLSA 5IDNA 5EQYA 5L6OA 2QOIA 2CGVA 3DPKA 3ODYX 3RMFA 5EFQA 1F5QA 4Y8DA 1F0QA 4JBOA 4DINA 1AGWA 3NZ0A 4LL5A 4EOIA 4G31A 1Q4LA 3ORXA 4XG4A 2F7EE 3Q4TA 2WGJA 3K3IA 4BTJA 4O84A 3BU3A 3QTIA 4HYHA 4OT6A 1KOAA 3QQUA 4RIOA 5JQ8A 5C4KA 3NX8A 4O83A 3DJ6A 2YISA 2YDIA 2XM8A 3EQRA 4BCGA 5DMZA 5JZJA 3LFDA 4FTIA 4RA5A 2PZPA 3G5DA 4GJ2A 4QTEA 3RZFA 1MQ4A 3IW5A 5EM5A 5AV3A 4USFA 2QOLA 3A8XA 4JR7A 5C8MA 4IZ7A 2PZ5A 2ZMDA 3DBEA 4FTQA 4M15A 3HVCA 4DN5A 2BPMA 2VTAA 3Q96A 3MBLA 5FD2A 2XIXA 3I4BA 3FLNC 3CC6A 3EKKA 2XS0A 4E6QA 5IMEA 5FP5A 1UWJA 4UWYA 4O6EA 4AP7A 4CCUA 1ATPE 5HNBA 2C5XA 2FSTX 5HNGA 2O5KA 4D9UA 3MA6A 4I6BA 3UJGA 3ZLYA 3QZFA 4C38A 1CSNA 4FZ6A 4GT5A 2UW4A 3DLSA 2RFDA 4YJSA 1YHVA 1YXXA 4RLKA 4KIKB 3EMGA 2OZOA 3FI4A 3CY3A 4FTLA 2WFYA 4MD7E 5DIAA 5FXQA 3R9HA 5DGZA 2Y6MA 2UZVA 3V8WA 2FVDA 3FI2A 4GK3A 3A7GA 5L2WA 5EHYA 1UA2A 5I3RA 5FXSA 1ZXEA 2OICA 1OIQA 3R02A 4Y46A 4C4EA 2UW5A 3O0GA 2CCHA 3MFRA 2C3JA 3KMWA 3OWKA 1KE7A 3H9OA 3BHYA 3PXKA 3RAWA 3VS6A 4CV8A 3BBTB 1M52A 5IDPA 3FMKA 4MH7A 5AEPA 3K54A 3C4XA 4TWPA 1W7HA 2XCKA 2GS6A 5HI2A 2XK8A 1H26A 3EZRA 4KIQA 5CEPA 3PJCA 2R7BA 3Q4CA 2FB8A 2RIOA 3PJ1A 4QMLA 3V5JA 3VBQA 4I5MA 2WIHA 3CP9A 5A46A 5TT7A 3ANRA 3S95A 3TNIA 3ZC6A 3S4QA 4O86A 2ITPA 4PF4A 3OT8A 3L9NA 4FKIA 4PNKA 4ZEGA 1QPCA 3H10A 3F7WA 4JX7A 4FOCA 3VBWA 4D1ZA 2W4OA 4IX6A 3E8CA 2G2FA 1I09A 3VJOA 4BKZA 3FZPA 4GVAA 2GQGA 4EH4A 1LP4A 4ONAA 4A07A 2W1FA 3UO5A 1W82A 5DE2A 4JAIA 4AAAA 2PMLX 3GOKA 4P7EA 2BAKA 5AP7A 3IW6A 3NW5A 4DH3A 2FYSA 5IEYA 1ZMUA 1GZKA 2UZDA 2CN5A 3VBXA 3VHEA 4BIEA 2X0GA 2I7QA 4C36A 2GNFA 4ANOA 3PVBA 5KHXA 4U40A 5F95A 4BDFA 2JLDA 2VN9A 2QOCA 1JKSA 2YITA 3QRUA 3QLGA 3R83A 3ZDUA 3RBWA 3HX4A 4AFEA 4NWMA 1E1XA 2XBAA 4BYJA 3V5LA 5GJFA 3VS7A 1FMKA 2XYUA 3PE1A 2IZUA 4USDA 3WIGA 2HENA 2V7AA 4X6QC 3UC4A 2J4ZA 4OAUC 4JS8A 4CLIA 4H1JA 3ZEPA 5IMXA 2CGXA 3HMMA 2IZTA 1NVSA 2VO7A 1GJOA 4QTCA 3PDTA 4I41A 4J95A 3KULA 2R3OA 2C6LA 3BELA 1JOWB 4XOZA 4D4VA 3REPA 3TV4A 4F6WA 3GCVA 4JQ8A 2A1AB 2PMNX 2GFSA 1OI9A 2WO6A 4YZDA 3TKUA 4EK4A 2BRNA 3IW7A 3VUDA 1IA9A 3BHHA 3WZJA 3AMAA 4FEWA 1MRYA 2P55A 4O2ZA 4YTHA 5IQBA 4HCUA 3QTQA 4GK2A 1P5EA 2V62A 3OUKA 2HY81 3UTOA 4DFYA 3TN8A 3UO6A 3SD0A 4O0VA 2X1NA 3I0QA 4O81A 4QMVA 4ZTQA 3ZC5A 4NTSA 5GZ9A 4DH1A 4U41A 4YZNA 4CRSA 4IM2A 3ZXZA 1PMNA 2QONA 5L2IA 2QO9A 3A7FA 5HG7A 1T46A 3MJ1A 2C6DA 1V0PA 4JDIA 4LRMA 5J9YA 4JDJA 3QA0A 1OKZA 2Q0BA 2XCHA 3QD4A 4C02A 2XKCA 4BCKA 4C37A 2BAJA 4CFMA 2YM3A 1J1BA 5CVGA 3HEGA 2C5NA 1Q8TA 4WBBB 4GEOA 5L6WL 4JBVA 2ITVA 3BX5A 3GT8A 3OF0A 2B55A 4W4WA 1P14A 3RPOA 5LVOA 1BL6A 4QMUA 4EK5A 4U44A 4ASZA 3S3IA 4HCVA 4XX9A 3CBLA 5CWZA 3W2OA 4BTMA 3MVMA 3ZO1A 3DAEA 2NP8A 3DDQA 3EFKA 2HK5A 3O96A 5K4JA 2B53A 2Z2WA 4ZSEA 4DFXE 3IK3A 3I60A 2KTYA 4G6NA 3EFJA 1FPUA 5JMSA 1J7LA 5CYIA 5EQPA 5FBNC 3UVQA 5CAUA 3I7CA 4DFZE 4J52A 5LMKC 4QYGA 3VBVA 2GFCA 4TT7A 4K9YA 5DT0A 5KMMA 3V51A 4CMTA 5CAOA 3I7BA 5CALA 1OL2A 5LOHA 4ZLZA 5AADA 4OBQA 4TW9A 5L3AA 1UNHA 1FOTA 3DT1A 3RNYA 3OUNB 4IFGA 5FTGA 4NW6A 3OROA 3Q3BA 4HNFA 3BLRA 3CXWA 4YBJA 5DH3A 3I81A 5BVKA 5AP6A 4DEBA 4BWPA 4F0GA 3NVMB 5IQHA 3O51A 3UMWA 4AE9A 3EFLA 4PWNA 5AV4A 3QLFA 4L68A 4D4SA 2F49A 4MD8E 5HG9A 3U51A 3QCSA 1PKGA 2JIUA 1CKJA 3EB0A 5DNRA 2REIA 4UZHA 1Q62A 5JRQA 4IM0A 3DAKA 3EJ1A 4FTRA 4FBXA 4BDHA 4UMQA 4H39A 5CEOA 3HV7A 3UO4A 4I92A 3Q9WA 5D12A 1YOMA 4YP8A 5CXZA 1CKPA 4ASEA 2VU3A 3T9IA 5KMLA 3EYHA 3LMGA 4W8DA 4QNAA 4G9RA 5M09A 4E4XA 3UZTA 4FIGA 3TKHA 4QMMA 5BYZA 4IAFA 4RJ8A 1WBSA 3CY2A 2HZ4A 4U97A 3ULIA 5GIPE 3KF4A 3KVWA 1G5SA 4OTIA 2YWPA 4R3RA 5BVFA 4PTEA 3S2PA 4AW5A 4RX8A 3MFTA 3U4UA 1PMVA 2I6LA 4FKWA 2BHHA 5AAFA 3VS5A 4YZBA 5AR3A 3R1SA 2JKKA 4YMJA 5BVDA 1KV1A 3P08A 2FA2A 1ZYJA 4ENYA 4NJDA 1S9JA 3DTCA 3MH3A 1M17A 2WTVA 3MB7A 5DPVA 3AC8A 1Z57A 3F82A 3H9FA 4O22A 3ZOSA 3RCJA 1W0XC 5J7HA 4BIBA 1O9UA 3M11A 2VWBA 3A4OX 3R9DA 3RALA 4O82A 3F5GA 4CLJA 4X0MA 5H9BA 1PXKA 4LI5A 1H1SA 4LOPA 4USEA 3LQ5A 1R78A 5ANEA 3BLQA 4XLVA 2OFVA 4UXLA 1G8SA 4GG5A 1GOLA 3RJCA 4O0YA 3KN5A 3LMIA 3COHA 3DNEA 2XZSA 3QZIA 4FTOA 4LYNA 4P4CA 4P5QA 1XJDA 2VTJA 3FSFA 5ICPA 5IEXA 5IQIA 4MD9E 4GFOA 4CG8A 4DEAA 3ACKA 3AC1A 3ROYA 2C6EA 4RFMA 4G3DA 2ERZE 2QHMA 5A4TA 5HIEA 3ZUVA 2UVXA 5J1VA 4FIIA 3BQCA 2IVSA 4FG9A 2ZV7A 5IQAA 5HCYA 2XNMA 4ZSAA 3UG2A 3ZHPC 4BDEA 4GL9A 4YJPA 4ALWA 4ARKA 2WXVA 3HGKA 4J97A 2E9UA 5CSHA 3W8LA 1FVVA 4GIHA 2UZUE 5AIRA 4BCQA 5AA8A 4G16A 3QYZA 3AD4A 4E4NA 3MH1A 4EOSA 3WZDA 4KKGA 1REKA 1TVOA 3C0IA 2XRWA 2C5YA 3PSBA 4ZJIA 2RFSA 2E9OA 2HIWA 3FC1X 4RGJA 4QTDA 5CVFA 2ONLC 3R73A 4FOBA 4GS6A 4IJ9A 4RIWA 3SOAA 3ID6C 2JFLA 3NW6A 3VQUA 4BBEA 2J6MA 4B8LA 4K33A 2C30A 3GFEA 3OFMA 4R8QA 3E92A 3GCUA 2GTNA 4U79A 2BMCA 3NWWA 2O65A 3LXPA 4OTDA 2IZRA 5CXHA 5E8UA 4CXAA 4I5CA 2BFXA 3FLWA 2R3QA 3KXGA 5B7VA 2R0UA 4GUBA 5DT3A 3RK7A 4EI4A 3R30A 1URCA 2XK4A 4J71A 4NKAA 3EN9A 5FM3A 5HQ0A 4TY1A 3ULZA 2GHMA 3A4PA 3G6HA 3HP5A 4LQMA 5LVNA 1RQQA 4FT3A 4H3BA 5BUEA 4KBAA 5F4NA 3UGCA 2BZIB 2IO6A 4D28A 3QUPA 2R7IA 5HORA 3QZGA 4FVRA 5HX6A 4H36A 4ZY5A 2J9MA 4FEQA 3G33A 1WVYA 2GMXA 2J2IB 4NW5A 4XMOA 5HE1A 2WQOA 5C9CA 2WEVA 4QP8A 1WBPA 3PRIA 4IX3A 3ZH8A 5JRSA 5CTPA 4WBOA 5DWRA 3VNTA 2X9EA 4UMUA 3Q5ZA 2RG5A 1APME 3DXPA 2X8EA 3QC4A 5I9ZA 3Q32A 2J0LA 2BDJA 1KWPA 4L45A 3UNZA 5K0XA 5EM7A 3P78A 4FE2A 2RG6A 4FK3A 5DEWA 3GC8A 4MF0A 5K9IA 3P9JA 3HV6A 3QQFA 5E8VA 4BICA 2Y0AA 2WMWA 5L4QA 3S1HA 3OWPA 2BZKB 2H9VA 3NUPA 3UOJA 3MY0A 4PMPA 4E6AA 2BZHB 5E8YA 3FLQA 5BVOA 5HTBA 3UQFA 3ENHA 2F57A 2DS1A 3LOKA 3IG7A 3PXYA 4HZRA 4K8AA 4WHZA 5EKNA 1H4LA 2QURA 1XH7A 5GJDA 4FTKA 4BKJA 3MIAA 3HRCA 5IQCA 4J53A 2JC6A 1CMKE 4G17A 3A2CA 3BV3A 3H30A 3LCSA 2X7FA 3L1SA 3QU0A 4QQJA 3TWJA 5LVMA 2PPQA 5A6OA 3TG1A 3C4EA 2Y4PA 3P7AA 1XH4A 3IECA 4ZP5A 4F6UA 3W2RA 5EYKA 2YJRA 3DB6A 4FKVA 4DH7A 4EK6A 3EQPA 5DBXA 3GU6A 3D0EA 5EG3A 2ZVAA 3FKNA 4AGDA 2WMVA 4I5HA 4PDSA 3V6SA 3KREA 5KHWA 2C0OA 3Q52A 4FV7A 4ALUA 4AZTA 5J79A 4AS0A 3ZBFA 4FKPA 4JL9A 3KMUA 3ZZEA 3NAYA 2HZNA 4FG7A 1JKKA 4IB1A 4IWPA 3BPRA 3DLZA 4LM5A 1QPEA 2XUUA 3BKBA 4V05A 4TPTA 3FMLA 4W8EA 4YLJA 1XH6A 4RWLA 4C34A 4UN0C 2C1BA 3C13A 4LRKA 4BF2A 1DAYA 4IZ5A 2OW3A 4QD6A 3I5ZA 4HYSA 2PUNA 4IHPA 1LPUA 4MAOA 4BCMA 2B4SB 2H34A 4QMYA 2OZAB 3BE9A 3WF5A 4DTAA 4WT6A 1JVPP 3C4WA 4ZTMA 4CVAA 4CFWA 4UYNA 3ZO3A 4EOQA 2VTNA 4G6OA 3GC9A 3QD3A 4DGGA 2UZBA 4YHTA 1ZYSA 4JQ7A 3FZRA 4DYMA 3QX4A 5I9UA 4E4LA 2F2CB 4PRJA 3FJQE 3DDPA 1WBTA 5ETAA 2H96A 3UMXA 4CV9A 5BVNA 4RX7A 3HV3A 3Q4UA 4LUEA 4FI1A 4M12A 4N6YA 5HG8A 2YM5A 2YCQA 3PXRA 4IC7A 4LMNA 3W18A 2VWUA 2VO6A 4I24A 4WRGA 1ZOHA 2QOHA 2UW3A 3D5VA 2JDSA 4IE9A 2OXXA 4P5ZA 1W8CA 3PZHA 1VZOA 1JAMA 5M4UA 5DLSA 2WOTA 3MESA 2PSQA 4IMYA 2BRGA 3U8WA 3OY3A 4XRJA 4L7SA 3A60A 3FQHA 4FV3A 4I22A 5HLNA 5IPJA 2Z7RA 1XBAA 3C4FA 3LJ2A 3NSZA 4M3QA 2IZSA 3NIEA 4BWXA 2WMBA 1OZ1A 4C3PA 3THBA 4O7WA 3N51A 3VUHA 3NS9A 5AJQA 5EW9A 3U9NA 4AW1A 3NYNA 3P7BA 4QO9A 5CT7A 2OK1A 5AP3A 3UOLA 2C69A 4DT8A 3TV6A 3CTJA 4O0XA 4U8ZA 3KY2A 4KB8A 4BDGA 4BYIA 3OW4A 2ZB0A 2DYLA 2BTRA 4AW2A 3ZLWA 4A06A 1GNGA 3PXFA 1VYZA 1J91A 3LCKA 3D94A 3LQ8A 3IW4A 4MX9A 4OLIA 2UVYA 3KVXA 4FNZA 4IM3A 4OBOA 3V04A 4KABA 4UZDA 3QF9A 3R00A 5FM2A 3NW7A 2RSVA 1HCLA 2HY0A 3OZ6A 3QCXA 5HICA 2BRBA 4G3CA 3P0MA 1YI3A 2PE0A 1WZYA 4C4JA 4UEUA 4ZTRA 4BDBA 5KUPA 4WOVA 2HYYA 4YPDA 3TIYA 3AT4A 2ZV8A 3F5PA 4F70A 1XO2B 2GHGA 4KSPA 1Y8YA 4J99A 5E91A 3PYYA 2VTOA 3WYXA 4CYJA 4QTBA 4DT9A 4CQGA 2GS7A 2AYPA 2OO8X 3LHJA 5DRDA 5CNOA 4BCHA 3OXZA 4A4OA 4BZNA 4AA5A 3CQEA 4W4VA 3VRYA 5CEMA 4QPMA 5M44A 2VD5A 1A06A 3PP1A 1AD5A 4MWHA 4II5A 1PXIA 4QPSA 4C33A 4WG4A 4U80A 3Q9XA 3AMBA 3T3VA 5B2LA 4RSSA 5IU2A 2Z60A 1BLXA 4EOPA 1H1QA 4BCIA 4F4PA 2PVMA 5IA3A 3KCKA 3E7OA 3BBWA 1JWHA 3NUSA 4BCNA 3F61A 1XH5A 3MY1A 2OZAA 4QRCA 4OGRA 3KK8A 3EYGA 2QCSA 2VRXA 4EWHA 1H01A 3BI6A 3MPMA 3QTWA 4D2RA 1GY3A 4N6ZA 4QMZA 4EQCA 4RMZA 2BHEA 5JGBA 2ZM4A 3F3ZA 1K2PA 4QNYA 3DBQA 5IQEA 2V0DA 5F9EA 3DZOA 4RFZA 3CKXA 2W06A 2Y9QA 3OW3A 4CFNA 4FTAA 1OITA 2W5AA 1Q8UA 3E3BX 3QWJA 3NUAA 3KFAA 2X4FA 1OPKA 4GIIA 1M7QA 3QD0A 3V3VA 2YM4A 3T8OA 2PVFA 4AZVA 1OKYA 1WBNA 3ZFYA 1ZYCA 5LJJA 4IB0A 3RZBA 2J0KA 3CD3A 3Q9ZA 2JAMA 5L6PA 3KF7A 5AR4A 5M08A 3NCGA 5EI8A 2XNGA 4BCOA 5HTCA 2E9PA 2VUWA 5ANKA 4L43A 3G2FA 3UP2A 3KCFA 3NIZA 4EH8A 4BDAA 4QP4A 4K18A 4EBVA 4NL0A 1PHKA 4ACHA 3NGAA 1H28A 4DH5A 1O6LA 4X7QA 3KRJA 4Y73A 3LXKA 3FLSA 4XG8A 4DCEA 4YTCA 2XVDA 5AR2A 2GPHA 4JIAA 4NK9A 5FG8A 1ZYLA 3VUTA 4R78A 5IH6A 3CTHA 3N9XA 1KE9A 3VS0A 5FUTA 4YR8A 3R63A 1H25A 3TJDA 3V5QA 4RJ7A 1XHAA 2OXYA 1GZNA 4C3FA 4O91A 2XIRA 4FSMA 3CD8A 3Q5IA 3RM6A 2YFXA 4HVDA 3FI8A 4C4HA 4DTKA 4EL9A 4ZIMA 3VW6A 5CANA 5EK7A 4BDKA 2C68A 5DA3A 3OHTA 4Q5HA 1F3MC 4FNWA 4PV0A 5M55A 2BIKB 4JOAA 4KS8A 5HO8A 5IA0A 1A9UA 3IQ7A 2XJ0A 3HYHA 3ETAA 2RFNA 2WU7A 4S2ZA 5K0KA 2O63A 2WTKB 3W2PA 5C03A 3BRBA 3F2AA 4LMUA 3E64A 4BVUA 4U9AA 1GZ8A 1YOJA 1YWRA 3R9OA 5HVKA 4Z7GA 2WKMA 5J8IA 3HMOA 3QQHA 4HZSA 1RJBA 5KMIA 3WILA 2BDFA 1OM1A 3GQLA 2YWVA 4AF3A 5HTIA 4NH1A 4BBMA 4FYNA 3MSSA 4PL3A 3MVHA 4KKHA 2JBOA 2WTDA 3SXRA 3VS2A 1OIRA 4IAAA 2ETRA 4I0TA 3LFNA 3V5WA 1B39A 5L2SA 4WRSA 3FQEA 3C51A 5D7VA 4JNWA 4E6DA 5EYDA 3CJGA 4AGCA 3TUDA 3PPKA 4IADA 4HGEA 3VBYA 2PK9A 3PA3A 3CGOA 2YM8A 4O27B 3W2QA 5H8BA 4NFMA 4YHFA 1XH8A 5AP1A 2W5HA 4S30A 5FEDA 3ZRMA 4DGOA 4L46A 2ZMCA 4RRVA 5CAQA 3SV0A 2ACXA 2XNPA 3KULB 2CMWA 3IKAA 2R3NA 4RIXA 1A48A 4WIHA 3M1SA 3DTWA 4QQCA 4TN6A 4FV8A 3E5AA 3HNGA 1BUHA 3PA5A 1BL7A 2X2LA 4CQEA 3FQSA 3HMPA 3KC3A 3PA4A 4A9YA 4BCPA 4WNOA 3MI9A 3GQIA 3ZEWA 4DG0E 4DEEA 2DQ7X 4H3PA 4PTGA 4BI2A 5HO7A 5IH5A 3FE3A 5E4HA 4NZWB 4TXCA 2CNVA 3Q9YA 4YU2A 4MXYA 1IAJA 4FL1A 2W1HA 3UG1A 3NUYA 4JBQA 4DGLC 3PXQA 3UE4A 1SMHA 1U54A 2GNIA 4HGSA 4C4FA 1NT2A 1CKIA 5LWNA 2VTMA 3C9WA 3UQCA 4EQMA 3QQLA 2DWBA 5JN2A 2OF4A 5KX8A 1P4OA 3P1AA 3QL8A 3ZUUA 4BDCA 1PXPA 2EB3A 1YOLA 5G1XA 3WIKA 2O3PA 4U6RA 4I20A 4P2KA 3PJ8A 2ITNA 2ZYBA 1SM2A 5CI6A 4CTCA 5HU9A 3KRWA 1OKVA 2PL0A 3L8XA 4K2RA 2B1PA 3MVLA 2WTKC 2X2MA 5DT4A 2UZLA 3G90X 4X3FA 4FVQA 4RWJA 3RTPA 1LEWA 4JI9A 2XKFA 5ANJA 5HNIX 3DKGA 5FDXA 4CYIA 5LCJA 5CZIA 4BI0A 4BWKA 3QD2B 5C1QB 1XBBA 3QKLA 4W9WA 1O6YA 2VAGA 3RWPA 3BHVA 3FEGA 3EL8A 3LXLA 3GC7A 2IVUA 5HBJA 2J5FA 2J0IA 3FPMA 3LPBA 1UKHA 2CDZA 2G1TA 3R28A 4JVGA 3FHRA 4O0RA 3CR0A 4IC8A 4YNOA 3U87A 4C3RA 3Q2JA 4ERWA 2A0CX 4LGDA 2B9HA 4PPBA 3HV5A 3D5WA 5JQ5A 4EJNA 3N4VA 3VAPA 1WCCA 3ELJA 5AUXA 2XEZA 4AZWA 1ZARA 1XBCA 4I0SA 5DRBA 3MFUA 2YERA 4HYIA 4WA9A 2RGPA 1YW2A 3NYXA 2W1IA 4PTCA 3DK3A 3LLAA 4JJRA 2O2UA 3O7LB 1KE6A 3SG9A 3NAXA 3OXIA 5HHWA 2WB8A 4L52A 3QXPA 4D2VA 3MYGA 4I4EA 3CE3A 3TM0A 3OOGA 1J3HA 2BIYA 4NFNA 4ENXA 4ANNA 2XJ2A 4UB7A 4F9BA 3GC0A 3B8RA 1RW8A 3GU5A 3P23A 4TYEA 5T68A 3S0OA 4D1XA 2CKOA 4ZTHA 3H9RA 3GCSA 4AN3A 3F2NA 2ITYA 4FVPA 4U45A 2HW7A 3RHKA 3HECA 4XV3A 1I44A 3C7QA 1DI8A 3D2KA 4YUQA 1V1KA 3G0EA 1OUYA 1LR4A 3WZKA 4L8MA 2YN8A 2QD9A 4M14A 4QMSA 4PDYA 3GXLA 2Y4IB 3O50A 3GI3A 4W9XA 4FSQA 1SVGA 5HIDA 3D2IA 1B38A 3TACA 5GHVA 2XMYA 4YLKA 4LGGA 4I5PA 4RBLA 4YO4A 5I0BA 4HOKA 3GFWA 3KXXA 4FV2A 3BIZA 3VRZA 4PNIA 4XV1A 4OBPA 4O1OA 3OT3A 2QLQA 5KO1A 4IWDA 4IX5A 4BDJA 3DQWA 1ND4A 2GQSA 2PMIA 3PG3A 5FQDC 5J5TA 4FZFB 1OKWA 2WZJA 3KK9A 4YTFA 4AT4A 3PTGA 4FSTA 4C4GA 4EHGA 4O0SA 4YSMA 5JFXA 4IX4A 3MJ2A 3QCYA 5F94A 3EZVA 3OMVA 2X39A 1ZOGA 4QYYA 4PDOA 2YIXA 3ZMMA 3A99A 5ANOA 5F1ZA 3QWKA 2OH4A 4EOOA 1QPJA 3W2CA 4XG3A 3DQXA 4AXAA 2HXQA 2HZ0A 2QU5A 2W99B 3MH2A 4E5AX 4FGRA 3E88A 3LM0A 5A4CA 4PY1A 3H4JA 5IUGA 3GEQA 3TDVA 4ITHA 3QUEA 4ANBA 2YM7A 3AD6A 3NLBA 3LIJA 2PUIA 3RI1A 4FIFA 3WE4A 2XRUA 3FAAA 4MYGA 4KRCA 3ITZA 3TT0A 4AN9A 2IN6A 5E8ZA 3TNHA 3U55A 3KXHA 3MPAA 3QA8A 2ITOA 2B7AA 5I9YA 3NNWA 4MXCA 5M57A 2QLUA 3WF8A 3ZS5A 1H1RA 5GINE 5CY3A 5AUUA 2NRYA 3BHTA 4ASDA 4J96A 4MBIA 1QL6A 4AE6A
chains in the Genus database with same CATH superfamily
5A3XA 4OT5A 1UU9A 3PUFC 4AQKA 4U3YA 2WMSA 1VYWA 4OUCA 2G2IA 3U6JA 2JITA 2C47A 3SRVA 2I1MA 2QG5A 3U9CA 4E5WA 1X8BA 4EOJA 3FYJX 4D1SA 1BKXA 2W1CA 1Y6AA 5D7AA 4XP3A 4AWIA 3FKOA 3UIMA 4FT7A 3DJ5A 4FIHA 2Y4IC 4XBUA 2VZ6A 3FBVA 1FQ1B 2X7OA 2WMAA 3TEIA 4CTBA 4MBLA 5ANIA 5E1EA 2XM9A 3AC3A 3QHWA 5I4NA 4CZUA 3HA8A 5AUTA 4RIWB 4Q9SA 3C1XA 4KWPA 5A54A 1H0WA 1JKTA 4FZ7A 4MNFA 3EHAA 3UPZA 5CQUA 4KBKA 4BBFA 2WMXA 2XK9A 1PMEA 4D2TA 2QG7A 1SNUA 3O71A 4GYIA 3PY1A 4DBXA 5BQ0A 5TE0A 4X3JA 1UWHA 3D7ZA 2GQRA 5AAGA 3NEWA 1WBOA 3NYOA 4M68A 4FV0A 1CM8A 4GCJA 4Y5QA 4E73A 5EDPA 4EUUA 5CSXA 2QR8A 4M13A 2CLQA 3LCDA 2XNNA 4JQEA 3Q60A 5CU0A 5FXRA 4ZTSA 1GIJA 3RAKA 2PVRA 3LCOA 3DA6A 1H1WA 4CT2A 4O7VA 3E63A 4CZTA 4WO5A 3L9LA 3LFQA 5LVPA 4MCVA 3QGWA 4FSWA 4XOYA 1XWSA 3HMNA 4MQ2A 3NNXA 3RHXA 1R3CA 2VO3A 5K5NA 4I94A 4QDVA 3FMEA 4PPCA 1IRKA 1Q3DA 3WARA 4BR3A 2XB7A 3QTSA 5E1SA 3V01A 2YZAA 3QRIA 5C26A 3TZ9A 3BWFA 5HOAA 3O8TA 5E92A 4YO6A 1OL7A 5CU3A 3TI1A 3UDBA 2GCDA 3OWLA 4FTUA 4BHZA 4UMPA 4FKTA 5CASA 3MIYA 4TRLA 4XHKB 3RK9A 3ZUTA 2PZIA 1OVEA 4E20A 2QO7A 4KA3A 2V5QA 2OJFE 4GRBA 2NO3A 1EH4A 1JSTA 1IR3A 3IGGA 1ZRZA 1PMUA 3JVRA 2R3LA 3PP0A 3OP5A 5IG1A 5EYCA 4F09A 4FEXA 2CKEA 3C50A 1U59A 1TKIA 4O7LA 4ANLA 2J0MB 2W0JA 3DOGA 4N70A 3KQ7A 3R7GA 4FKJA 4IDVA 4G5PA 4F1OA 4XP0A 2UZOA 4DH8A 2X81A 4FL2A 3VO3A 2Z7SA 2OJJA 4FTNA 2I0VA 2XK6A 4R6VA 1YXVA 4S32A 1JLUE 5HCZA 2OJIA 4ITJA 1XR1A 5DR6A 4ZLYA 4RVTA 1BI8A 3COMA 4RVLA 3ZDIA 5A9UA 2W5BA 4H05A 2C4GA 2PVHA 4GG7A 3TL8A 1R39A 3FC2A 4K77A 3KRLA 2UW0A 3P7CA 4DFNA 2VWIA 4MNEA 1YDRE 3UYSA 2YIWA 4IVDA 3EQHA 4H58A 4QPAA 3GB2A 4FV5A 5HBHA 2G9XA 4J7BA 5AV2A 1YDSE 1UU3A 2OI4X 4O6LA 4IDTA 3AQVA 3L9PA 3R22A 2IW8A 3TV7A 5AM7A 5J7BA 2QVSE 2Y6OA 3GVUA 2UW7A 3LM5A 5C8NA 1G8AA 3WE8A 3DXQA 1PYXA 2BROA 2OIBA 3DK7A 1YRPA 3O8PA 2PVYA 4GKHA 2I0EA 4IAYA 4L3LA 4N4SA 1QPDA 3NRMA 1VLRA 2PUUA 3QC9A 3QXOA 4G34A 2WMQA 3LQ3A 5ANDA 2EXMA 3PVGA 2CGWA 4L01A 2QU6A 2CN8A 3D9VA 4D2WA 4U0IA 4TNBA 4C2VA 4CNHA 5IA2A 4YPSA 5HE3A 4D9TA 5IQDA 3V5TA 5CAPA 2PYWA 2B9IA 3MTFA 3JR1A 4YJQA 2EVAA 1H27A 1TQIA 4BIDA 3EQIA 2E9VA 3GU7A 4IQ6A 3VUKA 2BFYA 4I6HA 3SKCA 2JAVA 1YI4A 2JDOA 3HL7A 3KGAA 4GMYA 3R2YA 5DI1A 4FG8A 2YLEA 4JT3A 1WAKA 3COIA 4QYEA 5CNNA 3CIKA 3VWAA 4FV1A 4NJ3A 2XNEA 1VR2A 3CPBA 2OWBA 5CI7A 5AR8A 3KN6A 1MUOA 3ET7A 4IW0A 3ORNA 4I0RA 2C0IA 4PDPA 4E26A 4F7SA 4QEBA 2XYNA 5BVWA 3F66A 3NUXA 1OPJA 4XEYA 3QX2A 3MH0A 5BNJA 4EONA 3C5IA 1NVRA 1PXNA 2C6MA 3ZRKA 4QP6A 4RC3A 2VO0A 4C0TA 4ZLOA 4F63A 1LUFA 1OB3A 1R0EA 2R3MA 4KRDA 4AN2A 4XG9A 4E7WA 4EEVA 1Q3WA 4TL0A 3UZPA 3W0PA 4I3ZA 3OD6X 4R7IA 5HLPA 1YXSA 3EQGA 3D5XA 3I1AA 3JYAA 4RC2A 4ASXA 4F1TA 4KBCA 3QHRA 3IO7A 4FT5A 1PXOA 2R3KA 4MEDA 5BMMA 2AC3A 4B7TA 3HAMA 2VTRA 1M14A 2W7XA 3AC4A 5AM6A 4ACCA 1KSWA 2ITZA 1MRVA 2C3IB 4PP9A 3RPVA 3BZ3A 3DB8A 4B0GA 3ACJA 4DCAA 4GSBA 3I5NA 4O7NA 4XV2A 2HWOA 3FY0A 3DCVA 3VC4A 2OJ9A 3AC2A 3ORLA 5LMAA 4TWCA 2O0UA 5BUJA 4XCUA 2HW6A 3BLHA 4V0GA 3H0YA 3VBTA 2XA4A 4NM0A 4ZJVA 4KINA 4GV1A 1Y57A 3MFSA 5EOBA 2XKEA 4JAJA 4WNKA 3W33A 1DS5A 4C2WA 2X2KA 2W96B 1FBNA 1XQZA 4CFVA 3EQCA 3IDBA 2ZFYA 2R3PA 5BX0A 1IASA 1PY5A 4AGWA 2JBPA 3W10A 5AAEA 1K9AA 2WAJA 3OEZA 3QTZA 3TNWA 3GUBA 2JIVA 3JS2A 2ZB1A 4QP9A 4JIKA 4HW7A 1JSVA 5EOLA 2C0TA 4BDDA 1PJKA 3RPYA 3PPZA 5M56A 4EZ7A 3PZEA 3R1QA 3IOPA 1W2CA 2A4LA 4AW0A 3CQWA 4CFXA 3R01A 5E7RA 2ITTA 3BCEA 3QFVA 2YABA 4J1RA 2Z7QA 1UVRA 4FKOA 4FK6A 4WUAA 4ANMA 4BGGA 3II5A 3DV3A 4GU6A 4XS2A 4YJUA 1FMOE 2BDWA 2IVTA 3ZSHA 4DEHA 1FGIA 3PWDA 1NW1A 1TFFA 5HIBA 3CJFA 3IGOA 4KIOA 5AP4A 1JQHA 3RP9A 2NPQA 5FGKA 2B52A 3T3UA 4A4XA 4EH2A 4O7RA 4LRJA 3FLZA 4QT1A 3ZSGA 4APCA 2ZDTA 4IWOA 4UV0A 2PVLA 4FR4A 3EFWA 3MVJA 4BCFA 1ZMWA 2JFMA 3UDTA 1FVRA 4HVIA 4FIJA 4O4FA 2BZJA 4XYFA 4BCJA 5ANGA 4QDEA 4IVAA 4JX3A 4YZ9A 3DY7A 3QRJA 4CFUA 5CSVA 2R3IA 4C61A 5CT0A 2F2UA 3ATTA 3GOPA 3DGKA 4YHJA 2XEYA 5AV1A 2YLFA 1WFCA 3C4ZA 4HYUA 5H3QA 2OSCA 2YIRA 4AOJA 4AT3A 5CEIA 3TXOA 4BZDA 2OIQA 5DOSA 1Y6BA 3PXZA 5E8TA 3Q04A 4CRLA 5C8KA 4FSRA 4MTAA 2OBJA 2KULA 2WQMA 3ZSIA 3GCQA 5EM6A 4Q9ZA 3R1NA 2WMTA 5H2UA 5CAVA 4R7BA 5KMKA 5M07A 1JPAA 3L9MA 3KL8A 5LVLA 2W4JA 3R71A 4EQUA 4Z16A 1YI6A 2B9JA 1AQ1A 5DYJA 4FX3A 5C4LA 4QYHA 4RX9A 3ZFMA 3VUMA 3PLSA 5DHJA 4FTJA 5CU4A 4A9RA 4MKCA 2QOKA 5JSMA 4D55A 4V04A 3G0FA 1IAHA 4NYEA 3CS9A 4EBWA 4O4CA 5K5XA 4H3QA 4DEIA 3VJNA 1ZZ2A 4YC3A 3OEFX 4EK8A 2RL5A 2UZEA 2OGVA 4JDHA 3F9NA 4FTTA 2WELA 1WBWA 5CU2A 2R0IA 4R5SA 2F9GA 3PPJA 1YVJA 1Z9XA 4XH6A 2YAKA 2G2HA 2F4JA 2R4BA 4G9CA 4AZFA 2HCKA 3IW8A 1P4FA 2WD1A 3BE2A 4NT4A 2OU7A 3AT2A 1OIUA 2PHKA 3TNPC 1YHWA 2W4KA 1RDQE 3QKMA 4OTPA 3TNQB 4JLCA 3F2RA 4BI1A 2ITWA 3D7TA 4LG4A 4U42A 3Q6WA 4GH2A 4DGNA 4S33A 3C0GA 5DR9A 5LWMA 3W55A 3TJCA 3CSVA 5J95A 4EORA 3M2WA 4AX8A 3ORTA 4F0FA 1ERKA 3OBGA 4NUSA 3HLLA 3KRXA 2X8IA 3O7LD 4JG6A 1YHSA 4H1MA 5EW3A 2OH0E 3UOHA 4TYJA 5AUZA 5ETCA 4J8NA 4NCTA 2ZM3A 5AP5A 1M2PA 4NM7A 3UOKA 5B2MA 3PRFA 4FF8A 4K11A 4ZJJA 1SYKA 1GIHA 2OJGA 4RIXB 5AX9A 4KIPA 4G2FA 4F6SA 2BAQA 2OKRA 3OCBA 4OR5A 4TWNA 3WF6A 3WBLA 2JKMA 1QMZA 3KU2A 3VW8A 3SXSA 2ETKA 2QQ7A 4NSTA 4RZVA 4QMTA 3R7YA 4Z55A 5HU3A 1J7UA 3F3VA 3FL5A 3DKOA 2H6DA 3FZOA 3O8UA 2AUHA 3BQRA 2WTWA 3QALE 2OFUA 4HPTE 4AACA 5KKRB 3AXWA 4FEUA 4ACDA 2QHNA 4MK0A 1SVEA 1PW2A 4GW8A 2ZM1A 4PX6A 5DVRA 5CF8A 3E8DA 1O6KA 3JXWA 1U54B 4YJTA 2X9FA 5EHLA 3NNVA 3SW4A 4FKQA 5EHOA 2JEDA 4LDTA 4CGAA 3R8LA 4AUAA 3LJ1A 3LXNA 5FWKK 4L42A 4FKGA 3BEAA 2HZIA 3PFQA 5HE0A 3A7HA 1YXUA 2YCSA 1CTPE 4UX9A 1H0VA 5LQFA 2WMRA 3ZONA 4CZYB 3U6HA 4CG9A 4X3FB 4L00A 4F64A 5I5ZA 2BVAA 2JDTA 3LVPA 4ITIA 2YZLA 3TDWA 4CKJA 4D2SA 4ZS4A 5LXMA 3WYYA 2X6EA 4WNMA 2R2PA 1Y91A 1K3AA 4MXAA 3AT3A 2PY3A 4YNEA 2YA9A 3FUPA 4X2JA 4O7ZA 2WHBA 1PYEA 4DF3A 4JBPA 4M8TA 4ZTLA 4C59A 5CF6A 3LE6A 3OTVA 1XMLA 1MRUA 3F7ZA 4MXOA 2GTMA 5E8WA 1Z5MA 4Q2AA 3ORKA 1YWNA 3R8UA 3PWYA 4MHAA 4EC9A 4L9IA 5HD4A 1BYGA 2YHVA 1R1WA 3Q2MA 4Y5HA 4AGUA 5EI6A 1OBGA 3SGCA 4DTBA 3IDCA 3EOCA 4LV8A 2J5EA 2XKDA 4TYIA 1Q5KA 3D15A 2DUVA 5HVJA 2OLCA 4ZMEA 1HCKA 1OL6A 1JKLA 1UKIA 1W2FA 3UC3A 2IJMA 4XJ0A 3AGLA 3ORMA 3PY0A 3ZM4A 2I0YA 4DFLA 3UIXA 2A27A 4NIFA 4AOIA 3H0ZA 3OC1A 4CSVA 2CKPA 3I79A 3FMMA 4C62A 1NY3A 2J7TA 1Q99A 3QQGA 2VTQA 5CSWA 4N57A 4L44A 4BB4A 4EH3A 5FTQA 3O2MA 4U81A 5TOZA 4RJ5A 3B8QA 4ID7A 5D10A 1MP8A 1J7IA 5CVHA 5JT2A 4EH6A 4IBMA 3UVPA 5LCKA 2OF2A 3FDNA 3GU8A 2CKQA 3QCQA 4ZXTA 4EKLA 2XK3A 4PL5A 1ZZLA 5HD7A 2GNHA 4B99A 2QOOA 1YDTE 3DS6A 3HP2A 3D5UA 3EQFA 4YURA 2BUJA 5FBOA 3KXMA 4AQCA 3F6XA 3R7UA 3R8PA 1KV2A 4IH8A 1M7NA 4R3PA 4DGMA 3D83A 4DDIA 3TMOA 3BEGA 2R9SA 5DR2A 1KE8A 4X3FC 2G01A 2C1AA 3SA0A 2QKWB 3G51A 3LLTA 4M7IA 4UYAA 3VQHA 2V7OA 2PWLA 4EYJA 2EXCX 2J90A 2YIYA 4Y83A 5BYLA 1ST4A 3E93A 5CZHA 3VS4A 4RIYA 2XNOA 5AR5A 3ANQA 2CLXA 5IF1A 4RA4A 2XALA 2VTHA 2W1GA 5L8KA 5J87A 3E3PA 4NKSA 5JZNA 4QMXA 4FC0A 1PXMA 2PVKA 2XIYA 5CF5A 3B2TA 3GBZA 4RWKA 3R9RA 4ZY4A 4NEUA 1JBPE 3SOCA 2VX1A 3MGYA 2QO2A 2GU8A 4FJVA 4B6LA 4KKEA 3P4KA 5BVEA 3OVVA 4EOLA 3BHUA 3L8PA 5K4IA 4F9CA 4FMQA 3GNIB 4M84A 3ALNA 3VVHA 3LKMA 2C6OA 3R0TA 3ZZWA 4OTHA 3C0HA 2P2IA 3ROCA 3SX9A 4KAOA 2YAAA 2YDKA 1OPLA 3FKLA 4ERKA 2C5VA 4TNDA 4UWBA 3SQQA 4UMTA 4FIEA 1R0PA 3TUCA 4KSQA 2WQNA 3FZTA 1W84A 4CD0A 4ZZOA 4LL0A 3O23A 2X6DA 3OG7A 5FEEA 4BZOA 3O17A 4UXQA 2HAKA 5BUIA 4TYHA 5GZAA 1H1PA 3AD5A 3MWUA 5B0XA 3R1YA 3KIOC 1ZWSA 4OTRA 2X0QA 5EKOA 4YTIA 5L8JA 3SRVB 4IANA 4ZSJA 2GS2A 3SAYA 1VEBA 3LFEA 4FKSA 5JFVA 1P2AA 4YGAA 2P4IA 3OXTA 3PIXA 2CGUA 3W1FA 2EUFB 2PMOX 2VX0A 3DNDA 5I3OA 4ANQA 4DLJA 5LMBA 4QMPA 4OTQA 4A9UA 4BC6A 4JRVA 3UNKA 4PUZA 4WD5A 4F0IA 4C57A 2GNLA 4HNIA 4ZSGA 4M69A 2WTCA 4Z3VA 3K5UA 5DN3A 4MXZA 2PULA 3HUBA 3P86A 4FSYA 3VULA 2P3GX 5B2KA 2ERKA 4G5JA 3ERKA 2W1DA 3POZA 4S34A 4DAWA 5D1JA 4W4YA 4IACA 3U54A 2VV9A 5HLWA 3UZRA 2OXDA 5CEQA 4IB5A 3F69A 4C35A 4CKIA 2YACA 4DFBA 2IF8A 2RFEA 3QKKA 4IAIA 2XF0A 4S31A 2CNQA 1GZOA 3PSCA 4YJVA 3ZM9A 5CENA 3AG9A 3JVSA 4RT7A 2V22A 5J9LA 3OCTA 5GJGA 4F65A 2CHLA 3EN6A 4MWIA 4F7JA 2NRUA 3MV5A 4IVCA 2R3GA 3A7IA 3G6GA 4XG7A 5T6KA 5AV0A 4E5BA 2Z02A 1ZY4A 4TWOA 4I93A 4UWCA 4FICA 1STCE 4O21A 5IKWA 4ALVA 5M4CA 2X7GA 1H8FA 3NR9A 3R7VA 4D5HA 5J9ZA 4ORKA 4DFUA 3CPCA 5HKMA 3F3UA 4GFGA 3Q4ZA 1PXLA 3BYOA 3Q6UA 1NXKA 4R1VA 4F08A 4BY9E 5DFPA 3UQGA 4IZYA 4C58A 2XANA 1V0BA 3W0RA 3QQKA 3RCDA 3S00A 3PUPA 3DKCA 4X2NA 4F7NA 3L8VA 5A4QA 5CLPA 1NVQA 3ORIA 1BX6A 1E1VA 3PIZA 3MB6A 5IA1A 4DLIA 4KIKA 3CCNA 2IPXA 3KRRA 3QAME 5KNJA 4PMSA 1L3RE 3WF9A 4YSJA 3MS9A 4RQVA 3LFSA 3JPVA 4BRXA 3FMDA 5HE2A 4XP2A 2JDRA 5L2TA 3Q53A 3ZYAA 4AA4A 3DBDA 4AZSA 2CPKE 4OTWA 5HCXA 3E87A 3FZSA 2W1ZA 3G9LX 1IEPA 1TZDA 5E90A 1SZMA 5E8XA 4OTFA 1SNXA 3R21A 3TUBA 3LFCA 3A8WA 4RC4A 3LFAA 3LCTA 4RFYA 4M67A 3KXZA 3M42A 1KOBA 3NUNA 3E7VA 3F5XA 5AUYA 1DAWA 4RX5A 3N4TA 5JH6A 2Q0NA 2UZTA 4DBNA 3LMHA 4MNEB 4XG2A 2VWZA 4AG8A 4RZWA 2VTTA 4LV7A 4ZOGA 4F1MA 4B8MA 3BGPA 4I6FA 5EI2A 3GU4A 3U4WA 2BILB 3P79A 2CNUA 4DHJA 1DM2A 3TIZA 3TZMA 4O0WA 5D41A 2C3LA 5IA4A 4DEGA 3CKWA 2F7ZE 2P0CA 2CCIA 5C27A 3ZRLA 5CSPA 4D0XA 1Q61A 1PF8A 4YC6A 3W8QA 5AUVA 4HVHA 2HWPA 4EH7A 5ITAA 1U5RA 2UW9A 3LJ0A 4OW8A 2J0JA 3PJ2A 3ZCLA 1OGUA 3PE2A 5M4IA 4YJNA 4C7TA 3IDPA 5FTOA 3BYVA 4AZEA 2ZOQA 5AA9A 4ZZMA 2UV2A 4XV9A 1WMKA 3KKVA 4QYFA 4IXPA 2X8DA 3CEKA 4FSZA 4RQKA 3FSKA 1ZYDA 4FKRA 4L7FA 2ZDUA 3MA3A 1E9HA 2UZWE 3QTRA 3EWHA 2G15A 2VGOA 4GT4A 3I6WA 4FKLA 4EH9A 3C4CA 3UP7A 5CQWA 5FEQA 3N4UA 5AIKA 5JFWA 2GDOA 4AOTA 5A4LA 3W32A 3OY1A 1U5QA 4Q5EA 2AC5A 4XNEA 4U43A 5A14A 4IFCA 4RG0A 3ORZA 4E93A 1OECA 2E2BA 3GCPA 4RJ3A 5LMKA 3COKA 4G3EA 5JGAA 3IONA 4P90A 3HRFA 5KMOA 3SC1A 4EOMA 5IQGA 4BFMA 5TO8A 4LFIA 5GNKA 2PTKA 4BTKA 1J1CA 1JNKA 4Z7HA 3E62A 4XLIA 2FUMA 4PPAA 3DKFA 3GGFA 3GENA 2W17A 2PVJA 5M51A 4XRLA 1PRYA 4M97A 3VHKA 4BN1A 2YM6A 1YWVA 2EWAA 2YCFA 2QKRA 3SHEA 4UMRA 3ZLXA 4DG2E 2YCRA 1PXJA 4I21A 4I23A 4I4FA 2GNJA 2BRMA 2ITQA 4CMOA 2RKUA 2R3FA 4NU1A 3A61A 1T45A 3DK6A 3GP0A 1IG1A 2F7XE 4U5JA 2VWVA 4QMOA 4Y95A 3FMHA 5LARA 4ZK5A 5HVYA 3I6UA 4X2FA 5T3QA 5JFSA 2WNTA 5AFVA 4ZTNA 4PP7A 4D4RA 3UIBA 3HMIA 4IIRA 4EC8A 1IA8A 4JRNA 1OUKA 2W1EA 1Q24A 2X0PA 4V0GB 5HG5A 4FUYA 4CFFA 4FV9A 5HGIA 1MQBA 1WBVA 5ETFA 4UBAA 2QOBA 2ZJWA 4D0WA 2C5OA 3VUGA 3BU6A 3UNJA 3ZTXA 1WVXA 3ALOA 3QQJA 1DI9A 3BGZA 3G15A 4I6LA 2LAVA 2C3KA 1HOWA 4GU9A 1OIYA 3IOKA 4C4IA 2PU8A 4X2GA 4O7YA 3MN3A 5HX8A 3R7IA 4KUJA 3LZBA 4N0SA 3ZBXA 3FLYA 2XIKA 3ZXTA 3DXNA 4MVFA 3RGFA 5J5SA 4QMWA 3F3TA 2HELA 2WQBA 2Z8CA 2YDJA 4O2PA 1M2RA 3IPHA 2WOUA 4FODA 2X4ZA 2Y7JA 3OCSA 5IQFA 4F9AA 5A6NA 3DJ7A 1XMMA 4F7LA 4GYGA 2WPAA 2VTSA 1Q8ZA 3PY3A 4EWQA 4O0TA 5KMNA 3JY0A 5IISA 1ZAOA 1VJYA 4X21A 4HVSA 4G3FA 4E1ZA 3BYMA 3R7EA 4A9TA 4CEGA 5DG5A 1B6CB 4ZSLA 4WG3A 4RVMA 3TZ7A 1Q97A 3DAJA 4F78A 2FSMX 4I1ZA 1S9IA 3UPXA 4YBKA 2OIDA 3NMUF 1ST0A 3FY2A 4C8BA 5FRIA 4JR3A 3U6IA 4ZAUA 2Y8OA 4W4XA 3R8ZA 4K1BA 3VIDA 2FSOX 4DG3E 3DBCA 4AT5A 4YJOA 3FXWA 2JKQA 3RK5A 5AUWA 1H07A 4M66A 4AA0A 4TYGA 4QP2A 3VUIA 1ZMVA 4R5YA 3RKBA 4JG7A 1XKKA 4WG5A 2RF9A 3IS5A 4JG8A 3MDYA 5EYMA 5TKDA 3SW7A 3QGYA 5JEBA 3I0OA 2ESMA 3FWQA 4O96A 3ZO2A 2XJ1A 4EH5A 3PVUA 4L3JA 5KCVA 3P5KA 2IG7A 4L6QA 4PMTA 4I6QA 3H3CA 4FA2A 5EQEA 4R1YA 2B54A 1ZY5A 5IZFA 2FH9A 4GVJA 4X2KA 1H00A 4PQNA 2XH5A 5DEYA 3WI6A 2BTSA 1W83A 2Z7LA 3CQUA 1REJA 2GHLA 3BGQA 3VN9A 4CCBA 2WEIA 3NCZA 4FTMA 3R8VA 4O7SA 4RVKA 2ONLA 4ACGA 5CS6A 4JDKA 3ATSA 3OOMA 3AC5A 4HGTA 3K5VA 5H8GA 3TCPA 4GK4A 1G8JA 3DU8A 4U7ZA 1NA7A 5IUIA 4ZY6A 2CJMA 4WKQA 3PSDA 4DEDA 3NVKI 2XIZA 3OWJA 3HV4A 4WSYA 5H8EA 2IWIA 5GZ8A 5IH4A 2WQEA 3F3WA 3SLSA 2OG8A 3POOA 4QQTA 4B4LA 2JDVA 2WIPA 4X6RA 4EJ7A 4FYOA 2BR1A 3V5PA 4ACMA 4L67A 2PE1A 3LFBA 2UZNA 4FRFA 4K6ZA 3QBNA 4GT3A 1L8TA 1CDKA 4YZMA 1V0OA 3QTUA 3RPSA 5M06A 5KZIA 1FVTA 2IW9A 4EYMA 5A4EA 2EB2A 5IA5A 5I9VA 3TTIA 3QRKA 4FNYA 4MBJA 5EDRA 4FEVA 4HVGA 5JK3A 5KE0A 1KUTA 4QOXA 4TTHB 2ITXA 4HJOA 3L8SA 4CMUA 4DC2A 4BKYA 2O8YA 4D4YA 2EU9A 4FL3A 2FGIA 3TZ8A 3D7TB 2BRHA 4JXFA 4EZ3A 2IW6A 3HAVA 3DBFA 2WMUA 2QR7A 3ORPA 3R8MA 3UIUA 3OBJA 2PUPA 2R3JA 5KBRA 2YJSA 3UVRA 5J1WA 3RNIA 5HZNA 4GKIA 4FZDB 1WVWA 3KEXA 2QC6A 4MF1A 3HUCA 5AP2A 1LEZA 3EQBA 3FMNA 4IZAA 1W98A 4R3CA 5KMJA 3BYUA 2BALA 2JIIA 3CLYA 3UODA 3VF9A 5E9EA 2R3HA 4NM5A 2XK7A 5F20A 3W2SA 5CEKA 4M0ZA 1GIIA 4O0UA 3SXFA 2YEXA 5TR6A 4FKUA 4O4DA 3TKIA 3R6XA 4QP1A 4EHZA 2GSFA 4YC8A 4L53A 5AWMA 2YIQA 5ETIA 5AX3A 5FLFA 2ZAZA 4GJ3A 4DITA 2PVNA 4YJRA 1UNGA 3MTLA 2VWWA 4IAZA 3AGMA 5I9WA 3ZU7A 3DZQA 4F9WA 4DE4A 3BWJA 2E9NA 5BPYA 1BI7A 4CKRA 3QUDA 2C6IA 3FMJA 5BYYA 4NM3A 5D11A 3BV2A 2VNYA 2A98A 3FHIA 4GFMA 4FT0A 4E4MA 3PFYA 3MY5A 2BKZA 4V01A 3LAUA 3D14A 4LGHA 4AFJA 5D9HA 1UU7A 3HA6A 2PE2A 3RVGA 2QODA 4HGLA 4HCTA 5EW8A 2V55A 3WOWA 2ZV2A 3EN7A 1H24A 1Q41A 2WU6A 3QYWA 1G3NA 4FTCA 2QOQA 2UVZA 3HRBA 1TQPA 3E8NA 3EKNA 4LUDA 4E3CA 2JD5A 3CGFA 2I0HA 3FYKX 4BGQA 5G6VA 2H8HA 3HDNA 4J8MA 1U46A 3PIYA 1PKDA 4UY9A 4Y85A 4RPVA 3UBDA 3WZUA 4ZMFA 5CX9A 4G1WA 4B9DA 3QTXA 1ZOEA 4O38A 4J98A 2UW6A 4LOQA 4OTGA 5CF4A 3MPTA 3ENMA 5M53A 1XH9A 3AOXA 2A19B 2R3RA 2XBJA 3FPQA 4LOOA 5I9XA 5HO6A 5HBEA 1OMWA 5K3YA 4NCTC 3QRTA 4BGHA 3KA0A 2NNWB 3W16A 4FNXA 4EZ5A 4JMQA 3EN4A 4DA5A 2PZRA 3PVWA 2J51A 4A4LA 4UALA 4RJ6A 5JKGA 3FZ1A 2A2AA 3FXZA 2UUEA 3QZHA 4PL4A 2VNWA 2W9ZB 3NDMA 4NIFB 3TTJA 2CSNA 4KNBA 4FV4A 4FV6A 4ZZNA 3LFFA 2QOFA 3FV8A 2HXLA 1UU8A 5KZ0A 2I40A 4LV5A 4MXXA 4KS7A 5L2QA 4D5KA 2HOGA 3K2LA 3V8TA 3BYSA 4XG6A 5EDQA 3FI3A 4R77A 3C5UA 4FT9A 1YXTA 4IB3A 1M2QA 4D2PA 2VWXA 4D58A 2FSLX 3EL7A 4U3ZA 5CU6A 3R9NA 2Q83A 5C01A 4ANSA 3RAIA 2J50A 1Y8GA 4EHVA 2JKOA 4BDIA 4EK3A 3HKOA 4QMNA 3E8EA 3PLAE 5ACBC 3VS1A 2LGCA 4FSNA 3MW1A 3RAHA 3V6RA 3AKLA 2P2HA 2IVVA 4IAKA 4E8AA 3DFAA 3KB7A 3OTUA 4BTFA 3R7OA 3PG1A 4YZCA 4IJPA 2VTIA