3PSDA

Non-oxime pyrazole based inhibitors of b-raf kinase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
276
structure length
262
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
publication title Non-oxime pyrazole based inhibitors of B-Raf kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 262
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3psdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3psdA01
4CG9A 3CQUA 3IPHA 2Y6MA 3IGOA 4OAVB 4U43A 4F09A 2QG7A 1CKJA 3UOJA 4ZSLA 4AU8A 4FTJA 3VO3A 1KE8A 2W1GA 3DZQA 4NM5A 2YLFA 3R02A 5CF5A 4LRJA 3QHRA 4ID7A 3D5UA 3T3UA 2JEDA 2W4OA 5FBOA 3FZPA 5L6PA 4GIIA 2JIIA 3R63A 4M15A 4FTAA 4XYFA 4FTTA 3PFQA 5M4FA 4QMUA 4EK3A 3R9RA 4NW5A 1CKIA 5IA4A 5EHOA 3KB7A 2PMOX 5IH4A 3NNUA 4KKHA 3PJ3A 4PL5A 2PZYA 3SX9A 3R8LA 4FV2A 4DCEA 3PG3A 2OFVA 5AR4A 1P2AA 3ZSIA 2WMSA 3R28A 2Z7LA 4UX9A 4JNWA 4XG8A 4C0TA 3MFSA 4I4EA 4PF4A 1WBPA 2R3LA 3WF5A 3C9WA 4RMZA 3HMMA 2UUEA 3FPMA 2XIZA 4DCAA 2Z7QA 3LHJA 4AW0A 4CTBA 5GZ9A 4G5PA 2WZJA 4GFOA 3LKMA 3O71A 4RFZA 1SNXA 3CLYA 4P4CA 4K1BA 4X2KA 3ZH8A 4CVAA 4X3FA 3MA6A 4D0XA 5E8WA 5L6OA 4PTGA 1XH7A 4E4LA 4K18A 2RG5A 2BILB 1OITA 3FI4A 4Q2AA 4TRLA 4FIHA 1KWPA 2QR8A 4E1ZA 4PNIA 4PP9A 3QRKA 5E1EA 3C0GA 5D7AA 2JDTA 5T6KA 4RX9A 4EBWA 4EH7A 2HOGA 4GVAA 2CKPA 4FUXA 3R8ZA 3COMA 3QQHA 3OOGA 4AW2A 3UC4A 1T46A 3PJCA 5EK7A 2GQGA 2YWVA 3PG1A 2CMWA 4MXAA 5F4NA 1GIHA 4QMLA 2GS7A 3SG8A 5M06A 2VN9A 3ELJA 4BTFA 4AG8A 3MPTA 4EZ5A 1Z57A 3UIBA 2A4LA 3ACKA 3R6XA 3L8XA 4O0YA 4IVDA 2B9JA 2VTQA 1IASA 5EHLA 1PKGA 3NW5A 1M2RA 4JIKA 4M14A 3KRRA 1FQ1B 5EKOA 4XV9A 1Q61A 3P5KA 5BUJA 5HG8A 3F2NA 3SQQA 4CZYB 3QZFA 5J7BA 5AFVA 1ZYLA 4E4MA 4KKEA 1XR1A 4JDKA 4FSQA 1PMUA 3MIAA 4BYIA 3FJQE 4DGMA 4GT4A 1GZKA 2WU7A 4ZIMA 4WNMA 3WZEA 1PXNA 3EZVA 4JDIA 4AN9A 2W96B 4IZYA 3VRZA 1P4FA 3R2YA 4ITJA 4I24A 3IDBA 3LFQA 1H07A 3O8PA 3ORZA 3BLRA 3VAPA 4F0FA 2VX0A 2PMLX 4JBVA 3OS3A 4KBAA 4PMTA 3VRYA 2UW7A 1JVPP 3MH0A 5HQ0A 4RWJA 3AT4A 4JBPA 4U41A 2OKRA 4RVTA 4XUFA 4PDPA 5AA8A 4K8AA 3TNHA 3CD8A 3EQBA 3QHWA 4Y46A 3WZUA 3FV8A 3QUPA 3H9RA 3EQDA 4EK5A 2QOBA 3UPXA 1DAYA 2WMTA 5HVKA 5FEEA 1W98A 4O6LA 5TT7A 4FTRA 4IB5A 4X7QA 1KV2A 4DN5A 5FDPA 4WBOA 2PMIA 3OWJA 2I40A 5T3QA 4RSSA 4IAZA 4DFXE 4EH5A 3C51A 5JGBA 1GJOA 1YWRA 3U51A 1M7QA 3P79A 4ANMA 3ZEWA 2OIQA 2W99B 3UZPA 5AM6A 1NT2A 3H0ZA 3BQRA 2PVRA 1H0WA 4IWPA 3LE6A 5E4HA 2VWVA 5HU9A 1QCFA 3KN6A 3E64A 2RFSA 3QLGA 3LQ3A 4O7WA 3GEQA 3VUGA 4FEXA 4E5BA 4RBLA 3VBVA 4YHTA 3R7OA 4FV4A 3U54A 3BGPA 3A8WA 3QTSA 3BEAA 2X7OA 3NPCA 3FXWA 3I0OA 2WPAA 3HX4A 4IVCA 4L45A 4XOZA 5M4IA 2GQRA 4QMTA 4CXAA 3IO7A 3P86A 5JSMA 2WTDA 3B2TA 5A14A 3DT1A 3R8VA 1DAWA 1J1BA 3FKNA 4YZBA 2UZUE 4J7BA 4CLJA 5CEKA 3JVRA 4F1MA 3LCDA 5F94A 4C8BA 3DBFA 4USEA 4HPUE 2Z7SA 3OCSA 3QGWA 4UY9A 4ANQA 5FP5A 4IVAA 3C5UA 5CSXA 4A07A 3LXKA 3NYXA 4I0RA 4R3PA 4ZLZA 2IW8A 2P4IA 3OXZA 1OPKA 3E8NA 4F1OA 2BFYA 3JS2A 4ASXA 4FK6A 3S1HA 4IB1A 2IW6A 2VU3A 4YJQA 2WMAA 4FL3A 3TTJA 4ORKA 4Y95A 2UW5A 4HW7A 4OTWA 5M4UA 4NCTA 3JUHA 4O1PA 2DS1A 4BIEA 4TWOA 4EOOA 4FKIA 4ZXTA 4BHNA 1H25A 4YZMA 5CZHA 1R3CA 3TCPA 3C4WA 5M57A 4I6BA 5K0KA 4DGGA 3WIGA 3MY5A 2WTKB 2VWXA 3AD4A 5FGKA 3UVPA 4DG3E 2VX3A 3OOMA 5ANDA 5CZIA 3TV6A 3FMJA 4MTAA 4AT5A 5LMBA 4J96A 1PKDA 4GU6A 3V51A 3Q4CA 2R3MA 4AP7A 1XO2B 4FKOA 4IX6A 3F88A 3D5VA 2YCRA 2PMNX 3GU6A 4KSQA 3LFSA 3RTPA 3O7LB 3I4BA 4IWQA 2Z8CA 3HNGA 2HYYA 5M55A 3DKGA 4EH3A 3QTXA 4O2PA 3WE8A 1H1RA 1YDTE 3QZHA 4S32A 4EH4A 3QQLA 4CNHA 1YXVA 3LJ1A 3OD6X 2IW9A 4BDCA 3DCVA 4NJDA 3PA3A 3UP2A 3ALNA 4FODA 3ROCA 2OW3A 4F1TA 5JFXA 3QFVA 3RZBA 3G9LX 2OO8X 2OZAA 3G0FA 4X3FC 3DKOA 3Q6WA 5J8IA 4CRSA 4DITA 2VWWA 5AV4A 2XK7A 1JLUE 3NUSA 4MH7A 1XQZA 3NUPA 3KK9A 4AAAA 1R0PA 4OTRA 3VC4A 3P9JA 3HUCA 5AP0A 3H10A 4FYOA 4PDSA 3T3VA 1P14A 4ZOGA 2X4FA 3KXXA 4B9DA 3H30A 3UNKA 2YZAA 4BWKA 1GZNA 1XHAA 3DV3A 5ACBC 2BUJA 4C4IA 3PXYA 4J97A 5AR8A 3ZUVA 2GHGA 2XKDA 2CGWA 4U3YA 3CGOA 2XJ0A 4RIWB 4W8EA 3PTGA 3ZU7A 2XP2A 3BHVA 3M11A 4RQKA 5AP6A 4KRDA 4X0MA 4ZMFA 5HE0A 3RK7A 2UVZA 3Q4UA 5L8JA 1H1QA 3QTRA 1NVQA 3E8CA 4EZ3A 1SYKA 3SOCA 1U54B 3MH2A 3RPVA 4HVHA 4CQGA 3G90X 1W7HA 4G6NA 3T9TA 1F0QA 1Q97A 4H36A 4RA5A 2YLEA 5IQDA 2WTJA 3CD3A 3OBJA 4TZRA 3QRTA 2VWBA 3T8OA 5L2TA 3Q53A 4YLJA 4FKSA 4CV8A 1E1XA 3D7ZA 2OICA 4DEHA 2EB3A 5J95A 4DFUA 3HP5A 2BFXA 4GT3A 2X6EA 2OI4X 3RK9A 3UIMA 3GGFA 4P5ZA 3QWKA 3DBDA 4FA2A 4PPBA 4E3CA 4UYAA 5AIRA 4QQ5A 1OL5A 2XIKA 3GQLA 2W1IA 5I9XA 5FUTA 3F6XA 3R21A 3RP9A 4CEGA 3E8DA 3AMBA 3LZBA 5BPYA 3AC2A 4BC6A 4IAYA 4UBAA 3WYXA 3GCUA 4ACGA 2I1MA 4IDTA 5DWRA 4FKLA 4GL9A 1GZOA 4IDVA 3V04A 3ZDIA 4IE9A 4UV0A 4EOPA 5M56A 1H26A 4O6EA 1XH8A 5I9VA 3UZTA 3LLTA 4FSYA 4BTKA 3MVHA 3FBVA 4NYEA 3UPZA 1ZY4A 3L1SA 2F49A 3V6RA 3FE3A 3WZDA 2ZDTA 4DFLA 5JEBA 4CRLA 2RGPA 3FMNA 4BL1A 2CDZA 1VR2A 3Q9WA 2ITOA 3TKUA 3PXRA 3CS9A 2O5KA 1PW2A 3LMHA 4P90A 4QMNA 1UU8A 4S2ZA 4UXQA 3ZXTA 4XG9A 5IA5A 1UKIA 2GMXA 3M42A 3UZRA 3SKCA 1Z5MA 4A9TA 1W0XC 4X6RA 4FGRA 3ZUUA 4JI9A 4L7FA 4C36A 5CF4A 2C6KA 2GCDA 4YC8A 4DGNA 2UV2A 2QR7A 2PVKA 3Q3BA 5EQYA 1G8AA 5A46A 4O0WA 1UWJA 1JNKA 3LAUA 4MXCA 4O86A 2UW4A 2JBOA 1UU9A 3ETAA 2UZWE 4PMMA 4IX5A 2R3IA 2QLQA 3TUBA 3C50A 2F7EE 1YOMA 3ZLXA 1BYGA 4J95A 1YXTA 4XV2A 4KNBA 2QCSA 5TR6A 2ZMDA 3MJ1A 4F08A 4O0VA 3R8PA 2R3RA 5ANJA 4EH6A 3OCBA 4O21A 5IDNA 3FKLA 1J7LA 4KS7A 3C4FA 5HTCA 4GJ3A 3ID6C 5L3AA 3DTWA 3TIYA 3FXXA 4PUZA 3FL5A 3UO6A 2ESMA 1U59A 4I5CA 3EQHA 3QA8A 1SVGA 1NVRA 4FV8A 5IEXA 3M1SA 2WB8A 5C1QB 4AT4A 3A7JA 2CGVA 2XRUA 3OXTA 3BHUA 3NVMB 4HVGA 4ZSJA 5CQWA 3SG9A 4IBMA 3AQVA 3D2KA 3B2WA 4HOKA 2ACXA 2HZ4A 1SVHA 3IW8A 3QQFA 2LAVA 4ZZOA 4F64A 1RJBA 4GCJA 3AD5A 2PVFA 3F61A 4A9RA 4ZK5A 4BCOA 1LP4A 4UB7A 4OLIA 4FTOA 3OT8A 1REKA 5H3QA 3HA8A 3LJ2A 3FC2A 5CSHA 2JDRA 3O7LD 1V0BA 2G9XA 5AUZA 1H0VA 2F4JA 3LMGA 5DBXA 3Q9ZA 4OAUC 5CX9A 3NNXA 2ITPA 4O0SA 4KRCA 2OXXA 3MWUA 1PXLA 5E8UA 3W1FA 4BCNA 5JT2A 5IQHA 2I6LA 5BVKA 3GUBA 5KX8A 2NRUA 5I9UA 4AQCA 4AE6A 3V5QA 3QA0A 2O0UA 2XIYA 4OTPA 4PX6A 4DH1A 2PE0A 4IIRA 4FV9A 2ZM1A 3AMAA 2ZV9A 2G15A 3BU3A 4GV1A 4K6ZA 3GB2A 3EN4A 5A6OA 2H6DA 2R3OA 3MFRA 5A3XA 4YZNA 3ZONA 5IDPA 4GMYA 2PULA 2PZIA 1URCA 4NM0A 5FXSA 3CSVA 2YDJA 1H01A 3MESA 4DFZE 2WQBA 4II5A 5A4LA 4IAKA 5C26A 4QYEA 3NNVA 5E92A 4O83A 3UO4A 2YDKA 5M09A 2ITXA 2UVYA 3IOKA 3OW4A 4MBJA 5DN3A 5T68A 4Z55A 4FSMA 4F9CA 1VEBA 1FMOE 4DEAA 5CNOA 4QMWA 2VO6A 3E93A 4ZY6A 5K5XA 3DAKA 2PVLA 3U4WA 4OTFA 4I20A 2ITZA 3LPBA 2NPQA 1YQJA 2XNNA 3U55A 4LYNA 4GIHA 3KFAA 4QMYA 5FRIA 4DH3A 4FKJA 3ITZA 3S2PA 4QP6A 1PRYA 3AT2A 4I0TA 2OH0E 4I5HA 4OUCA 3TNQB 3TXOA 4FTKA 4U9AA 5ANOA 4Y72A 3TTIA 4YNOA 2IG7A 3LFBA 1ZYDA 4FR4A 4TY1A 4UWCA 3RM7A 4FZ7A 4M12A 3ZM9A 2ITQA 3IOPA 3HMPA 2J4ZA 4MCVA 3LFDA 2VV9A 3VUHA 4BDJA 4ALUA 2PE2A 2OH4A 2QVSE 3U6HA 5CENA 4BZOA 4U5JA 3DAJA 3UNZA 3RBWA 4FT5A 4PMPA 3TDVA 3ZSGA 3POZA 4V0GA 3G33A 3EMGA 4OR5A 2Y9QA 3II5A 4FMQA 4PWNA 4QMMA 1YOLA 4LV5A 3BU6A 4LGHA 3SLSA 4ALVA 1R0EA 3TV7A 3BPRA 2J0KA 4LL0A 3WF9A 4D2SA 4FEVA 4ERKA 4FIJA 4ERWA 4ZTMA 2W5AA 5DLSA 4FKQA 2E9NA 2W1DA 3EZRA 4AXAA 3FLZA 2NO3A 5EDRA 5J7HA 2R0IA 2I0EA 3LFFA 2V55A 4BFMA 3IQ7A 4FNYA 4K33A 3HEGA 4E5AX 3LQ5A 3OVVA 2J9MA 4GU9A 3R1QA 4EK8A 1F3MC 3UMXA 4K0YA 1XBCA 3Q9XA 1ERKA 4PMSA 3N4VA 1YXXA 4FG9A 1LEWA 4MWHA 2A1AB 4NKSA 4U6RA 3TEIA 1DI9A 4W8DA 4HCUA 3DY7A 4FSTA 5DOSA 4C4FA 3DDQA 2CJMA 3LM0A 3NNWA 5BMMA 3R7EA 4ARKA 1SMHA 4RPVA 4ANNA 1PY5A 3O0GA 3JYAA 3GBZA 1SZMA 4R78A 3P4KA 1OKWA 3ZO1A 3ENHA 2FSLX 3O50A 4D1ZA 5KHWA 5HLPA 3MPMA 5CI7A 4NIFA 2XIRA 4B7TA 3R8UA 1B38A 4ASZA 1JSTA 3FHIA 4R8QA 3W2SA 4O7RA 1LPUA 2A0CX 4W4XA 2HWPA 2R9SA 2BTRA 2CGXA 1OBDA 4O7ZA 1OKVA 2OG8A 5J87A 5KZ0A 3DK7A 2I7QA 4JRNA 2CLXA 5JFSA 4E7WA 2G01A 4O0XA 4BDAA 4OBQA 4BBMA 1UU3A 2OXYA 4AS0A 5DYJA 3QUDA 3OXIA 4BTJA 1O6LA 2C5XA 4XBRA 3HKOA 2BHHA 2VTIA 3GU7A 4IVBA 3E3PA 5GJDA 2PVHA 5AAFA 2UW9A 2WTWA 2X8EA 4OTIA 3VNTA 4I93A 3PSCA 4IC8A 3HV5A 3CY3A 1VYWA 4IZ5A 1V1KA 4OBPA 3SXRA 4IQ6A 2C5OA 2UW8A 4GFMA 3BYVA 2SRCA 2UW3A 1OECA 2VO7A 2DQ7X 4QO9A 4FICA 4G2FA 1GIJA 1NXKA 2JIUA 2W4JA 3U87A 1CSNA 2R3JA 3L9MA 4H58A 5TKDA 3LQ8A 5DRDA 4E26A 4QMQA 3LMIA 3MB7A 1YHSA 2UZNA 5LWNA 3OROA 2ZOQA 4YURA 4G9RA 1REJA 2IPXA 3MIYA 4RWIA 4RVMA 1YXUA 3O17A 5I9ZA 2GNGA 4C4GA 3ZO4A 5CU3A 3W10A 5CVHA 2A19B 2IZRA 3HDMA 5CU6A 3BELA 1XH4A 2PE1A 4LGDA 5TO8A 5CF8A 1NA7A 1JKSA 4CV9A 4TW9A 3ANQA 2ITUA 3KVWA 3OFMA 1YW2A 2Y8OA 2FGIA 1PXPA 1TVOA 2J90A 3CQWA 3I6UA 3NYNA 4FSWA 5F1ZA 4DC2A 3FXZA 4EHEA 3KXMA 3BE9A 4KINA 5AV2A 2W06A 3PA5A 2W9ZB 5DA3A 4C2WA 4RWKA 1U5RA 2C0IA 5LMKC 1K3AA 2B9IA 4D2PA 4I4FA 3DXNA 5LVLA 4AGDA 5DNRA 4L52A 4NSTA 2FA2A 3KU2A 1WBTA 2OU7A 3MFUA 3R9NA 4BGQA 3KULA 4USDA 2AYPA 5JRQA 3T9IA 1BI8A 1OL2A 4RJ5A 2ITYA 3W8LA 2HW6A 5KNJA 3VS1A 3SC1A 2BAKA 4DEIA 3R1NA 3R30A 4TYEA 3V8SA 3VJNA 4CSVA 5HICA 3GQIA 1Q8TA 2G2FA 3NIZA 1WFCA 3R22A 3QKMA 2VNYA 3D94A 3GOKA 4YNEA 5CAPA 3LXLA 5JQ8A 3ZEPA 5FP6A 2Z02A 1BMKA 2OJFE 1O6KA 3V5PA 4NU1A 3PIYA 2CHLA 1XKKA 3IW4A 4JG8A 4GK3A 2WQMA 4D28A 2X9EA 2Y4IB 4RX5A 2OFUA 3IDPA 2GHMA 2QG5A 4IWOA 4UWBA 1OI9A 2IZSA 3KCKA 1RQQA 3PJ8A 1E9HA 1H1SA 4FNXA 3FPQA 3MJ2A 5J9LA 3BBTB 4ACHA 2EWAA 3NX8A 3A62A 4BF2A 2RL5A 4RX8A 3VUTA 4CD0A 4FTMA 4BIBA 1AGWA 1Z9XA 4D55A 4QTDA 5CEOA 1SNUA 4EHVA 1YI4A 3QRIA 2EVAA 2HCKA 5CANA 1PYEA 4J98A 3BRBA 3S00A 2C5NA 1Y6AA 3NLBA 4JLCA 5D1JA 2QKRA 2UZTA 3BE2A 3ZFXA 4BB4A 2EXCX 3C4CA 2ZV8A 5HOAA 1S9IA 4H05A 4Q5HA 1H1WA 4FZDB 5FD2A 3RJCA 5AA9A 2XBAA 3QZIA 2F9GA 2UZVA 3R2BA 4YJOA 4O7VA 5EQEA 5IQGA 3PRIA 3W16A 4FTCA 1YWVA 3OEZA 4J8MA 3PSBA 5DRBA 5FG8A 1KE7A 4XRJA 4CMTA 3C4EA 2RG6A 4M0YA 1Y57A 4ZTRA 3CR0A 1FPUA 2JITA 3AXWA 5EH0A 4RA4A 2I0YA 4FKRA 5J79A 1BX6A 5AP4A 4L43A 2OZAB 3GCQA 1YWNA 4LUEA 1A06A 3KRWA 2ONLC 3GVUA 4XH6A 3EWHA 3FZRA 4UMTA 3GCSA 5EI2A 5IQBA 2R0UA 2LGCA 4H3QA 4PRJA 4DGOA 4F9YA 3CGFA 2G2IA 3R7UA 5IA1A 2QOKA 4KWPA 2P55A 4LL5A 3IK3A 3FY0A 5ETFA 2J51A 3LLAA 2HXLA 2F2CB 3GC9A 5K4IA 3LXPA 4ALWA 3F2AA 2IVSA 2W1ZA 3ZS5A 2XNPA 5A4CA 3VBYA 3UO5A 2A2AA 3A8XA 5LVNA 4R7BA 4NFMA 5AV1A 3NUXA 3PLSA 5ETIA 3TZ9A 4Y5QA 3RAWA 4D9UA 5AP7A 3AC1A 3FMHA 1UNGA 2YCQA 3UQGA 3N51A 3PPZA 5M07A 4IC7A 2VZ6A 2R3HA 5CXZA 2XK4A 3GC0A 3RNIA 4GVJA 3WF8A 4U45A 2YM8A 4DEGA 5HCZA 4FL1A 2XM9A 3DJ7A 3KKVA 3ORPA 4YGAA 3REPA 2V0DA 3BYOA 1V0PA 5KBRA 5BVEA 4ENXA 5DE2A 3PVBA 1LR4A 3N9XA 4ZSGA 3HYHA 4ANLA 5A54A 2NNWB 1GZ8A 5AP2A 4N4SA 5LVPA 3I79A 5BQ0A 4CMOA 1OIYA 5I4NA 1H1PA 4OT5A 5C9CA 2VTLA 2WTVA 4Y85A 2JAVA 4J99A 2HZNA 1W8CA 3FI8A 5GZAA 1WBVA 2WOTA 3BU5A 5EYKA 1QPDA 4Z7GA 3VIDA 3A2CA 1KUTA 5JQ5A 2IZTA 4BDKA 2X2MA 5GHVA 4QP1A 3VVHA 2HENA 4Z9LA 2B0QA 4FT3A 3SAYA 3QRJA 3LIJA 3F3VA 1K9AA 2BIKB 4XHKB 1UNHA 3CIKA 2X7FA 3EN5A 4RQVA 4AZTA 4AZWA 5H8EA 5C4KA 4EOIA 2IVVA 3GFWA 5EM6A 4IWDA 4RG0A 4EOKA 2KULA 5HO8A 3O8TA 3D2IA 4I94A 2C5VA 4EK4A 3GFEA 5J5TA 4NW6A 4QQCA 2HIWA 4CMUA 3PLAE 2WEIA 5IA0A 3R1SA 2QHNA 3TUDA 1JOWB 3ODYX 3DK6A 3MS9A 2C68A 3FY2A 3PY0A 3ZRMA 3E7OA 4EI4A 1MP8A 3K3IA 4G3EA 2BZHB 3BZ3A 4ASDA 3QTUA 2QO2A 3DQXA 3FSKA 4FKVA 5EI8A 3CKWA 3OW3A 5GJFA 5CSWA 4BDDA 3G15A 4CZTA 5LXMA 1JKTA 5E90A 4IX3A 2BPMA 3PWYA 4BTMA 2WD1A 2AUHA 2YJSA 1L3RE 1XBBA 3D5WA 4HGSA 3RPSA 4ZJIA 5KKRC 4A9SA 4QNAA 3HMOA 2DWBA 4X3JA 4WOVA 4O0RA 4FZFB 3JVSA 2B4SB 3UYTA 3ZZEA 4MKCA 4GUBA 4QPSA 1PJKA 3EKKA 4YUQA 3D7TA 2YIRA 1Y8YA 2PUPA 3V3VA 1QPCA 2IO6A 1AD5A 4O0TA 5E8XA 4GYGA 3KCFA 4HZRA 2OGVA 4IB0A 3ORNA 5HO7A 4MEDA 4QT1A 4UMPA 5L2WA 3IG7A 1WVYA 2YZLA 3DAEA 3V5JA 3I60A 3V6SA 4MD8E 4GS6A 3ENMA 4FV1A 5EKNA 1MRUA 3RHKA 2X1NA 3SA0A 4O81A 2JKOA 3FLYA 3QD4A 3OCTA 3VBXA 2X2KA 4UZHA 1IAHA 1HCLA 1WVWA 3DFCB 4WA9A 1T45A 3R7GA 4G3FA 5L4QA 1PMEA 3UQFA 3COKA 4AUAA 4FTIA 1Q8ZA 4C34A 3CPCA 4IX4A 4ZJJA 3RI1A 5IKWA 3KVXA 4AOJA 3DTCA 1Y6BA 4N6ZA 5AUYA 2QURA 2OBJA 3DNDA 5IUHA 3F2RA 3P7AA 2E9OA 2PSQA 4OGRA 3ORLA 5JRSA 5C8MA 3L8PA 3BI6A 2C6IA 4FNWA 3UOHA 5HIEA 2YM3A 3POOA 4AOIA 5EW3A 5AUXA 4C58A 3EB0A 4HYUA 4FYNA 4IJPA 4G34A 5EYMA 4BR3A 2QKWB 5DPVA 3FUPA 4ANOA 2R5TA 2EU9A 5IA3A 4RIXA 4OBOA 3LFNA 2CLQA 2ETKA 4JL9A 4WT6A 5EDQA 5HHWA 4QTCA 2R4BA 3ATSA 2O63A 3DA6A 3Q96A 2BRHA 2XUUA 4AF3A 2JDSA 3QX4A 4B0GA 4U80A 3RZFA 4H1JA 4M13A 1FVVA 5L8LA 3SRVB 4HPTE 5HESA 2PUIA 1S9JA 1AQ1A 3A60A 4YBJA 5B0XA 3Q2JA 4D4SA 3R04A 2YHVA 3CQEA 4M69A 2QOFA 2XNGA 4LOQA 2V7OA 5AM7A 1WBOA 2YAAA 2PU8A 5TE0A 2UZDA 2IVTA 2BTSA 2HW7A 3N4TA 3TM0A 4C35A 2XNMA 5M4CA 3ORKA 2XK8A 4FV6A 4AN2A 5F9EA 1FBNA 2VWUA 4DT8A 4YZCA 5IF1A 3WZKA 3AC5A 3U6JA 3C4ZA 4W9WA 3L8VA 2C6LA 2YN8A 2XA4A 4P5QA 5CT0A 1ZZLA 1GNGA 4BDBA 4C3RA 3QCYA 4FBXA 3W2RA 4Y8DA 3V5TA 4LRMA 3VBWA 3AC3A 3IDCA 2V7AA 3QBNA 3EJ1A 3DJ5A 4DTAA 3DXPA 3VUDA 3KL8A 4W4VA 2E9VA 5H8BA 3AGMA 2H9VA 2PUNA 4D1XA 3CPBA 1ZMWA 5LCJA 2X39A 3LCOA 4ZZNA 2XRWA 3QC9A 4DG0E 3O51A 3HGKA 4L01A 3RWPA 4J71A 3UP7A 4EC9A 4HGLA 4UALA 2YIYA 3F7ZA 2R3PA 2BRMA 5L2IA 4BVUA 5M51A 3TDWA 4FVPA 3ZLWA 1UV5A 3UMWA 3PVUA 5IZFA 5C8KA 3AC8A 3B8RA 5E8TA 3S3IA 5DEWA 2ZM3A 4DH7A 5K9IA 5KUPA 3QQUA 5EFQA 4ZTNA 4CZUA 1FGKA 3PPKA 5BUIA 1MRYA 3PXFA 1OUKA 3FQEA 3HUBA 4FSNA 3AOXA 2WOUA 3PUPA 3I0QA 4UMRA 2VWYA 2OIBA 3VS3A 3QL8A 5GNKA 4PTEA 1BI7A 3OUNB 5HLWA 4FTUA 3ULIA 4GK4A 4YR8A 1O9UA 4XX9A 4FV7A 2YCSA 4FTQA 4O22A 5BVFA 4JG7A 4S31A 2BDJA 3PZEA 4Z16A 4GUEA 4KBCA 5CI6A 4AW1A 4IAAA 1FGIA 5IH5A 1H28A 4FG7A 4LV8A 4H3PA 4FT9A 3OY3A 3LCSA 2GFSA 4YJVA 4AFEA 2EXMA 4EL9A 5CAUA 4BCMA 3F82A 5AX9A 4A4LA 1OIQA 3DDPA 5K4JA 5CU4A 3C4XA 5D9HA 5HVJA 4AGWA 2IWIA 2WEVA 4NKAA 4JAJA 4HJOA 2RKUA 3KXGA 1YRPA 5F20A 4IJ9A 5GIPE 2F2UA 3G2FA 1Q8YA 3C1XA 3Q5IA 2OJJA 2YM4A 5D7VA 3FAAA 2X6DA 3FSFA 4A4OA 4C3FA 4FOCA 2BRNA 3ZYAA 4DA5A 4FV3A 3TL8A 1PF8A 3QTWA 3EQGA 5ICPA 3TV4A 4MVFA 5BYZA 2ITWA 4ZSAA 1Y8GA 3LVPA 1Q4LA 2ERKA 3K2LA 2J0LA 1ZOHA 3F69A 2PZPA 3GU5A 5HBHA 2Q83A 4HYHA 4RIYA 1RDQE 4E73A 2C6EA 3OTVA 4XG3A 2NP8A 4IACA 3G6GA 4FIGA 4IXPA 4X2FA 5EM7A 3D5XA 3U4UA 4AACA 4OTDA 2CSNA 3OT3A 4E4NA 3L9NA 2GNJA 4RFYA 4X2GA 4XP3A 3ATTA 3F5PA 2WFYA 4L46A 4XV3A 5AR5A 2OSCA 3FZSA 4QYYA 4E20A 2KTYA 4G9CA 2H96A 1U4DA 3ORXA 4L42A 3C13A 4FT7A 4MXOA 3LFEA 2JKKA 4BN1A 4BWXA 4ZLYA 5CEPA 5IQFA 3C0IA 3EQCA 3NZ0A 2ITTA 2IVUA 3FLNC 3BX5A 3UDBA 3KEXA 4BWPA 4FTLA 3UGCA 1R1WA 3BLQA 5CVGA 3DLSA 4FOBA 5AR7A 3TN8A 5DH3A 4ZS0A 4D5KA 4L00A 4UN0C 1ZYJA 4RGJA 4CCUA 2YABA 5BYLA 3EQRA 4IHPA 3KF7A 4AWIA 1Q8WA 5EYCA 3KMMA 4IFGA 4YHFA 5AR2A 1OBGA 3DBCA 3MH3A 4Y5HA 3CCNA 5LARA 3WOWA 3VS2A 3FZ1A 1ZARA 3OWLA 3KXNA 4IZ7A 3UG2A 3VQHA 4B8MA 4D4YA 3R00A 1UWHA 1TKIA 3OY1A 4TPTA 1W84A 5B2KA 4BKJA 4R5SA 5HE2A 5CNNA 3EFKA 3OWPA 5HEZA 4QP8A 1IG1A 1J1CA 2QO7A 4YPSA 3HRFA 4Z3VA 3FDNA 2O2UA 3ZC5A 5BVOA 3UJGA 3QKLA 2UZOA 4ZSEA 3PA4A 5AV0A 3UVRA 4E6QA 1XH5A 2VTHA 3IONA 2Y7JA 4MWIA 5J5SA 3K5VA 5LMKA 3A99A 4R1VA 3BHTA 3R9DA 2UZBA 4TL0A 4JS8A 4XP0A 4F0IA 4JJRA 1GIIA 4JQ8A 2W05A 2XNEA 3QXOA 4E5WA 3HAVA 3COIA 4D0WA 2VWZA 3CTJA 3BWFA 3KULB 4JOAA 3O96A 4N0SA 2WO6A 1W83A 4U3ZA 3IS5A 4I5PA 3GENA 5GIOE 2E9UA 3F9NA 1J91A 4BBEA 1TQPA 3D14A 2YITA 4LQMA 5F95A 5FBNC 3WBLA 2YFXA 1J3HA 1MUOA 3ZZWA 5JFVA 4YTCA 4E6DA 3VBTA 5KMMA 3NYOA 4QMOA 1JKKA 2W17A 4O0UA 3NMUF 4J52A 2QI8A 3GU8A 3R01A 2X8IA 2O64A 2Y4PA 4F6UA 5ETAA 4DEDA 4DT9A 4XG7A 3MBLA 5C8NA 2XKFA 2HWOA 4AOTA 3TT0A 4JR7A 1IA8A 2CN5A 3AMYA 3PVWA 4KS8A 3TZMA 1XBAA 3HECA 4ZEGA 3SOAA 3TIZA 4AX8A 2B52A 4L53A 4QMSA 2WNTA 4L44A 5KMIA 1YI6A 2GNIA 3PYYA 3ANRA 3WI6A 2ZV7A 3EN9A 3BGZA 5FTQA 4FF8A 1YDSE 2ZJWA 4AGUA 1Q3WA 3GU4A 4PPAA 4RZVA 1YVJA 3R71A 5IQEA 1KSWA 4C4JA 3THBA 1JPAA 1QPJA 4OTGA 4QD6A 3PP0A 3VS7A 3CY2A 5DVRA 4Q9SA 4YMJA 4MNEA 4F6WA 3NYVA 1KV1A 1LEZA 5ACKA 4DINA 3QX2A 3SXSA 4KD1A 3TG1A 4EQMA 3RAHA 4M66A 3KK8A 3NW6A 1OM1A 3MW1A 4QMZA 4GYIA 3C0HA 4HGEA 2X4ZA 4I41A 2P3GX 3BGQA 3FI2A 5I3RA 3HRCA 4FEWA 4DBXA 4AZSA 3COHA 5KO1A 3BV3A 4PTCA 2BZKB 3G9NA 1EH4A 5BUEA 4R1YA 5HG7A 2PWLA 3VJOA 4AZVA 3Q52A 2BHEA 5LVMA 1JWHA 2VTNA 4R7HA 2PK9A 3QQJA 5HTIA 5J9YA 4EJ7A 4M68A 4QOXA 3FEGA 4WSYA 1ZY5A 2WQNA 4GG7A 4X3FB 3IECA 3OBGA 4XMOA 5HG9A 2ONLA 4TN6A 3GNIB 3A4PA 3R1YA 5FWKK 3ROYA 5CEQA 4QP7A 2V22A 3TWJA 3LCKA 4D2TA 4E93A 2WELA 3OZ6A 3IKAA 3E5AA 4FIEA 3PY1A 5CQUA 3RK5A 2GTMA 4HGTA 4YC6A 3FWQA 4F9BA 2DUVA 2QD9A 4YJPA 2WQOA 3EYHA 3HV6A 1NY3A 3PXKA 4RC2A 4MX9A 4QP4A 3FQSA 3HVCA 5ETCA 3W55A 3E8EA 4Z7HA 1Q8UA 3PZHA 5IQCA 3PJ1A 4FGBA 3SVVA 1KE9A 5DI1A 4CFUA 3WILA 3ZUTA 4BKYA 5DEYA 5I9WA 4JRVA 4F7SA 4Q5EA 2QOCA 4G16A 4KAOA 3BYMA 2JIVA 4OTHA 3FLSA 4RWLA 4AW5A 4PP7A 2VTAA 1IA9A 5D11A 3TUCA 5DMZA 3FMLA 2H34A 5AIKA 5D12A 3W2CA 4BYJA 4RX7A 4JT3A 3PY3A 1YOJA 2WTKC 2ZVAA 1ZRZA 3CTHA 1ZYSA 4N70A 1K2PA 3MVLA 4QNYA 2R2PA 5CTPA 4RJ3A 3HMIA 1KOAA 2BDWA 1HOWA 3TI1A 4C4HA 2Z60A 2JAMA 3U9NA 1HCKA 2E2BA 3A61A 5HKMA 1Q5KA 4RZWA 2BKZA 4XBUA 5DG5A 5KMLA 2RFEA 4UEUA 4ZAUA 3F3TA 3E62A 2XVDA 3FKOA 2GNLA 5E8SA 1ZYCA 3PIZA 3A7FA 1OIRA 2CNQA 2W1FA 3BCEA 3FC1X 1OL1A 5CVFA 5HE1A 1DM2A 4F9WA 3F5GA 3MY1A 4K77A 3VW8A 4KIPA 4O96A 5CEIA 4H1MA 3Q04A 2UVXA 1SM2A 2NRYA 1APME 2PVNA 2YWPA 3K54A 4FX3A 4NM3A 4U7ZA 2JDOA 4XRLA 4CG8A 3RHXA 4NK9A 4UWYA 4XJ0A 3DOGA 4DH8A 2CGUA 2BZJA 4BIDA 4GT5A 4L6QA 4M0ZA 4QMPA 3D0EA 4U42A 3GOPA 1BLXA 4AA5A 2O8YA 4O7LA 2BZIB 4F70A 2QOIA 3CJGA 2XB7A 3BQCA 4FNZA 2QLUA 2B7AA 1IRKA 2UZEA 3R73A 4DLJA 2XCKA 3PVGA 4QRCA 4QQTA 3D4QA 4BCHA 3FL4A 4FV0A 3HP2A 2RIOA 4I92A 1JQHA 1UKHA 4KIOA 5AX3A 5CS6A 5A4QA 1H4LA 3AGLA 4NWMA 1XJDA 2XYUA 4W9XA 4KB8A 4DEEA 4BCGA 4TYHA 4S33A 4KSPA 3QC4A 5AMNA 4O27B 1ZXEA 2ZMCA 3UODA 2FSMX 3L8SA 3UVQA 3MVMA 2OZOA 3SDJA 1PYXA 3SW4A 2ERZE 4EHZA 1FVTA 2IJMA 2VUWA 5J1WA 3QQGA 3TKIA 3FZOA 4BI1A 2GNFA 3OF0A 3Q2MA 2XNOA 3P08A 5TF9A 4C37A 4D4VA 4NZWB 5KMJA 2WMVA 4R77A 2XK9A 3D7TB 4U40A 1ZLTA 4ENYA 3P1AA 3QD3A 5ANGA 3VUKA 2R7BA 4EYMA 3AG9A 3E92A 3SGCA 5CAVA 3EL7A 3DLZA 2C4GA 4UMUA 5C4LA 3SD0A 2VWIA 4WNKA 3I6WA 2R3KA 5B2LA 4G1WA 5E1SA 4YZ9A 4I6QA 4AN3A 4YLLA 3EHAA 4CT2A 4EH2A 5KZIA 3R8MA 2OK1A 3GT8A 2W4KA 2JKMA 2PL0A 3P7CA 3QXPA 4U81A 2DYLA 2Y0AA 4O2ZA 5AEPA 5HU3A 3PJ2A 4CFVA 4WUNA 2CNUA 4NM7A 4G5JA 3QCXA 2XKEA 5I5ZA 4E8AA 5K3YA 4EK6A 1BL7A 3GP0A 2QHMA 5M08A 2WMUA 3TNPC 3LFAA 3PRFA 2C6TA 4YP8A 5AAEA 2X81A 5I9YA 4O84A 2YEXA 3PXZA 5CWZA 5CALA 5FM3A 4PPCA 2X0GA 1PMVA 1FVRA 1OVEA 3OP5A 1PXOA 3MY0A 2QO9A 2X8DA 4CT1A 4RFMA 2BVAA 2YACA 4QPMA 1M14A 1IR3A 4HVDA 4DHFA 4JDJA 3NUYA 3G5DA 1TQIA 4X6QC 4D1SA 4D4RA 2VD5A 2R64A 5EW9A 4LG4A 1VJYA 5ANKA 3MV5A 3R7IA 3JPVA 5EOBA 4EOLA 2RSVA 2GNHA 3OMVA 5D41A 4D2VA 4A4XA 5HTBA 4C02A 5IQIA 2XCHA 1CDKA 5G6VA 4EWHA 3S4QA 4RIXB 3BHYA 5HLNA 2GS2A 4U97A 3ZRKA 5IEVA 5CY3A 4ACMA 4G6OA 4L68A 4MQ2A 3BYUA 2J6MA 3WYYA 2AC3A 5IU2A 4MD9E 3KXHA 2B54A 5EM8A 4TWNA 4EC8A 2JFLA 5JZJA 2QQ7A 4DF3A 3PWDA 4YJUA 5HNIX 4I1ZA 5DHJA 5B2MA 5HGIA 2HZIA 2IN6A 3FLWA 4AA4A 3PXQA 3O2MA 5AP3A 4OW8A 1FMKA 4GK2A 4M69B 3ZLYA 2C3IB 4J8NA 5CSVA 5IMEA 3KMWA 2YJRA 3QZGA 1PMNA 3PDTA 1Q62A 4ITIA 4BGGA 4ZJVA 1ZAOA 4FVQA 3RPOA 5JZNA 1LUFA 3MYGA 3LW0A 4D58A 5HD4A 4G3DA 3ZC6A 1M2PA 2YIWA 4O1OA 1A9UA 2R3FA 3FQHA 2XEYA 3BBWA 3OG7A 2V5QA 4E6AA 3NCZA 3ORIA 4FK3A 5ANEA 2JGZA 3UOKA 4BDFA 4YO4A 3QTZA 3VUIA 4F0GA 4S34A 4PQNA 4CTCA 3QYZA 3KMUA 3DBEA 3RALA 3U6IA 4IH8A 2C6DA 2ZV2A 2BKKA 4O7NA 3ZFMA 5KBQA 3ACJA 2GSFA 3VHEA 2QNJA 4GKHA 4TT7A 4V05A 1A48A 3QKKA 2X9FA 4WG4A 4C4EA 3QQKA 4FE2A 1NVSA 2JBPA 3RAKA 3QCSA 4JAIA 3I5ZA 1E1VA 4FZ6A 4MXZA 5LWMA 3JR1A 3G0EA 3MI9A 5E91A 5JFWA 4MAOA 3DKFA 4NJ3A 5IEYA 3HAMA 5FEDA 4WRGA 2JLDA 3NIEA 3SHEA 5HZNA 2Y6OA 3QD0A 3CXWA 5CAOA 2WTIA 2W5BA 2C0OA 4EWQA 2WQEA 4U44A 1OKZA 3KC3A 5CXHA 3R7YA 2W1EA 4CFXA 2OXDA 3HV3A 1QL6A 1VZOA 2CKQA 4F9AA 5BNJA 2QODA 2B1PA 3FMKA 1JSUA 3MGYA 4M7IA 4F65A 5GZ8A 4KIKA 4BKZA 2ETRA 3EL8A 3QTQA 3NR9A 5JMSA 2VGOA 3AC4A 1PXMA 3OTUA 4H3BA 3VS0A 4L9IA 2I0HA 1BL6A 4BGHA 4J53A 2VO0A 4AT3A 2XYNA 5IUGA 1QMZA 2VGPA 3DNEA 4QYHA 2C6OA 2B53A 3RCJA 4LMNA 4FT0A 1IAJA 1JKLA 3QLFA 5AV3A 3KREA 4JX3A 2Z7RA 3TKHA 3BV2A 3C5IA 2YERA 4C57A 4RC4A 2XK6A 3RKBA 2XNBA 3OC1A 3UNJA 3ZO2A 4FKPA 1OUYA 5JK3A 5AAGA 3RGFA 1IEPA 4DTKA 3DQWA 4FEUA 4XG6A 1PXIA 4W4WA 3H9OA 5HG5A 5CLPA 3R9HA 3FI3A 2ZM4A 4LUDA 5HI2A 3BYSA 3D83A 5HBJA 5DIAA 1W82A 5EI6A 2QOHA 4R5YA 3NAYA 2P2IA 2WXVA 4M67A 3AD6A 4HVIA 3F5UA 1OPJA 2RF9A 3UQCA 4EHGA 4NTTA 5BVWA 5J1VA 3RCDA 4EUUA 1BKXA 1YKRA 1ZOGA 2Z2WA 3F7WA 3FMEA 4JX7A 2B9FA 3VF8A 5KHXA 3HZTA 3K3JA 3EFLA 4EYJA 4H39A 3I7CA 4XEYA 4EH9A 3GXLA 3F66A 4RIYB 5LOHA 2WIPA 4N6YA 4A06A 4F7JA 5FQDC 1M7NA 3HV4A 5GJGA 4BI2A 5EQPA 3HMNA 3F3ZA 2OF4A 4YHJA 2PVMA 5HD7A 2VTMA 5DR9A 2W1CA 4OT6A 4WD5A 4BBFA 4USFA 4FIFA 4FKUA 5BX0A 1KE6A 3NUAA 4GJ2A 4PDYA 2JKQA 1F5QA 2C47A 4MYGA 2QONA 4L3LA 4MXYA 4YJRA 1URWA 2BMCA 2GTNA 3C7QA 5EW8A 4K11A 5KE0A 5TOZA 3TJCA 4EJNA 3TNIA 3VBQA 5CEMA 1KOBA 4K2RA 3MDYA 2HZ0A 1I44A 2YISA 1FINA 1UU7A 4JVGA 2EXEA 4NH1A 3BWJA 5JN2A 4KBKA 4PL4A 1PXKA 1YHVA 2B9HA 3WZJA 5L2SA 3VULA 2C5YA 4JR3A 3CKXA 2OWBA 3UYSA 4EUTA 4WIHA 4RJ7A 3LJ0A 3NGAA 1H8FA 2OJIA 3H3CA 5LVOA 4EOQA 3H9FA 5LJJA 4GKIA 4QYFA 4LMUA 4JDHA 4I0SA 4IM0A 1WMKA 3FHRA 3CP9A 4M97A 2WMWA 3VS6A 4U79A 4EORA 4UYNA 4ZLOA 4EOSA 1YI3A 3EYGA 5BVDA 4YLKA 2PY3A 5DT4A 3RMFA 4WO5A 3EQPA 2JDVA 3D15A 5E7RA 3KQ7A 2VTPA 2ZAZA 2PZ5A 4DAWA 3MPAA 3UBDA 5DGZA 4FL2A 2CKOA 4DE4A 2C30A 3DZOA 1I09A 1WBWA 4C33A 4CYIA 3Q6UA 3QALE 5ANIA 4A9YA 5ITAA 3R9OA 3GC8A 4ANBA 4E4XA 4BCKA 4R7IA 3WE4A 1H00A 4QTEA 4QPAA 4D2WA 4EQCA 1QPEA 3NEWA 5IG1A 2QOOA 4GSBA 5L6WL 4V01A 1XH6A 4NEUA 4EKLA 5IPJA 5IQAA 1ZZ2A 5C03A 3Q4TA 5HNGA 5FXRA 4BCPA 2BIYA 3EFJA 4AE9A 2W1HA 4PL3A 4BHZA 2BRGA 4B4LA 3LXNA 4RVKA 5AJQA 2ZB1A 5G1XA 3ZDUA 5HIBA 4FSRA 4DFNA 4TYJA 3VWAA 1CTPE 4CCBA 4JQEA 5HVYA 4EBVA 4N57A 2XMYA 3GCVA 2OIDA 3FYJX 2R7IA 1H24A 2O3PA 4RJ4A 2WHBA 3O23A 4MK0A 3ET7A 3UIXA 4ANSA 4V0GB 5FXQA 4R3CA 3FMDA 1YXSA 3V01A 4AGCA 1OL7A 3GC7A 2O65A 4CYJA 4EZ7A 2V62A 5AWMA 2BAJA 1NW1A 2YIQA 3Q4ZA 4YU2A 3I81A 3TACA 1WVXA 2BROA 3EH9A 5DT0A 3ZM4A 3ZRLA 2X7GA 4XG4A 4UXLA 3DBQA 3VF9A 3SW7A 3FZTA 4WNPA 3H4JA 2E9PA 3RVGA 4NTSA 4QTAA 4MNFA 3UIUA 3R83A 2C3KA 3NRMA 3UG1A 3VHKA 2HAKA 4RC3A 2PYWA 4HCTA 3R0TA 2WMXA 2PHKA 2J2IB 5KMKA 4GG5A 2F57A 3TZ7A 5HBEA 4IEBA 2VO3A 4MNEB 2P0CA 4AZEA 1KE5A 3ODZX 2VTOA 5K5NA 5I3OA 3ZTXA 4IW0A 4IFCA 3KRJA 2BR1A 4TYIA 3N4UA 4EOJA 2C6MA 2XKCA 3Q60A 4M84A 4TKSA 2XBJA 4YTHA 3HL7A 4EH8A 5HO6A 2FYSA 4IM3A 5FDXA 4TWPA 3ZXZA 2BCJA 4WG5A 2HXQA 2YCFA 3NAXA 4JBQA 4DTBA 4O38A 2WMRA 4FSZA 4D5HA 2ZDUA 4YZDA 2JFMA 4PDOA 3PP1A 3CBLA 2B55A 3KF4A 3KN5A 2QU5A 3Q9YA 4A7CA 4I3ZA 5EDPA 2ETMA 2ZB0A 3EOCA 1J7IA 5JKGA 3P7BA 5H2UA 2WAJA 4ACCA 4BI0A 3W2QA 5A6NA 4FV5A 2XZSA 5H9BA 3ZFYA 4O7YA 4JQ7A 4F7LA 4XLIA 3P78A 1B6CB 3P0MA 4LRKA 2Q0BA 4GW8A 2XF0A 4NIFB 5LCKA 3SV0A 3ZLSA 4V04A 4FSUA 3FLQA 4FEQA 4X2JA 3IW7A 4IZAA 5M44A 2Y4IC 2I0VA 3OEFX 4NT4A 4HVSA 3VQUA 4M3QA 4MXXA 2XH5A 1PXJA 4BCJA 5JGAA 4X21A 3E63A 3NW7A 4HZSA 1YDRE 4CFWA 4F4PA 2FO0A 2VRXA 3NS9A 4XNEA 4WHZA 3UC3A 3EIDA 2EB2A 3LOKA 3DB8A 3QWJA 5AADA 5KCVA 1M52A 1G8SA 2VTJA 3MTLA 5HCXA 4KUJA 4CGAA 5IMXA 3PSDA 4YJNA 5AUVA 3ZHPC 2JD5A 4L7SA 5FTGA 2BAQA 1H27A 3DB6A 3NVKI 5AUUA 1RW8A 3NCGA 1FOTA 5JH6A 4B6LA 1B39A 2PPQA 5HNBA 3OHTA 2HELA 2IZUA 3UE4A 2CCHA 2WIHA 4FKGA 3VN9A 4IB3A 4NCTC 1ZOEA 2PVJA 2XK3A 2YM5A 4O91A 4A9UA 4LM5A 4QP3A 4EQUA 4TNBA 5FM2A 1M2QA 3UOLA 4UZDA 2YDIA 4NL0A 1XWSA 5HIDA 2YM6A 4G3GA 1Q99A 3F3UA 3DS6A 2GPHA 1O6YA 3BHHA 4IAFA 3W8QA 5CF6A 1ZMUA 3NUUA 4YC3A 4C7TA 2CN8A 1R78A 3QUEA 4WNOA 5LMAA 1JBPE 5A4EA 3CC6A 3CJFA 3SXFA 3DPKA 5IH6A 1UA2A 2GFCA 4YSJA 3EN6A 4PV0A 3R7VA 4BDGA 4FG8A 4YBKA 3PIXA 4DGLC 4DLIA 4Q9ZA 2VTSA 4RLKA 4HYIA 4BDIA 3NUNA 3QU0A 4DYMA 4ASEA 3U8WA 4LOPA 2R3GA 1OGUA 4CQEA 2W7XA 4BZDA 5CAQA 2FH9A 3NDMA 5C27A 2VTRA 4C3PA 2VNWA 5EM5A 1Y91A 3D9VA 1JSVA 3W2PA 1X8BA 4QMVA 2GQSA 1Q24A 4GFGA 1VYZA 2QC6A 4QYGA 4KIQA 2R3NA 4WG3A 2F7ZE 4ZY4A 3O8UA 1P4OA 2J5EA 5KMNA 1Q3DA 4GEOA 1BUHA 2JC6A 2OJGA 2FSOX 4O7SA 2CKEA 4FZAB 5B7VA 3RNYA 4TWCA 4CFMA 2GU8A 3ZBXA 4F7NA 2C1AA 2PTKA 4RRVA 2RFNA 4ZTQA 3SRVA 4DEBA 1UNLA 4R6VA 5CSPA 2QU6A 3Q32A 3V8TA 3KXZA 4RIWA 1WBSA 3IW5A 3G51A 4XV1A 4BRXA 4TYHB 1Q41A 3RM6A 4M8TA 3EQFA 3KRXA 1OPLA 2FB8A 4L8MA 5C01A 1M17A 1WAKA 5KKRB 4W4YA 3W33A 3EKNA 3QCQA 3JY9A 3LCTA 4BCQA 1U54A 4ONAA 3CE3A 4J1RA 1R39A 3WIKA 2FSTX 2PUUA 3OCGA 3JXWA 3V5WA 4YTIA 4FVRA 2YM7A 4ITHA 4ZTLA 2GHLA 2ZYBA 3EFWA 4GRBA 5IUIA 4ACDA 4FKTA 4FUYA 3VUMA 4OTQA 1G5SA 1OZ1A 4BICA 4TNDA 4ZS4A 3LFCA 2VAGA 3FYKX 1XH9A 4JXFA 4BDHA 3DK3A 4XG2A 1ATPE 2EUFB 3FMMA 2G2HA 4DH5A 4RLLA 2J5FA 3PE2A 5H8GA 1STCE 3MB6A 4EKKA 5M53A 3DXQA 3GI3A 4CLIA 2YAKA 3A4OX 2X2LA 2H8HA 5L8KA 2W9FB 1OKYA 2CNVA 1WCCA 3IW6A 5EYDA 4D2RA 3P23A 1CKPA 4QMXA 3RAIA 4C38A 3AT3A 4I6FA 4ZZMA 2P2HA 3VS4A 5EOLA 3ZCLA 3MA3A 5HX8A 3S95A 2RFDA 3DU8A 4AFJA 4U8ZA 1UVRA 4FKWA 4I5MA 4BDEA 4XS2A 4RIOA 3KGAA 5IA2A 2BRBA 3MVJA 4ZP5A 2HY81 2HY0A 1YHWA 3JY0A 2WGJA 4XLVA 4BCIA 4C59A 4ZTHA 3ZMMA 3PE1A 2QOQA 4PY1A 3ZOSA 4BZNA 5J9ZA 3NWWA 4LI5A 3BLHA 3M2WA 4I21A 4F99A 4UMQA 4G17A 3V5LA 3QYWA 3QD2B 5CYIA 3EN7A 2ITVA 4GH2A 5AUWA 5HORA 4XOYA 4MBLA 4DBNA 3CEKA 3DFAA 5KMOA 4G3CA 5AR3A 4QQJA 3TZ8A 2W0JA 3A7IA 3W18A 4F63A 2GDOA 4K9YA 1GY3A 1J7UA 2UW6A 3RINA 3RWQA 4IANA 4Y73A 3I7BA 1U46A 1GOLA 4U0IA 2J50A 2P33A 4AA0A 2XJ2A 2XEZA 3HLLA 2FVDA 2VX1A 3EQIA 2UW0A 3BIZA 2XIXA 3ORMA 4RJ8A 3BKBA 2PZRA 2C3LA 2BALA 3NSZA 5AP1A 4MF1A 5FTOA 3W32A 5GINE 2YIXA 3K5UA 3VS5A 3E3BX 3QGYA 4YTFA 3WF7A 4B99A 5CASA 1MRVA 2OF2A 2PVYA 2C3JA 4TXCA 5A9UA 4I23A 4B8LA 3MTFA 2WMBA 3E7VA 4APPA 5DFPA 2BDFA 3QAME 4G6LA 1U5QA 3HV7A 3U9CA 4IMYA 4NUSA 5HE3A 4P2KA 4CKIA 3ERKA 4WBBB 4EONA 5FLFA 3PPJA 5I0BA 2ITNA 4YSMA 4I6HA 4R3RA 3ZBFA 4MF0A 1CMKE 4O82A 4HYSA 4WRSA 5E8ZA 4E6CA 4YJTA 3I1AA 3Q5ZA 4WSQA 4QTBA 2WKMA 3KY2A 5CU2A 5DR2A 1OL6A 3DGKA 3LM5A 3RPRA 4CFFA 3MSSA 4BY9E 2YA9A 3DKCA 4HCVA 3IGGA 1G3NA 2R3QA 3HA6A 3L9PA 4KA3A 5CT7A 5L2QA 3ULZA 4C62A 5AUTA 5E9EA 2A27A 3RPYA 2J0IA 2VTTA 3HRBA 5AP5A 1P5EA 2OJ9A 2CCIA 2XM8A 3H0YA 2G1TA 4CFNA 1WZYA 4FC0A 4AZFA 4LFIA 4HNIA 4Y83A 1ZWSA 3F3WA 4FIIA 4JG6A 4F6SA 1PHKA 5LQFA 3QF9A 4TTHB 3V8WA 3W2OA 4CKRA 1TQMA 3F5XA 3I5NA 1GAGA 1MQ4A 3E88A 3KRLA 2HK5A 5FEQA 3WF6A 3A7GA 3G6HA 2C69A 2F7XE 5E8YA 2UZLA 4D9TA 1OB3A 5E8VA 1JAMA 4JIAA 3E87A 4JBOA 4RT7A 3ALOA 3BEGA 2XJ1A 4RVLA 4YO6A 1MQBA 2OLCA 4MHAA 3S0OA 3GCPA 4KIKB 4MQ1A 4XP2A 1V0OA 4NFNA 1WBNA 1OIUA 5BVNA 4WUAA 1SVEA 3B8QA 5JGDA 4L3PA 4I22A 2AC5A 4X2NA 5D10A 5DT3A 2C0TA 4CKJA 4KABA 2QOLA 4WKQA 3OUKA 4G31A 4C2VA 1DI8A 5BMSA 2J0JA 3DJ6A 4YPDA 3KA0A 2WTCA 3VW6A 4ZY5A 4FTNA 5K0XA 4EEVA 4LOOA 4PNKA 5A4TA 2WU6A 4HNFA 4KKGA 2C1BA 2GS6A 3QTIA 5EHYA 1OMWA 4DFYA 4DG2E 4EOMA 5HCYA 4MBIA 5BYYA 1RE8A 3MFTA 3HDNA 3WARA 4QP9A 3ZSHA 4MD7E 4IM2A 4IAIA 4BCFA 4L67A 3MH1A 2J7TA 2REIA 4S30A 1DS5A 4DFBA 1L8TA 3ZO3A 2CPKE 2XS0A 5IISA 1H08A 4C61A 4IADA 4L3JA 4YJSA 3ORTA 4ZTSA 3TNWA 2WMQA 4ZMEA 3UTOA 5CU0A 3A7HA 4FI1A 4LGGA 4RJ6A 5HX6A 1ZMVA 4APCA 4XCUA 1ND4A 3CTQA 3TJDA 2W5HA 3OWKA 2Q0NA 2J0MB 4P7EA 5DR6A 5EG3A 1CM8A 3MN3A 2FUMA 3QRUA 4TYGA 4QP2A 3L9LA 4O7TA
chains in the Genus database with same CATH superfamily
4CG9A 3CQUA 3IPHA 2Y6MA 3IGOA 4OAVB 4U43A 4F09A 2QG7A 1CKJA 3UOJA 4ZSLA 4AU8A 4FTJA 3VO3A 1KE8A 2W1GA 3DZQA 4NM5A 2YLFA 3R02A 5CF5A 4LRJA 3QHRA 4ID7A 3D5UA 3T3UA 2JEDA 2W4OA 5FBOA 3FZPA 5L6PA 4GIIA 2JIIA 3R63A 4M15A 4FTAA 4XYFA 4FTTA 3PFQA 5M4FA 4QMUA 4EK3A 3R9RA 4NW5A 1CKIA 5IA4A 5EHOA 3KB7A 2PMOX 5IH4A 3NNUA 4KKHA 3PJ3A 4PL5A 2PZYA 3SX9A 3R8LA 4FV2A 4DCEA 3PG3A 2OFVA 5AR4A 1P2AA 3ZSIA 2WMSA 3R28A 2Z7LA 4UX9A 4JNWA 4XG8A 4C0TA 3ML1A 3MFSA 4I4EA 4PF4A 1WBPA 2R3LA 3WF5A 3C9WA 4RMZA 3HMMA 2UUEA 3FPMA 2XIZA 4MUQA 4DCAA 2Z7QA 3LHJA 4AW0A 4CTBA 5GZ9A 4G5PA 2WZJA 3W0RA 4GFOA 3LKMA 3O71A 4RFZA 1SNXA 3CLYA 4P4CA 4K1BA 4X2KA 3ZH8A 4CVAA 4X3FA 3MA6A 4D0XA 5E8WA 5L6OA 4PTGA 1XH7A 4E4LA 4K18A 2RG5A 2BILB 1OITA 3FI4A 4Q2AA 4TRLA 4FIHA 1KWPA 2QR8A 4E1ZA 4PNIA 4PP9A 3QRKA 5E1EA 3C0GA 5D7AA 2JDTA 5T6KA 4RX9A 4EBWA 4EH7A 2HOGA 4GVAA 2CKPA 4FUXA 3R8ZA 3COMA 3QQHA 3OOGA 4AW2A 3UC4A 1T46A 3PJCA 5EK7A 2GQGA 2YWVA 3PG1A 2CMWA 4MXAA 5F4NA 1GIHA 4QMLA 2GS7A 3SG8A 5M06A 2VN9A 3ELJA 4BTFA 2X0PA 4AG8A 3MPTA 4EZ5A 1Z57A 3UIBA 2A4LA 3ACKA 3R6XA 3L8XA 4O4EA 4O0YA 4IVDA 2B9JA 2VTQA 1IASA 1TFFA 5EHLA 1PKGA 3NW5A 1M2RA 4JIKA 4M14A 3KRRA 1FQ1B 5EKOA 4XV9A 1Q61A 3P5KA 5BUJA 5HG8A 3F2NA 3SQQA 4CZYB 3QZFA 5J7BA 5AFVA 1ZYLA 4E4MA 4KKEA 1XR1A 4JDKA 4FSQA 1PMUA 3MIAA 4BYIA 3FJQE 4DGMA 4GT4A 1GZKA 2WU7A 4ZIMA 4WNMA 3WZEA 1PXNA 3EZVA 4JDIA 4AN9A 2W96B 4IZYA 3VRZA 1P4FA 3R2YA 4AXDA 4ITJA 4I24A 3IDBA 3LFQA 1H07A 3O8PA 3ORZA 3BLRA 3VAPA 4F0FA 2VX0A 2PMLX 4JBVA 3OS3A 4KBAA 4PMTA 3VRYA 2UW7A 1JVPP 3MH0A 5HQ0A 4RWJA 3AT4A 4JBPA 4U41A 2OKRA 4RVTA 4XUFA 4PDPA 5AA8A 4K8AA 3TNHA 3CD8A 3EQBA 3QHWA 4Y46A 3WZUA 3FV8A 3QUPA 3H9RA 3EQDA 4EK5A 2QOBA 3UPXA 1DAYA 2WMTA 5HVKA 5FEEA 1W98A 4O6LA 5TT7A 4FTRA 4IB5A 4X7QA 1KV2A 4DN5A 5FDPA 4WBOA 2PMIA 3OWJA 2I40A 5T3QA 4RSSA 4IAZA 4DFXE 4EH5A 3C51A 5JGBA 1GJOA 1YWRA 3U51A 1M7QA 3P79A 4ANMA 3ZEWA 2OIQA 2W99B 3UZPA 5AM6A 1NT2A 3H0ZA 3BQRA 2PVRA 1H0WA 4IWPA 3LE6A 5E4HA 2VWVA 5HU9A 1QCFA 3KN6A 3E64A 3O5AA 2RFSA 3QLGA 3LQ3A 4O7WA 3GEQA 3VUGA 4FEXA 4E5BA 4RBLA 3VBVA 4YHTA 3R7OA 4FV4A 3U54A 3BGPA 3A8WA 3QTSA 3BEAA 2X7OA 3NPCA 3FXWA 3I0OA 2WPAA 3HX4A 4IVCA 4L45A 4XOZA 5M4IA 2GQRA 3KIOC 4QMTA 4CXAA 4JMQA 3IO7A 3P86A 5JSMA 2WTDA 3B2TA 5A14A 4DHZA 3DT1A 3R8VA 1DAWA 1J1BA 3FKNA 4YZBA 2UZUE 4J7BA 4CLJA 5CEKA 3JVRA 4F1MA 3UDTA 3LCDA 5F94A 4C8BA 3DBFA 4USEA 4HPUE 2Z7SA 3OCSA 3QGWA 4UY9A 4ANQA 5FP5A 4IVAA 3C5UA 5CSXA 4A07A 3LXKA 3NYXA 4I0RA 4R3PA 4ZLZA 2IW8A 2P4IA 3OXZA 1OPKA 3E8NA 4F1OA 2BFYA 3JS2A 4ASXA 4FK6A 3S1HA 4IB1A 2IW6A 2VU3A 4YJQA 2WMAA 4FL3A 3TTJA 3NFGB 4ORKA 4Y95A 2UW5A 4HW7A 4OTWA 5M4UA 4NCTA 3JUHA 4O1PA 2DS1A 4BIEA 4AXFA 4TWOA 4EOOA 4FKIA 4ZXTA 4BHNA 1H25A 4YZMA 5CZHA 1R3CA 3TCPA 3C4WA 5M57A 4I6BA 5K0KA 4DGGA 3WIGA 3MY5A 2WTKB 2VWXA 3AD4A 5FGKA 3UVPA 4DG3E 2VX3A 3OOMA 5ANDA 5CZIA 3TV6A 3FMJA 4MTAA 4AT5A 5LMBA 4J96A 1PKDA 4GU6A 3V51A 3Q4CA 2R3MA 4AP7A 1XO2B 4FKOA 4IX6A 3F88A 3D5VA 2YCRA 2PMNX 3GU6A 4KSQA 3LFSA 3RTPA 3O7LB 3I4BA 4IWQA 2Z8CA 3HNGA 2HYYA 5M55A 3DKGA 4EH3A 3QTXA 4O2PA 3WE8A 1H1RA 1YDTE 3QZHA 4S32A 4EH4A 3QQLA 4CNHA 1YXVA 3LJ1A 3OD6X 2IW9A 4DDIA 4BDCA 3DCVA 4NJDA 2XAMA 3PA3A 3UP2A 3ALNA 4FODA 3ROCA 2OW3A 4F1TA 5JFXA 3QFVA 3RZBA 3G9LX 2OO8X 2OZAA 3G0FA 4X3FC 3DKOA 3Q6WA 5J8IA 4CRSA 4DITA 2VWWA 5AV4A 2XK7A 1JLUE 3NUSA 4MH7A 1XQZA 3NUPA 3KK9A 4AAAA 1R0PA 4OTRA 3VC4A 3P9JA 3HUCA 5AP0A 4AXCA 3H10A 4FYOA 4PDSA 3T3VA 1P14A 4ZOGA 2X4FA 3KXXA 4B9DA 3H30A 3UNKA 2YZAA 4BWKA 1GZNA 1XHAA 3DV3A 5ACBC 2BUJA 4C4IA 3PXYA 4J97A 5AR8A 3ZUVA 2GHGA 2XKDA 2CGWA 4U3YA 3CGOA 2XJ0A 4RIWB 4W8EA 3PTGA 3ZU7A 2XP2A 3BHVA 3M11A 4RQKA 5AP6A 4KRDA 4X0MA 4ZMFA 5HE0A 3RK7A 2UVZA 3Q4UA 5L8JA 1H1QA 3QTRA 1NVQA 3E8CA 4EZ3A 1SYKA 3SOCA 1U54B 3MH2A 3RPVA 4HVHA 4CQGA 3G90X 1W7HA 4G6NA 3T9TA 1F0QA 1Q97A 4H36A 4RA5A 2YLEA 5IQDA 2WTJA 3CD3A 3OBJA 4TZRA 3QRTA 2VWBA 3T8OA 5L2TA 3Q53A 4YLJA 4FKSA 4CV8A 1E1XA 3D7ZA 2OICA 4DEHA 2EB3A 5J95A 4DFUA 3HP5A 2BFXA 4GT3A 2X6EA 2OI4X 3RK9A 3UIMA 3GGFA 4P5ZA 3QWKA 3DBDA 4FA2A 4PPBA 4E3CA 4UYAA 5AIRA 4QQ5A 1OL5A 2XIKA 3GQLA 2W1IA 2X0OA 5I9XA 3F6XA 3R21A 3RP9A 5FUTA 4CEGA 3E8DA 3AMBA 3LZBA 5BPYA 3AC2A 4BC6A 4IAYA 4UBAA 3WYXA 3GCUA 4ACGA 2I1MA 4IDTA 5DWRA 4FKLA 4GL9A 3W0MA 1GZOA 4IDVA 3V04A 3ZDIA 4IE9A 2IF8A 4UV0A 4EOPA 5M56A 1H26A 4O6EA 1XH8A 5I9VA 3UZTA 3LLTA 4FSYA 4BTKA 3MVHA 3FBVA 4NYEA 3UPZA 1ZY4A 3L1SA 2F49A 3V6RA 3FE3A 3WZDA 2ZDTA 4DFLA 5JEBA 4CRLA 3W0NA 2RGPA 3FMNA 4BL1A 2CDZA 1VR2A 3Q9WA 2ITOA 3TKUA 1G8JA 3PXRA 3CS9A 2O5KA 1PW2A 3LMHA 4P90A 4QMNA 1UU8A 4S2ZA 4UXQA 3ZXTA 4XG9A 5IA5A 1UKIA 2GMXA 3M42A 3UZRA 3SKCA 1Z5MA 4A9TA 1W0XC 4X6RA 4FGRA 3ZUUA 4JI9A 4L7FA 4C36A 5CF4A 2C6KA 2GCDA 4YC8A 4DGNA 2UV2A 2QR7A 2PVKA 3Q3BA 5EQYA 1G8AA 5A46A 4O0WA 1UWJA 1JNKA 3LAUA 4MXCA 4O86A 2UW4A 2JBOA 1UU9A 3ETAA 2UZWE 4PMMA 4IX5A 2R3IA 2QLQA 3TUBA 3C50A 2F7EE 1YOMA 3ZLXA 1BYGA 4J95A 1YXTA 4XV2A 4KNBA 2QCSA 5TR6A 2ZMDA 3MJ1A 4F08A 4O0VA 3R8PA 2R3RA 5ANJA 4EH6A 3OCBA 4O21A 5IDNA 3FKLA 1J7LA 4KS7A 3C4FA 4AAYA 5HTCA 4GJ3A 3ID6C 5L3AA 3DTWA 3TIYA 3FXXA 4PUZA 3FL5A 3UO6A 2ESMA 4QDVA 1U59A 4I5CA 3EQHA 3QA8A 1SVGA 1NVRA 4FV8A 5IEXA 3M1SA 2WB8A 5C1QB 4AT4A 3A7JA 2CGVA 2XRUA 3OXTA 3BHUA 3NVMB 4HVGA 4ZSJA 5CQWA 3SG9A 4IBMA 3AQVA 3D2KA 3B2WA 4HOKA 2ACXA 2HZ4A 1SVHA 3IW8A 3QQFA 2LAVA 4ZZOA 4F64A 1RJBA 4GCJA 3AD5A 2PVFA 3F61A 4A9RA 4ZK5A 4BCOA 1LP4A 4UB7A 4OLIA 4FTOA 3OT8A 1REKA 5H3QA 3HA8A 3LJ2A 3FC2A 5CSHA 2JDRA 3O7LD 1V0BA 2G9XA 5AUZA 1H0VA 2F4JA 3LMGA 5DBXA 3Q9ZA 4OAUC 5CX9A 3NNXA 2ITPA 4O0SA 4KRCA 2OXXA 3MWUA 1PXLA 5E8UA 3W1FA 4BCNA 5JT2A 5IQHA 2I6LA 5BVKA 3GUBA 5KX8A 2NRUA 5I9UA 4AQCA 4AE6A 3V5QA 3QA0A 2O0UA 2XIYA 4OTPA 4PX6A 4DH1A 2PE0A 4IIRA 4FV9A 2ZM1A 3AMAA 2ZV9A 2G15A 3BU3A 4GV1A 4K6ZA 3GB2A 3EN4A 5A6OA 2H6DA 2R3OA 3MFRA 5A3XA 4YZNA 3ZONA 5IDPA 4GMYA 2PULA 2XANA 2PZIA 1URCA 4NM0A 5FXSA 3CSVA 2YDJA 1H01A 3MESA 4DFZE 2WQBA 4II5A 5A4LA 4IAKA 5C26A 4QYEA 3NNVA 5E92A 4O83A 3UO4A 2YDKA 5M09A 2ITXA 2UVYA 3IOKA 3OW4A 4MBJA 5DN3A 5T68A 4Z55A 4FSMA 4F9CA 1VEBA 1FMOE 4DEAA 5CNOA 4QMWA 2VO6A 3E93A 4ZY6A 5K5XA 3DAKA 2PVLA 3U4WA 4OTFA 4I20A 2ITZA 3LPBA 2NPQA 1YQJA 2XNNA 3U55A 4LYNA 4GIHA 3KFAA 4QMYA 5FRIA 4DH3A 4FKJA 3ITZA 3S2PA 4QP6A 1PRYA 3AT2A 4I0TA 2OH0E 4I5HA 4OUCA 3TNQB 3TXOA 4FTKA 4U9AA 5ANOA 4Y72A 3TTIA 4YNOA 2IG7A 3LFBA 1ZYDA 4FR4A 4TY1A 4UWCA 3RM7A 4FZ7A 4M12A 3ZM9A 2ITQA 3IOPA 3HMPA 2J4ZA 4MCVA 3LFDA 2VV9A 3VUHA 4BDJA 4ALUA 2PE2A 2OH4A 2QVSE 3U6HA 5CENA 4BZOA 4U5JA 3DAJA 3UNZA 3RBWA 4FT5A 4PMPA 3TDVA 3ZSGA 3POZA 4V0GA 3G33A 3EMGA 4OR5A 2Y9QA 3II5A 4FMQA 4PWNA 4QMMA 1YOLA 4LV5A 3BU6A 4LGHA 3SLSA 4ALVA 1R0EA 3TV7A 3BPRA 2J0KA 4LL0A 3WF9A 4D2SA 4FEVA 4ERKA 4FIJA 4ERWA 4ZTMA 2W5AA 5DLSA 4FKQA 2E9NA 2W1DA 3EZRA 4AXAA 3FLZA 2NO3A 5EDRA 5J7HA 2R0IA 2IEWA 2I0EA 3LFFA 2V55A 4BFMA 3IQ7A 4FNYA 4K33A 3HEGA 4E5AX 3LQ5A 3OVVA 2J9MA 4GU9A 3R1QA 4EK8A 1F3MC 3UMXA 4K0YA 1XBCA 3Q9XA 1ERKA 4PMSA 3N4VA 1YXXA 4FG9A 1LEWA 4MWHA 2A1AB 4NKSA 4U6RA 3TEIA 1DI9A 4W8DA 4HCUA 3DY7A 4FSTA 5DOSA 4C4FA 3DDQA 2CJMA 3LM0A 3NNWA 5BMMA 3R7EA 4ARKA 1SMHA 4RPVA 4ANNA 1PY5A 3O0GA 3JYAA 3GBZA 1SZMA 4R78A 3P4KA 1OKWA 3ZO1A 3ENHA 2FSLX 3O50A 4D1ZA 5KHWA 5HLPA 3MPMA 5CI7A 4NIFA 2XIRA 4B7TA 3R8UA 1B38A 4ASZA 1JSTA 3FHIA 4R8QA 3W2SA 4O7RA 1LPUA 2A0CX 4W4XA 1ST4A 2HWPA 2R9SA 2BTRA 2CGXA 1OBDA 4O7ZA 1OKVA 2OG8A 5J87A 5KZ0A 3DK7A 3BL9A 2I7QA 1XMLA 4JRNA 2CLXA 4O4CA 5JFSA 4E7WA 2G01A 4O0XA 4BDAA 4OBQA 4BBMA 1UU3A 2OXYA 4AS0A 5DYJA 3QUDA 3OXIA 4BTJA 1O6LA 2C5XA 4XBRA 3HKOA 2BHHA 2VTIA 3GU7A 4IVBA 3E3PA 5GJDA 2PVHA 5AAFA 2UW9A 2WTWA 2X8EA 4OTIA 3VNTA 4I93A 3PSCA 4IC8A 3HV5A 3CY3A 1VYWA 4IZ5A 1V1KA 4OBPA 3SXRA 4IQ6A 2C5OA 2UW8A 4GFMA 3BYVA 2SRCA 2UW3A 1OECA 2VO7A 2DQ7X 4QO9A 4FICA 4G2FA 1GIJA 1NXKA 2JIUA 2W4JA 3U87A 1CSNA 2R3JA 3L9MA 4H58A 5TKDA 3LQ8A 5DRDA 4E26A 4QMQA 3LMIA 3MB7A 1YHSA 2UZNA 5LWNA 3OROA 2ZOQA 4YURA 4G9RA 1REJA 2IPXA 3MIYA 4RWIA 4RVMA 1YXUA 3O17A 5I9ZA 2GNGA 4C4GA 3ZO4A 5CU3A 3W10A 5CVHA 2A19B 2IZRA 3HDMA 5CU6A 3BELA 1XH4A 2PE1A 4LGDA 5TO8A 5CF8A 1NA7A 1JKSA 4CV9A 4TW9A 3ANQA 2ITUA 3KVWA 3OFMA 1YW2A 2Y8OA 2FGIA 1PXPA 1TVOA 2J90A 3CQWA 3I6UA 3NYNA 4FSWA 5F1ZA 4DC2A 3FXZA 4EHEA 3KXMA 3BE9A 4KINA 5AV2A 2W06A 3PA5A 2W9ZB 5DA3A 4C2WA 4RWKA 1U5RA 2C0IA 5LMKC 1K3AA 2B9IA 4D2PA 4I4FA 3DXNA 5LVLA 4AGDA 5DNRA 4L52A 4NSTA 2FA2A 3KU2A 1WBTA 2OU7A 3MFUA 3R9NA 4BGQA 3KULA 4USDA 2AYPA 5JRQA 3T9IA 1BI8A 1OL2A 3AKLA 4RJ5A 2ITYA 3W8LA 2HW6A 5KNJA 3VS1A 3SC1A 2BAKA 4DEIA 3R1NA 3R30A 4TYEA 3V8SA 3VJNA 4CSVA 5HICA 3GQIA 1Q8TA 2G2FA 3NIZA 1WFCA 3R22A 3QKMA 2VNYA 3D94A 3GOKA 4YNEA 5CAPA 3LXLA 5JQ8A 3ZEPA 5FP6A 2Z02A 1BMKA 2OJFE 1O6KA 3V5PA 4NU1A 3PIYA 2CHLA 1XKKA 3IW4A 4JG8A 4GK3A 2WQMA 4D28A 2X9EA 2Y4IB 4RX5A 2OFUA 3IDPA 2GHMA 2QG5A 4IWOA 4UWBA 1OI9A 2IZSA 3KCKA 1RQQA 3PJ8A 1E9HA 1H1SA 4FNXA 3FPQA 3MJ2A 5J9LA 3BBTB 4ACHA 2EWAA 3NX8A 3A62A 4BF2A 2RL5A 4RX8A 3VUTA 4CD0A 4FTMA 4BIBA 1AGWA 1Z9XA 2XALA 4D55A 4QTDA 5CEOA 4QEBA 1SNUA 4EHVA 1YI4A 3QRIA 2EVAA 2HCKA 5CANA 1PYEA 4J98A 3BRBA 3S00A 2C5NA 1Y6AA 3NLBA 4JLCA 5D1JA 2QKRA 2UZTA 3BE2A 3ZFXA 4BB4A 2EXCX 3C4CA 2ZV8A 5HOAA 1S9IA 4H05A 4Q5HA 1H1WA 4FZDB 5FD2A 3RJCA 5AA9A 2XBAA 3QZIA 2F9GA 2UZVA 3R2BA 4YJOA 4O7VA 5EQEA 5IQGA 3PRIA 3W16A 4FTCA 1YWVA 3OEZA 4J8MA 3PSBA 5DRBA 4AQKA 5FG8A 1KE7A 4XRJA 4CMTA 3C4EA 2RG6A 4M0YA 1Y57A 4ZTRA 3CR0A 1FPUA 2JITA 3AXWA 5EH0A 4RA4A 2I0YA 4FKRA 5J79A 1BX6A 5AP4A 4L43A 2OZAB 3GCQA 2XAOA 1YWNA 4LUEA 1A06A 3KRWA 2ONLC 3GVUA 4XH6A 2AQXA 3EWHA 3FZRA 4UMTA 3GCSA 5EI2A 5IQBA 2R0UA 2LGCA 4H3QA 4PRJA 4DGOA 4F9YA 3CGFA 2G2IA 3R7UA 5IA1A 2QOKA 4KWPA 2P55A 4LL5A 3IK3A 3FY0A 5ETFA 2J51A 3LLAA 2HXLA 2F2CB 3GC9A 5K4IA 3LXPA 4ALWA 3F2AA 2IVSA 2W1ZA 3ZS5A 2XNPA 5A4CA 3VBYA 3UO5A 2A2AA 3A8XA 5LVNA 4R7BA 4NFMA 5AV1A 3NUXA 3PLSA 5ETIA 3TZ9A 4Y5QA 3RAWA 4D9UA 5AP7A 3AC1A 3FMHA 1UNGA 2YCQA 3UQGA 3N51A 3PPZA 5M07A 4IC7A 2VZ6A 2R3HA 5CXZA 2XK4A 3GC0A 3RNIA 4GVJA 3WF8A 4U45A 2YM8A 4DEGA 5HCZA 4FL1A 2XM9A 3DJ7A 3KKVA 3ORPA 3NFFB 4YGAA 3REPA 2V0DA 3BYOA 1V0PA 2X0QA 5KBRA 5BVEA 4ENXA 5DE2A 3PVBA 1LR4A 3N9XA 4ZSGA 3HYHA 4ANLA 5A54A 2NNWB 1GZ8A 5AP2A 4N4SA 5LVPA 3I79A 5BQ0A 4CMOA 1OIYA 5I4NA 1H1PA 4OT5A 5C9CA 3W0OA 2VTLA 2WTVA 4Y85A 2JAVA 4J99A 2HZNA 1W8CA 3FI8A 5GZAA 1WBVA 2WOTA 3BU5A 5EYKA 3BL7A 1QPDA 4Z7GA 3VIDA 3A2CA 1KUTA 5JQ5A 2IZTA 4BDKA 2X2MA 5GHVA 4QP1A 3VVHA 2HENA 4Z9LA 2B0QA 4FT3A 3SAYA 3QRJA 3LIJA 3F3VA 1K9AA 2BIKB 4XHKB 1UNHA 3CIKA 2X7FA 3EN5A 4RQVA 4AZTA 4AZWA 5H8EA 5C4KA 4EOIA 2IVVA 3GFWA 5EM6A 4IWDA 4RG0A 4EOKA 2KULA 5HO8A 3O8TA 3D2IA 4I94A 2C5VA 4EK4A 3GFEA 5J5TA 4NW6A 4QQCA 2HIWA 4CMUA 3PLAE 2WEIA 5IA0A 3R1SA 2QHNA 3TUDA 1JOWB 3ODYX 3DK6A 3MS9A 2C68A 3FY2A 2XARA 3PY0A 3ZRMA 3E7OA 4EI4A 1MP8A 3K3IA 4G3EA 2BZHB 3BZ3A 4ASDA 3QTUA 2QO2A 4I6LA 3DQXA 3FSKA 4FKVA 5EI8A 3CKWA 3OW3A 5GJFA 5CSWA 4BDDA 3G15A 4QDEA 4CZTA 5LXMA 1JKTA 5E90A 4IX3A 2BPMA 3PWYA 4BTMA 2WD1A 2AUHA 2YJSA 1L3RE 1XBBA 3D5WA 4HGSA 3RPSA 4ZJIA 5KKRC 4A9SA 4QNAA 3HMOA 2DWBA 4X3JA 4WOVA 4O0RA 4FZFB 3JVSA 2B4SB 3UYTA 3ZZEA 4MKCA 4GUBA 4QPSA 1PJKA 3EKKA 4YUQA 3D7TA 2YIRA 1Y8YA 2PUPA 3V3VA 1QPCA 2IO6A 1AD5A 4O0TA 5E8XA 4GYGA 3KCFA 4HZRA 2OGVA 4IB0A 3ORNA 5HO7A 4MEDA 4QT1A 4UMPA 5L2WA 3IG7A 4BJJA 1WVYA 2YZLA 3DAEA 3V5JA 3I60A 3V6SA 4MD8E 4GS6A 3ENMA 4FV1A 5EKNA 1MRUA 3RHKA 2X1NA 3SA0A 4O81A 2JKOA 3FLYA 3QD4A 3OCTA 3VBXA 2X2KA 4UZHA 1IAHA 1HCLA 1WVWA 3DFCB 4WA9A 1T45A 3R7GA 4G3FA 5L4QA 1XMMA 1PMEA 3UQFA 3COKA 4AUAA 4FTIA 1Q8ZA 4C34A 3CPCA 4IX4A 4ZJJA 3RI1A 5IKWA 3KVXA 4AOJA 3DTCA 1Y6BA 4N6ZA 5AUYA 2QURA 2OBJA 3DNDA 1TZDA 5IUHA 3F2RA 3P7AA 2E9OA 2PSQA 4OGRA 3ORLA 5JRSA 5C8MA 3L8PA 3BI6A 2C6IA 4FNWA 3UOHA 5HIEA 2YM3A 3POOA 4AOIA 5EW3A 5AUXA 4C58A 3EB0A 4HYUA 4FYNA 4IJPA 4G34A 5EYMA 4BR3A 2QKWB 5DPVA 3FUPA 4ANOA 2R5TA 2EU9A 5IA3A 4RIXA 4OBOA 3LFNA 2CLQA 2ETKA 4JL9A 4WT6A 5EDQA 5HHWA 4QTCA 2R4BA 3ATSA 2O63A 3PFYA 3DA6A 3Q96A 2BRHA 2XUUA 4AF3A 2JDSA 3QX4A 4B0GA 4U80A 3RZFA 4H1JA 4M13A 1FVVA 5L8LA 3SRVB 4HPTE 5HESA 2PUIA 1S9JA 1AQ1A 3A60A 4YBJA 5B0XA 3Q2JA 4D4SA 3P5JC 3R04A 2YHVA 3CQEA 4M69A 2QOFA 2XNGA 4LOQA 2V7OA 5AM7A 1WBOA 2YAAA 2PU8A 5TE0A 2UZDA 2IVTA 2BTSA 2HW7A 3N4TA 3TM0A 4C35A 2XNMA 5M4CA 3ORKA 2XK8A 4FV6A 4AN2A 5F9EA 1FBNA 2VWUA 4DT8A 4YZCA 5IF1A 3WZKA 3AC5A 3U6JA 3C4ZA 4W9WA 3L8VA 2C6LA 2YN8A 2XA4A 4P5QA 5CT0A 1ZZLA 1GNGA 4BDBA 4C3RA 3QCYA 4FBXA 3W2RA 4Y8DA 3V5TA 4LRMA 3VBWA 3AC3A 3IDCA 2V7AA 3QBNA 3EJ1A 3DJ5A 4DTAA 3DXPA 3VUDA 3KL8A 4W4VA 2E9VA 5H8BA 3AGMA 2H9VA 2PUNA 4D1XA 3CPBA 1ZMWA 5LCJA 2X39A 3LCOA 4ZZNA 2XRWA 3QC9A 4DG0E 3O51A 3HGKA 4L01A 3RWPA 4J71A 3UP7A 4EC9A 4HGLA 4UALA 2YIYA 3F7ZA 2R3PA 2BRMA 5L2IA 4BVUA 5M51A 3TDWA 4FVPA 3ZLWA 1UV5A 3UMWA 3PVUA 5IZFA 5C8KA 3AC8A 3B8RA 5E8TA 3S3IA 5DEWA 2ZM3A 4DH7A 1W2CA 5K9IA 3QQUA 5EFQA 4ZTNA 4CZUA 1FGKA 5KUPA 3PPKA 5BUIA 1MRYA 3PXFA 1OUKA 3FQEA 3W0PA 3HUBA 4FSNA 3AOXA 2WOUA 3PUPA 3I0QA 4UMRA 2VWYA 2OIBA 3VS3A 3QL8A 5GNKA 4PTEA 1BI7A 3OUNB 5HLWA 4FTUA 3ULIA 4GK4A 4YR8A 1O9UA 4XX9A 4FV7A 2YCSA 4FTQA 4O22A 5BVFA 4JG7A 4S31A 2BDJA 3PZEA 4Z16A 4GUEA 4KBCA 5CI6A 4AW1A 4IAAA 1FGIA 5IH5A 1H28A 4FG7A 4LV8A 4H3PA 4FT9A 3OY3A 3LCSA 2GFSA 4YJVA 4AFEA 2EXMA 4EL9A 5CAUA 4LV7A 4BCMA 3F82A 5AX9A 4AXEA 4A4LA 1OIQA 3DDPA 5K4JA 5CU4A 3C4XA 5D9HA 5HVJA 4AGWA 2IWIA 2WEVA 4NKAA 4JAJA 4HJOA 2RKUA 3KXGA 1YRPA 5F20A 4IJ9A 5GIPE 2F2UA 3G2FA 1Q8YA 3C1XA 3Q5IA 2OJJA 2YM4A 5D7VA 3FAAA 2X6DA 3FSFA 4A4OA 4C3FA 4FOCA 2BRNA 3ZYAA 4DA5A 4FV3A 3TL8A 4F78A 1PF8A 3QTWA 3EQGA 5ICPA 3TV4A 4MVFA 5BYZA 2ITWA 4ZSAA 1Y8GA 3LVPA 1Q4LA 2ERKA 3K2LA 2J0LA 1ZOHA 3F69A 2PZPA 3GU5A 5HBHA 2Q83A 4HYHA 4RIYA 1RDQE 4E73A 2C6EA 3OTVA 4XG3A 2NP8A 4IACA 3G6GA 4FIGA 4IXPA 4X2FA 5EM7A 3D5XA 3U4UA 4AACA 4OTDA 2CSNA 3OT3A 4E4NA 3L9NA 2GNJA 4RFYA