3PSDA

Non-oxime pyrazole based inhibitors of b-raf kinase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
276
structure length
262
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
publication title Non-oxime pyrazole based inhibitors of B-Raf kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 68
structure length 262
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3psdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3psdA01
4XBUA 3CJFA 2Y7JA 4G2FA 2OZOA 5HU3A 4QP7A 4DGNA 2XYNA 5M4UA 3QTRA 1F3MC 2VD5A 3ZBXA 2QG7A 4FSTA 1OL5A 4L3PA 3G6GA 3BV2A 2OBJA 3F5UA 2EVAA 1Z57A 2SRCA 2JIIA 4FTRA 3SA0A 2JITA 4I4FA 4I22A 3JVRA 3V5TA 4N6YA 4OW8A 4MXAA 2C4GA 3M11A 4ASEA 4G6OA 1Q24A 1W84A 3L1SA 2WOUA 4WBBB 1NW1A 3BELA 5L8KA 4R3CA 3JR1A 5JT2A 3R71A 4UXQA 2OJGA 5EI2A 3PVUA 2GS2A 1OZ1A 3S3IA 4I0TA 3TIYA 5CEOA 3PLSA 5JGAA 5IEVA 3GU4A 4ANSA 3PLAE 5F4NA 3ZC6A 2G2IA 4WNOA 4RC4A 1B39A 5FWKK 3KK9A 3FXWA 1RW8A 2XKCA 2CMWA 5J5TA 3RM7A 2W0JA 5C8MA 5L8LA 4FV8A 4XJ0A 4CLIA 4J96A 3QZFA 4ZTRA 2X6DA 2OZAA 1O9UA 4CZTA 4NJ3A 2ZV9A 4YZMA 4AE6A 4K33A 4AU8A 1GOLA 2WIPA 3G5DA 1MRYA 4LOQA 3JY9A 4YLLA 1GIJA 3MFSA 3LCSA 3QKLA 1DAWA 3DBDA 3BHUA 4OGRA 4P4CA 4U97A 1V0OA 4J1RA 4DG2E 4E6AA 4NSTA 1YDTE 3LOKA 4CD0A 2WQBA 3R83A 4FG9A 3KXMA 5IDPA 2VAGA 4QTAA 5AR5A 4WIHA 4LGDA 4BZDA 4GIHA 2GTNA 2BAJA 2EUFB 3E88A 1PXNA 3KRWA 2FH9A 4C2WA 4I6HA 4ZLOA 5CNOA 3ZM9A 2Y8OA 1ZAOA 3CE3A 5CQWA 2B52A 2C3IB 2JDTA 3MN3A 4K1BA 3C50A 4PTCA 4ALUA 4NK9A 4PMMA 4Y5QA 2VWVA 3FMKA 1Q62A 3FY0A 4FNWA 5H2UA 4AACA 2XKDA 3KCFA 3RPRA 4O7ZA 5FP5A 3QTSA 5CEPA 2WZJA 1YOMA 2YAAA 3GC0A 1UNHA 4DBNA 1KSWA 3VN9A 4QQJA 3V5JA 4DFBA 1SZMA 4X2JA 5JZNA 4FL2A 3AG9A 5CZIA 5D7AA 3Q6UA 5HG5A 1P2AA 3UC3A 2PVLA 3C1XA 3QCSA 3WIGA 3NMUF 3R2YA 2OG8A 3QQJA 3VBXA 4AT5A 5H8BA 4D4SA 2BCJA 3MESA 3LCDA 2BALA 2ITVA 4AOJA 2DS1A 2EXMA 3I5ZA 3Q6WA 3CTJA 4U7ZA 3I0QA 1SVGA 4G3GA 1UU3A 3AMAA 3GCQA 3PZHA 4D55A 3QTXA 4JJRA 3ZS5A 3RAKA 5ANKA 3Q4TA 3KFAA 5F20A 3LXLA 3E8CA 3WZDA 5KMNA 2R3QA 3EFLA 2BAKA 5IUHA 2XVDA 2VTTA 3FI4A 2IW8A 4M7IA 5C9CA 2J0KA 3VRZA 1LUFA 5L4QA 5DG5A 3TNHA 2Z02A 3R63A 5IH5A 4CFXA 5BVNA 2E9PA 2PZPA 4QTEA 4FSWA 5BPYA 4PF4A 1XKKA 5AJQA 4S31A 1JAMA 1ZARA 3AOXA 1XQZA 4HVDA 5FUTA 4V04A 2VTIA 2QR7A 3BPRA 3BU3A 4NJDA 4A4OA 4ANNA 4I20A 3OUKA 4XS2A 1MQBA 4BYJA 4FEUA 3W55A 5E7RA 4XYFA 4KABA 2NP8A 5ANGA 3ATSA 2YIYA 4TYGA 5A4EA 4GRBA 4YZ9A 5AAFA 3LXKA 3ZU7A 4R78A 3A99A 4L45A 1Y6AA 1SVHA 4U0IA 4D2TA 3BI6A 5L2WA 4QQCA 4RFYA 1XBAA 3EQPA 2BDJA 5FGKA 4KRCA 2QC6A 3S2PA 4W4YA 2R7IA 4ITJA 1Y6BA 3O8TA 3WZUA 3NYXA 4BI1A 3O2MA 5DT0A 2QCSA 2PUNA 3CCNA 2VX0A 5EOBA 4MXZA 3FYJX 1Q41A 5EOLA 3WYYA 5CAQA 1OBDA 3D5WA 4MXYA 4QP6A 2HYYA 4P5QA 3EN4A 1NVSA 2Z2WA 4KD1A 3IECA 3UQCA 4B0GA 4FEQA 4FT7A 4LUDA 2CNUA 3ORTA 1MRUA 1W7HA 1FMKA 2OGVA 2C68A 2F49A 3BQRA 2WKMA 1BKXA 4AXAA 4UMUA 4C4HA 4DT9A 2XIZA 4AA5A 4GSBA 3L8XA 4C4GA 2OJFE 3TV6A 4FK3A 2QLUA 4BYIA 4X2FA 3SQQA 3FKLA 1YVJA 4X6RA 3SOAA 4YHFA 4EHVA 5CAUA 4MWIA 3A7HA 5CU3A 3FMMA 3D15A 4QNYA 2ZDUA 5JFSA 4GCJA 5KMMA 4MQ1A 4BVUA 4EBVA 1VZOA 5KMOA 5HO6A 1JPAA 2H34A 4TWPA 3UOHA 3OXTA 4NTSA 2GNIA 3ZFXA 4ZTMA 4HNFA 5EW3A 3TNWA 3MB7A 4RIXB 3H4JA 3OW4A 2J2IB 3MYGA 3QTZA 1NXKA 3CEKA 4K77A 4OLIA 3RPYA 1YXSA 3TIZA 3L9LA 3RALA 2OFVA 5HLWA 4JQEA 1R78A 5D11A 3L8SA 4BBFA 4HVHA 3DBEA 4TTHB 1QPEA 1MP8A 1XH4A 2UZVA 3BBWA 3ENMA 3PXKA 4OBPA 5DOSA 1A48A 1E9HA 4DH7A 2ERZE 2J0IA 1YOLA 2CJMA 2OIDA 5HVJA 3V6SA 2HY0A 3CC6A 2XJ2A 3VS7A 4DEHA 3H30A 2Z60A 3IKAA 2OIBA 3KRXA 4LRKA 2EU9A 3CD8A 4QP9A 4AN2A 4O21A 4AP7A 1YOJA 2ACXA 2W99B 4R7BA 2OXYA 3DXPA 4M69B 2BKZA 2R3KA 3RHKA 4B99A 4RLLA 3V5QA 4UZHA 2VU3A 2C6MA 5K0KA 5LARA 4AZEA 1KUTA 2UW3A 3UIBA 4FV4A 5D9HA 3TZ9A 1SVEA 4UN0C 4J99A 4AGUA 4JR7A 4YLKA 4GKIA 3DLZA 3E63A 3JVSA 3TXOA 4BDFA 3BU6A 1XBCA 4AAAA 4TYIA 4BDGA 2IVUA 5BYYA 2C6OA 5LCKA 5AMNA 4C3PA 2GDOA 2ETMA 2XKEA 1YWRA 1PYXA 1U59A 4IEBA 4ASDA 3SD0A 5BX0A 3HP2A 4H05A 4O0WA 1IRKA 4DT8A 5HIEA 1V0PA 3HUCA 3TKHA 4KIPA 4Z7HA 3GQLA 4FV0A 4JR3A 1YW2A 4R7IA 4BGHA 4CYJA 5CVHA 3UPXA 4V0GA 4IAIA 3ACKA 3O7LB 2Q0NA 2P2HA 4YJVA 5AAGA 4ACHA 4FKSA 4AGDA 3NUSA 4JBOA 4W8EA 1ZRZA 4QP3A 4BCGA 1Q8ZA 2ZMCA 5AV3A 4A9UA 2REIA 4BTJA 4PNKA 5KMJA 4DG3E 4BBEA 1Q3WA 2OH4A 3PDTA 2YIRA 1ZYSA 2DQ7X 4GUBA 3BWFA 4EOOA 5FP6A 1P5EA 3UQFA 3MB6A 1Q8YA 3QFVA 4DLIA 5K0XA 4L44A 4MBLA 4TN6A 4I6BA 5HU9A 3AC1A 1BMKA 2R3FA 5EQPA 5HTIA 4G34A 4QTDA 3F3WA 1SNUA 2OU7A 1PF8A 5DHJA 4C4FA 3F7WA 3CQEA 3LMHA 3OMVA 3V04A 4NU1A 2W1IA 4RC3A 3VUTA 1Y8GA 2UW4A 5CF5A 5HBJA 3LFNA 5K5XA 1WMKA 4W8DA 4JRNA 4H3BA 3F69A 5EM8A 3A7FA 3ORMA 5E1EA 1YXUA 3S00A 2R64A 2VTRA 5HIDA 4ID7A 2XH5A 2QVSE 3IW4A 4YBKA 2P3GX 3NEWA 5J9LA 3FLZA 4IWDA 2FSMX 2VO0A 3RINA 3TJCA 2XIYA 3R9DA 4AZWA 4N4SA 2X0GA 4XG2A 4YC3A 4JBQA 4O7LA 1M52A 4I5CA 2HCKA 4LMNA 4DH8A 3Q9WA 1LEZA 4TWOA 4HJOA 4B8MA 3OEFX 4EHEA 1NY3A 3GCSA 5HNBA 1FGIA 3HMIA 4O83A 5J95A 3P78A 5HCZA 4A9SA 4MXOA 3N9XA 3ULIA 4AW1A 3HYHA 4X3FA 5EHYA 3ANQA 4M8TA 3Q04A 2YM4A 2G2FA 1Q61A 2R3NA 3ANRA 4BTKA 5CX9A 2V55A 5L6WL 4IDVA 2RG5A 4FICA 4GV1A 4RQVA 5CI6A 5E8XA 4DEBA 3QRTA 4I24A 2XRUA 3GNIB 3QTQA 4H39A 3TNPC 2QOQA 3AGLA 3MH2A 4AF3A 3KB7A 4FTUA 5AR7A 3Q53A 4GMYA 5BVEA 3MI9A 4RVLA 4USEA 5JN2A 2O3PA 4FYOA 4USFA 3R8UA 3HL7A 3PTGA 4G3EA 3NYOA 4ENXA 1OPKA 3CS9A 3PG1A 1V1KA 3NUXA 4E6QA 3MGYA 5AV2A 2VWZA 1YXVA 4ITHA 1YXXA 2WTKB 5GHVA 4I3ZA 1WVYA 3Q2MA 3A2CA 4FKUA 5CLPA 4EH5A 3FQEA 4JIKA 5FM2A 2OH0E 4KSPA 4WG3A 3PE1A 3LFSA 4A9YA 3FZRA 4I1ZA 3D7ZA 4AT3A 3VUMA 4E20A 2IPXA 2X8DA 5M4IA 3H9RA 4W4WA 5CI7A 2OZAB 4BCOA 2C3JA 3FLYA 1ZZLA 4I92A 3D2IA 4L6QA 4WSQA 4ZSGA 4BKJA 1AQ1A 4QMYA 3LFFA 2F7EE 2ONLA 4S34A 1H28A 2UW7A 3QCXA 4GH2A 1WBNA 4G3FA 4Y83A 5E91A 5TKDA 3SC1A 4YR8A 4IJ9A 4K11A 4NCTA 4HPUE 4QMTA 4M3QA 2XNBA 3RK7A 2O2UA 1BL6A 4BCNA 4PMSA 3BYSA 3NDMA 3EWHA 2AC3A 1WBOA 4I6QA 5AA8A 4KKGA 2CKOA 5CU0A 3IQ7A 3HNGA 3COIA 1JKSA 1JLUE 4JL9A 4TWCA 3NUYA 4LM5A 3PY1A 4I6FA 4IXPA 2NO3A 4O6LA 4IADA 2JFLA 3MPTA 3A4PA 2JGZA 5CSHA 1APME 4OTGA 4OAVB 5E8TA 1YI3A 2WMBA 2R2PA 4M84A 4M67A 2GHGA 2OK1A 2QOHA 4ANLA 1IA8A 4HW7A 5IPJA 5C03A 4ALWA 4PDSA 4ZS4A 3R2BA 5C8NA 3O96A 3R0TA 3QAME 5BYZA 5E8UA 4FIHA 1XR1A 2PZ5A 5AUWA 1OUYA 4N6ZA 4JIAA 4N0SA 4YGAA 1H07A 2PE1A 3MA3A 1OM1A 3AT4A 4G9CA 5BVDA 3SVVA 4JG6A 2V7OA 4QYEA 1R3CA 4U5JA 4M14A 2BZKB 3C5IA 3VHKA 2ITUA 1CKJA 4HCUA 4IWPA 4BCKA 3ORIA 2KTYA 4B9DA 5HG9A 5IEYA 5EI6A 3QU0A 2R7BA 3FXXA 4FZDB 3U9CA 4DYMA 5L3AA 2ITTA 2HZIA 2PMNX 5M44A 4UB7A 5K5NA 2PU8A 2X2KA 3QC4A 4IX3A 3BEAA 3GGFA 4GK3A 3A8XA 5H8GA 4ZJJA 2Q83A 3PXRA 4A4XA 4FV2A 5D7VA 1U5QA 4LUEA 2EB2A 2YM5A 1QL6A 2WEVA 2YIXA 4DG0E 3QZHA 4O2ZA 2Z8CA 4P90A 3GOKA 2WTVA 3I5NA 4C34A 3SOCA 3ZO3A 1U4DA 3R8PA 4IAAA 3U51A 4E5BA 4L53A 2A27A 1OUKA 3G90X 4X7QA 2Z7RA 4YMJA 4QMVA 2WMAA 3P0MA 5FXQA 4EOIA 5J7HA 1HOWA 4BF2A 2IZTA 5IA4A 3IW6A 5FG8A 4C7TA 2XKFA 4EUUA 3A7GA 4MD9E 5L2SA 4HGSA 5E8YA 4O1OA 3R8LA 4RWIA 4K6ZA 5G6VA 2UZNA 4N70A 3OW3A 4D5KA 3OXZA 2OI4X 3KRLA 1PXKA 3RMFA 1Y57A 3FKOA 3UDBA 2R3HA 4CV9A 5A4QA 5CWZA 4F70A 3W2QA 3OUNB 4MBJA 4KIQA 2YWPA 3O51A 3PJ8A 1XH7A 3NW5A 4XNEA 5TT7A 2XCKA 3UYSA 2VTSA 4MKCA 3BYMA 1HCKA 4ZLYA 3L9PA 4FKWA 4RIYB 4YZDA 5HO8A 3RBWA 5JH6A 1ZYJA 2XIXA 1FGKA 1PW2A 4X3JA 5IA0A 1FPUA 3N51A 5JSMA 4RQKA 4EK5A 3ALNA 1W8CA 4G1WA 4Q5HA 4O38A 4BTFA 3OXIA 3R9HA 5ITAA 1PRYA 3WF5A 4B8LA 3P7AA 4GT3A 3OCTA 3TI1A 5J9YA 4FKRA 2GNHA 4CT2A 2B0QA 3OCGA 4RFMA 1W82A 3Q4UA 1GAGA 3ZBFA 1ZMUA 4MNEA 5FDPA 2B55A 5K4IA 4F08A 4HVGA 2C6KA 3BGZA 4ZXTA 4AA4A 1IA9A 4KKEA 3IG7A 3PA3A 4RX7A 4TWNA 2PMLX 3VBWA 4CLJA 3PSCA 5HZNA 4WNMA 1CSNA 3FY2A 3NIZA 3C51A 3VS0A 4WOVA 2I7QA 4O0YA 4O6EA 2GFSA 3K3IA 4YBJA 2JAVA 5CAPA 4DINA 4GYGA 3G0EA 3HGKA 2WMWA 2HK5A 3WF7A 5G1XA 5JRSA 5CEMA 3NCZA 3GC7A 4I0RA 4ZJVA 4F6SA 2A0CX 4DCEA 2V5QA 5K3YA 4YO6A 4QMLA 2F7XE 4ZLZA 3F3TA 1XH6A 3ITZA 3RWPA 4DH5A 5A4CA 3FMNA 5CF8A 4IX4A 3CIKA 3OP5A 4PY1A 3ORXA 2BFYA 4BWPA 4FF8A 2JIUA 2J6MA 3SAYA 1MRVA 4H58A 4UALA 4Z7GA 3PJ3A 3U87A 5EK7A 1YRPA 3D5XA 3T9TA 4EHGA 2C1AA 5HD4A 5DH3A 5K4JA 3UZRA 5AP6A 1PXIA 1YI6A 3OZ6A 3QUPA 3TJDA 3ZUVA 5E92A 3UJGA 3GVUA 1IG1A 4BCHA 3WIKA 3MPMA 4KRDA 3HX4A 2FA2A 5KZIA 4YZBA 4YTCA 5E9EA 2Y4IB 1EH4A 2JDSA 2EWAA 4AX8A 2XA4A 4EWHA 4U42A 1GZOA 1R0PA 3JUHA 2JDRA 2XK6A 4CXAA 4TYHB 3BE2A 4X2NA 4D2PA 3NUNA 1KOBA 2WMQA 2BRBA 4NM7A 5E1SA 4EC9A 2VWXA 5HVYA 4IB5A 5HG7A 4EQUA 2J5EA 2ZM3A 1H1WA 3QX4A 1XJDA 3OCSA 4J71A 2Z7SA 3KXZA 4CFMA 3HV3A 2GQSA 3R8VA 5I9XA 1TQPA 5J87A 4XMOA 4EOMA 5EKNA 2GS6A 2OIQA 3A4OX 3P08A 3CGFA 4HGLA 4P2KA 3P23A 4JDHA 4O1PA 4QMZA 4QMXA 4YHJA 4PL3A 4DFLA 2CNQA 3MJ1A 3WF9A 4MXCA 2QOLA 3MJ2A 4WT6A 3RNIA 4EOLA 5JZJA 4V0GB 1MUOA 2OSCA 2C0IA 2ITWA 1H08A 2YCSA 3R7GA 3DFCB 2BZHB 3BWJA 3QTIA 4Q2AA 2ESMA 1M2RA 2XRWA 4L7FA 4ZSLA 4EBWA 3P5KA 4KA3A 5CAVA 1K3AA 3CR0A 4GK4A 5DVRA 4Q5EA 3LHJA 4BTMA 2BDFA 2OXDA 3GFEA 4IANA 5IISA 3QUEA 2XK4A 3SG8A 3CKXA 3NRMA 2VGOA 3KC3A 4S32A 4DEAA 2PZYA 3F3ZA 4LOOA 4R3PA 5D10A 3R1NA 3VBTA 3VS1A 4BCIA 4C59A 4FEWA 3ORKA 4JXFA 4GK2A 4OTHA 1OPLA 3UO4A 4XX9A 5HBHA 3WZJA 2HZNA 5CU2A 4AN3A 3BHVA 5IMEA 1JNKA 1JWHA 1PMNA 1YKRA 4G16A 5HX6A 1PMEA 4OBQA 5AWMA 4UX9A 1O6LA 5I9ZA 2CLXA 1J7LA 4YLJA 2AYPA 2XIRA 3SW4A 3EB0A 3A62A 3C9WA 2QQ7A 4F6UA 1HCLA 5A6NA 3FV8A 4O86A 5AM6A 3UO6A 5C4LA 2Y9QA 2YZAA 2H96A 3F3UA 5M07A 1VYWA 4XHKB 4BC6A 3GC8A 5HNGA 4DGOA 4UYAA 2ZDTA 3UGCA 2UW8A 3GCVA 4HYSA 3ZSGA 5A14A 2PVJA 2WIHA 3EL8A 4DFYA 3SXRA 4AW0A 3OOMA 3PA4A 2WQMA 1TQIA 4O0TA 5CF4A 3R7YA 4FTTA 3DV3A 2NNWB 3MWUA 5KO1A 1OI9A 5I9WA 3LCOA 4QMUA 4QMPA 3KF4A 4YNOA 4CFUA 3R1YA 4FSZA 3KN5A 4KS8A 4JNWA 4ZP5A 5BVFA 3QD4A 2X39A 3N4TA 4WUAA 4IACA 4G3DA 3W8LA 4FZ6A 3ZEWA 3LQ3A 4CCUA 3POOA 5ACBC 1JBPE 3BIZA 4U44A 5IQHA 5JRQA 4FUXA 3AC5A 1GZ8A 5F95A 4BZOA 3BLHA 3WF6A 2PVMA 4O27B 3ALOA 1H8FA 4X3FB 2B9FA 3B8QA 3EIDA 5EQEA 2ITYA 3KULB 4GT4A 2BIKB 4BCPA 4R8QA 3QZIA 3MFRA 4FR4A 3UVPA 4BKYA 5AUTA 3ELJA 1PXPA 3QRKA 4BICA 4ZAUA 1WVXA 3FLWA 3U54A 4D1SA 4GFMA 3UNKA 2GNFA 2YZLA 1H26A 1P14A 1PJKA 3DA6A 4CMOA 4ZZOA 3TG1A 2JIVA 4RZVA 1JKTA 3B8RA 5CVGA 1OL1A 5ACKA 2R9SA 4G17A 3V5LA 2ZJWA 1DI8A 2BVAA 1P4OA 3KF7A 3Q60A 5L8JA 4CQGA 2R0UA 3TKUA 4N57A 3VS6A 4UMQA 4F09A 5AM7A 4JX3A 3V6RA 5M57A 5IQDA 3H9OA 5ICPA 1A06A 4OUCA 4ZOGA 4B4LA 2C6TA 3TWJA 2PVKA 3T3UA 4HZSA 5A3XA 4X6QC 5A6OA 4I0SA 3E7VA 3AMBA 4LQMA 5AUXA 4CTBA 3C4EA 3LFEA 4O7VA 2XNOA 4NL0A 4PPBA 5I4NA 2OF4A 4MF1A 4O0UA 2R3RA 5T3QA 3ZTXA 4ARKA 2O5KA 3IONA 2R3PA 4RJ5A 4RVMA 4BDIA 3PSBA 4CFWA 3IPHA 2GNGA 2YCQA 4GG7A 2JKQA 3W18A 2IG7A 1LP4A 5FEEA 3T8OA 1U54A 4CFNA 2RGPA 3D7TB 4F9YA 1YWNA 5HD7A 3FLNC 3WARA 3E62A 4RX5A 3C13A 4FV1A 5F1ZA 4G3CA 4W4XA 5AX9A 3VQHA 4B7TA 3KRRA 2RF9A 4RWKA 4FZAB 4ZS0A 3FI2A 3MTLA 3R73A 4FIIA 2VX1A 1GIHA 1VR2A 1W83A 1S9IA 5DEYA 4FSMA 4ALVA 5KUPA 3ODYX 4KUJA 4U9AA 2ZMDA 2I6LA 1K9AA 3H10A 2P4IA 4C0TA 5LMKA 3TUDA 4FGRA 4H3QA 4DCAA 3FE3A 2XK7A 1V0BA 3F5PA 5AUYA 2QI8A 1IEPA 1KE7A 1L3RE 2J0LA 4IVAA 3LCTA 3VVHA 2FSOX 1IAJA 3TTIA 3FSKA 5T68A 5AP0A 4GL9A 3M1SA 3DU8A 5LVPA 5M09A 3DAEA 3NVMB 4I93A 4NH1A 3MTFA 4E4NA 1JQHA 4D2WA 4EH3A 4Z55A 5DA3A 1ZYDA 3E8NA 4IH8A 2I0YA 2W7XA 4M15A 2FSLX 3KXXA 3LMGA 4WD5A 2YISA 1ERKA 4RBLA 4XOZA 4EORA 1YHSA 2YDKA 3DKFA 3PG3A 4XCUA 2R3JA 2I40A 5JGDA 3R8ZA 1R1WA 4MH7A 3SXFA 4ACMA 4QMNA 3DK3A 3CXWA 4X0MA 4XG3A 3QWKA 3RHXA 3KK8A 4L52A 4EWQA 2ZYBA 2PSQA 4FTMA 4L3JA 4UZDA 4U79A 4RIOA 4YJTA 3C4XA 4CKRA 3ZFYA 2P55A 4RIYA 2CKEA 2ZB0A 4F9AA 3HUBA 3FPQA 4E4LA 4M66A 4YP8A 3I7BA 4RJ8A 4AG8A 4DITA 3T9IA 4EHZA 3HV4A 5EW8A 2WU6A 4D0WA 2IWIA 4TZRA 3LFBA 2CKQA 2W1EA 2EB3A 4L67A 2HWPA 3WZKA 3UO5A 3NYNA 4FBXA 4PWNA 3VO3A 4TNDA 4UXLA 4JG8A 4BDHA 4FT3A 5FEDA 2YJRA 3UOLA 3FL4A 3LW0A 4XG8A 4DTKA 4GT5A 2QKRA 2B9HA 4F63A 4L46A 1BX6A 3VUGA 3U4WA 4ZIMA 4NW5A 3C0IA 4FIGA 3TDWA 3POZA 4Y46A 2WMTA 4YJUA 2UW0A 2VWWA 4LL5A 3EQCA 4CZUA 4YNEA 2OF2A 4FV6A 3MV5A 4XP3A 2WMXA 2CNVA 2E2BA 1XWSA 1M17A 3JS2A 4DFXE 5E8ZA 1OL7A 4NFNA 4BDEA 4TY1A 1ZYCA 5LVLA 1KWPA 4LMUA 2ITQA 4FIFA 3ZRKA 3HZTA 3W1FA 4FKPA 3RKBA 2F4JA 3Q52A 2V62A 3PXFA 5FEQA 2O63A 1TVOA 3PE2A 1PY5A 5CSVA 4MNEB 5FXRA 1L8TA 3ATTA 4GVJA 4WRSA 3WBLA 1PHKA 2JKKA 4FKQA 3EZRA 4RGJA 4RX8A 4E8AA 4PV0A 3U6HA 4I23A 4A7CA 4M0YA 3GCPA 3DBFA 3IO7A 3KMMA 2WTIA 3DDQA 3EQIA 3L9MA 4FL1A 2QU6A 3EKKA 4G6LA 4ZK5A 1H25A 3UMXA 1OBGA 4BCJA 2W17A 2NPQA 3CQWA 3EFKA 3MA6A 2B7AA 5TOZA 1DAYA 3ROYA 4IB0A 4JG7A 3HP5A 4YJSA 2GU8A 2CGXA 3DXNA 4OBOA 4TKSA 5AP1A 4XUFA 2F7ZE 3PPZA 4FTCA 4UWCA 3U8WA 3CSVA 4EONA 2X7OA 5CVFA 2W9ZB 2OKRA 3FZTA 3KN6A 5A54A 2BHHA 3A60A 4XV9A 5GJGA 2UZUE 2VZ6A 3GCUA 4KWPA 4WNKA 1KE9A 2I0HA 2ITZA 4ZTNA 3UP2A 4TYHA 3F5XA 3C4WA 2BTSA 4FTNA 5EYDA 3RK9A 5FD2A 4ZEGA 5HICA 4UY9A 1UKHA 2PL0A 3MVJA 4GVAA 3DT1A 2YAKA 3Q9XA 4FGBA 3VW8A 3FHIA 3FMJA 4EEVA 3CY2A 4I41A 3D0EA 1LPUA 3PRIA 2WTJA 3FLSA 2PUPA 1J7IA 3PVWA 5H9BA 4IE9A 5AV1A 4AWIA 3TN8A 4DHFA 2IO6A 4ACCA 2XB7A 4F6WA 3ZZEA 1R39A 3ZDUA 3F88A 5IH6A 2QLQA 3V5PA 4R3RA 3LPBA 3WE4A 5LMBA 2X7FA 3EFJA 3Q32A 4S33A 4O22A 5A9UA 2XNMA 1WBWA 2XZSA 2J7TA 2VGPA 4JAJA 5DE2A 5FM3A 4FC0A 2J5FA 1REJA 4K2RA 2X8EA 3FI8A 3R7IA 1CDKA 3CP9A 3NW7A 3F82A 3AGMA 3M42A 5CYIA 3CTQA 3KU2A 3PPJA 1LR4A 3LFCA 5M51A 3KVXA 4J8MA 3F2NA 5DFPA 2QG5A 3LJ2A 3E3BX 3NX8A 3F2RA 1H4LA 3LFAA 3HA6A 3ORLA 1OIUA 3R22A 2H6DA 4QPAA 4DN5A 2XYUA 4KIKA 3RGFA 1RJBA 3FL5A 5EHOA 4FT5A 5I5ZA 3FJQE 4O84A 2C3LA 4C8BA 1QPDA 2W5HA 5JEBA 4YPDA 3KXNA 3QQUA 3LE6A 5AR2A 1RQQA 2XK9A 3QWJA 2G1TA 2UV2A 5CT7A 4NIFA 2VO3A 4DGMA 1OIQA 3A8WA 3BQCA 3RZFA 4YJQA 5CU4A 3C4ZA 4FTKA 4DH1A 4IC8A 2H9VA 3V8WA 4QT1A 4QYYA 3HVCA 4O0VA 4G9RA 4FOBA 5M06A 5IMXA 4BI0A 3GB2A 2IZRA 4FKIA 3PFQA 4IWQA 1P4FA 5LJJA 2OXXA 1QCFA 4APPA 3TZMA 4F9WA 4NW6A 4J95A 3DCVA 5TO8A 3SV0A 3MDYA 1VYZA 4QQTA 1J3HA 5CS6A 3ET7A 4HGTA 2JFMA 4E1ZA 3E64A 4ZTHA 1DS5A 4U8ZA 3SRVA 5CF6A 2YIWA 2R3GA 4HVSA 4BKZA 1UU7A 2VWYA 3AXWA 2GQGA 3MS9A 2R0IA 4JS8A 5EM7A 3BEGA 3I4BA 4IM0A 3KULA 3OT3A 4ACDA 4CRLA 4BB4A 4AZVA 3DJ7A 3DZOA 3FHRA 4IBMA 5D12A 5ETIA 5DWRA 3RAWA 4HNIA 4EJ7A 4MEDA 2QHMA 3CQUA 3SKCA 3PY0A 5EYCA 2GNJA 3W8QA 4WG4A 3RI1A 1UU9A 2BHEA 3U4UA 2XBJA 4FE2A 5IUIA 4QYGA 4D1ZA 5CU6A 4IAYA 2HOGA 2OICA 3FKNA 2UVYA 5EYKA 4ZY6A 4MBIA 2O64A 3BYUA 4M68A 4XP2A 4DFNA 2W5AA 4BL1A 4QYFA 2GTMA 3EZVA 2W96B 2WTKC 4Z9LA 2JD5A 3GI3A 1JOWB 3S4QA 4I94A 3LQ5A 3QD3A 3RPSA 2C30A 1Q8TA 3WYXA 2QOIA 2FSTX 3IW8A 4EH4A 4IC7A 2NRUA 5TF9A 5DRBA 2B54A 3LKMA 3PWDA 1OKYA 4FTIA 3R9RA 4IVDA 3W33A 3SW7A 4HZRA 1KE6A 3EYHA 4JDIA 4OR5A 4DA5A 3VUDA 3AT2A 4XRJA 2RL5A 3FI3A 3W2RA 4OTFA 5CEQA 2H8HA 1QPCA 3EQRA 4EL9A 2CPKE 5IKWA 4AZSA 3UYTA 4D58A 2FVDA 1BI8A 3HEGA 2ZM4A 4AUAA 4PTEA 4Q9SA 4YC8A 3QYWA 5F94A 3PXQA 5B0XA 5GJDA 5C1QB 3LLAA 3D7TA 3PXZA 2QOBA 4KBAA 3O8PA 1UA2A 3EQDA 2UVZA 3F66A 3FZ1A 2E9NA 3I1AA 2RFDA 2WB8A 3KQ7A 3LAUA 4KB8A 1GY3A 3G9LX 5EKOA 2IW9A 3W2PA 4F65A 1Y91A 2JKMA 5JFVA 4BIDA 1OL6A 4HVIA 5LVMA 2YHVA 4RA4A 5E8WA 4GYIA 4BDAA 4L42A 4CMUA 3NNUA 4V05A 5ETAA 4JBVA 4JDKA 2WMRA 3CD3A 3LLTA 3ZHPC 3GP0A 5IA2A 5B2KA 1B38A 2PVRA 3PSDA 5IU2A 1U54B 5I0BA 4L68A 1Z9XA 2CKPA 4C38A 3GENA 2KULA 2PVNA 3MIAA 2X7GA 4ANMA 4FKVA 2R3MA 4EK6A 1GJOA 4I5PA 3ZRMA 1KV2A 4IWOA 3II5A 4YPSA 4DC2A 2XS0A 4FTLA 3DLSA 3FC2A 3PP1A 5EW9A 5EM5A 4O0SA 3RPVA 2C5OA 3DK7A 1Z5MA 3UOKA 2X8IA 3DGKA 3I0OA 3ZSHA 3VIDA 1ZMVA 5E90A 4AN9A 5GJFA 3EQFA 3DS6A 4A9RA 4UBAA 5AR4A 2VTAA 4WSYA 5AUUA 3LJ0A 2J51A 3AT3A 3TEIA 2CDZA 5GIPE 2HAKA 3TL8A 4MX9A 4FKTA 2W1ZA 3G2FA 3OWJA 4RJ4A 5M55A 3UG2A 3W2CA 4JAIA 4TL0A 3EFWA 4F7NA 1OKWA 1URCA 5L2IA 2XK8A 3ZC5A 5I9VA 3SLSA 2JAMA 2QOCA 4CTCA 4EI4A 3DJ6A 4KAOA 4D2RA 5DR2A 5CSWA 5FDXA 3G0FA 4KS7A 4CT1A 3HAMA 1H01A 5LWMA 1U5RA 4V01A 2UVXA 4QTBA 4ITIA 2VTJA 1YI4A 2C0TA 2YA9A 2XM9A 4J52A 5HESA 3W2OA 4E93A 2BFXA 2VWUA 3D83A 4RRVA 4EQCA 5HO7A 4PNIA 1OITA 3ULZA 4F1TA 4GJ2A 4W9XA 4NKAA 3BGPA 3BYOA 2CCHA 5A46A 4BIEA 2QNJA 1MQ4A 3NS9A 1CKIA 5EDPA 4G5PA 4B6LA 2XJ1A 3BKBA 3MY1A 5F9EA 5DN3A 5CSXA 2IVVA 3MVMA 5GZAA 2VN9A 3VS5A 4QMQA 2YLFA 2YM8A 4XEYA 5GIOE 4BR3A 4ZTLA 4WRGA 3UMWA 5IQCA 2RKUA 4GIIA 4C4IA 4AOTA 5HGIA 3G51A 3WZEA 2BRNA 3ZYAA 3MH3A 2RFEA 3R9OA 4QMSA 3LFQA 4CG8A 4WBOA 4CVAA 1PXLA 1ZOEA 5CTPA 5B2MA 3L8PA 4DFZE 1Q8WA 3E92A 5CY3A 4F0GA 1T46A 5IQFA 4GFOA 1VJYA 3JY0A 3DQXA 3HMMA 4Y8DA 5DT4A 4FVQA 5BNJA 5IA5A 4F1MA 3LZBA 4D4RA 1H24A 1UWHA 4KKHA 5ETFA 1Q8UA 3K54A 2JDOA 3QC9A 4YC6A 4YTHA 3PIYA 5BUJA 2VNYA 5DYJA 5FTGA 3OWKA 5CEKA 4YSJA 4RWJA 5LMAA 4QMOA 5BMMA 3G15A 4BBMA 2O8YA 3O0GA 3GOPA 2ETRA 3DBCA 1JSUA 3EN7A 3NNXA 4FK6A 1FQ1B 5DT3A 5EI8A 1ATPE 4C33A 3VS3A 5JQ8A 4U6RA 4I21A 5C26A 5IQIA 2YDIA 4S2ZA 3ZLWA 4MQ2A 2C1BA 4RZWA 1S9JA 2WPAA 5AP3A 4AZFA 5AP2A 5M53A 3QCQA 5B7VA 4IB1A 4D4VA 5EM6A 4IZ5A 3KXHA 1WBPA 3MSSA 3L8VA 4FSRA 3NNVA 4EJNA 3NUAA 1G5SA 3OHTA 4G31A 2LAVA 2HXLA 4IX6A 4FTQA 5HTCA 3EQGA 3GBZA 5L2QA 1TQMA 4OT5A 5IA3A 3SX9A 3IDPA 3PYYA 2PWLA 3H0YA 3TV4A 2YJSA 4TW9A 1UNGA 2YFXA 4HOKA 3E87A 3QQKA 3ZZWA 4BRXA 4D5HA 3AD6A 4Q9ZA 2YITA 2GHLA 3TZ8A 2ZAZA 4Y72A 4L43A 4EOJA 5DR6A 5HX8A 1SNXA 4O91A 3RAHA 3FXZA 5AAEA 3UC4A 4FNZA 5IUGA 4EOPA 2VX3A 3NNWA 3V51A 2O0UA 4NKSA 1WBSA 1WCCA 3R8MA 5BUIA 5KCVA 1PMUA 3LCKA 3NPCA 3OFMA 3IGOA 3IOKA 3Q2JA 4CKJA 3BHHA 3QQFA 5AA9A 3QA8A 4ORKA 4QOXA 5AUZA 4AOIA 4RWLA 3UIMA 2YDJA 2Y0AA 3ZCLA 4PX6A 4EK4A 3UQGA 5CZHA 3W10A 5CNNA 4FTOA 3ZH8A 1F5QA 3HMNA 4CKIA 1ZLTA 3I6UA 4TXCA 3DTWA 4XG6A 3TTJA 4D1XA 1JKKA 2VNWA 4W9WA 5AP4A 4EKKA 2QD9A 2GS7A 2QURA 3OBJA 4G6NA 3TT0A 3DKCA 3NWWA 4IVCA 4RG0A 4IZAA 4EZ3A 5L6PA 4YHTA 2YACA 5DNRA 4HPTE 4MK0A 4Z16A 4LL0A 5DLSA 4ZZMA 3V5WA 3CLYA 4U40A 4D2SA 1OB3A 3ZO2A 5DBXA 4FIJA 2J0MB 4YSMA 3G9NA 3MY5A 4QYHA 3FMHA 4C36A 2W4OA 3C0HA 4MYGA 2GMXA 4UMRA 5KKRB 3DB6A 5AIKA 2X2LA 1XHAA 3BLRA 3E8EA 2A2AA 4KIKB 1YDSE 2OWBA 3QX2A 4QPSA 4WUNA 3PWYA 5HLPA 2VO7A 3FMLA 5E8VA 3QHRA 2UZEA 3LM5A 5EYMA 5HBEA 3MPAA 2XEYA 3QF9A 4IAFA 4O96A 4UWYA 4PDYA 4MF0A 5ANDA 3UIUA 5JFWA 4NIFB 3NW6A 4R6VA 3S0OA 3PJ2A 3PP0A 3VUIA 4Y85A 3ODZX 4E4XA 4YO4A 4XLIA 3VUHA 4R7HA 4JDJA 3ZLYA 3U55A 4FOCA 1WAKA 2A4LA 3QHWA 2XNNA 3JXWA 4IX5A 4Y5HA 3R28A 4D0XA 1J1CA 5BVOA 5CAOA 4IW0A 2EXEA 3R7EA 4RIWA 4C3FA 4FSQA 2FYSA 3TKIA 3LVPA 2XIKA 3ZLSA 3ZRLA 5CANA 1WVWA 5IH4A 2VWBA 2ZVAA 5HIBA 4FKOA 4U3ZA 3W2SA 5CXZA 1IASA 1M2QA 2XP2A 3OTUA 4FV3A 3DKGA 3OY3A 1STCE 3OS3A 4II5A 4E6CA 3SRVB 1ZY5A 4ERKA 2YLEA 2OW3A 3MVHA 3RWQA 3A61A 3RJCA 2WQOA 3D14A 4IM3A 4JRVA 4K0YA 4X3FC 4ZMEA 5EFQA 5EG3A 3VS2A 2HIWA 5BQ0A 3ZUTA 1BI7A 5FBOA 4BDKA 2UZOA 2W06A 4RFZA 4J7BA 2J4ZA 2LGCA 5EDRA 1UV5A 1PMVA 4RC2A 4USDA 5E4HA 2XM8A 3OD6X 2WTDA 2ETKA 3PY3A 2UZLA 4OTQA 4PUZA 4MHAA 4AZTA 4EK8A 5I3RA 3IDCA 5H8EA 3R6XA 2JLDA 4BHZA 2QODA 3RCDA 2BZIB 2CN5A 4QMMA 3LXPA 4QMWA 4E5AX 5IQBA 4FEVA 3ORNA 3IDBA 2XNGA 4UEUA 1XH9A 3QUDA 5HHWA 2PUUA 5KNJA 2ZB1A 2OJIA 4U45A 1CM8A 2WMSA 4DEGA 3HRFA 5C8KA 3UODA 5L2TA 4L9IA 5CALA 3HDNA 4CV8A 4BCQA 1GNGA 4BN1A 5HLNA 4RT7A 5HEZA 1H0WA 3V8SA 3RVGA 3SG9A 4EKLA 1H00A 4KINA 4RJ6A 5BYLA 4XG4A 4MNFA 4X2GA 1BYGA 4RVTA 3BE9A 4TRLA 2WU7A 3IW7A 1PXMA 3Q4CA 4ASZA 4IAKA 4NTTA 4JQ8A 3HECA 4XH6A 3Q96A 3QTUA 1G8SA 3TM0A 3DDPA 4YJPA 2X4FA 3REPA 2F57A 2ONLC 3NAXA 3SHEA 3TACA 3B2WA 4WNPA 3OT8A 4AFJA 1FBNA 3QGYA 4DGLC 4FIEA 4NCTC 3A7IA 2XCHA 1OVEA 2G2HA 2ERKA 5AP7A 5IG1A 4XV2A 3OG7A 4O7WA 3RTPA 4GKHA 2J50A 5J7BA 4O82A 4QP4A 4W4VA 1W0XC 3TZ7A 4BIBA 2HW6A 1GIIA 3NIEA 4E3CA 2ITXA 4F7JA 2YWVA 3QRJA 2FUMA 4DF3A 5TE0A 5HCXA 4EZ5A 3WOWA 2GHMA 3PVGA 3OTVA 3F6XA 1B6CB 3C4CA 5LVOA 3PZEA 5A4LA 3OVVA 4FZ7A 3P9JA 2JBOA 5AUVA 4DGGA 4EOKA 5DEWA 2W1FA 5BVKA 4TNBA 1G8AA 5AR8A 3VS4A 3O23A 3BBTB 5BMSA 3LXNA 5JK3A 2BUJA 4O7NA 5GINE 2JKOA 2V7AA 3IGGA 5J9ZA 4ZMFA 3O8UA 1PXOA 3FZSA 1ZOHA 3UNZA 1SMHA 4ASXA 4F99A 3I79A 4A9TA 4D9UA 3D5UA 3HV7A 4ZY4A 4BGQA 4BCFA 2PMOX 3CGOA 2R5TA 1NT2A 2BPMA 1X8BA 3EN9A 5HE1A 4JT3A 2OFUA 3AC3A 3KGAA 4PMPA 4E26A 1JSVA 3AQVA 2WQEA 2ZM1A 4U43A 3TUCA 4ZTQA 3ETAA 2F9GA 3QKKA 1FINA 3GXLA 4BDCA 2BILB 3QYZA 2GPHA 4QD6A 1BLXA 3BV3A 1UU8A 2WEIA 2P0CA 5HNIX 1H1QA 2G9XA 1PXJA 1E1XA 4H3PA 3OY1A 5T6KA 2QONA 3FMEA 3S95A 2PE0A 3NUPA 5BVWA 3I81A 2OJJA 1ZY4A 4NM5A 4O7TA 1WBVA 4CZYB 4OTPA 4JX7A 3UG1A 3DTCA 2UZDA 2RFNA 3OCBA 3UP7A 3BCEA 5DPVA 4YJRA 1YQJA 4YJOA 2JDVA 3IOPA 3ACJA 4C35A 4EH8A 2WAJA 3D94A 2V0DA 2W1GA 1R0EA 2CSNA 5TR6A 4FODA 4NUSA 4DFUA 3AC2A 2YCRA 4EH9A 5IEXA 4L8MA 3EL7A 1LEWA 1IR3A 3K2LA 1REKA 3PPKA 4I5HA 5EHLA 4YJNA 4D4YA 2PHKA 2FB8A 5FTOA 3GU7A 2IJMA 3DJ5A 4BGGA 4DBXA 4EYMA 2I1MA 3LM0A 5FXSA 4CG9A 4FNYA 4K18A 3QL8A 4EUTA 2HXQA 5GNKA 3COMA 3EKNA 1KE8A 4TT7A 3MIYA 2BRGA 2CGVA 1H1RA 3NAYA 3QQHA 4P7EA 3P79A 3A7JA 2C5XA 3R9NA 4PQNA 1M7QA 4X2KA 3VBQA 3DAKA 3FQSA 2VTHA 2W5BA 3EQHA 3TV7A 3C0GA 4IHPA 5CENA 2WXVA 2XNEA 4LYNA 4BDDA 4GUEA 1PKDA 4FVPA 4MD8E 3GU5A 4EZ7A 3E3PA 3HRCA 5J1VA 4QP1A 3GC9A 3KEXA 4ZSEA 4R77A 4FSNA 4UWBA 4D2VA 2BRHA 4PPAA 1ZYLA 3UVQA 1OPJA 4L00A 3KREA 1T45A 3QZGA 4QTCA 1K2PA 3DQWA 2VTQA 4IQ6A 5JGBA 5M4FA 4JQ7A 1PKGA 1XH5A 3ZO1A 3NVKI 1J91A 4CSVA 3R04A 3FC1X 4GEOA 3V8TA 2FGIA 3FSFA 3OF0A 4L01A 3MW1A 3VUKA 5AX3A 1CKPA 2XUUA 3DNEA 2W1CA 4FX3A 1YDRE 2YERA 4AA0A 4BDBA 3CPBA 1SM2A 4C4JA 3EYGA 4E6DA 5KMKA 4ONAA 4AGCA 2CN8A 5GZ8A 1FVVA 3HAVA 4ANOA 3O50A 4AS0A 4CMTA 4MAOA 3PJCA 4PP9A 3SGCA 4BZNA 3IW5A 4GG5A 3EOCA 2W9FB 4L7SA 4UV0A 4IIRA 4IZYA 1I09A 3EN5A 1AGWA 2BRMA 4F0IA 1BL7A 2X6EA 3C5UA 4BWKA 2BKKA 1BUHA 3HV5A 4FVRA 5M4CA 4NT4A 4C2VA 1YWVA 3NZ0A 3RPOA 4L3LA 5CT0A 5M56A 1XH8A 2PUIA 3VWAA 2AC5A 5AV0A 3H3CA 4FG7A 5LOHA 2WGJA 5HQ0A 2QO7A 4RSSA 3VJOA 3M2WA 4LI5A 3V3VA 4M97A 3W32A 4DEEA 4E4MA 4MTAA 4AT4A 5LXMA 3E7OA 3N4VA 2C6LA 2QR8A 3GU8A 4LRMA 5LWNA 1UNLA 2X9FA 3AC4A 2RSVA 2CGUA 3VF8A 5EQYA 1ZMWA 3L9NA 2C69A 4HYIA 3NUUA 4FV5A 3U6JA 5M08A 4FI1A 4ZTSA 5HE2A 2OLCA 1M14A 3QALE 3CY3A 3R7VA 3HMPA 4ZSJA 2WFYA 4RJ7A 3RP9A 4ZY5A 2BR1A 3C7QA 3MY0A 4O2PA 4EOSA 3THBA 2IN6A 5JFXA 1CTPE 2E9VA 5ETCA 5HORA 4PTGA 4GU6A 2CLQA 2PK9A 3PIXA 4EYJA 3OWLA 3ZXZA 2JEDA 4R1YA 3S1HA 2P2IA 5D41A 4EQMA 3IK3A 4FSYA 2UUEA 5D1JA 5DGZA 4CEGA 2QKWB 3PVBA 4DTAA 4MXXA 4PDOA 5DIAA 4JOAA 3QGWA 4C37A 2Y4PA 4J98A 2B53A 2VTPA 4GS6A 5LQFA 4XV1A 4K8AA 5JKGA 2ZV8A 1YHWA 2ZOQA 5IF1A 4EOQA 4JLCA 3ZM4A 1U46A 3QBNA 4C4EA 3BHTA 3HMOA 4DH3A 1KV1A 2P33A 3C4FA 3UVRA 3SDJA 2Y6MA 4FT0A 1H27A 2CCIA 2RG6A 4Z3VA 2QO9A 4G5JA 4IMYA 4U3YA 3NCGA 3UZPA 1M2PA 4A07A 3FDNA 4F1OA 4K9YA 4ACGA 3FZPA 5LVNA 4TYEA 4HYHA 2GQRA 3E93A 1XBBA 1VEBA 3AMYA 2DWBA 2VO6A 4PL5A 2B1PA 3GQIA 4QRCA 4RIWB 5I9YA 4X21A 2F2UA 3UE4A 3TUBA 3BX5A 4XBRA 5IQEA 3D9VA 5ANOA 2J0JA 2VTLA 2QHNA 5HKMA 5HE3A 3QRUA 1FOTA 1ZWSA 1WZYA 4F4PA 2WOTA 3KKVA 3BYVA 5AEPA 3DK6A 4WHZA 5AR3A 2VTOA 1IAHA 2X1NA 3IS5A 2YM3A 4C58A 3JPVA 4PDPA 4U80A 1Q5KA 4FKJA 4O0RA 3WE8A 4CRSA 5C4KA 3FBVA 1XO2B 3HV6A 1CMKE 3P4KA 4J8NA 4CFVA 2AUHA 1PYEA 5JQ5A 1Q3DA 2XEZA 3HKOA 4EH7A 2WO6A 4I5MA 4KSQA 3BLQA 2C6EA 3F7ZA 3QXOA 3RK5A 4FZFB 1OL2A 4BY9E 2WELA 3G6HA 4XLVA 2R3LA 3NYVA 4IDTA 3ORPA 2PVFA 3UPZA 3DZQA 4PP7A 2IVTA 1W98A 3OBGA 4FV9A 4S30A 5HVKA 2X4ZA 2QOKA 3QA0A 3DY7A 4OTDA 3E8DA 3RAIA 2WD1A 2X9EA 4MWHA 4Y73A 3I6WA 4QP8A 4CCBA 1H1PA 2O65A 4TPTA 2BZJA 3B2TA 4PMTA 2Y6OA 4IZ7A 2I0VA 3BU5A 4NZWB 3BGQA 4KNBA 3TNQB 5HG8A 3K5VA 3NLBA 3Q9ZA 5KHXA 3JYAA 4LV5A 1OKZA 2PTKA 3DOGA 2DYLA 3CKWA 3AD4A 3ERKA 2GCDA 3QQGA 2W05A 3R00A 2PYWA 3ZUUA 2IZUA 1Q97A 3F2AA 1DI9A 3VBVA 2PMIA 3F3VA 4XP0A 3R7UA 5FTQA 4AW2A 4JBPA 4O7RA 4FL3A 3MBLA 3DAJA 2B9JA 4H1JA 4DAWA 3AC8A 5KBQA 3BRBA 5HE0A 2BROA 1GZKA 3KMWA 1KE5A 2IZSA 5AADA 4EH2A 4DE4A 1AD5A 2C47A 2HZ4A 3DNDA 3E5AA 2W4JA 3LJ1A 1FVRA 2HZ0A 5KX8A 4UMPA 2RIOA 4QP2A 2UW9A 3CTHA 5H3QA 2PPQA 2FO0A 5IDNA 1OMWA 2OJ9A 2BMCA 4NFMA 4RMZA 5JMSA 1O6KA 2ZV2A 1NVRA 2XNPA 3LFDA 4FTAA 1J1BA 5IQAA 2WTWA 3PA5A 2BAQA 3Q3BA 2OO8X 4TYJA 4AQCA 4DEIA 4GU9A 5AV4A 2QOFA 3O71A 3FLQA 4FT9A 4FUYA 4LGGA 3ZFMA 1JVPP 3FQHA 3R02A 3R1QA 4FYNA 2BTRA 3ID6C 3UNJA 3KY2A 5LMKC 2WTCA 3KXGA 4U41A 3ZOSA 4APCA 2WNTA 3KMUA 3ZMMA 1H1SA 1M7NA 3UTOA 2YM6A 3WILA 3I7CA 1SYKA 4IM2A 3MFUA 4XOYA 5LCJA 3VRYA 2W1HA 2UZBA 3EJ1A 3VNTA 2C0OA 4HCTA 2G15A 1QMZA 3COHA 2UZWE 2ITNA 3EN6A 4NWMA 3COKA 2DUVA 3VHEA 3D2KA 3QLGA 1OIRA 4OAUC 3GT8A 4F9BA 4IB3A 3AD5A 3ORZA 5KE0A 2NRYA 2XF0A 5C01A 4C02A 5KMLA 3MVLA 3U9NA 2HENA 2UW6A 3QD0A 4XG7A 4JI9A 2ITOA 3DBQA 5KBRA 2PULA 2BDWA 2C5YA 3FMDA 3QXPA 2IVSA 4IFGA 4YU2A 5CSPA 4DTBA 2WHBA 2QO2A 4M0ZA 4H36A 4DEDA 3KRJA 3W16A 3WF8A 2C5NA 3HDMA 4NYEA 4R1VA 2X2MA 1ZXEA 4U81A 3WI6A 5FQDC 4O7SA 2PZIA 5DMZA 4Y95A 3MFTA 5IA1A 2E9OA 3BHYA 4E73A 4E5WA 3ENHA 3P7BA 1GZNA 2CGWA 2R3OA 2XMYA 2UZTA 4FKGA 4GJ3A 4IFCA 4MVFA 4YZNA 4BDJA 5IQGA 4M12A 3D5VA 4WG5A 2IW6A 4RPVA 3LMIA 3QRIA 3FPMA 3GFWA 5FBNC 2VTNA 3CBLA 4EH6A 4AFEA 2XBAA 2EXCX 1RDQE 2WMVA 5K9IA 2X81A 3P1AA 3FUPA 5EH0A 3RM6A 1Q99A 4E7WA 4AGWA 4LGHA 4C62A 4F9CA 4IVBA 4IJPA 1F0QA 4KBKA 2R3IA 2G01A 5I3OA 1J7UA 4O0XA 3N4UA 2B4SB 2YEXA 5DI1A 5J79A 2YABA 4QO9A 3ZONA 4UMTA 3UOJA 4MD7E 3ZDIA 4QNAA 2HELA 3F5GA 2PZRA 3UIXA 5DRDA 2Q0BA 1QPJA 3Q5IA 4JVGA 5CXHA 3QQLA 5FLFA 3UBDA 5DR9A 1JKLA 2HY81 5CQUA 4HCVA 5CEIA 4CFFA 3ZO4A 5KMIA 1A9UA 1OIYA 2VTMA 3VQUA 4RIXA 1YXTA 4RLKA 2WMUA 4XV3A 2C6DA 1WFCA 3VJNA 5C27A 3HA8A 3ZSIA 4WA9A 3ROCA 1RE8A 2I0EA 4CNHA 3K5UA 2YM7A 4CGAA 5AP5A 3OROA 5J8IA 5J1WA 4FMQA 3ZEPA 3VF9A 4D9TA 2C3KA 3FYKX 2YIQA 3MH0A 3CJGA 3VW6A 4QPMA 2YCFA 4EK3A 4ENYA 4PRJA 4I4EA 4LFIA 1UWJA 4F7SA 3VBYA 4M13A 1Q4LA 4OTWA 3NR9A 4BHNA 4ERWA 4KBCA 3DFAA 3O7LD 5J5SA 5KZ0A 3BZ3A 2ZV7A 4C61A 4OT6A 1YHVA 4KIOA 4M69A 3ZXTA 4XG9A 3F61A 2Y4IC 3OEZA 4F64A 4A4LA 3ZLXA 1UVRA 3DPKA 4GW8A 4YUQA 3Q4ZA 3DB8A 3P7CA 4J97A 3R7OA 5ANEA 4YURA 4J53A 5ANIA 2HWOA 4D28A 5CASA 4CQEA 2GFCA 4R5YA 1URWA 4R5SA 4RA5A 3KVWA 3LIJA 1O6YA 5HCYA 5BUEA 2GNLA 4PL4A 3R30A 4P5ZA 2V22A 4F0FA 3OWPA 1JSTA 2Z7LA 3PRFA 2CHLA 4XRLA 4FEXA 1FMOE 1FVTA 4GFGA 1ZOGA 4BFMA 4AE9A 4RJ3A 3RCJA 2F2CB 1OKVA 2J90A 3EH9A 1OECA 2R4BA 3QKMA 3PUPA 3R21A 1ND4A 4UYNA 4LOPA 4QQ5A 2A19B 2Z7QA 2J9MA 4O7YA 3EQBA 3OC1A 4ZSAA 2ITPA 4C3RA 3PJ1A 3O17A 4LV8A 5KHWA 1KOAA 4F7LA 3R1SA 4YZCA 1NA7A 2B9IA 3HLLA 3OOGA 3QD2B 4NM3A 3TCPA 4LRJA 5L6OA 2QOOA 3GUBA 3QTWA 4RVKA 2QU5A 4CYIA 4BCMA 5HI2A 3HRBA 5EDQA 3VAPA 3FZOA 4EC8A 5GZ9A 3NGAA 4A06A 4WO5A 2RFSA 4YTFA 2A1AB 2E9UA 4PPCA 1E1VA 2C6IA 2PVYA 3SXSA 3FEGA 4HYUA 2PY3A 3K3JA 5KKRC 2VV9A 3V01A 3VC4A 4AW5A 4IAZA 3Q5ZA 1UKIA 4FNXA 3KCKA 3VULA 3H0ZA 1DM2A 5E8SA 3RZBA 2W1DA 4OTIA 5I9UA 3PIZA 3UZTA 4WKQA 2PVHA 4NEUA 3Q9YA 1WBTA 1I44A 5AFVA 3EMGA 3PXYA 3G33A 4MCVA 2HW7A 4DLJA 2XK3A 3RNYA 1ZZ2A 4ZZNA 1Y8YA 2WQNA 4OTRA 4BI2A 4FTJA 4NM0A 3R01A 4ZJIA 5B2LA 2YN8A 3GEQA 4LG4A 4BWXA 3GU6A 2BIYA 5AIRA 2VWIA 4ANBA 3KL8A 2GSFA 2VUWA 1H0VA 2W4KA 4FA2A 3EHAA 3LQ8A 5ANJA 4C57A 1G3NA 3U6IA 3DXQA 3TNIA 4ANQA 1OGUA 5A4TA 3MH1A 3TDVA 3QCYA 4O81A 2VRXA 4FG8A 2JBPA 3D4QA 4H1MA 4FKLA 3P86A 5HTBA 1NVQA 2JC6A 4RX9A 3CPCA 3F9NA 1TKIA 2XJ0A 3FWQA 3KA0A 3QLFA 4FSUA 4HGEA 5HOAA 4YTIA 3H9FA 3T3VA 3NSZA 5FRIA 2C5VA 2UW5A 3DKOA 3FAAA 5IZFA 2PE2A 3I60A 4FV7A
chains in the Genus database with same CATH superfamily
4XBUA 3CJFA 2Y7JA 4G2FA 2OZOA 5HU3A 4QP7A 4DGNA 4AAYA 2XYNA 5M4UA 3QTRA 1F3MC 2VD5A 3ZBXA 2QG7A 4FSTA 1OL5A 4L3PA 3G6GA 3BV2A 2OBJA 3F5UA 2EVAA 1Z57A 2SRCA 2JIIA 4FTRA 3SA0A 2JITA 4I4FA 4I22A 3JVRA 3V5TA 4N6YA 4OW8A 4MXAA 2C4GA 3M11A 4ASEA 4G6OA 1Q24A 1W84A 3L1SA 2WOUA 4WBBB 1NW1A 3BELA 5L8KA 4R3CA 3JR1A 5JT2A 3R71A 4UXQA 2OJGA 5EI2A 3PVUA 2GS2A 1OZ1A 3S3IA 4I0TA 3TIYA 5CEOA 3PLSA 5JGAA 5IEVA 3GU4A 4ANSA 3PLAE 5F4NA 3ZC6A 2G2IA 4WNOA 4RC4A 5BV3A 1B39A 5FWKK 3KK9A 3FXWA 1RW8A 2XKCA 2CMWA 5J5TA 3RM7A 2W0JA 5C8MA 5L8LA 4FV8A 4XJ0A 4CLIA 4J96A 3QZFA 4ZTRA 2X6DA 2OZAA 1O9UA 4CZTA 4NJ3A 2ZV9A 4YZMA 4AE6A 4K33A 4AU8A 1GOLA 2WIPA 3G5DA 1MRYA 4LOQA 3JY9A 4YLLA 1GIJA 3MFSA 3LCSA 3QKLA 1DAWA 3DBDA 3BHUA 4OGRA 4P4CA 4U97A 1V0OA 4J1RA 4DG2E 4E6AA 4NSTA 1YDTE 3LOKA 4CD0A 2WQBA 3R83A 4FG9A 3KXMA 5IDPA 2VAGA 4QTAA 5AR5A 4WIHA 4LGDA 4BZDA 4GIHA 2GTNA 2BAJA 2EUFB 3E88A 1PXNA 3KRWA 2FH9A 4C2WA 4I6HA 4ZLOA 5CNOA 3ZM9A 2Y8OA 1ZAOA 3CE3A 5CQWA 2B52A 2C3IB 2JDTA 3MN3A 4K1BA 3C50A 4PTCA 4ALUA 4NK9A 4PMMA 4Y5QA 2VWVA 3FMKA 1Q62A 3FY0A 4FNWA 5H2UA 4AACA 2XKDA 3KCFA 3RPRA 4O7ZA 5FP5A 3QTSA 5CEPA 2WZJA 1YOMA 2YAAA 3GC0A 1UNHA 4DBNA 1KSWA 3VN9A 4QQJA 3V5JA 4DFBA 1SZMA 4X2JA 5JZNA 4FL2A 3AG9A 5CZIA 5D7AA 3Q6UA 5HG5A 1P2AA 3UC3A 2PVLA 3C1XA 3QCSA 3WIGA 3NMUF 3R2YA 2OG8A 3QQJA 3VBXA 4AT5A 5H8BA 4D4SA 2BCJA 3MESA 3LCDA 2BALA 2ITVA 4AOJA 2DS1A 2EXMA 3I5ZA 3Q6WA 3CTJA 4U7ZA 3I0QA 1SVGA 4BJJA 4G3GA 1UU3A 3AMAA 3GCQA 3PZHA 4D55A 3QTXA 4JJRA 3ZS5A 3RAKA 5ANKA 3Q4TA 3KFAA 5F20A 3LXLA 3E8CA 3WZDA 5KMNA 2R3QA 1G8KA 3EFLA 2BAKA 5IUHA 2XVDA 2VTTA 3FI4A 2IW8A 4M7IA 5C9CA 2J0KA 3VRZA 1LUFA 5L4QA 5DG5A 3TNHA 2Z02A 3R63A 5IH5A 4CFXA 5BVNA 2E9PA 2PZPA 4QTEA 4FSWA 5BPYA 4PF4A 1XKKA 5AJQA 4S31A 1JAMA 1ZARA 3AOXA 1XQZA 4HVDA 5FUTA 4V04A 2VTIA 2QR7A 3BPRA 3BU3A 4NJDA 4A4OA 4ANNA 4I20A 3OUKA 4XS2A 1MQBA 4BYJA 4FEUA 3W55A 5E7RA 4XYFA 3BLAA 4KABA 2NP8A 5ANGA 3ATSA 2YIYA 4TYGA 5A4EA 4GRBA 4YZ9A 5AAFA 3LXKA 3ZU7A 4R78A 3A99A 4L45A 1Y6AA 1SVHA 4U0IA 4D2TA 3BI6A 3BL9A 5L2WA 4QQCA 4RFYA 1XBAA 4DHJA 3EQPA 2BDJA 5FGKA 4KRCA 2QC6A 3S2PA 4W4YA 2R7IA 4ITJA 1Y6BA 3O8TA 3WZUA 3NYXA 4BI1A 3O2MA 5DT0A 2QCSA 2PUNA 3CCNA 2VX0A 5EOBA 4MXZA 3FYJX 1Q41A 5EOLA 3WYYA 5CAQA 1OBDA 3D5WA 4MXYA 4QP6A 2HYYA 4P5QA 3EN4A 1NVSA 2Z2WA 4KD1A 3IECA 3UQCA 4B0GA 4FEQA 4FT7A 4LUDA 2CNUA 3ORTA 1MRUA 1W7HA 1FMKA 2OGVA 2C68A 2F49A 3BQRA 2WKMA 1BKXA 4AXAA 4UMUA 4C4HA 4DT9A 2XIZA 4AA5A 4GSBA 3L8XA 4C4GA 2OJFE 3TV6A 4FK3A 2QLUA 4BYIA 4X2FA 3SQQA 3FKLA 1YVJA 4X6RA 3SOAA 4YHFA 4EHVA 5CAUA 4MWIA 2AQXA 3A7HA 5CU3A 3FMMA 3D15A 4QNYA 2ZDUA 5JFSA 4GCJA 5KMMA 4MQ1A 2X0PA 4BVUA 4EBVA 1VZOA 5KMOA 5HO6A 1JPAA 2H34A 4TWPA 3UOHA 3OXTA 4NTSA 2GNIA 3ZFXA 4ZTMA 4HNFA 5EW3A 3TNWA 3MB7A 4RIXB 3H4JA 3OW4A 2J2IB 3MYGA 3QTZA 1NXKA 3CEKA 4K77A 4OLIA 3RPYA 1YXSA 3TIZA 3L9LA 3RALA 2OFVA 5HLWA 4JQEA 1R78A 5D11A 3L8SA 4BBFA 4HVHA 3DBEA 4TTHB 4JMQA 1QPEA 1MP8A 1XH4A 2UZVA 3BBWA 3ENMA 3PXKA 4OBPA 5DOSA 1A48A 1E9HA 4DH7A 2ERZE 2J0IA 1YOLA 2CJMA 2OIDA 5HVJA 3V6SA 2HY0A 3CC6A 2XJ2A 3VS7A 4DEHA 3H30A 2Z60A 3IKAA 2OIBA 3KRXA 4LRKA 2EU9A 3CD8A 4QP9A 4AN2A 4O21A 4AP7A 1YOJA 2ACXA 2W99B 4R7BA 2OXYA 3DXPA 4M69B 2BKZA 2R3KA 3RHKA 4B99A 4RLLA 3V5QA 4UZHA 2VU3A 2C6MA 5K0KA 5LARA 4AZEA 1KUTA 2UW3A 3UIBA 4FV4A 5D9HA 3TZ9A 1SVEA 4UN0C 4J99A 4AGUA 4JR7A 4YLKA 4GKIA 3DLZA 3E63A 3JVSA 3TXOA 4BDFA 3BU6A 1XBCA 4AAAA 4TYIA 4BDGA 2IVUA 5BYYA 2C6OA 5LCKA 5AMNA 4C3PA 2GDOA 2ETMA 2XKEA 1YWRA 1PYXA 1U59A 4IEBA 4ASDA 3SD0A 5BX0A 3W0OA 3HP2A 4H05A 4O0WA 1IRKA 4DT8A 5HIEA 1V0PA 3HUCA 3TKHA 4KIPA 4Z7HA 3GQLA 4FV0A 4JR3A 1YW2A 4R7IA 4BGHA 4CYJA 5CVHA 3UPXA 4V0GA 4IAIA 3ACKA 3O7LB 2Q0NA 2P2HA 4YJVA 5AAGA 4ACHA 4FKSA 4AGDA 3NUSA 4JBOA 4W8EA 1ZRZA 4QP3A 4BCGA 1Q8ZA 2ZMCA 5AV3A 4A9UA 2REIA 4BTJA 4PNKA 3P5JC 5KMJA 4DG3E 4BBEA 1Q3WA 2OH4A 3PDTA 2YIRA 1ZYSA 2DQ7X 4GUBA 3BWFA 4EOOA 5FP6A 1P5EA 3UQFA 3MB6A 1Q8YA 3QFVA 4DLIA 5K0XA 4L44A 4MBLA 4TN6A 4I6BA 5HU9A 3AC1A 1BMKA 2R3FA 5EQPA 5HTIA 4G34A 4QTDA 3F3WA 1SNUA 2OU7A 1PF8A 5DHJA 4C4FA 3F7WA 3CQEA 3LMHA 3OMVA 3V04A 4NU1A 2W1IA 4RC3A 3VUTA 1Y8GA 2UW4A 5CF5A 5HBJA 3LFNA 5K5XA 4LDTA 1WMKA 4W8DA 4JRNA 4H3BA 3F69A 5EM8A 3A7FA 3ORMA 5E1EA 1YXUA 3S00A 2R64A 2VTRA 5HIDA 4ID7A 2XH5A 2QVSE 3IW4A 4YBKA 2P3GX 3NEWA 5J9LA 3FLZA 4IWDA 2FSMX 2VO0A 3RINA 3TJCA 2XIYA 3R9DA 4AZWA 4N4SA 2X0GA 4XG2A 4YC3A 4JBQA 4O7LA 1M52A 4I5CA 2HCKA 4LMNA 4DH8A 3Q9WA 1LEZA 4TWOA 4HJOA 4B8MA 3OEFX 4EHEA 1NY3A 3GCSA 5HNBA 1FGIA 3HMIA 4O83A 5J95A 3P78A 5HCZA 4A9SA 4MXOA 3N9XA 3ULIA 4AW1A 3HYHA 4X3FA 5EHYA 3ANQA 4M8TA 4QEBA 3Q04A 2YM4A 2G2FA 1Q61A 2R3NA 3ANRA 4BTKA 5CX9A 2V55A 5L6WL 4IDVA 2RG5A 4FICA 4GV1A 4RQVA 5CI6A 5E8XA 4DEBA 3QRTA 4I24A 2XRUA 3GNIB 3QTQA 4H39A 3TNPC 2QOQA 3AGLA 3MH2A 4AF3A 3KB7A 4FTUA 5AR7A 3Q53A 4GMYA 5BVEA 3MI9A 4RVLA 4USEA 5JN2A 2O3PA 4FYOA 4USFA 3R8UA 3HL7A 3PTGA 4G3EA 3NYOA 4ENXA 1OPKA 3CS9A 3PG1A 1V1KA 3NUXA 4E6QA 3MGYA 5AV2A 2VWZA 1YXVA 4ITHA 1YXXA 2WTKB 5GHVA 4I3ZA 1WVYA 3Q2MA 3A2CA 4FKUA 5CLPA 4EH5A 3FQEA 4JIKA 5FM2A 2OH0E 4KSPA 4WG3A 3PE1A 3LFSA 4A9YA 3FZRA 4I1ZA 3D7ZA 4AT3A 3VUMA 4E20A 2IPXA 2X8DA 5M4IA 3H9RA 4W4WA 5CI7A 2OZAB 4BCOA 2C3JA 3FLYA 1ZZLA 4I92A 3D2IA 4L6QA 4WSQA 4ZSGA 4BKJA 1AQ1A 4QMYA 3LFFA 2F7EE 2ONLA 4S34A 1H28A 2UW7A 3QCXA 4GH2A 1WBNA 4G3FA 4Y83A 5E91A 5TKDA 3SC1A 4YR8A 4IJ9A 4K11A 4NCTA 4HPUE 4QMTA 4M3QA 2XNBA 3RK7A 2O2UA 1BL6A 4BCNA 4PMSA 3BYSA 4AQKA 3NDMA 3EWHA 2AC3A 1WBOA 4I6QA 5AA8A 4KKGA 2CKOA 1W2DA 3IQ7A 3HNGA 3COIA 1JKSA 1JLUE 4JL9A 4TWCA 3NUYA 4LM5A 3PY1A 4I6FA 4IXPA 2NO3A 4O6LA 4IADA 2JFLA 3MPTA 3A4PA 1W2CA 2JGZA 5CSHA 1APME 4OTGA 4OAVB 5E8TA 1YI3A 2WMBA 2R2PA 4M84A 4M67A 2GHGA 2OK1A 2QOHA 4ANLA 1IA8A 4HW7A 5IPJA 5C03A 4ALWA 4PDSA 4ZS4A 3R2BA 5C8NA 3O96A 3R0TA 3QAME 5BYZA 5E8UA 4FIHA 1XR1A 2PZ5A 5AUWA 1OUYA 4N6ZA 4JIAA 4N0SA 4YGAA 1H07A 2PE1A 3MA3A 1OM1A 3AT4A 4G9CA 5BVDA 3SVVA 4JG6A 2V7OA 4QYEA 1R3CA 4U5JA 4M14A 2BZKB 3C5IA 3VHKA 2ITUA 1CKJA 4HCUA 4IWPA 4BCKA 3ORIA 2KTYA 4B9DA 5HG9A 5IEYA 4BJJB 5EI6A 3QU0A 2R7BA 3FXXA 4FZDB 3U9CA 4DYMA 5L3AA 2ITTA 2HZIA 2PMNX 5M44A 4UB7A 5K5NA 2PU8A 2X2KA 3QC4A 4IX3A 3BEAA 3GGFA 4GK3A 3A8XA 5H8GA 4ZJJA 2Q83A 3PXRA 4A4XA 4FV2A 5D7VA 1U5QA 4LUEA 2EB2A 2YM5A 1QL6A 1W2FA 2WEVA 2YIXA 3QZHA 4O2ZA 2Z8CA 4DG0E 3TMOA 4P90A 3GOKA 2WTVA 3I5NA 4C34A 3SOCA 3ZO3A 1U4DA 3R8PA 4FJVA 4IAAA 3U51A 4E5BA 4L53A 2A27A 1OUKA 3G90X 4X7QA 2Z7RA 4YMJA 4QMVA 2WMAA 3P0MA 5FXQA 4EOIA 5J7HA 1HOWA 4BF2A 2IZTA 5IA4A 3IW6A 5FG8A 4C7TA 2XKFA 4EUUA 3A7GA 4MD9E 5L2SA 4HGSA 5E8YA 4O1OA 3R8LA 4RWIA 4K6ZA 5G6VA 2UZNA 4N70A 3OW3A 4D5KA 3OXZA 2OI4X 3KRLA 1PXKA 3RMFA 1Y57A 3FKOA 3UDTA 3UDBA 2R3HA 4CV9A 5A4QA 5CWZA 4F70A 3W2QA 3OUNB 4MBJA 4KIQA 2YWPA 3O51A 3PJ8A 1XH7A 3NW5A 4XNEA 5TT7A 2XCKA 3UYSA 2VTSA 4MKCA 3BYMA 1HCKA 4ZLYA 3L9PA 4FKWA 4RIYB 4YZDA 5HO8A 3RBWA 5JH6A 1ZYJA 2XIXA 1FGKA 1PW2A 4X3JA 5IA0A 1FPUA 3N51A 5JSMA 4RQKA 4EK5A 3ALNA 1W8CA 4G1WA 4Q5HA 4O38A 4BTFA 3KIOC 3OXIA 3R9HA 5ITAA 1PRYA 3WF5A 4B8LA 3P7AA 4GT3A 3OCTA 3TI1A 5J9YA 4FKRA 2GNHA 4CT2A 2B0QA 3OCGA 4RFMA 1W82A 3Q4UA 1GAGA 3ZBFA 1ZMUA 4MNEA 5FDPA 2B55A 5K4IA 4F08A 4HVGA 2C6KA 3BGZA 4ZXTA 4AA4A 1IA9A 4KKEA 3IG7A 3PA3A 4RX7A 4TWNA 2PMLX 3VBWA 4CLJA 3PSCA 5HZNA 4WNMA 1CSNA 3FY2A 3NIZA 3C51A 3VS0A 4WOVA 2I7QA 4O0YA 4O6EA 2GFSA 3K3IA 4YBJA 2JAVA 3AKJA 5CAPA 4DINA 4GYGA 3G0EA 3HGKA 2WMWA 2HK5A 3WF7A 5G1XA 5JRSA 5CEMA 3NCZA 3GC7A 4I0RA 4ZJVA 4F6SA 2A0CX 4DCEA 2V5QA 5K3YA 4YO6A 4QMLA 2F7XE 4ZLZA 3F3TA 1XH6A 3ITZA 3RWPA 4DH5A 5A4CA 3FMNA 5CF8A 4IX4A 3CIKA 3OP5A 4PY1A 3ORXA 2BFYA 4BWPA 4FF8A 2JIUA 2J6MA 3SAYA 3ML1A 1MRVA 4H58A 4F78A 4UALA 4Z7GA 3PJ3A 3U87A 5EK7A 1YRPA 3D5XA 3T9TA 4EHGA 2C1AA 5HD4A 5DH3A 5K4JA 3UZRA 5AP6A 3VONA 1PXIA 1YI6A 3OZ6A 3QUPA 3TJDA 3ZUVA 5E92A 3UJGA 3GVUA 1IG1A 4BCHA 3WIKA 3MPMA 4KRDA 3HX4A 2FA2A 5KZIA 4YZBA 4YTCA 5E9EA 2Y4IB 1EH4A 2JDSA 2EWAA 4AX8A 2XA4A 4EWHA 4U42A 1GZOA 1R0PA 3JUHA 2JDRA 2XK6A 4CXAA 4TYHB 3BE2A 4X2NA 4D2PA 3NUNA 1KOBA 2WMQA 2BRBA 4NM7A 5E1SA 4EC9A 2VWXA 5HVYA 4IB5A 5HG7A 4EQUA 2J5EA 2ZM3A 1H1WA 3QX4A 1XJDA 3OCSA 4J71A 2Z7SA 3KXZA 4CFMA 3HV3A 2GQSA 3R8VA 5I9XA 1TQPA 5J87A 4XMOA 4EOMA 5EKNA 2GS6A 2OIQA 3A4OX 3P08A 3CGFA 4HGLA 4P2KA 3P23A 4JDHA 4O1PA 4QMZA 4QMXA 4YHJA 4PL3A 4DFLA 2CNQA 3MJ1A 3WF9A 4MXCA 2QOLA 3MJ2A 4WT6A 3RNIA 4EOLA 5JZJA 4V0GB 1MUOA 2OSCA 2C0IA 2ITWA 1H08A 2YCSA 3R7GA 3DFCB 2BZHB 3BWJA 3QTIA 4Q2AA 2ESMA 1M2RA 2XRWA 4L7FA 4ZSLA 4EBWA 3P5KA 4KA3A 5CAVA 1K3AA 3CR0A 4GK4A 5DVRA 4Q5EA 3LHJA 4BTMA 2BDFA 2OXDA 3GFEA 4IANA 5IISA 3QUEA 2XK4A 3SG8A 3CKXA 3NRMA 2VGOA 3KC3A 4S32A 4DEAA 2PZYA 3F3ZA 4LOOA 4O4EA 4R3PA 5D10A 3R1NA 3VBTA 3VS1A 4BCIA 4C59A 4FEWA 3ORKA 4JXFA 4GK2A 4OTHA 1OPLA 3UO4A 4XX9A 5HBHA 3WZJA 2HZNA 5CU2A 4AN3A 3BHVA 5IMEA 1JNKA 1JWHA 1PMNA 1YKRA 4G16A 5HX6A 1PMEA 4OBQA 5AWMA 4UX9A 1O6LA 5I9ZA 2CLXA 1J7LA 4YLJA 2AYPA 2XIRA 3SW4A 3EB0A 3A62A 3C9WA 2QQ7A 4F6UA 1HCLA 5A6NA 3FV8A 4O86A 5AM6A 3UO6A 5C4LA 2Y9QA 2YZAA 2H96A 3F3UA 5M07A 1VYWA 4XHKB 4BC6A 3GC8A 5HNGA 4DGOA 4UYAA 2ZDTA 3UGCA 2UW8A 3GCVA 4HYSA 3ZSGA 5A14A 2PVJA 2WIHA 3EL8A 4DFYA 3SXRA 4AW0A 3OOMA 3PA4A 2WQMA 1TQIA 4O0TA 5CF4A 3R7YA 4FTTA 3DV3A 2NNWB 3MWUA 5KO1A 1OI9A 5I9WA 3LCOA 4QMUA 4QMPA 3KF4A 4YNOA 4CFUA 3R1YA 4FSZA 3KN5A 3NFFB 4KS8A 4JNWA 4ZP5A 5BVFA 3QD4A 2X39A 3N4TA 4WUAA 4IACA 4G3DA 3W8LA 4FZ6A 3ZEWA 3LQ3A 4CCUA 3POOA 5ACBC 1JBPE 3BIZA 4U44A 5IQHA 5JRQA 4FUXA 3AC5A 1GZ8A 5F95A 4BZOA 3BLHA 3WF6A 2PVMA 4O27B 3ALOA 1H8FA 4X3FB 2B9FA 3B8QA 3EIDA 5EQEA 2ITYA 3KULB 4GT4A 2BIKB 4BCPA 4R8QA 3QZIA 3MFRA 4FR4A 3UVPA 4BKYA 5AUTA 3ELJA 1PXPA 3QRKA 4BICA 4ZAUA 1WVXA 3FLWA 3U54A 4D1SA 4GFMA 3UNKA 2GNFA 2YZLA 1H26A 1P14A 1PJKA 3DA6A 4CMOA 4ZZOA 3TG1A 2JIVA 4RZVA 4AXCA 1JKTA 3B8RA 5CVGA 1OL1A 5ACKA 2R9SA 4G17A 3V5LA 2ZJWA 1DI8A 2BVAA 1P4OA 3KF7A 3Q60A 5L8JA 4CQGA 2R0UA 3TKUA 4N57A 3VS6A 4UMQA 4F09A 5AM7A 4JX3A 3V6RA 5M57A 5IQDA 3H9OA 5ICPA 1A06A 4OUCA 4ZOGA 4B4LA 2C6TA 3TWJA 2PVKA 3T3UA 4HZSA 5A3XA 4X6QC 5A6OA 4I0SA 3E7VA 3AMBA 4LQMA 5AUXA 4CTBA 3C4EA 3LFEA 4O7VA 2XNOA 4NL0A 4PPBA 5I4NA 2OF4A 4MF1A 4O0UA 2R3RA 5T3QA 3ZTXA 4ARKA 2O5KA 2IEWA 3IONA 2R3PA 4RJ5A 4RVMA 4BDIA 3PSBA 4CFWA 1ST0A 3IPHA 2GNGA 2YCQA 4GG7A 2JKQA 3W18A 2IG7A 1LP4A 5FEEA 3T8OA 1U54A 4CFNA 2RGPA 3D7TB 4F9YA 1YWNA 5HD7A 3FLNC 3WARA 3E62A 4RX5A 3C13A 4FV1A 5F1ZA 4G3CA 4W4XA 5AX9A 3VQHA 4B7TA 3KRRA 2RF9A 4RWKA 4FZAB 4ZS0A 3FI2A 3MTLA 3R73A 4FIIA 2VX1A 1GIHA 1VR2A 1W83A 1S9IA 5DEYA 4FSMA 4ALVA 5KUPA 3ODYX 4KUJA 4U9AA 2ZMDA 2I6LA 1K9AA 3H10A 2P4IA 4C0TA 5LMKA 3TUDA 4FGRA 4H3QA 4DCAA 3FE3A 2XK7A 1V0BA 3F5PA 5AUYA 2QI8A 1IEPA 1KE7A 1L3RE 2J0LA 4IVAA 3LCTA 3VVHA 2FSOX 1IAJA 3TTIA 3FSKA 5T68A 5AP0A 4GL9A 3M1SA 3W0PA 3DU8A 5LVPA 5M09A 3DAEA 3NVMB 4I93A 4NH1A 3MTFA 4E4NA 1JQHA 4D2WA 4EH3A 4Z55A 5DA3A 1ZYDA 3E8NA 4IH8A 2I0YA 2W7XA 4M15A 2FSLX 3KXXA 3LMGA 4WD5A 4O4CA 2YISA 1ERKA 4RBLA 4XOZA 4EORA 1YHSA 2YDKA 3DKFA 3PG3A 4XCUA 2R3JA 2I40A 5JGDA 3R8ZA 1R1WA 4MH7A 3SXFA 4ACMA 4QMNA 3DK3A 3CXWA 4X0MA 4XG3A 3QWKA 3RHXA 3KK8A 4L52A 4EWQA 2ZYBA 2PSQA 4FTMA 4L3JA 4UZDA 4U79A 4RIOA 4YJTA 3C4XA 4CKRA 3ZFYA 2P55A 4RIYA 2CKEA 2ZB0A 4F9AA 3HUBA 3FPQA 4E4LA 4M66A 4YP8A 3I7BA 4RJ8A 4AG8A 4DITA 3T9IA 4EHZA 3HV4A 5EW8A 2WU6A 4D0WA 2IWIA 4TZRA 3LFBA 2CKQA 2W1EA 2EB3A 4L67A 2HWPA 3WZKA 3UO5A 3NYNA 4FBXA 4PWNA 3VO3A 4TNDA 4UXLA 4JG8A 4BDHA 4FT3A 5FEDA 2YJRA 3UOLA 3FL4A 3LW0A 4XG8A 4DTKA 4GT5A 3PUFC 2QKRA 2B9HA 4F63A 4L46A 1BX6A 3VUGA 3U4WA 4ZIMA 4NW5A 3C0IA 4FIGA 3TDWA 3POZA 4Y46A 2WMTA 4YJUA 2UW0A 2VWWA 4LL5A 3EQCA 4CZUA 4YNEA 2NYAA 2OF2A 4FV6A 3MV5A 4XP3A 2WMXA 2CNVA 2E2BA 1XWSA 1M17A 3JS2A 4DFXE 5E8ZA 1OL7A 4NFNA 4BDEA 4TY1A 1ZYCA 5LVLA 1KWPA 4LMUA 2ITQA 4FIFA 3ZRKA 3HZTA 3W1FA 4FKPA 3RKBA 2F4JA 3Q52A 2V62A 3PXFA 5FEQA 2O63A 1TVOA 3PE2A 1PY5A 5CSVA 4MNEB 5FXRA 1L8TA 3ATTA 4GVJA 4WRSA 3UDSA 3WBLA 1PHKA 2JKKA 4FKQA 3EZRA 4RGJA 4RX8A 4E8AA 4PV0A 3U6HA 4I23A 4A7CA 4M0YA 3GCPA 3DBFA 3IO7A 3KMMA 2WTIA 3DDQA 3EQIA 3L9MA 4FL1A 2QU6A 3EKKA 4G6LA 4ZK5A 1H25A 3UMXA 1OBGA 4BCJA 2W17A 2NPQA 3CQWA 3EFKA 3MA6A 2B7AA 5TOZA 1DAYA 3ROYA 4IB0A 4JG7A 3HP5A 4YJSA 2GU8A 2CGXA 3DXNA 4OBOA 4TKSA 5AP1A 4XUFA 2F7ZE 3PPZA 4FTCA 4UWCA 3U8WA 3CSVA 4EONA 2X7OA 5CVFA 2W9ZB 2OKRA 3FZTA 3KN6A 5A54A 2BHHA 3A60A 4XV9A 5GJGA 2UZUE 2VZ6A 3GCUA 4KWPA 4WNKA 1KE9A 2I0HA 2ITZA 4ZTNA 3UP2A 4TYHA 3F5XA 3C4WA 2BTSA 4FTNA 5EYDA 3RK9A 5FD2A 4ZEGA 5HICA 4UY9A 5IQAA 1UKHA 2X0OA 2PL0A 3MVJA 4GVAA 3DT1A 2YAKA 3Q9XA 4FGBA 3VW8A 3FHIA 3FMJA 4EEVA 4DHIB 3CY2A 4I41A 3D0EA 1LPUA 3PRIA 2WTJA 3FLSA 2PUPA 1J7IA 3PVWA 5H9BA 4IE9A 5AV1A 4AWIA 3TN8A 4DHFA 2IO6A 4ACCA 2XB7A 4F6WA 3ZZEA 1R39A 3ZDUA 3F88A 5IH6A 2QLQA 3V5PA 4R3RA 3LPBA 3WE4A 5LMBA 2X7FA 3EFJA 3Q32A 4S33A 4O22A 5A9UA 2XNMA 1WBWA 2XZSA 2J7TA 2VGPA 4JAJA 5DE2A 5FM3A 4FC0A 2J5FA 3W0RA 1REJA 4K2RA 2X8EA 3FI8A 3R7IA 1CDKA 3CP9A 3NW7A 3F82A 3AGMA 3M42A 5CYIA 3CTQA 3KU2A 3PPJA 1LR4A 3LFCA 5M51A 3KVXA 4J8MA 3F2NA 5DFPA 2QG5A 3LJ2A 3E3BX 3NX8A 3F2RA 1H4LA 3LFAA 3HA6A 3ORLA 1OIUA 3R22A 2H6DA 4QPAA 4DN5A 2XYUA 4KIKA 3RGFA 1RJBA 3FL5A 5EHOA 4FT5A 5I5ZA 3FJQE 4O84A 2C3LA 4C8BA 1QPDA 2W5HA 5JEBA 4YPDA 3KXNA 3QQUA 3LE6A 5AR2A 1RQQA 2XK9A 3QWJA 2G1TA 2UV2A 5CT7A 4NIFA 2VO3A 4DGMA 1OIQA 3A8WA 3BQCA 3RZFA 4YJQA 5CU4A 3C4ZA 4FTKA 4DH1A 4IC8A 2H9VA 3V8WA 4QT1A 4QYYA 3HVCA 4O0VA 4G9RA 4FOBA 5M06A 5IMXA 4BI0A 3GB2A 2IZRA 4FKIA 3PFQA 4IWQA 1P4FA 5LJJA 2OXXA 1QCFA 4APPA 3TZMA 4F9WA 4NW6A 4J95A 3DCVA 5TO8A 3SV0A 3MDYA 1VYZA 4QQTA 1J3HA 5CS6A 3ET7A 4HGTA 2JFMA 4E1ZA 3E64A 4ZTHA 1DS5A 4U8ZA 3SRVA 5CF6A 2YIWA 2R3GA 4HVSA 4BKZA 1UU7A 2VWYA 3AXWA 2GQGA 3MS9A 2R0IA 4JS8A 5EM7A 3BEGA 3I4BA 4AXFA 4IM0A 3KULA 3OT3A 4ACDA 4CRLA 4BB4A 4AZVA 3DJ7A 3DZOA 3FHRA 4IBMA 3NFGB 5D12A 5ETIA 5DWRA 3RAWA