4QO9A

Mst3 in complex with danusertib
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
281
structure length
280
Chain Sequence
b'ADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 280
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qo9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qo9A01
3TL8A 5AEPA 4GV1A 4BGQA 4QP2A 5HU3A 2R3HA 2E9PA 2XM9A 4BI0A 3GC9A 4C4HA 4GH2A 4L52A 3F5PA 2ZMCA 5AP5A 3ALNA 4QMMA 4DFUA 4BB4A 3TG1A 5HE3A 5A3XA 3DXPA 3MPAA 3W8LA 3QQFA 5HE0A 4U81A 3THBA 5DEYA 5EK7A 3NYOA 4BHZA 3GT8A 2YA9A 5A4CA 5DH3A 3GCVA 3NNUA 4ZLYA 4K8AA 4IXPA 3FY2A 4JJRA 4RLKA 5LARA 3SG8A 5KO1A 4A9SA 4YO4A 3VS6A 4UBAA 5LVLA 5M08A 3D7TB 1MRVA 3O2MA 4BTMA 4UMRA 4HNIA 4USEA 5ICPA 4FKUA 2NRYA 1J7UA 2QODA 4BDFA 4FTUA 5DEWA 3RPVA 3JVSA 4BZDA 3E3PA 4CV9A 2R9SA 2RG5A 3DY7A 5J87A 3NVKI 3PYYA 2B0QA 4FSTA 4FV2A 2FA2A 4HCVA 1M17A 4G6OA 4CRLA 3C4FA 3E63A 3VVHA 4B99A 4R6VA 4F6UA 4PMTA 4O7TA 4LL0A 4KIKB 5FM2A 4LFIA 5L2QA 3PP1A 2XK8A 4JX3A 2CLXA 1YDSE 5DR2A 5EQYA 3QRJA 4XJ0A 5AAEA 5HNIX 1K2PA 4RQVA 4ACGA 3KCKA 5CSHA 4RZWA 5DT3A 2XYUA 3UTOA 3D5UA 3P4KA 4FTNA 2GHGA 3AC8A 3GVUA 3MH1A 1UA2A 5EYKA 4BL1A 2C6MA 3FLQA 1J7LA 3W8QA 3PG3A 3Q4ZA 3QRTA 3F5XA 5KZ0A 5FXQA 5GIOE 4AZVA 4C02A 3ZO1A 5LCKA 2C3LA 5T3QA 3LJ0A 1STCE 4QT1A 3NCZA 2VO3A 3OTVA 3UBDA 2ZMDA 2Z02A 1H0VA 4BTFA 4QQCA 4RA4A 2OGVA 3RZFA 3DTWA 3V51A 3CGOA 2IO6A 4MF0A 4FX3A 1WBVA 5A14A 3RAHA 2W99B 1JBPE 5AUWA 2DYLA 1YKRA 2G2HA 2QOLA 5DN3A 3KMUA 5HZNA 3SW7A 1H27A 4HYIA 2YM3A 4RJ3A 4ITIA 2GMXA 3QXOA 4HOKA 2HELA 4IW0A 5HNGA 3UYSA 4CFMA 2O0UA 5JRQA 1UWJA 3KK9A 2R4BA 5CNNA 3UP7A 1PRYA 2WTKC 4QTDA 5A9UA 2O3PA 5AP6A 3OROA 3Q4UA 3ZCLA 3QD3A 2VWXA 1KWPA 5CEIA 3F6XA 4ZY4A 1P14A 1ZAOA 3ID6C 1VEBA 1OVEA 4BICA 4GEOA 1L3RE 2HIWA 2V22A 2WTKB 4FSMA 2OFVA 4MWIA 5ETCA 5AP0A 4ONAA 5IA5A 4JXFA 4CMOA 4GW8A 4G9RA 4PMMA 4F6WA 2BROA 4QP1A 3RNYA 4YJTA 1NY3A 3KB7A 2YIXA 5E8VA 5DOSA 2YZAA 1UNLA 2X0GA 5JGBA 1F5QA 5HG5A 5AFVA 3QGYA 5E8ZA 1XBAA 3WZJA 2UVXA 2W1HA 3W32A 4GJ3A 4IX6A 4MXCA 3UQGA 3R04A 2Y4IC 4QPSA 4XV9A 4BTKA 5CAPA 3ZFMA 4XP2A 4DH7A 3QD4A 2Y6OA 2Y4IB 4IJPA 4FL2A 4JIKA 3S1HA 2WU7A 3D7ZA 3EJ1A 2XNNA 3NNWA 4XRLA 3UO4A 4TL0A 3EQPA 3ZRLA 4TWCA 1YDTE 3BGPA 3FLNC 3NZ0A 2C5VA 5AP3A 2VX1A 4XCUA 2G01A 1Q3WA 4J96A 2J51A 4YURA 5CWZA 4FEVA 3C50A 2IVSA 2OW3A 3ATTA 4W8DA 4APCA 5H9BA 2R7BA 4X2NA 3P79A 5HE1A 4BWXA 2QCSA 4IWDA 4P5QA 4FT0A 4WKQA 5H8BA 2W1FA 4Y5HA 3PJ8A 2IZRA 5CS6A 3I81A 1GJOA 2P2IA 5M56A 2QOKA 2C0TA 2JKMA 2XJ1A 2R5TA 2XKCA 3KXMA 4WO5A 2EU9A 4RPVA 4O83A 4O6EA 3OF0A 5IZFA 3UZPA 2X8DA 2BZJA 3TTJA 3A61A 5FLFA 4HPUE 3Q96A 2J5FA 3PJ3A 4G9CA 3KRXA 3GQLA 3KXZA 3LMGA 4FEQA 1PHKA 3ZOSA 2QOQA 2VTNA 2FYSA 3DBFA 3ATSA 4YJPA 4DFBA 4I5PA 5D41A 3KQ7A 4PPCA 2JDVA 4KBKA 4D4VA 2CNQA 2G2FA 2XH5A 4RQKA 5LOHA 2C5OA 5CEKA 3NUPA 3ZRKA 4AGDA 1Z9XA 4DGLC 2F7ZE 3NUSA 2W1GA 3TNIA 3MIYA 2FSOX 4C59A 4U45A 2C3IB 4MD8E 3O8TA 4NFMA 3KCFA 3R8VA 5CYIA 4R1YA 5HESA 1G3NA 2Z7QA 5L2IA 2VTRA 3BEGA 4WIHA 3WZDA 3ORIA 4AP7A 5CSPA 2WXVA 4RVMA 3NUAA 2I0YA 3EQFA 3CKXA 3QC9A 4NWMA 2WEIA 4WNPA 3RGFA 1ATPE 3VNTA 4CZYB 4W4WA 5IMXA 1UU9A 5ETFA 3FI2A 3AD4A 4EQUA 4JG7A 5HORA 1ND4A 3AC3A 3QALE 3PA3A 4O91A 4U41A 3KN6A 4FTQA 3SLSA 5IEYA 2PVFA 4J53A 5KNJA 3GFWA 5CU3A 2Q0BA 2W0JA 3VF8A 3PPJA 3WF5A 3ZHPC 3CQEA 3COKA 2WOTA 3F88A 5EHYA 3SHEA 2HW7A 4P4CA 3V8SA 1W83A 5ANKA 3HMIA 3Q9WA 2R3RA 2V7AA 4UZDA 5E8SA 3QCXA 4OAUC 2X7GA 3BCEA 5J5SA 3AC1A 4E7WA 3CTHA 1FVVA 4L3PA 1NA7A 2R3IA 3KF7A 4W9XA 1P5EA 2XK6A 4XOZA 3EFWA 3QYWA 3VC4A 4I93A 2PE0A 2W1DA 5K5NA 4FTLA 3T9TA 5DI1A 2UZEA 2OZAB 3GCPA 3MFSA 3BELA 2BAJA 1VZOA 1XBBA 2CHLA 2CKPA 5IQBA 5G6VA 2WQMA 2X81A 5CZHA 5BMMA 5E92A 3REPA 4FGRA 4DBXA 2CCHA 4UB7A 2PK9A 3IW5A 4MEDA 2OH0E 3Q4TA 4FTKA 1WFCA 1NW1A 1KOAA 3NUXA 2HY0A 4G34A 3F3UA 3VUMA 3NW7A 2E9UA 3GQIA 2JFLA 4CZUA 2HXLA 4MQ1A 3HV5A 5BVKA 4FL3A 4B8MA 3EQIA 4FMQA 2QLUA 4O0VA 1KE6A 2JKOA 4QYHA 5CALA 4F65A 1U5RA 1IA8A 3R2YA 1OPJA 2W1IA 2XCHA 5CU6A 4CGAA 1A9UA 3AC2A 4F08A 4EH3A 3U6IA 4C57A 3UVQA 4E8AA 3P0MA 2PWLA 5HEZA 3PXQA 2OIBA 2XJ2A 5KUPA 2UW0A 4RT7A 5BVWA 1EH4A 2NPQA 4Q5EA 4AFJA 2BTRA 3QZIA 3MI9A 4CG8A 3ANQA 5EFQA 1B38A 2YCRA 2CJMA 2XIZA 4NM7A 3V3VA 4B7TA 5K9IA 3V5WA 4JOAA 5FWKK 5AV3A 1NT2A 3R1QA 5JKGA 3HV6A 3LJ2A 5C01A 5AV2A 4MHAA 3KULA 5I0BA 3FPMA 4DHFA 4HGSA 3OUNB 4YLJA 1KV2A 3LCSA 4TNBA 1PXLA 5CQWA 3LFBA 3VUDA 4AAAA 1QL6A 1WVWA 4IM0A 3QKLA 4RVKA 2F49A 2RFDA 1UKIA 3OCBA 5AUYA 5IDNA 4CRSA 3BYSA 5J9YA 4O27B 2XBJA 3G2FA 1UKHA 1WBWA 3VHKA 4OBOA 4FT7A 4EKKA 5B2KA 5KE0A 5E91A 2BRGA 3UO5A 4IFGA 4NCTA 4WA9A 2VX0A 5F1ZA 1H28A 5HLNA 3QUDA 2C4GA 2C1BA 3HA8A 4Z3VA 3QX2A 1OL7A 4RIWB 5DFPA 5GJGA 5A4LA 4Z16A 2PMIA 5D10A 3D0EA 2GQRA 3A7GA 3DBCA 3OHTA 1GNGA 4DF3A 2PVMA 4R3RA 3VJOA 4FYOA 3T3VA 5FEEA 5LMKA 1LR4A 4FL1A 3U6JA 4K18A 2C5XA 3LFSA 3ZC6A 1XKKA 3A8XA 3CE3A 3MDYA 1AGWA 5AP4A 4QMSA 3R7VA 1IRKA 2WMXA 3HUCA 3V5PA 3R7EA 5G1XA 4ARKA 2ESMA 3PY1A 5CF4A 3OBGA 4MKCA 3ZUVA 5DE2A 1OUYA 4AA5A 2CNUA 3ENMA 3OT3A 3HL7A 4BTJA 5KBRA 3QLGA 5TOZA 1OIYA 4XV1A 4YJQA 3O0GA 1MQBA 4LGGA 5EQPA 5CSXA 3AD5A 3DT1A 5FUTA 5I9VA 5I9WA 4LRKA 2VGPA 4CV8A 4D58A 2VWUA 3ZFXA 1ZYSA 4RA5A 4QD6A 4U8ZA 2ITQA 5DVRA 3PJ2A 3OP5A 3HLLA 4F0GA 5L6PA 4N57A 2XIRA 3FE3A 5GINE 3WF8A 2XKFA 2XVDA 2V55A 4WT6A 3RWQA 4EK8A 5EM5A 2GU8A 2V7OA 3KL8A 5FGKA 5IUHA 3Q2MA 4YHTA 4EH8A 2W5AA 3K5VA 3SDJA 4AN3A 1HCLA 2XRWA 3AC4A 4D5KA 4EH2A 4D1SA 2IN6A 3MVHA 3V8TA 5AUXA 4FZDB 4KSQA 2YFXA 1GZOA 2FSMX 2C0OA 2KTYA 2UZVA 4I6QA 3VQHA 1PMNA 3W2CA 2PULA 4EWQA 3F7WA 3TI1A 3JY9A 4QMUA 5I9XA 5AR5A 4FNYA 4A07A 5D9HA 2CDZA 4UWBA 3MYGA 1FMKA 3E8DA 3OY1A 1XH5A 3UJGA 4EH6A 5AV4A 3E87A 3DJ6A 3K54A 2XNBA 4JQ7A 1M7NA 2GPHA 4QMLA 4QYEA 2DQ7X 4HCUA 1OZ1A 2W17A 3NIZA 4W8EA 2E9VA 3UIBA 1U5QA 4XUFA 4USFA 5CANA 4D4SA 3KRJA 3VW8A 4QP7A 3VW6A 3BYUA 4AX8A 4F7JA 4HVHA 4DT8A 4BCIA 3ITZA 2OI4X 4L6QA 4V0GA 4FT3A 2BRBA 4N4SA 4IB3A 3DFCB 3ZH8A 5DIAA 4FTJA 3TEIA 4C0TA 3AMBA 2Y7JA 1KUTA 1BKXA 4FTOA 4YU2A 3IDPA 1WBOA 5B2MA 4RIYA 4WSQA 3RHKA 3RWPA 2EWAA 3C9WA 2X2LA 4QP6A 4QTBA 3CP9A 4QMYA 3GU4A 4AW1A 5FEDA 4E4MA 3L8SA 5BVFA 3SAYA 1W82A 3D94A 3ORNA 4RVTA 4QQTA 3WYXA 1ZZLA 1FMOE 1MQ4A 3W2QA 3C0HA 1GZNA 3DS6A 3R30A 4JRNA 2DWBA 4KD1A 1FGIA 3HZTA 4XX9A 5AUUA 2ZB0A 2JAVA 2XMYA 3ZLXA 1WBPA 2XEZA 1Q8TA 1JSUA 4BCQA 2VZ6A 5HIDA 4D0WA 2V62A 4FKVA 4D28A 4NZWB 3NR9A 3UIXA 5EYDA 2FB8A 5DLSA 1YI4A 5IQIA 2QO9A 2YCQA 2XNOA 5DRBA 2GTMA 3CQUA 4D2SA 3WBLA 5CSVA 4O2PA 4MBJA 5KBQA 3R9NA 4IX5A 4PUZA 3TNWA 1CM8A 2YIRA 4CFFA 3P23A 4RWIA 1JLUE 5HBEA 4M7IA 4GFOA 3ROCA 3OXZA 5E90A 3KREA 4YNEA 2BMCA 5I9UA 3CY2A 4EOLA 5C4KA 3AT2A 4UXLA 3FQSA 2XZSA 3QWKA 4C4FA 5AUTA 4BIDA 3I7CA 5M51A 3N4VA 2ETMA 2JEDA 4CLJA 1YRPA 3BU5A 2VWYA 2BR1A 1CTPE 5EM7A 4I3ZA 4PX6A 3UP2A 3GCUA 4DFXE 3CR0A 3F3WA 3S0OA 1BMKA 1UU3A 3L9NA 1LUFA 2IVVA 2VWBA 2VO6A 4RBLA 4IM3A 3V5JA 4I24A 3ZLYA 5IQEA 3SRVB 1ZYDA 4FODA 4IADA 2OJJA 2XK3A 2WAJA 2X9FA 4C3PA 4RGJA 2LAVA 4OUCA 3DK3A 5CXHA 3OZ6A 4F4PA 3EQDA 3V8WA 2CCIA 5JSMA 3PXRA 5CVHA 3VULA 4QRCA 4O7YA 3QWJA 1W8CA 3LFCA 5IQDA 3IPHA 3P5KA 3E8NA 3RVGA 4AXAA 4XG9A 4PTCA 5HCYA 5I9YA 3BYOA 4QTAA 3S4QA 4G5JA 1OKVA 3K5UA 4CEGA 5KKRC 1UNHA 3DBQA 4FZ7A 1I09A 4QP9A 3QCQA 3WZUA 1TQIA 3I7BA 4X2KA 4CFVA 2QI8A 3ACJA 5EI8A 2Q83A 4EZ3A 5HGIA 5CI6A 2ITTA 2Z2WA 4ANMA 3UOJA 4O7SA 5KKRB 2CGWA 3R71A 4C3RA 3W2SA 4ACDA 4GUBA 5ACBC 3WARA 4DG0E 2ITPA 4CFXA 4EZ7A 2GNFA 3Q52A 3TWJA 1YQJA 5L6WL 5KMOA 2C1AA 4YGAA 4BCFA 4BDDA 2XS0A 4U43A 1S9JA 2VRXA 4KBCA 1TQMA 4LV5A 3I5NA 2XUUA 2ZM1A 2YZLA 4O7ZA 2QOIA 3HYHA 3QQJA 2CGXA 2PSQA 2P55A 2J0LA 2W4KA 4UN0C 3H3CA 4F0FA 4O81A 2WOUA 3KXHA 4D4RA 2XK7A 2UW7A 4YJSA 3E88A 3QC4A 4HZRA 3A62A 4F1OA 3SA0A 2YAKA 1MUOA 2QG7A 1XHAA 3PWDA 3KA0A 3Q6WA 3IDBA 4P2KA 4FKIA 3EMGA 3EOCA 2I6LA 3KRRA 5K0KA 4EHZA 2ZDTA 3E8CA 4OBQA 1ZYLA 2W9FB 3P7CA 3VS4A 3R8ZA 4M0YA 3ZMMA 4G6NA 1PXOA 4ZY5A 3PSCA 3HAMA 5B7VA 4FSQA 3QYZA 4RJ5A 3QQGA 2FO0A 2RF9A 4IVCA 4S31A 5E1SA 5AR4A 1Y8YA 3A2CA 3R01A 2UW3A 4CD0A 4ANLA 2W9ZB 4FVPA 3OWPA 4II5A 4WRSA 2PE1A 4ASDA 3R1NA 4CT2A 4CXAA 1P4OA 1Z57A 4G5PA 4PF4A 5KMLA 1U54B 2OJGA 3ODYX 3COHA 1KE5A 3FMEA 3LPBA 4IZ5A 5HIBA 3ROYA 2WMSA 2R2PA 4D9TA 5J7HA 2XNEA 5J95A 4U44A 4AS0A 2QQ7A 2R3MA 3HMNA 3OCTA 5M06A 3FBVA 5H3QA 4O0UA 4TT7A 3CJFA 4XMOA 3F61A 3GBZA 4EH5A 4PY1A 1OIQA 3LIJA 5HICA 4QQJA 4DH1A 3UZTA 5FXRA 3FHRA 2UW9A 2R3QA 3ZDUA 3A4OX 5CLPA 4ENXA 5CZIA 2HWPA 3DKGA 2W4OA 3GXLA 4O21A 4PPAA 4TWOA 3IGGA 1WVYA 4FEWA 2VTLA 3CQWA 3GOKA 2J0MB 4H58A 4L7FA 5JEBA 2QHMA 4IVAA 5CT0A 4AFEA 3JXWA 1IA9A 4O0YA 3ZTXA 4OTRA 5IDPA 4FC0A 2NNWB 4TPTA 4FKLA 4D2TA 2VN9A 2YCSA 4L53A 4CT1A 2PYWA 4LUEA 4YC8A 2YACA 4EK6A 1GOLA 4QMZA 3RPRA 1XBCA 1WBSA 2EXEA 3JYAA 5KMKA 4XLVA 3UQFA 4EZ5A 3NRMA 3FLYA 5LMBA 1QPEA 4JDJA 3F69A 4JBPA 3AGLA 5FDXA 2IW8A 2QO7A 3FWQA 4L01A 5HI2A 3I60A 3LCTA 4A9UA 2QOBA 2RG6A 3NNXA 5CTPA 5CF5A 3TTIA 2QOHA 5KMNA 3QL8A 4GYGA 4IZYA 2JDTA 4UMTA 3ZUTA 3QU0A 4PTEA 4PDOA 5IA1A 3LM5A 4PL5A 3D9VA 2P4IA 2Z8CA 4FGBA 4P7EA 3P7AA 1MRYA 3QRIA 1OPKA 3COIA 1R0PA 4LL5A 2JBPA 4XP0A 5J1WA 4E4NA 3BE2A 4DFLA 1GIIA 4O7RA 3PVGA 3G9NA 4D55A 1H00A 2YHVA 5BVOA 4AGWA 3VUGA 1PKDA 3CD8A 3L8PA 4PPBA 3UOKA 3TKUA 5IQGA 2F57A 2WTDA 3KGAA 3EFKA 3T8OA 3QQKA 4HYUA 4L44A 4W4YA 4ANNA 3C5IA 2BHHA 2WQOA 3RNIA 5CI7A 3RCJA 4DEAA 3F9NA 3KVWA 4K77A 4DTAA 4N0SA 5C8MA 4CTCA 3M11A 3OTUA 4U9AA 3NYNA 4EK3A 3C13A 2HYYA 2GQGA 3E92A 2OIQA 3HX4A 3PVUA 4ZS0A 3LXNA 4NKSA 4RZVA 5T6KA 4O2ZA 5JGDA 4AZFA 3FKNA 5FD2A 5DT4A 4A4LA 1H24A 3M1SA 1Q97A 3RTPA 5LQFA 4O0XA 4EOSA 4UWCA 2PZ5A 2XNPA 3N4TA 2E2BA 3TJCA 3VBXA 1BX6A 1K3AA 3BX5A 5LVMA 4DGMA 3DCVA 4JDKA 4YZ9A 4GU9A 1LEZA 5KMIA 4NT4A 3ORXA 2WMTA 4V04A 4ZTHA 3R2BA 5HOAA 2BFXA 4ZJVA 3LMIA 3UPXA 5M55A 4A06A 2O8YA 4WBOA 4WBBB 1CSNA 2OXXA 1XWSA 3IOKA 1VR2A 4Q9ZA 1FVRA 3C51A 3OT8A 3ORKA 2FGIA 4TYEA 4XRJA 4Z7GA 5CU0A 5J8IA 3MY5A 3D83A 1ZYCA 3AMAA 1OITA 4IC8A 3C5UA 2HZ0A 3BQCA 4KKEA 2BDWA 2NRUA 4JNWA 4Y8DA 4BCKA 2QU6A 1OBDA 3LXKA 2X9EA 4KSPA 3ORLA 2GS2A 1Q61A 3Q04A 3FLWA 2IPXA 2QG5A 3EB0A 3PXYA 1OPLA 2LGCA 4ID7A 4PTGA 4OGRA 4AE6A 2BHEA 1W84A 2IZUA 4U40A 2VU3A 4WUNA 4ZTMA 5BQ0A 5LWMA 5EKOA 2ITYA 1ZLTA 4JQEA 3AT4A 3QTZA 5CEPA 2YLFA 4HJOA 5IA4A 4GT3A 4BDEA 3Q60A 5IUIA 3UODA 4YHFA 2BZHB 2ZV8A 5E8UA 3OFMA 1H1PA 4YPDA 2R64A 4O0WA 5C26A 2ZJWA 4ITHA 5LVPA 3RI1A 2XNMA 3IOPA 5HO8A 4PQNA 1NVQA 2UZTA 3VUIA 5GZ8A 3RINA 3GGFA 5JFWA 1DAWA 3R0TA 3EFJA 4EHEA 2VAGA 3F2RA 5M4FA 4E5WA 3WOWA 2RKUA 4NM3A 3WILA 1U4DA 4IJ9A 4NIFA 4AW2A 4BGHA 4IAIA 5CT7A 3IW7A 2UW5A 3PJ1A 1O6KA 2W5HA 3SG9A 3CPBA 2F9GA 4BDBA 3G6GA 5FTQA 2ZV2A 2VNWA 2CKOA 3O7LB 4JDHA 2OJFE 2WMWA 4ZTNA 4U42A 1OBGA 2HZNA 4G2FA 4KS7A 4I22A 5JQ8A 5JFSA 4DITA 5BUJA 4FR4A 4QMOA 5EOBA 3CLYA 5KX8A 4LGDA 4JX7A 3TKHA 2W7XA 4QP3A 2B53A 3KEXA 4R8QA 4O38A 2C6KA 4C37A 3Q3BA 4XYFA 4XLIA 4IHPA 3ZBXA 1TKIA 3HGKA 4H1MA 3GC8A 3TV6A 5EOLA 4GKHA 2QOCA 4R3CA 1WAKA 1J1BA 1FGKA 3MVLA 3R6XA 1XH6A 3PSDA 4FIGA 1QMZA 2OBJA 2GTNA 5EI2A 3HECA 2Q0NA 3MGYA 5FQDC 1Q4LA 3FHIA 1JVPP 3SV0A 4FIIA 1IR3A 4RVLA 3SC1A 4AA0A 3UC4A 4DFYA 4BCOA 4B6LA 2C69A 4S2ZA 4FIJA 3AGMA 4OT5A 3S3IA 4F9BA 4YJOA 2P33A 4XOYA 3UNZA 4BCPA 2C68A 4GK2A 2PVLA 4JAIA 5LVOA 1OKYA 3PSBA 2GS7A 3C4WA 3W55A 3VRZA 4EKLA 2QU5A 4DGGA 3NSZA 5HLWA 2VD5A 3Q5ZA 3Q5IA 4NKAA 1XH7A 4R78A 2UUEA 4IACA 1V0PA 3Q9ZA 4HVGA 4HVIA 5CXZA 2WMVA 3PIYA 3GUBA 4GCJA 1Q99A 2WMRA 4MX9A 4WNMA 4F0IA 1UU8A 4IANA 4DE4A 2X6DA 3QUEA 3WZKA 3RAKA 3ANRA 2PTKA 4CG9A 4U3YA 3R8LA 3RZBA 4ZJJA 2CPKE 3GC0A 3QFVA 1YVJA 5E4HA 1FOTA 3LQ5A 4IFCA 3VBWA 1JKKA 3NDMA 3UOHA 2G15A 4C4JA 2EUFB 3LFNA 1G5SA 4GIIA 4FSUA 3ORZA 2QC6A 3E64A 3HMMA 5JFXA 4QTCA 4WG4A 1SVGA 4QO9A 3P1AA 1UU7A 2YIYA 3FKOA 4BBEA 4ZAUA 3OVVA 4FF8A 3FEGA 4XHKB 4E93A 4AT3A 4BY9E 3NPCA 4IEBA 1XH8A 5EI6A 3JUHA 4PDSA 3LFFA 3FYKX 3R7YA 1V0OA 5AMNA 4C62A 2HK5A 1ZY4A 5L8KA 1W98A 2ERKA 2CGUA 4MYGA 5ANJA 2ZYBA 4ZK5A 2GNJA 2ZM4A 2OLCA 2PE2A 3GB2A 1OGUA 4M14A 3OWLA 2PMOX 3RAIA 3LFAA 2I0EA 4RFZA 3MFRA 5H8EA 5AX3A 5ACKA 2BIYA 4GFMA 4U80A 3OBJA 4H36A 4I5MA 3BEAA 3HEGA 3OW3A 3TV4A 3VS0A 5E1EA 3PIZA 1JOWB 2YWVA 4FKQA 5DR6A 1JWHA 4YTCA 4FICA 1GAGA 3WE4A 4FG9A 3L8VA 3H0YA 4LOPA 4DEDA 3O17A 1T46A 2B54A 4YLKA 2C5NA 4O86A 1G8AA 3O8PA 3FZSA 4ZSGA 1ZRZA 4I23A 3BHUA 3P86A 5BMSA 1UWHA 5KZIA 2JIVA 1XH4A 4U5JA 3OW4A 4OTPA 3ENHA 3PTGA 3DAEA 3BI6A 4FYNA 5TKDA 3R22A 3ZZEA 5DPVA 3L1SA 1PW2A 2ZOQA 3TKIA 4XG7A 3IONA 3Q9YA 4FNXA 2C47A 1M2QA 3R9OA 3OS3A 1B39A 4C2VA 4UEUA 4FBXA 2AC3A 4BVUA 4ZS4A 3LCKA 4EOKA 1ERKA 3R83A 2V0DA 1QPJA 5ANDA 3FQHA 3WF9A 2BIKB 5EDRA 4CNHA 4I21A 4HZSA 4O7WA 2CKQA 2ZB1A 1OMWA 3KK8A 1PXJA 4GSBA 4NW5A 5AAGA 3P78A 2XB7A 1H08A 1OL5A 2XA4A 2F7EE 2BILB 1S9IA 3QTSA 3NNVA 4G16A 3VBYA 2W1CA 5DA3A 5TE0A 1W0XC 3TDWA 4JI9A 3BHHA 3KVXA 1E9HA 1YI3A 2R3NA 4S33A 1TQPA 5IQHA 2XRUA 4E6DA 3OY3A 3POOA 3QD0A 2QOOA 3O51A 2UZNA 4XS2A 1CDKA 2G2IA 4ZSJA 1H8FA 4FSYA 4N6YA 4FTTA 5AP2A 2QNJA 3DQXA 4EC8A 5E7RA 4IWOA 5K5XA 3U6HA 2RIOA 4CVAA 4TNDA 4XH6A 4DCEA 3A60A 2YISA 4FG8A 3RK7A 1JKSA 2VTOA 3VHEA 2Z60A 2ITUA 4XBRA 4B9DA 3N4UA 2OICA 4E6CA 2PMNX 3FMJA 3CCNA 4XG8A 1I44A 5AIRA 3LXLA 2OF4A 5JZNA 4BIBA 2BAKA 2PVYA 3PUPA 3DU8A 3R73A 2PZIA 5D1JA 4D9UA 2QO2A 4ZTRA 2W1ZA 3FY0A 3GI3A 3BHVA 5DT0A 4IZ7A 4YSJA 1IAJA 5I4NA 3EKKA 3EL8A 2WFYA 4RFYA 4JG6A 2BZKB 3WI6A 4NK9A 3OCSA 4ANOA 4UY9A 3DAJA 4E4LA 4CMUA 4GYIA 3V5LA 4EOPA 3FPQA 4E1ZA 3RPSA 3HDNA 3QCYA 4OBPA 4L9IA 3G15A 3M42A 4D5HA 5HX6A 3TNPC 3QUPA 3NAYA 4FV3A 2IW6A 4U6RA 4WNKA 4DN5A 5M09A 1ZARA 2QR8A 3R02A 3A7JA 3FI4A 2FSLX 1QPCA 2A27A 2R3LA 3ZC5A 3VS5A 3KULB 2VNYA 3G90X 3IGOA 1H1WA 3EZRA 2B4SB 2C6DA 4FKOA 4A9RA 4BCNA 4CSVA 5HIEA 2HOGA 2R3KA 3HKOA 4YC3A 4UX9A 3RCDA 3DPKA 2PVRA 3GCSA 3H9FA 2UZLA 4FSRA 4PNKA 1L8TA 1UVRA 4Z9LA 4EYJA 4I4EA 3FZOA 4NCTC 3W16A 4CYJA 1NVSA 3FLSA 3UQCA 4I92A 4OTFA 5BUEA 2J0IA 4LV8A 3F5UA 4OR5A 1K9AA 2BKZA 1BUHA 3QBNA 4E73A 4FV9A 1M14A 3NUUA 4S30A 3ZU7A 3GU7A 4YSMA 5AWMA 2GQSA 5LXMA 4DG2E 2XP2A 3W2RA 2ITNA 3GEQA 5IUGA 1RQQA 5LMKC 2YCFA 5M4IA 2VTIA 4IAKA 4EH7A 4G3EA 4I20A 3CEKA 3KKVA 3QX4A 1OL1A 3BIZA 5F95A 2BDJA 3UNJA 3CTJA 3GNIB 2XYNA 2B55A 2A4LA 2OU7A 3L9PA 4EBWA 4ACMA 4YLLA 5CAOA 4UYNA 4D2RA 2DUVA 2GCDA 4V05A 2QONA 4D1ZA 3MJ1A 4PP9A 4D1XA 2VTQA 4M69A 5DHJA 3UVPA 3ZO4A 2WMUA 5IEVA 5DNRA 1AD5A 3OC1A 5A54A 3QA0A 4TYHA 4CTBA 4A7CA 4BI1A 2I0VA 2VTHA 1PMUA 4L45A 3G5DA 3OWKA 4I41A 4AZTA 4B4LA 3RM7A 2J5EA 2OH4A 1JKLA 4YJUA 4BDKA 2PVJA 2UZWE 3NUNA 3PVWA 1YXSA 3R8PA 3VWAA 4YZBA 3VN9A 4JR7A 3EN7A 3TACA 3PE2A 2R3JA 5J1VA 2HZ4A 1MP8A 4ITJA 4MH7A 4EUTA 2HENA 4XG4A 1SNUA 4O22A 3ZFYA 4J97A 3WIKA 5M4CA 3MBLA 4GUEA 4ZIMA 3LFQA 4UWYA 4OT6A 5F4NA 2VWIA 4M15A 3DLZA 4O7VA 4ASEA 5CX9A 1Y91A 5L2TA 4BWPA 3BBWA 3BU6A 2A0CX 5JK3A 2CLQA 4PDYA 2J9MA 3QA8A 3AD6A 4EOIA 3KF4A 2R3PA 2OSCA 3PA4A 2ONLA 4LMNA 1H4LA 4QNYA 4DEHA 5DWRA 3DKOA 1Q41A 3GCQA 5C4LA 4HPTE 4BDIA 4EHVA 2J7TA 5DBXA 4DEGA 5HO6A 2WIHA 4U79A 3DBDA 3BKBA 4FTMA 4HYHA 4EK4A 3W10A 2GNGA 4FZFB 4FE2A 4TYHB 3C4CA 3FDNA 4TY1A 4WNOA 3FL4A 4RJ6A 4ERWA 1H25A 2ZV9A 2ITZA 5ETAA 4BRXA 4ENYA 4JBQA 4V0GB 2YM7A 5GZ9A 3OUKA 3U9NA 4I94A 5EYMA 4O7NA 2IZSA 2ZAZA 3DGKA 4BCJA 5K4JA 4M67A 4RIXA 2X4FA 4ALVA 4O84A 4UXQA 5DGZA 4DAWA 5E8YA 3L8XA 3TIYA 2GFCA 3IK3A 4QOXA 4OTWA 5CAQA 4RIYB 2RFSA 4XV2A 4N70A 1H0WA 1HOWA 2JDRA 2QHNA 3NUYA 2ONLC 1BI8A 5AR8A 3SXSA 3DJ7A 3D5XA 3UDBA 3CSVA 3JPVA 5ANIA 4UMUA 3ZXTA 4AACA 5EW9A 1BI7A 2R3FA 3WE8A 1YOLA 3B2TA 1OKZA 3GOPA 2ZM3A 4E20A 4KB8A 3RBWA 4DEEA 3LW0A 2JDOA 3I5ZA 5K4IA 3OD6X 4FTCA 4UMQA 4CFUA 2C6LA 4HVDA 4KUJA 3MN3A 1Q8UA 1Y8GA 4O6LA 5T68A 4F64A 2BAQA 2WD1A 4X3FA 2Y4PA 3VBVA 4KWPA 4BCMA 2I0HA 1FPUA 2YDJA 2WZJA 3BHYA 1NVRA 3ULZA 2QR7A 4YTIA 5CAUA 5ANEA 1ZOHA 4JS8A 5AAFA 5HVJA 4AT4A 4F09A 5L4QA 4D2VA 3W18A 1RE8A 2PY3A 5AR2A 4MXXA 4ZSLA 4F1MA 2G9XA 1OL2A 2OF2A 3II5A 3SKCA 4F9WA 4GFGA 3JY0A 2XIKA 2CKEA 4QPMA 3Q2JA 3SVVA 4C8BA 2FUMA 3OOGA 4YUQA 4JG8A 3W1FA 3G51A 3PWYA 3R7UA 4C33A 4C7TA 4IAZA 2C6IA 3HVCA 5EG3A 1BL7A 3ZUUA 3KC3A 4NM0A 1PY5A 2X4ZA 3KY2A 4ZSEA 3DOGA 2OKRA 4X3FC 4JAJA 4AN2A 5HX8A 4IB0A 1ZMUA 4JDIA 4C4IA 5LVNA 4EEVA 3TCPA 3F82A 3SOCA 2P0CA 3PXZA 4X3FB 3ZEWA 2RL5A 5L8LA 2F7XE 3R8MA 1PMEA 3JS2A 3DB6A 3VBTA 5CY3A 2X39A 3QRKA 3R9HA 2WIPA 5EM6A 3W33A 3Q53A 4O82A 3QHRA 4XG6A 4ANSA 1YHVA 4RC4A 4JBOA 2BCJA 4GG7A 1ZWSA 3EQGA 2BUJA 3LMHA 1KSWA 1YDRE 3FLZA 4CZTA 1OKWA 2PMLX 3BHTA 1PKGA 5IH5A 3ZEPA 1WZYA 5CF8A 4G3DA 3ZSHA 2JBOA 4IQ6A 4EJNA 3NWWA 2JDSA 1RJBA 2X1NA 2PVHA 3KXNA 4FVQA 3VS2A 4P5ZA 1SMHA 2WKMA 1ZMWA 5JZJA 4OTIA 2REIA 3G9LX 3DK6A 5AR7A 5F20A 4CQEA 2VUWA 3ODZX 5IA0A 3NYXA 3R1YA 3F66A 4AT5A 5JGAA 3GU6A 3LFDA 3RHXA 4QMTA 3RJCA 1OL6A 3ORMA 5J79A 3RALA 5IH6A 3A8WA 4FNWA 5KCVA 4PP7A 4RJ8A 2Z7RA 3H9OA 3BZ3A 2C5YA 1WMKA 3FI8A 1OI9A 4FOCA 1VYZA 2PUUA 3NW6A 4L7SA 5TO8A 4E6QA 4PV0A 4XBUA 4V01A 4D2WA 1XH9A 3DNDA 3R1SA 1GZ8A 4Y85A 1KE9A 5HG9A 5TT7A 3QZFA 4IB1A 4O96A 4JIAA 4M3QA 3EQBA 3SQQA 3FZ1A 1O6LA 4FV0A 3ZS5A 1M2PA 3ERKA 3AT3A 4DTKA 4KNBA 4H1JA 3P9JA 1PYXA 4GMYA 4AN9A 4WD5A 4E5AX 2E9OA 4ALWA 4BYJA 1UV5A 4FTRA 4M97A 4I1ZA 4MNFA 4D2PA 3LM0A 3CC6A 3R63A 2YWPA 1PXNA 4F7SA 1J91A 4ZTLA 4OTQA 4Z7HA 5JFVA 4AE9A 4F99A 2AC5A 5IQAA 3A7IA 2XKDA 4TRLA 5HE2A 4IMYA 4FK3A 1JPAA 3FAAA 3A7FA 3PDTA 5AP1A 4ZTSA 4XG2A 3PRFA 3NAXA 4UALA 3VUHA 4EWHA 1YXTA 4LOOA 3DTCA 3P7BA 2HY81 5AX9A 4LI5A 5J9ZA 2X8EA 2ACXA 2GHMA 1Y6BA 2BFYA 2OG8A 3LHJA 5JN2A 4I0TA 3B8QA 2B9HA 4K2RA 4C36A 3GFEA 4ZMFA 3MWUA 3GC7A 3Q32A 4HGEA 4OAVB 4NU1A 1GZKA 5AUVA 3LQ8A 2VTPA 4M68A 1SZMA 1PXPA 1R3CA 2B7AA 3E7VA 4MBIA 3LLTA 3LE6A 4YBJA 3R7IA 4C35A 3ZRMA 3FYJX 4ZZOA 3FMHA 3FC1X 4ALUA 4J71A 3WZEA 4BN1A 5M53A 5J7BA 3O8UA 4LOQA 4YZNA 4PNIA 3Q4CA 2XNGA 1LP4A 1VYWA 1M52A 3FMLA 4NTTA 5AV0A 4DCAA 2DS1A 3MA6A 4C34A 1BL6A 2J6MA 2XM8A 3G0FA 3DNEA 3IW4A 2ZV7A 5D7AA 5HG8A 5TR6A 3V5TA 3VRYA 4BBMA 4EUUA 1PMVA 3FMMA 4ANBA 4KIKA 3W2OA 4K0YA 2OK1A 3I0QA 4FT9A 3QKKA 3FJQE 2H96A 4IB5A 4A4XA 2O2UA 3ZZWA 2H6DA 3BLQA 1UNGA 4ZLOA 3BGQA 1KE8A 4CCUA 3SXFA 3D14A 3MESA 3BPRA 3FMKA 3VBQA 4ZY6A 4DYMA 4ZP5A 2J50A 4QP8A 4U0IA 4FV4A 2FSTX 4N6ZA 3U54A 3EYHA 3DA6A 4KIPA 3D2IA 1BLXA 3IQ7A 4XG3A 3ZDIA 3ZO2A 3BYVA 5M07A 3R7GA 2YDKA 4C4EA 4E5BA 1U46A 2QURA 4DEBA 4KIQA 4I6BA 3B2WA 3MFUA 3CXWA 4JVGA 4RC3A 4FTIA 4EONA 5EYCA 3COMA 2B9IA 4FTAA 2UZDA 4GVAA 2R0UA 4YJRA 3U8WA 4WHZA 4EORA 5LJJA 2IZTA 4AA4A 5FEQA 3QF9A 4JQ8A 4FA2A 5HCXA 4O0TA 3FL5A 1PF8A 2GFSA 2R3GA 4EH9A 2QD9A 3LKMA 5AR3A 3GENA 4R7HA 2RSVA 5K3YA 5HHWA 2PUPA 5HQ0A 3KU2A 5DRDA 4FEXA 4YNOA 4EC9A 2GNHA 4TYGA 4TW9A 5AADA 2XKEA 3BGZA 3NGAA 4HGLA 5AJQA 4RLLA 3HA6A 3HDMA 3E8EA 3H30A 2W06A 4G3GA 1H01A 2X8IA 4JT3A 4F1TA 3F7ZA 4PWNA 5IA2A 3D4QA 1FINA 3PG1A 4H3QA 4KA3A 3DK7A 5FXSA 3QQLA 4L3LA 1JSTA 1REJA 3DV3A 3MJ2A 1Q24A 3C7QA 3HMPA 4PMSA 4BC6A 3EL7A 4EQCA 4H39A 4IH8A 3FV8A 3EZVA 4BDJA 2C3JA 1DS5A 4IAAA 4DC2A 2B52A 2WMBA 4IBMA 5CU4A 2UW6A 3BU3A 3QTXA 4JL9A 3VF9A 1LPUA 2PUIA 4M13A 1OIRA 2QKWB 3PJCA 2PVNA 4FKWA 3TN8A 3UG2A 5BVDA 3O50A 5E9EA 4M12A 3QLFA 4G17A 5EKNA 2H34A 4DLIA 2C6EA 3ACKA 3LZBA 4M84A 4F9AA 5IMEA 2BTSA 4U97A 3DLSA 2VWWA 2PL0A 4EOOA 3MH3A 1YWRA 4IX3A 4QQ5A 4R3PA 4E3CA 5BVEA 1GY3A 2A1AB 3BLRA 5FM3A 5FP5A 2HZIA 2OO8X 2ERZE 4EOJA 4MAOA 3QCSA 4Q5HA 4AUAA 1O6YA 5AM7A 2WPAA 3N51A 1JNKA 3C4ZA 3LJ1A 4X6QC 1YHWA 4PMPA 3QTQA 4J99A 3TZ8A 5CEQA 3CGFA 4RRVA 1ZMVA 4YHJA 3GU5A 5IKWA 3IKAA 4FKRA 4AGUA 3G6HA 5CEOA 3CY3A 3O96A 1URWA 2YN8A 4EH4A 2PZPA 2P2HA 3DZOA 2CN8A 4R5SA 2YJSA 2W4JA 2VGOA 1KV1A 2OIDA 4G6LA 5D7VA 3KMMA 1E1VA 3EWHA 4M8TA 3MA3A 3PXFA 5IQCA 4Y72A 3RP9A 3KXGA 5GJDA 3WIGA 4MF1A 3CKWA 4YBKA 3DFAA 4FIHA 3RAWA 2Y8OA 2IW9A 2B9FA 5EDQA 3R8UA 3ZSIA 2FH9A 3EIDA 5FTOA 4TYJA 2O64A 3OXIA 4PDPA 4WRGA 1XO2B 4Y95A 1J7IA 3QRUA 3DXQA 3SGCA 3MPMA 4NIFB 2IWIA 2Y6MA 4JLCA 4WOVA 2EXCX 4RSSA 4EJ7A 4CQGA 4CFWA 4ERKA 2R3OA 3CPCA 3LVPA 3S95A 3ZYAA 3MVJA 5EW3A 4A9TA 2WQBA 4O0SA 5ITAA 4NFNA 2IG7A 3BYMA 3RK9A 4H3PA 3UPZA 3LLAA 4BZOA 3OCGA 3TNQB 2BZIB 2SRCA 3QQHA 2ITOA 2YABA 2C6OA 3K3IA 3MY0A 4AOTA 4D4YA 4IVBA 5FP6A 2JITA 4J7BA 4XV3A 1BYGA 3UNKA 3FSKA 3FI3A 1YXVA 2WTIA 1YHSA 3ALOA 1KE7A 4Q2AA 2PZRA 3DXNA 4DLJA 5I9ZA 3PLAE 4BGGA 5AM6A 2PUNA 4L3JA 5FDPA 3LXPA 4J8NA 2EB2A 1M7QA 2ITXA 3CD3A 2JFMA 3PLSA 4TTHB 4L67A 3QTUA 4O1PA 3LCOA 3MS9A 4EBVA 2E9NA 4AW0A 4G1WA 4YP8A 3O23A 4ANQA 4QP4A 3OEFX 1NXKA 4YTHA 5AP7A 3SXRA 4F7NA 3VUTA 3FXZA 3ORTA 2GHLA 4MXAA 4RX8A 5HO7A 2YLEA 4DA5A 4EQMA 3R28A 4YC6A 4LRMA 4WG3A 5CSWA 3V6RA 4KKHA 5HKMA 4K11A 3AG9A 1CKPA 3P08A 4ZMEA 3DKFA 3RM6A 5HU9A 4I6HA 2RFNA 3PA5A 3L9MA 4IVDA 4BWKA 3DZQA 4IC7A 5IG1A 3IO7A 3D5WA 5L6OA 4CYIA 3JVRA 3MB6A 3WF6A 5HD7A 3MH2A 2UZOA 4C58A 5IEXA 5F94A 4O7LA 2WELA 4LGHA 2OJIA 4RJ4A 4J8MA 3K2LA 2RGPA 2X2KA 4BKYA 2EXMA 2VV9A 3H4JA 4TWNA 4H3BA 3FMNA 4QMVA 5I5ZA 5LWNA 2YIWA 4YZDA 4BDHA 2ETKA 3EQHA 2OZAA 1Z5MA 3IW8A 2JKQA 3SOAA 4JR3A 3BWFA 4QPAA 5DR9A 4USDA 5JT2A 2XCKA 4HGTA 1YXXA 3OMVA 3M2WA 4YPSA 3TIZA 5BX0A 5EQEA 3R7OA 4FKGA 4DEIA 5AA9A 3KMWA 1IG1A 3V01A 1R0EA 4LYNA 3ZM4A 5A46A 3EYGA 4KS8A 2IVUA 2BRNA 3MTFA 2J90A 5LCJA 3VS3A 2VTTA 4L46A 3F2AA 2PHKA 4FSZA 4RC2A 4EK5A 5ANGA 4W4VA 5IQFA 3G0EA 4WUAA 4AOIA 4FOBA 4UZHA 3U87A 4I6FA 4NYEA 2PVKA 4AW5A 1YW2A 2WB8A 2B1PA 3TUBA 4BR3A 2JIIA 4CKJA 3QZGA 4R5YA 5E8WA 5CENA 2WTVA 3AQVA 4R1VA 3R00A 4FG7A 4B8LA 4ZXTA 4FUYA 5EM8A 2QVSE 4CKRA 4GS6A 3TZ9A 3ZSGA 3HAVA 3R9DA 2JAMA 1WBTA 4L43A 5EH0A 4CMTA 2CGVA 4Y46A 1YXUA 1WBNA 3BLHA 3DAKA 2WO6A 4FSWA 5GNKA 4LG4A 3SD0A 2YM5A 3W2PA 1PXIA 5IISA 3ETAA 4G3CA 5L2WA 4L00A 5C27A 4H05A 4DGNA 4ZOGA 2OJ9A 3C4EA 2PPQA 4IAYA 4WG5A 4AU8A 2UW8A 2ITWA 4FV6A 4QNAA 1QCFA 2ITVA 1A48A 1OUKA 4TZRA 5HNBA 5C8KA 2OFUA 3HRBA 3PZEA 4R7IA 3DKCA 2QOFA 5C8NA 2OZOA 2WMAA 2I1MA 4KBAA 1F3MC 4KAOA 4K6ZA 4FK6A 5B0XA 5M4UA 4EI4A 3UC3A 1SVEA 4ACHA 2I7QA 4BFMA 4U7ZA 1Q8WA 5GIPE 1IAHA 4NW6A 1JKTA 4GRBA 4DH8A 2HWOA 4F9CA 3CIKA 1APME 5IA3A 4BCHA 5I3RA 5KMJA 4EL9A 4RIWA 4BDCA 2O65A 4X7QA 3QTRA 4JBVA 3C1XA 4KKGA 2A19B 3NVMB 4E4XA 2BALA 2YIQA 4X2FA 4RWJA 1G8SA 2J2IB 4DGOA 5DMZA 2W5BA 2ZDUA 1FQ1B 4FKTA 4IZAA 2UZBA 4X6RA 3U4UA 2BRMA 3OG7A 3QQUA 4MD7E 4DFNA 3I6UA 3I4BA 1GIHA 3PZHA 4DG3E 3HUBA 4TYIA 2J0JA 4PL4A 3ZBFA 1V1KA 4ASXA 3U51A 2YM8A 4YMJA 3VIDA 3JR1A 4FEUA 4NUSA 3RPOA 4K9YA 3F3VA 3VQUA 2H8HA 3UIUA 2XEYA 3IG7A 4FV8A 5FTGA 2AYPA 3UIMA 3NIEA 1DM2A 3HMOA 1RDQE 3NW5A 1R78A 4FZAB 4O0RA 3ZLWA 2VTAA 4BIEA 1P4FA 1Q62A 1XQZA 3ORPA 3ZONA 3IW6A 1OM1A 5EHLA 2BVAA 4UYAA 3D15A 2BRHA 4X0MA 2WHBA 3FQEA 1SYKA 4IWPA 2G1TA 3S2PA 3CTQA 4CFNA 4L8MA 1IASA 2XBAA 3VO3A 2H9VA 3KRLA 4FI1A 5M57A 2C3KA 1ZXEA 4MCVA 5CAVA 4YO6A 3EHAA 3TV7A 3KRWA 5F9EA 3A7HA 1DI9A 3GP0A 5FG8A 1CKIA 3DQWA 4WSYA 5HCZA 1WVXA 4TXCA 3EKNA 4QYYA 2GNIA 2VTJA 4AZWA 1Q3DA 3FC2A 1LEWA 4IDTA 3TUDA 2C30A 3BQRA 4TKSA 4AZSA 3HP5A 3DBEA 4RX9A 4YJNA 4QMNA 5M44A 3NMUF 3BRBA 4EYMA 4Y83A 3HRCA 1Y57A 4HVSA 5GJFA 5CVFA 3T9IA 3GU8A 3PFQA 2WNTA 1MRUA 1J1CA 3A99A 3E3BX 1PYEA 3ELJA 2HAKA 2JKKA 4GKIA 2GSFA 2JC6A 3LCDA 3QTIA 4GJ2A 4DFZE 2JIUA 1YWNA 2XIXA 2NP8A 1KOBA 4GG5A 4F9YA 3D5VA 4ZLZA 1DI8A 2CSNA 3KFAA 3MH0A 4AZEA 5B2LA 2UZUE 5GZAA 5AIKA 4DH5A 4LM5A 2BPMA 3PIXA 4XP3A 4JRVA 2AUHA 3CJGA 3CBLA 4FIFA 4FT5A 4BDGA 2BKKA 5HG7A 2JD5A 2O63A 3NEWA 3UO6A 2WMQA 1ZOEA 3QAME 3U9CA 3QKMA 2R0IA 3PE1A 1FBNA 5DYJA 2FVDA 2XJ0A 2EB3A 3ZLSA 2X7FA 1H07A 1XR1A 4NTSA 3F5GA 3UMXA 1Q8ZA 4ZZNA 5IF1A 4GU6A 3IECA 5CASA 4NM5A 1YOJA 4ZZMA 5FBNC 2YDIA 4XNEA 5E8TA 3RPYA 2X6EA 2A2AA 3UOLA 5AA8A 5IU2A 4S34A 5HVYA 3E93A 5LMAA 3KN5A 4F6SA 1PXMA 2HXQA 3MPTA 4J52A 2VO0A 5H2UA 5CNOA 4C3FA 4CCBA 4BKJA 4GK3A 4G3FA 1E1XA 5CU2A 1A06A 2WTWA 3UVRA 5J9LA 1H1RA 2VO7A 4AG8A 3FMDA 3FZPA 2R7IA 2WQEA 4KRCA 2XK4A 4FSNA 4KRDA 3CS9A 3UG1A 4YZMA 3WF7A 4EOQA 1O9UA 2RFEA 2W96B 3ULIA 2UVZA 2UW4A 1H1SA 3FZTA 3FKLA 2WTJA 2VTMA 5BYYA 1YWVA 4LMUA 4OTGA 5BYZA 3FSFA 4M69B 3B8RA 2BDFA 2X7OA 3E7OA 4ZSAA 2EVAA 4FV5A 4L42A 5C9CA 4BI2A 5KHXA 2YJRA 2W1EA 3S00A 3SRVA 4RWKA 4RX5A 3Q6UA 4NSTA 5E8XA 4OLIA 4XEYA 2VWZA 3FZRA 4ASZA 4TN6A 5DG5A 2GNLA 2YAAA 3IDCA 5IH4A 3MY1A 1YOMA 3LAUA 4FNZA 2O5KA 2YM6A 3C0GA 4QMQA 3MIAA 5JH6A 2VWVA 5CVGA 4RG0A 4R7BA 3MB7A 2GDOA 4J95A 1RW8A 2Z7SA 3RMFA 3EN9A 3TUCA 1URCA 1CKJA 3T3UA 4P90A 4RMZA 5A6NA 2C0IA 3DB8A 1X8BA 2C6TA 2XF0A 4BF2A 4AF3A 5BUIA 2WEVA 2XK9A 3NYVA 1M2RA 3NS9A 5D12A 3RK5A 4BYIA 4BKZA 5HVKA 4HNFA 5HBHA 4BDAA 3UZRA 3HV7A 3TT0A 4DINA 4RFMA 3VUKA 4FV1A 1QPDA 2J4ZA 1TVOA 4F63A 5A6OA 3EN4A 4X3JA 2CMWA 3MTLA 5CQUA 4MD9E 3WYYA 1ZY5A 2OXYA 4APPA 5HTIA 3I79A 4EOMA 1Q5KA 4QTEA 3I6WA 3ET7A 3SX9A 4DBNA 2QKRA 4QYGA 1P2AA 4W9WA 3MW1A 5HTCA 4R77A 3EH9A 5HLPA 2VX3A 4B0GA 5AV1A 2IJMA 3EN5A 2WTCA 4MNEA 5H8GA 1ZZ2A 4I5CA 1OECA 4X2JA 3O71A 5FRIA 3H10A 4HYSA 4IWQA 1SNXA 2PU8A 4LQMA 3L9LA 5HD4A 3TJDA 3PPZA 4PL3A 4C61A 4MTAA 4O1OA 4NJDA 4OTDA 3RKBA 4FUXA 4RIXB 4AGCA 4MWHA 4C2WA 4DH3A 4NEUA 5FBOA 2IVTA 2UVYA 4I4FA 5L8JA 4BBFA 1ZYJA 2P3GX 4FKJA 4PRJA 2CN5A 2PZYA 3HV3A 4FV7A 1F0QA 3BV2A 3MSSA 4M0ZA 5EW8A 3U55A 4YR8A 3ZO3A 1OIUA 5BVNA 3AXWA 2UV2A 4DTBA 4BZNA 2HCKA 2HW6A 2JGZA 1T45A 2YITA 4U3ZA 3TM0A 3EN6A 3C4XA 4YTFA 5A4EA 3PXKA 4IE9A 5C03A 3I1AA 4Y5QA 5AUZA 4IM2A 4S32A 2X2MA 1U59A 4GK4A 1U54A 3EQRA 3LQ3A 4MVFA 5CEMA 1JSVA 3NCGA 4AOJA 4E26A 4K1BA 3AMYA 3PPKA 4FKPA 4NJ3A 3H0ZA 4KABA 3BE9A 4YZCA 3AC5A 2Z7LA 3FUPA 5I3OA 4C38A 4FVRA 3NX8A 1Q8YA 2WGJA 4G31A 5BNJA 5TF9A 4A4OA 4F70A 1REKA 3HRFA 2F2UA 4QMXA 4E6AA 4HCTA 3VJNA 4Y73A 4MXZA 3V6SA 5ETIA 4FKSA 3TDVA 5L2SA 1AQ1A 2V5QA 4MNEB 4QYFA 4X2GA 3O7LD 5KMMA 2Y0AA 3TZMA 2XIYA 4ACCA 3TNHA 3A4PA 1FVTA 3HNGA 3VS7A 4GL9A 1R1WA 4A9YA 2NO3A 3E5AA 1H1QA 4RJ7A 4D0XA 1W7HA 4DT9A 2YEXA 3OWJA 4NL0A 3HP2A 4EHGA 3PVBA 4I5HA 3V5QA 4LUDA 4C4GA 2F4JA 1IEPA 4UMPA 4ZTQA 1CMKE 1VJYA 4KIOA 1B6CB 4RWLA 3VAPA 5JQ5A 4Q9SA 2JLDA 4MXYA 1YI6A 4CLIA 4ZEGA 5EDPA 3SW4A 1GIJA 2Y9QA 1ZOGA 3FXWA 3AOXA 3V04A 2W05A 3MFTA 1XJDA 3OEZA 3EFLA 4I0RA 4IDVA 5CF6A 5HTBA 4OTHA 3QD2B 4FIEA 4W4XA 4J98A 3QTWA 2QLQA 1V0BA 4ORKA 4IIRA 3D2KA 4LRJA 4I0SA 4MXOA 2OXDA 2YERA 3HV4A 4GVJA 2J0KA 3U4WA 4CKIA 3NLBA 3DDPA 5A4QA 4K33A 3F3TA 2OWBA 2B9JA 5BPYA 3UE4A 3ZM9A 3UMWA 4OW8A 3MV5A 4GT5A 3BWJA 4UV0A 5ANOA 3QHWA 5GHVA 5BYLA 4IX4A 3BV3A 1JAMA 1PXKA 3Q9XA 4YJVA 3R9RA 1DAYA 3QGWA 1J3HA 3G33A 5HBJA 4M66A 3BBTB 3F3ZA 2YM4A 2WQNA 3QZHA 3EQCA 2F2CB 3LFEA 3K3JA 4MQ2A 3R21A 4GIHA 3ZXZA 3TZ7A 5JMSA 4RIOA 5IPJA 4Z55A 3C0IA 3DJ5A 5A4TA 1R39A 3DDQA 4X21A 4BHNA 1H26A 4QMPA 2VTSA 1PJKA 3LOKA 4RX7A 3KXXA 1Y6AA 4IAFA 3VS1A 4HW7A 1SM2A 3PRIA 5EHOA 4L68A 5K0XA 4F7LA 4ZJIA 2ZVAA 3QXPA 3F2NA 2WU6A 3PY0A 3UYTA 4GT4A 2I40A 3D7TA 3MVMA 1WCCA 5J5TA 3OXTA 3IS5A 3I0OA 4AQCA 1OB3A 3FXXA 2GS6A 3TXOA 3POZA 4NH1A 4BCGA 4J1RA 3E62A 4QMWA 3PP0A 4TWPA 3N9XA 4AWIA 5KHWA 3PY3A 5D11A 4FZ6A 4MK0A 3H9RA 3UGCA 2CNVA 2ETRA 5L3AA 4KINA 1HCKA 1JQHA 3OOMA 5JRSA 2KULA 4MBLA 5C1QB 1SVHA
chains in the Genus database with same CATH superfamily
3TL8A 5AEPA 4GV1A 4BGQA 4QP2A 5HU3A 2R3HA 2E9PA 2XM9A 4BI0A 3GC9A 4C4HA 4GH2A 4L52A 3F5PA 2ZMCA 5AP5A 3ALNA 4QMMA 4LV7A 4DFUA 4BB4A 3TG1A 5HE3A 5A3XA 3DXPA 3MPAA 3W8LA 3QQFA 5HE0A 4U81A 3THBA 5DEYA 5EK7A 3NYOA 4BHZA 3GT8A 2YA9A 5A4CA 5DH3A 3GCVA 3NNUA 4ZLYA 4K8AA 4IXPA 3FY2A 4JJRA 4RLKA 5LARA 3SG8A 5KO1A 4A9SA 4YO4A 3VS6A 4UBAA 5LVLA 5M08A 3D7TB 1MRVA 3O2MA 4BTMA 4UMRA 4HNIA 4USEA 5ICPA 4FKUA 2NRYA 1J7UA 2QODA 4BDFA 4FTUA 5DEWA 3RPVA 3JVSA 4BZDA 3E3PA 4CV9A 2R9SA 2RG5A 3DY7A 5J87A 3NVKI 3PYYA 2B0QA 4FSTA 4FV2A 2FA2A 4HCVA 1M17A 4G6OA 4CRLA 3C4FA 3AKJA 3E63A 3VVHA 4B99A 4R6VA 4F6UA 4PMTA 4O7TA 4LL0A 4KIKB 5FM2A 4LFIA 3VONA 5L2QA 3PP1A 2XK8A 4JX3A 2CLXA 1YDSE 5DR2A 5EQYA 3QRJA 4XJ0A 5AAEA 5HNIX 1K2PA 4RQVA 4ACGA 3KCKA 5CSHA 4RZWA 5DT3A 2XYUA 3UTOA 3D5UA 3P4KA 4FTNA 4O4BB 2GHGA 3AC8A 3GVUA 3MH1A 1UA2A 5EYKA 4BL1A 2C6MA 3FLQA 1J7LA 3W8QA 3PG3A 3Q4ZA 3QRTA 3F5XA 5KZ0A 5FXQA 5GIOE 4AZVA 4C02A 3ZO1A 5LCKA 2C3LA 5T3QA 3LJ0A 1STCE 4QT1A 3NCZA 2VO3A 3OTVA 3UBDA 2ZMDA 3NFFB 2Z02A 1H0VA 4BTFA 4QQCA 4RA4A 2OGVA 3RZFA 3DTWA 3V51A 3CGOA 2IO6A 4MF0A 4FX3A 1WBVA 5A14A 3RAHA 2W99B 1JBPE 5AUWA 2DYLA 1YKRA 2G2HA 2QOLA 5DN3A 3KMUA 5HZNA 3SW7A 1H27A 4QDEA 4HYIA 2YM3A 4RJ3A 4ITIA 2GMXA 3QXOA 4HOKA 2HELA 4IW0A 5HNGA 3UYSA 4CFMA 2O0UA 5JRQA 2NYAA 1UWJA 3KK9A 2R4BA 5CNNA 3UP7A 1PRYA 2WTKC 4QTDA 5A9UA 2O3PA 5AP6A 3OROA 3Q4UA 3ZCLA 3QD3A 2VWXA 1KWPA 5CEIA 3F6XA 4ZY4A 1P14A 1ZAOA 3ID6C 1VEBA 1OVEA 4BICA 4GEOA 1L3RE 2HIWA 2V22A 2WTKB 4FSMA 2OFVA 4MWIA 5ETCA 5AP0A 4ONAA 5IA5A 4JXFA 4CMOA 4GW8A 4G9RA 4PMMA 4F6WA 2BROA 4QP1A 3RNYA 4YJTA 1NY3A 3KB7A 2YIXA 5E8VA 5DOSA 2YZAA 1UNLA 2X0GA 5JGBA 1F5QA 5HG5A 5AFVA 3QGYA 5E8ZA 1XBAA 3WZJA 2UVXA 2W1HA 3W32A 4GJ3A 4IX6A 4MXCA 3UQGA 3R04A 2Y4IC 4QPSA 4XV9A 4BTKA 1ST4A 5CAPA 3ZFMA 4XP2A 4DH7A 3QD4A 3PUFC 2Y6OA 2Y4IB 4IJPA 4FL2A 4JIKA 3S1HA 2WU7A 3D7ZA 3EJ1A 2XNNA 3NNWA 4XRLA 3UO4A 4TL0A 3EQPA 2AQXA 3ZRLA 4TWCA 1YDTE 3BGPA 3FLNC 3NZ0A 2C5VA 5AP3A 2VX1A 4XCUA 2G01A 1Q3WA 4J96A 2J51A 4YURA 5CWZA 4FEVA 3C50A 2IVSA 2OW3A 3ATTA 4W8DA 4APCA 5H9BA 2R7BA 4X2NA 3P79A 5HE1A 4BWXA 4DHIB 2QCSA 4IWDA 4P5QA 4FT0A 4WKQA 5H8BA 2W1FA 4Y5HA 3PJ8A 2IZRA 5CS6A 3I81A 1GJOA 2P2IA 5M56A 2QOKA 2C0TA 2JKMA 2XJ1A 2R5TA 2XKCA 3KXMA 4WO5A 2EU9A 4RPVA 4O83A 4O6EA 3OF0A 5IZFA 3UZPA 2X8DA 2BZJA 3TTJA 3A61A 5FLFA 4HPUE 3Q96A 2J5FA 3PJ3A 4G9CA 3KRXA 3GQLA 3KXZA 3LMGA 4FEQA 1PHKA 3ZOSA 2QOQA 2VTNA 2FYSA 3DBFA 3ATSA 4YJPA 4DFBA 4I5PA 5D41A 3KQ7A 4PPCA 2JDVA 4KBKA 4D4VA 2CNQA 2G2FA 2XH5A 4RQKA 5LOHA 2C5OA 5CEKA 3NUPA 3ZRKA 4AGDA 1Z9XA 4DGLC 2F7ZE 3NUSA 2W1GA 3TNIA 3MIYA 2FSOX 4C59A 4U45A 2C3IB 4MD8E 3O8TA 4NFMA 3KCFA 3R8VA 5CYIA 4R1YA 5HESA 1G3NA 2Z7QA 5L2IA 2VTRA 3BEGA 4WIHA 3WZDA 3ORIA 4AP7A 5CSPA 2WXVA 4RVMA 3NUAA 2I0YA 3EQFA 3CKXA 3QC9A 4NWMA 2WEIA 4WNPA 3RGFA 1ATPE 3VNTA 4CZYB 4W4WA 5IMXA 1UU9A 5ETFA 3FI2A 3AD4A 4EQUA 4JG7A 2XARA 5HORA 1ND4A 3AC3A 3QALE 3PA3A 4O91A 4U41A 3KN6A 4FTQA 3SLSA 5IEYA 2PVFA 4J53A 5KNJA 3GFWA 5CU3A 2Q0BA 2W0JA 3VF8A 3PPJA 3WF5A 3ZHPC 3CQEA 3COKA 2WOTA 3F88A 5EHYA 3SHEA 2HW7A 4P4CA 3V8SA 1W83A 5ANKA 3HMIA 3Q9WA 2R3RA 2V7AA 4UZDA 5E8SA 3QCXA 4OAUC 2X7GA 3BCEA 5J5SA 3AC1A 4E7WA 3CTHA 1FVVA 4L3PA 1NA7A 2R3IA 2IF8A 3KF7A 4W9XA 1P5EA 2XK6A 4XOZA 3EFWA 3QYWA 3VC4A 4I93A 2PE0A 2W1DA 5K5NA 4FTLA 3T9TA 5DI1A 2UZEA 2OZAB 3GCPA 3MFSA 3BELA 2BAJA 1VZOA 1XBBA 2CHLA 2CKPA 5IQBA 5G6VA 2WQMA 2X81A 5CZHA 5BMMA 5E92A 3REPA 4FGRA 4DBXA 2CCHA 4UB7A 2PK9A 3IW5A 4MEDA 2OH0E 3Q4TA 4FTKA 1WFCA 1NW1A 3AKLA 1KOAA 3NUXA 2HY0A 4G34A 3F3UA 3VUMA 3NW7A 2E9UA 3GQIA 2JFLA 4CZUA 2HXLA 4MQ1A 3HV5A 5BVKA 4FL3A 4B8MA 3EQIA 4FMQA 4AXDA 2QLUA 4O0VA 1KE6A 2JKOA 4QYHA 5CALA 4F65A 1U5RA 1IA8A 3R2YA 1OPJA 2W1IA 2XCHA 5CU6A 4CGAA 1A9UA 3AC2A 4F08A 4EH3A 3U6IA 4C57A 3UVQA 4E8AA 3P0MA 2PWLA 5HEZA 2X0QA 3PXQA 2OIBA 2XJ2A 5KUPA 2UW0A 4RT7A 5BVWA 1EH4A 2NPQA 4Q5EA 4AFJA 2BTRA 3QZIA 3MI9A 4CG8A 3ANQA 5EFQA 1B38A 2YCRA 2CJMA 2XIZA 4NM7A 3V3VA 4B7TA 5K9IA 3V5WA 4JOAA 5FWKK 5AV3A 1NT2A 3R1QA 4O4DA 3HV6A 3LJ2A 5JKGA 5C01A 5AV2A 4MHAA 3KULA 5I0BA 3FPMA 4DHFA 4HGSA 3OUNB 4YLJA 1KV2A 3LCSA 4TNBA 1PXLA 5CQWA 3LFBA 3VUDA 4AAAA 1QL6A 1WVWA 4IM0A 3QKLA 4RVKA 2F49A 2RFDA 1UKIA 3OCBA 5AUYA 5IDNA 4CRSA 3BYSA 5J9YA 4O27B 2XBJA 3G2FA 1UKHA 1WBWA 3VHKA 4OBOA 4FT7A 4EKKA 5B2KA 5KE0A 5E91A 2BRGA 3UO5A 4IFGA 4NCTA 4WA9A 2VX0A 5F1ZA 1H28A 5HLNA 3QUDA 2C4GA 2C1BA 3HA8A 4Z3VA 3QX2A 1OL7A 4RIWB 5DFPA 5GJGA 5A4LA 4Z16A 2PMIA 5D10A 3D0EA 2GQRA 3A7GA 3DBCA 3OHTA 1GNGA 4DF3A 2PVMA 4R3RA 3VJOA 4FYOA 3T3VA 5FEEA 5LMKA 1LR4A 4FL1A 3U6JA 4K18A 2C5XA 3LFSA 3ZC6A 1XKKA 3A8XA 3CE3A 3MDYA 1AGWA 5AP4A 4QMSA 3R7VA 1IRKA 2WMXA 3HUCA 3V5PA 3R7EA 5G1XA 4ARKA 2ESMA 3PY1A 5CF4A 3OBGA 4MKCA 3ZUVA 5DE2A 1OUYA 4AA5A 2CNUA 3ENMA 3OT3A 3HL7A 4BTJA 5KBRA 3QLGA 5TOZA 1OIYA 4XV1A 4YJQA 3O0GA 1MQBA 4LGGA 5EQPA 5CSXA 3AD5A 3DT1A 5FUTA 5I9VA 5I9WA 4LRKA 2VGPA 4CV8A 4D58A 2VWUA 3ZFXA 1ZYSA 4RA5A 4QD6A 4U8ZA 2ITQA 5DVRA 3PJ2A 3OP5A 3HLLA 4F0GA 5L6PA 4N57A 2XIRA 3FE3A 5GINE 3WF8A 2XKFA 2XVDA 2V55A 4WT6A 3RWQA 4EK8A 5EM5A 2GU8A 2V7OA 3KL8A 5FGKA 5IUHA 3Q2MA 4YHTA 4EH8A 2W5AA 3K5VA 3SDJA 4AN3A 1HCLA 2XRWA 3AC4A 4D5KA 4EH2A 4D1SA 2IN6A 3MVHA 3V8TA 5AUXA 4FZDB 4KSQA 2YFXA 1GZOA 2FSMX 2C0OA 2KTYA 2UZVA 4I6QA 3VQHA 1PMNA 3W2CA 2PULA 4EWQA 3F7WA 3TI1A 3JY9A 4QMUA 5I9XA 5AR5A 4FNYA 4A07A 5D9HA 2CDZA 4UWBA 3MYGA 1FMKA 3E8DA 3OY1A 1XH5A 3UJGA 4EH6A 5AV4A 3E87A 3DJ6A 3K54A 2XNBA 4JQ7A 1M7NA 2GPHA 4QMLA 4QYEA 4BJJB 2DQ7X 4HCUA 1OZ1A 2W17A 3NIZA 4W8EA 2E9VA 3UIBA 1U5QA 4XUFA 4USFA 5CANA 4D4SA 3KRJA 3VW8A 4QP7A 3VW6A 3BYUA 4AX8A 4F7JA 4HVHA 4DT8A 4BCIA 3ITZA 2OI4X 4L6QA 4V0GA 4FT3A 2BRBA 4N4SA 4IB3A 3DFCB 3ZH8A 5DIAA 4FTJA 3TEIA 4C0TA 3AMBA 2Y7JA 1KUTA 1BKXA 4FTOA 4YU2A 3IDPA 1WBOA 5B2MA 4RIYA 4WSQA 3RHKA 3RWPA 2EWAA 3C9WA 2X2LA 4QP6A 4QTBA 3CP9A 4QMYA 3GU4A 4AW1A 5FEDA 4E4MA 3L8SA 5BVFA 3SAYA 1W82A 3D94A 3ORNA 4RVTA 4QQTA 3WYXA 1ZZLA 1FMOE 1MQ4A 3W2QA 3C0HA 1GZNA 3DS6A 3R30A 4JRNA 2DWBA 4KD1A 1FGIA 3HZTA 4XX9A 5AUUA 2ZB0A 2JAVA 2XMYA 3ZLXA 1WBPA 2XEZA 1Q8TA 1JSUA 4BCQA 2VZ6A 5HIDA 4D0WA 2V62A 4FKVA 4D28A 4NZWB 3NR9A 3UIXA 5EYDA 2FB8A 5DLSA 1YI4A 5IQIA 2QO9A 2YCQA 2XNOA 5DRBA 2GTMA 3CQUA 4D2SA 3WBLA 5CSVA 4O2PA 4MBJA 5KBQA 3R9NA 4IX5A 4PUZA 3TNWA 1CM8A 2YIRA 4CFFA 3P23A 4RWIA 1JLUE 5HBEA 4M7IA 4GFOA 3ROCA 3OXZA 5E90A 1OGYA 4YNEA 2BMCA 5I9UA 3KREA 3CY2A 4EOLA 5C4KA 3AT2A 4UXLA 3FQSA 2XZSA 3QWKA 4C4FA 5AUTA 4BIDA 3I7CA 5M51A 3N4VA 2ETMA 2JEDA 4CLJA 1YRPA 3BU5A 2VWYA 2BR1A 1CTPE 5EM7A 4I3ZA 4PX6A 3UP2A 3GCUA 4DFXE 3CR0A 3F3WA 3S0OA 1BMKA 1UU3A 3L9NA 1LUFA 2IVVA 2VWBA 2VO6A 4RBLA 4IM3A 3V5JA 4I24A 3ZLYA 5IQEA 3SRVB 1ZYDA 4FODA 4IADA 2OJJA 2XK3A 2WAJA 2X9FA 4C3PA 4RGJA 2LAVA 4OUCA 3DK3A 5CXHA 3OZ6A 4F4PA 3EQDA 3V8WA 2CCIA 5JSMA 3PXRA 5CVHA 3VULA 4QRCA 4O7YA 3QWJA 1W8CA 3LFCA 5IQDA 3IPHA 3P5KA 3E8NA 3RVGA 4AXAA 4XG9A 4PTCA 5HCYA 5I9YA 3BYOA 4QTAA 3S4QA 4G5JA 3W0RA 1OKVA 3K5UA 4CEGA 5KKRC 1UNHA 3DBQA 4FZ7A 1I09A 4QP9A 3QCQA 3WZUA 1TQIA 3I7BA 4X2KA 4CFVA 2QI8A 3ACJA 5EI8A 2Q83A 4EZ3A 5HGIA 5CI6A 2ITTA 2Z2WA 4ANMA 3UOJA 4O7SA 5KKRB 2CGWA 3R71A 4C3RA 3W2SA 4ACDA 4GUBA 5ACBC 3WARA 4DG0E 2ITPA 4CFXA 4EZ7A 2GNFA 3Q52A 3TWJA 1YQJA 5L6WL 5KMOA 2C1AA 4YGAA 4BCFA 4BDDA 2XS0A 4U43A 1S9JA 2VRXA 4KBCA 1TQMA 4LV5A 3I5NA 2XUUA 2ZM1A 2YZLA 4O7ZA 2QOIA 3HYHA 3QQJA 2CGXA 2PSQA 2P55A 2J0LA 2W4KA 4UN0C 3H3CA 4F0FA 4O81A 2WOUA 3KXHA 4D4RA 2XK7A 2UW7A 4YJSA 3E88A 3QC4A 4HZRA 3A62A 4F1OA 3SA0A 2YAKA 1MUOA 2QG7A 1XHAA 3PWDA 3KA0A 3Q6WA 3IDBA 4P2KA 4FKIA 3EMGA 3EOCA 2I6LA 3KRRA 5K0KA 4EHZA 2ZDTA 3E8CA 4OBQA 1ZYLA 2W9FB 3P7CA 3VS4A 3R8ZA 4M0YA 3ZMMA 4G6NA 1PXOA 4ZY5A 3PSCA 3HAMA 5B7VA 4FSQA 3QYZA 4RJ5A 3QQGA 2FO0A 2RF9A 4IVCA 4S31A 5E1SA 5AR4A 1Y8YA 3A2CA 3R01A 2UW3A 4CD0A 4ANLA 2W9ZB 4FVPA 3OWPA 4II5A 4WRSA 2PE1A 4ASDA 3R1NA 4CT2A 4CXAA 1P4OA 1Z57A 4G5PA 4PF4A 5KMLA 1U54B 2OJGA 3ODYX 3COHA 1KE5A 3FMEA 3LPBA 4IZ5A 5HIBA 3ROYA 2WMSA 2R2PA 4D9TA 5J7HA 2XNEA 5J95A 4U44A 4AS0A 2QQ7A 2R3MA 3HMNA 3OCTA 5M06A 3FBVA 5H3QA 4O0UA 4TT7A 3CJFA 4XMOA 3F61A 3GBZA 4EH5A 4PY1A 1OIQA 3LIJA 5HICA 4QQJA 4DH1A 3UZTA 5FXRA 3FHRA 2UW9A 2R3QA 3ZDUA 3A4OX 5CLPA 4ENXA 5CZIA 2HWPA 3DKGA 2W4OA 3GXLA 4O21A 4PPAA 4TWOA 3IGGA 1WVYA 4FEWA 2VTLA 3CQWA 3GOKA 2J0MB 4H58A 4L7FA 5JEBA 3ML1A 2QHMA 4IVAA 5CT0A 4AFEA 3JXWA 1IA9A 4O0YA 3ZTXA 4OTRA 5IDPA 4FC0A 2NNWB 4TPTA 4FKLA 4D2TA 2VN9A 2YCSA 4L53A 4CT1A 2PYWA 4LUEA 4YC8A 2YACA 4EK6A 1GOLA 4QMZA 3RPRA 1XBCA 1WBSA 2EXEA 3JYAA 5KMKA 4XLVA 3UQFA 4EZ5A 3NRMA 3FLYA 5LMBA 1QPEA 4JDJA 3F69A 4JBPA 3AGLA 5FDXA 2IW8A 2QO7A 3FWQA 4L01A 5HI2A 3I60A 3LCTA 4A9UA 2QOBA 2RG6A 3NNXA 5CTPA 5CF5A 3TTIA 2QOHA 5KMNA 3QL8A 4GYGA 4IZYA 2JDTA 4UMTA 3ZUTA 3QU0A 4PTEA 4PDOA 5IA1A 3LM5A 4PL5A 3D9VA 2P4IA 2Z8CA 4FGBA 4P7EA 3P7AA 1MRYA 3QRIA 1OPKA 3COIA 1R0PA 4LL5A 2JBPA 4XP0A 5J1WA 4E4NA 3BE2A 4DFLA 1GIIA 4O7RA 3PVGA 3G9NA 4D55A 1H00A 2YHVA 5BVOA 4AGWA 3VUGA 1PKDA 3CD8A 3L8PA 1TZDA 4PPBA 3UOKA 3TKUA 5IQGA 2F57A 2WTDA 3KGAA 3EFKA 3T8OA 3QQKA 4HYUA 4L44A 4W4YA 3P5JC 4DHJA 4ANNA 3C5IA 2BHHA 2WQOA 3RNIA 5CI7A 3RCJA 4DEAA 3F9NA 3KVWA 4K77A 4DTAA 4N0SA 5C8MA 4CTCA 3M11A 3OTUA 4U9AA 3NYNA 4EK3A 3C13A 2HYYA 2GQGA 3E92A 2OIQA 3HX4A 3UDTA 3PVUA 4ZS0A 3LXNA 4NKSA 4RZVA 5T6KA 4O2ZA 5JGDA 4AZFA 3FKNA 5FD2A 1XMLA 5DT4A 4A4LA 1H24A 3M1SA 1Q97A 3RTPA 5LQFA 4O0XA 4EOSA 4UWCA 2PZ5A 2XNPA 3N4TA 2E2BA 3TJCA 3VBXA 1BX6A 1K3AA 3BX5A 5LVMA 4DGMA 3DCVA 4JDKA 4YZ9A 3W0PA 4GU9A 1LEZA 5KMIA 4NT4A 3ORXA 2WMTA 4V04A 4ZTHA 3R2BA 5HOAA 2BFXA 4ZJVA 3LMIA 3UPXA 5M55A 4A06A 2O8YA 4WBOA 4WBBB 1CSNA 2OXXA 1XWSA 3IOKA 1VR2A 4Q9ZA 1FVRA 3C51A 3OT8A 3ORKA 2FGIA 4TYEA 4XRJA 4Z7GA 5CU0A 5J8IA 3MY5A 3D83A 1ZYCA 3AMAA 1OITA 4IC8A 3C5UA 2HZ0A 3BQCA 4KKEA 2BDWA 2NRUA 4JNWA 4Y8DA 4BCKA 5M07A 2QU6A 1OBDA 3LXKA 2X9EA 4KSPA 3ORLA 2GS2A 1Q61A 3Q04A 3FLWA 2IPXA 2QG5A 3EB0A 3PXYA 1OPLA 2LGCA 4ID7A 4PTGA 4OGRA 4AE6A 2BHEA 1W84A 2IZUA 4U40A 2VU3A 4WUNA 4ZTMA 5BQ0A 5LWMA 5EKOA 2ITYA 1ZLTA 4JQEA 3AT4A 3QTZA 5CEPA 2YLFA 4HJOA 5IA4A 4GT3A 4BDEA 3Q60A 5IUIA 3UODA 4YHFA 2BZHB 2ZV8A 5E8UA 3OFMA 1H1PA 4YPDA 2R64A 4O0WA 5C26A 2ZJWA 4ITHA 5LVPA 3RI1A 2XNMA 3IOPA 5HO8A 4PQNA 1NVQA 2UZTA 3VUIA 5GZ8A 3RINA 3GGFA 5JFWA 1DAWA 3R0TA 3EFJA 4EHEA 2VAGA 3F2RA 4JMQA 5M4FA 4E5WA 3WOWA 2RKUA 4NM3A 3WILA 1U4DA 4IJ9A 4NIFA 4AW2A 4BGHA 4IAIA 5CT7A 3IW7A 2UW5A 3PJ1A 1O6KA 2W5HA 3SG9A 3CPBA 2F9GA 4BDBA 3G6GA 5FTQA 2ZV2A 2VNWA 2CKOA 3O7LB 4JDHA 2OJFE 2WMWA 4ZTNA 4U42A 1OBGA 2HZNA 4G2FA 4KS7A 4I22A 5JQ8A 5JFSA 4DITA 5BUJA 4FR4A 4QMOA 5EOBA 3CLYA 4O4FA 4LGDA 5KX8A 4JX7A 3TKHA 2W7XA 4QP3A 2B53A 3KEXA 4R8QA 2ZFYA 4O38A 2C6KA 4C37A 3Q3BA 4XYFA 4XLIA 4IHPA 3ZBXA 1TKIA 3HGKA 4H1MA 3GC8A 3TV6A 5EOLA 4GKHA 2QOCA 4R3CA 1WAKA 1J1BA 1FGKA 3MVLA 3R6XA 2XAMA 1XH6A 3PSDA 4FIGA 1QMZA 2OBJA 2GTNA 5EI2A 3HECA 2Q0NA 3MGYA 5FQDC 1Q4LA 3FHIA 1JVPP 3SV0A 4FIIA 1IR3A 4RVLA 3SC1A 4AA0A 3UC4A 3W0OA 4DFYA 4BCOA 4B6LA 2C69A 4F78A 4S2ZA 4FIJA 3AGMA 4OT5A 3S3IA 4F9BA 4YJOA 2P33A 4XOYA 3UNZA 4BCPA 2C68A 4GK2A 2PVLA 4JAIA 4O4EA 5LVOA 1OKYA 3PSBA 2GS7A 3C4WA 3W55A 3VRZA 4EKLA 2QU5A 4DGGA 3NSZA 5HLWA 2VD5A 3Q5ZA 3Q5IA 4NKAA 1XH7A 4R78A 2UUEA 4IACA 1V0PA 3Q9ZA 4HVGA 4HVIA 5CXZA 2WMVA 3PIYA 3GUBA 4GCJA 4LDTA 1Q99A 1G8KA 2WMRA 4MX9A 4WNMA 4F0IA 1UU8A 4IANA 4DE4A 2X6DA 3QUEA 3WZKA 3RAKA 3ANRA 2PTKA 4CG9A 4U3YA 3R8LA 3RZBA 4ZJJA 2CPKE 3GC0A 3QFVA 1YVJA 5E4HA 1FOTA 3LQ5A 4IFCA 3VBWA 1JKKA 3NDMA 3UOHA 2G15A 4C4JA 2EUFB 3TYKA 3O5AA 3LFNA 1G5SA 4GIIA 4FSUA 3ORZA 2QC6A 3E64A 3HMMA 5JFXA 4QTCA 4WG4A 1SVGA 4QO9A 5BV3A 3P1AA 1UU7A 2YIYA 3FKOA 4BBEA 4ZAUA 3OVVA 4FF8A 3FEGA 4XHKB 4E93A 4AT3A 3TMOA 4BY9E 3NPCA 4IEBA 1XH8A 5EI6A 3JUHA 4PDSA 3LFFA 3FYKX 3R7YA 1V0OA 5AMNA 4C62A 2HK5A 1ZY4A 5L8KA 1W98A 2ERKA 2CGUA 4MYGA 5ANJA 2ZYBA 4ZK5A 2GNJA 2ZM4A 2OLCA 2PE2A 3GB2A 1OGUA 4M14A 3OWLA 2PMOX 3RAIA 3LFAA 2I0EA 4RFZA 3MFRA 5H8EA 5AX3A 5ACKA 2BIYA 4GFMA 4U80A 3OBJA 4H36A 4I5MA 3BEAA 3HEGA 3OW3A 3TV4A 3VS0A 5E1EA 3PIZA 1JOWB 2YWVA 4FKQA 5DR6A 1JWHA 4YTCA 4FICA 1GAGA 3WE4A 4FG9A 3L8VA 3H0YA 4LOPA 4DEDA 3O17A 1T46A 2B54A 4YLKA 2C5NA 4O86A 1G8AA 3O8PA 3FZSA 4ZSGA 1ZRZA 4I23A 3BHUA 3P86A 5BMSA 1UWHA 5KZIA 2JIVA 1XH4A 4U5JA 3OW4A 4OTPA 3W0QA 3ENHA 3PTGA 3DAEA 3BI6A 4FYNA 5TKDA 3R22A 3ZZEA 5DPVA 3L1SA 1PW2A 2ZOQA 3TKIA 4XG7A 3IONA 3Q9YA 4FNXA 2C47A 1M2QA 3R9OA 3OS3A 1B39A 4C2VA 4UEUA 4FBXA 2AC3A 4BVUA 4ZS4A 3LCKA 4EOKA 1ERKA 3R83A 2V0DA 1QPJA 5ANDA 3FQHA 3WF9A 2BIKB 5EDRA 4CNHA 4I21A 4HZSA 4O7WA 2CKQA 2ZB1A 1OMWA 3KK8A 1PXJA 4GSBA 4NW5A 5AAGA 3P78A 2XB7A 1H08A 1OL5A 2XA4A 2F7EE 2BILB 1S9IA 3QTSA 3NNVA 4G16A 3VBYA 2W1CA 5DA3A 5TE0A 1W0XC 3TDWA 4JI9A 3BHHA 3KVXA 1E9HA 1YI3A 2R3NA 4S33A 1TQPA 5IQHA 2XRUA 4E6DA 3OY3A 3POOA 3QD0A 2QOOA 3O51A 2UZNA 4XS2A 1CDKA 2G2IA 4ZSJA 1H8FA 4FSYA 4N6YA 4FTTA 5AP2A 2QNJA 3DQXA 4EC8A 5E7RA 4IWOA 5K5XA 3U6HA 2RIOA 4CVAA 4TNDA 4XH6A 4DCEA 3A60A 2YISA 4FG8A 3RK7A 1JKSA 2VTOA 3VHEA 2Z60A 2ITUA 4XBRA 4B9DA 3N4UA 2OICA 4E6CA 2PMNX 3W0NA 3FMJA 3CCNA 4XG8A 1I44A 5AIRA 3LXLA 2OF4A 5JZNA 4BIBA 2BAKA 2PVYA 3PUPA 3DU8A 3R73A 2PZIA 5D1JA 4D9UA 2QO2A 4ZTRA 2W1ZA 3FY0A 3GI3A 3BHVA 5DT0A 4IZ7A 4YSJA 1IAJA 5I4NA 3EKKA 3EL8A 2WFYA 4RFYA 4JG6A 2BZKB 3WI6A 3AKKA 4NK9A 3OCSA 4ANOA 4UY9A 3DAJA 4E4LA 4CMUA 4GYIA 3V5LA 4EOPA 3FPQA 4E1ZA 3RPSA 3HDNA 3QCYA 4OBPA 4L9IA 3G15A 3M42A 4D5HA 5HX6A 3TNPC 3QUPA 3NAYA 4FV3A 2IW6A 4U6RA 4WNKA 4DN5A 5M09A 1ZARA 2QR8A 3R02A 3A7JA 3FI4A 2FSLX 1QPCA 2A27A 2R3LA 3ZC5A 3VS5A 3KULB 2VNYA 3G90X 3IGOA 1H1WA 3EZRA 2B4SB 2C6DA 4FKOA 4A9RA 4BCNA 4CSVA 5HIEA 2HOGA 2R3KA 3HKOA 4YC3A 4UX9A 3RCDA 3DPKA 4FRFA 2PVRA 3GCSA 3H9FA 2UZLA 4FSRA 4PNKA 1L8TA 1UVRA 4Z9LA 4EYJA 4I4EA