4QO9A

Mst3 in complex with danusertib
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
281
structure length
280
Chain Sequence
ADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 280
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qo9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qo9A01
4GW8A 3C13A 5F9EA 5HE3A 4NFNA 4FGBA 4AP7A 2IO6A 4JQ7A 4QYGA 4IHPA 4ZSJA 4B9DA 4G17A 5HQ0A 1OM1A 4KINA 2X6EA 2BFXA 5K9IA 2YEXA 3HV7A 4NH1A 1UWJA 3AD4A 1K3AA 1UNHA 3KFAA 4PPCA 3SQQA 3WZEA 3ZXZA 2W1ZA 3HGKA 2XNMA 2FSMX 4YBJA 3VUIA 4QQ5A 4AT5A 3ZRMA 4AG8A 1PMNA 4QTCA 3NLBA 2PUIA 5DR2A 3RZFA 2Z7RA 4UXLA 5IEXA 3IONA 4MWHA 4DGLC 3AT2A 4WSQA 4E7WA 4AN3A 1TVOA 3OOGA 5A4QA 3F5UA 1UV5A 2ZAZA 5FXRA 5E8UA 5HE2A 3HECA 3LCOA 3PZEA 4FV6A 4U7ZA 3ZHPC 4IW0A 4Q5HA 4CYIA 2WTCA 3ENHA 3NEWA 3I81A 4W8DA 4J8NA 5IQDA 2PVYA 1VYWA 2EXCX 3Q53A 3ODZX 3V8SA 3W2RA 3DAEA 3FJQE 4FZAB 3Q4UA 3RVGA 4USEA 1QPCA 3CP9A 4WNPA 4JT3A 3RBWA 4C37A 5E8WA 3ZU7A 3JS2A 4EH8A 4RQVA 3Q4TA 4FKIA 3ZO1A 1H25A 2G15A 4F1OA 3QLGA 4CKRA 2H6DA 3KRLA 3ZXTA 3LMGA 4HCUA 4U41A 4YC3A 4BGHA 4MXXA 5CT0A 4FMQA 3UIUA 5K5NA 2PVLA 4Y83A 1SNUA 5CAQA 1UKIA 1FVVA 1OL1A 2OF4A 1JKSA 4IC8A 5AAEA 3V5WA 2GNLA 3GXLA 3B8RA 4JG8A 4JBQA 1I44A 3BHVA 4XV1A 2CLXA 4K6ZA 2J51A 5IQGA 2C3LA 4FKJA 2OGVA 4QTDA 5K4IA 4FBXA 4PDOA 1M52A 3BE9A 3MTFA 3F6XA 3MWUA 3PSCA 3COHA 4C61A 4I1ZA 2ITOA 3E5AA 4C4GA 3DJ5A 4UALA 3E88A 5AP3A 4C4HA 5C4LA 1V0OA 2UW6A 3WZJA 3LM0A 4O7TA 1JLUE 5AP5A 3AC3A 3GU4A 4O1PA 2JAMA 3QD0A 4RG0A 2C68A 4MHAA 3RK5A 4EC9A 4G2FA 5JQ8A 5M07A 5AUZA 3HV3A 3TNWA 2VX3A 4BZDA 4DCAA 3CIKA 5T6KA 2C6KA 4QTBA 4DT8A 2QOQA 4RFZA 3D7TA 3C0IA 1JVPP 4RJ4A 5CENA 2FSTX 5BVKA 4JQ8A 3L9PA 5KKRC 5EM8A 1XH6A 3QX4A 4FIFA 3Q32A 3GU5A 5GIPE 3RTPA 5A4LA 4IH8A 5LQFA 3RNIA 3SRVA 3CGFA 4FZFB 2P4IA 3RNYA 3MESA 5FG8A 2GFCA 4WRGA 5E8XA 5I0BA 4TYIA 4K9YA 5EQYA 5LMAA 5GJGA 3ORMA 3PSDA 4W4XA 4FODA 4NM5A 3TNHA 4NW5A 4IDVA 4IVCA 2ZOQA 4RWJA 4CKIA 5IH6A 2ZV8A 3MTLA 3NIZA 3WE8A 2PK9A 5HOAA 2EVAA 5CU2A 3OEZA 3C7QA 3EQHA 5JRSA 5AA8A 2OIBA 5AM6A 3ORLA 5LCKA 5M57A 4U40A 4BDAA 3VAPA 2VNWA 1SM2A 3WZDA 2W0JA 3CQWA 4L7SA 4RT7A 4AW5A 4D2VA 1YOMA 3F9NA 2QHMA 2XM9A 2PULA 1H1PA 2WTIA 4M0ZA 4C34A 4YLJA 2C6TA 3DZQA 4CZTA 3A62A 4FVPA 4Y5HA 1HCLA 3P7CA 4DCEA 4F1TA 4D28A 3TT0A 1PMUA 1JWHA 5L4QA 5CAUA 3FY0A 5CS6A 4U80A 1OUKA 5M55A 5AV0A 4NUSA 3CTHA 2WNTA 3GQIA 3I6WA 3PA5A 5K3YA 3FMMA 3R7UA 2YAAA 4ANNA 2IJMA 3DFCB 3HMMA 4MQ2A 4QP9A 1REKA 3PPJA 4BBFA 4O7YA 4NIFA 4IVBA 5A4TA 3E92A 4I92A 4M14A 1WBOA 2BRGA 3I5ZA 4ZY5A 4F6UA 3FQEA 3P23A 3QQHA 4L68A 5EW8A 3PJ2A 2C1BA 3DKOA 3DLSA 3GNIB 4DGNA 4EH3A 3OWPA 5F94A 3WZKA 4DEGA 3LQ5A 3S3IA 3VRZA 2VX0A 4CSVA 3UC3A 4AZSA 4II5A 2HENA 5HVYA 5B2KA 3SKCA 1DI8A 3ZO2A 4NWMA 4OT6A 2G9XA 5IU2A 3G33A 3Q52A 3C4FA 2PMLX 5LWNA 3R1QA 2XMYA 4CV8A 4NKAA 4XG9A 3QKLA 1M2QA 3SXSA 3OD6X 2QC6A 2F2UA 2O2UA 1PXKA 3R8ZA 2X1NA 2VD5A 3CCNA 3VQHA 3FMNA 1MQ4A 3H0YA 5AAGA 4WKQA 3TG1A 2X0GA 4AOJA 2JGZA 3N4TA 3COIA 2GQGA 3R6XA 1PHKA 4APPA 4FSTA 4AUAA 5CVGA 5D7VA 4J97A 4UV0A 4CXAA 5IH4A 4YTFA 3ET7A 3MPMA 1ZAOA 3KF7A 4FV3A 4JVGA 4XBRA 3NAXA 1O9UA 4FV2A 3LFAA 1W84A 4OLIA 3RGFA 3OCGA 3QQUA 2UW4A 2UW7A 3UP2A 5IQIA 2WMAA 2PUUA 3ZLWA 4Q9ZA 3QAME 4EHGA 5LVOA 3G9NA 4D4YA 3UZTA 4AXAA 3FKLA 4Z16A 3SD0A 4EOLA 3I1AA 1XH8A 5IQBA 4DE4A 2YDJA 3KF4A 4RA5A 4O1OA 4F63A 3HA6A 4QT1A 5E91A 4KS8A 4AGWA 3IOPA 2A19B 2H8HA 5DRBA 1JAMA 4IJPA 5IF1A 3JYAA 5DYJA 2X8DA 4HZRA 1IA9A 4J53A 5IA5A 4F65A 4D0WA 4EH9A 3UPZA 3FLZA 4F9AA 4K33A 4L9IA 5HX8A 3Q4ZA 4YSJA 4ARKA 3HYHA 3CTJA 3OUKA 4J1RA 5DNRA 5BVWA 1Q8TA 3FL5A 3MJ1A 4LM5A 5KE0A 2XRWA 2X7FA 1GIHA 5CU6A 3QZFA 5ACBC 4FTAA 5EYMA 2WTKC 2OJ9A 3TNIA 4F70A 5GNKA 5B0XA 3HAVA 5D12A 4AE9A 5L6OA 2ZM4A 3E87A 4RGJA 1PMVA 4ANBA 4FV4A 1NVRA 4LQMA 2XNGA 1UU8A 2UZDA 3KXZA 5A4CA 4F1MA 5CEPA 1ZRZA 5HX6A 5IUGA 4M68A 3WF5A 3FPMA 1PXIA 3VBWA 5AJQA 4RC4A 2OIQA 1U46A 3OROA 4JJRA 4U6RA 4AS0A 3BGZA 1KE5A 1JQHA 2BDFA 5IISA 2FVDA 5FP5A 4BI1A 1GIJA 1W98A 2VV9A 2X8IA 4FKWA 4FV9A 5FDPA 3TNPC 3UQGA 3N9XA 4CMOA 2VO0A 4H1JA 5AWMA 2Q83A 3BBWA 2FA2A 2YAKA 4AGCA 1V1KA 3JUHA 2JKOA 3TZ8A 4JIKA 4PP7A 4J8MA 3ZOSA 4H3QA 4B99A 4BB4A 5AV2A 2ITVA 4HNFA 4GK2A 5HNGA 5JRQA 2XK7A 4ASZA 3QD2B 4HCTA 2WTDA 3L8PA 3PY1A 5L2QA 2WMXA 3VS7A 1ZOEA 3GUBA 4WNMA 4C3RA 5CNOA 3PXRA 5J9ZA 4UMRA 2GU8A 1KE7A 2DWBA 2R3FA 3SX9A 3KXGA 3N51A 2YWPA 4BTJA 1ATPE 4RJ5A 3U51A 4AZFA 1UNLA 5HO6A 3D94A 4GK4A 2DQ7X 4TKSA 4EOJA 4D1SA 1U54A 5CAPA 1BX6A 4TYGA 3SW4A 2XEZA 3FV8A 2O0UA 4ANQA 3DTCA 1OL7A 4KKGA 4G9CA 2B52A 5J87A 3VRYA 4C33A 4F7LA 3DAJA 2J7TA 2BKZA 4O0RA 4BDBA 3I7CA 4HVDA 5TR6A 2XKDA 3TTJA 2J0KA 2CCHA 3NCGA 2WMUA 1H01A 5GJDA 5BMSA 3P9JA 4FSUA 5LCJA 2YM8A 2R9SA 2H9VA 4C2VA 1HCKA 3I5NA 1AQ1A 3OXIA 2UW8A 3VF9A 5AUTA 4U97A 5M09A 3GCSA 4F0GA 3A8XA 4NM7A 2Z8CA 4ZEGA 3UO6A 3V6SA 4PDYA 3RCJA 3VUMA 4QMNA 4I22A 4BZOA 2OK1A 2W96B 3E93A 3PVUA 4Y5QA 3ZUUA 4YZDA 4GU9A 4YHFA 5DN3A 2QI8A 1ZY5A 3DBCA 2EXMA 3HUCA 4L43A 4V04A 4FTKA 3PLSA 1OIUA 3VBVA 2R64A 2XIRA 3KRXA 2IVTA 2O65A 3ZZWA 3LCSA 4EOPA 4FKQA 3THBA 1O6KA 4JDIA 4DG0E 1O6YA 3SHEA 2W1FA 3KB7A 4IAIA 5E9EA 4RA4A 3ACJA 4XJ0A 4RZWA 2YHVA 5I9ZA 3L9MA 3D7TB 5FEDA 4FEVA 5GINE 3GU8A 4FKTA 2ERZE 4ZXTA 4CQEA 2CJMA 4TNBA 3T9IA 1FINA 2R0IA 2YJSA 4J98A 2JKQA 5L8JA 3ITZA 4I93A 4AU8A 5JFVA 1YI4A 4DF3A 2YCQA 3SRVB 5IA2A 4MX9A 5BUEA 1BI7A 1IEPA 2UZNA 1ND4A 3UODA 3ENMA 4QRCA 5M4CA 2V0DA 3F82A 2UZVA 2F49A 2Z7SA 3LLAA 1APME 3EN7A 3BQCA 3OT8A 3VS0A 4CCBA 1FMOE 3LM5A 5FQDC 3VVHA 1Q61A 4EBWA 3EQIA 2NRUA 2WZJA 4YU2A 5J5TA 2R3JA 3BU5A 4ZTRA 4RIXA 2Z7QA 4BCIA 1CKIA 1JSTA 5DT0A 4A4XA 4LOOA 2VGPA 4M13A 4XV2A 4BYIA 3COMA 3ORXA 3OZ6A 4JQEA 3RJCA 2BIKB 4KSPA 2LAVA 4WUAA 5JT2A 4R7BA 4PP9A 5E1SA 4ZSGA 3NR9A 3RAIA 4UWCA 3WBLA 2BAQA 3REPA 3PRFA 1M2PA 2ZV2A 3EWHA 5IA4A 5J7BA 2BVAA 4ACGA 2CKEA 3MY1A 5AFVA 2XKCA 2ETMA 3QHRA 4YO6A 5KHWA 2F7ZE 5KCVA 3OS3A 3P78A 4UXQA 3IGOA 1E9HA 5GZ8A 5AV4A 1OIYA 2ONLC 4PMTA 4PY1A 5CEQA 4WBBB 2JKMA 3BHTA 3RPVA 2GTNA 2C69A 3A2CA 3OVVA 1YOLA 1JKKA 2J6MA 5CXHA 1H26A 2A27A 1BL6A 3EQGA 4YZNA 4X3FA 4LOQA 4FGRA 4BWKA 3PWDA 4DFUA 2W1HA 3E3PA 4FTMA 4ZSEA 3ROCA 3U4UA 2R3RA 1ZOGA 3OWLA 3Q9XA 3E7OA 2VWVA 3FQSA 3HDNA 4WUNA 4PX6A 3BLRA 5TF9A 4CRSA 3VC4A 4IM3A 2RFEA 3FLWA 3RCDA 2JDVA 4I3ZA 3FQHA 3VBYA 4PL3A 4M8TA 3PUPA 5GHVA 4H1MA 3HKOA 3EQDA 5M44A 2VTRA 2W1IA 2XIZA 4U3ZA 4DGOA 4IWOA 1Q3WA 3K3JA 3L1SA 3OCTA 4G3DA 2KULA 3PWYA 4O96A 3PPKA 4JDJA 3LMHA 4FK6A 3UYSA 1Q97A 2RIOA 2PVNA 1IG1A 4JOAA 4JR7A 4QMYA 5AIRA 1H0VA 3R8UA 4EYJA 2B0QA 4FV0A 4EORA 2FYSA 3HRBA 3HA8A 1VEBA 3FBVA 5EQPA 4IX5A 4LGGA 3EN5A 4A7CA 3T3VA 2PHKA 5HE0A 5FBNC 2AUHA 3R30A 4RWLA 5CNNA 2EB3A 5CF8A 3CKWA 3S95A 1XHAA 2J0IA 3HP5A 4U8ZA 4R3CA 4ENYA 4YJVA 5LVMA 4BDHA 3VUDA 5E7RA 4ALUA 5J1VA 4YHJA 3BRBA 3ETAA 4M69A 3PY3A 3TTIA 3VS5A 4BF2A 1BMKA 3UE4A 4BBMA 4O86A 3QTUA 2XVDA 2OBJA 1YI3A 3ORPA 4YGAA 2GMXA 5CSPA 3LXLA 4ANMA 1OBGA 2OWBA 3S0OA 3ORTA 1G3NA 1Q3DA 5F20A 3TI1A 2GSFA 2PYWA 4O7RA 3RHXA 2C6OA 2QU6A 2PE1A 4QMXA 4BDCA 2IZTA 4GCJA 4O0WA 1Q41A 2W99B 3VQUA 4LOPA 3F5PA 4P2KA 5HLWA 1KWPA 1OL2A 2XK3A 2GS2A 2YLEA 3FZ1A 3ZC5A 3ZSGA 3DXNA 5HBHA 4DA5A 2YCFA 1YI6A 2C5VA 3QRKA 4WNKA 3HV4A 4Z9LA 4NW6A 4FG9A 4QTEA 2WU6A 4BDDA 4JLCA 1YXVA 3V8TA 3OBGA 1YKRA 3HEGA 4P5ZA 2R7IA 3NW7A 4B6LA 4DC2A 4RZVA 2XK9A 3LPBA 3AMAA 3MYGA 4FV8A 5FXQA 2P2IA 5AP2A 5HLNA 4U45A 1SVGA 4JR3A 4ASXA 4ZS4A 2CNUA 1UVRA 3LIJA 2VRXA 4S30A 4AQCA 1MP8A 3AD6A 3QA8A 3R1SA 4MNEA 4YMJA 4S31A 2YM6A 3K54A 3FSFA 2W4OA 2ERKA 2I40A 2QO2A 5D9HA 5ITAA 4R8QA 5J8IA 5TOZA 4WG5A 3U4WA 4EQCA 4NL0A 3ELJA 5HD7A 3MY0A 3UIBA 2V5QA 2ZDTA 3MH2A 4F7SA 3QBNA 5CAVA 4P5QA 3BGPA 3C0HA 3AC1A 1DS5A 1ERKA 1GY3A 2C47A 2ITPA 4JXFA 5IPJA 4UMUA 3MFUA 4O0VA 4IAAA 4PRJA 4XRLA 4F9CA 3CBLA 3DFAA 2JD5A 2WOUA 3MH0A 2OF2A 3G9LX 4FK3A 4YC6A 4DLIA 1ZYDA 3R9OA 5H8BA 2QD9A 1XBBA 2WIPA 3F3VA 3PG3A 3OY3A 4NJ3A 4B8LA 1OVEA 3FUPA 1L3RE 4FL3A 4D2TA 4X3JA 3QTIA 5IA3A 4JBVA 4DTKA 4BZNA 3UOLA 5HG7A 3VBXA 2F4JA 2GPHA 1LPUA 1ZY4A 3BEGA 3PE2A 4GJ2A 2OIDA 5JZJA 2UV2A 4U79A 3RI1A 2J5FA 3C4XA 1REJA 1U54B 1Y6AA 5AMNA 5L8LA 4ZY4A 2RF9A 4A07A 4FR4A 4Q5EA 2C1AA 1JPAA 4QTAA 4FSNA 4QPMA 2PVKA 3DK3A 3ZUVA 3R02A 5AX3A 4BN1A 4QQCA 4PTGA 1RQQA 4YTIA 1ZYSA 4NM3A 3I6UA 5KBRA 1DI9A 4BDGA 1E1XA 3TUDA 3UOJA 4OAUC 4K0YA 3H9OA 4CNHA 2YERA 3B2TA 3MJ2A 4JRNA 4B0GA 5HVKA 3DXQA 4ACHA 3NVKI 4FTIA 4NFMA 2GQSA 4U3YA 5HO7A 3CQUA 3IKAA 3WYXA 3ALNA 5AIKA 3RPOA 2O3PA 2OSCA 5CU3A 3QRTA 2Q0NA 4FKSA 2DUVA 3BWFA 2C4GA 4X2GA 5I9VA 3KY2A 3QCYA 3VJNA 5LMKC 4YC8A 2C0IA 5CF5A 3HV5A 4GSBA 1WBTA 4RJ8A 3V6RA 4UB7A 5AUYA 1DM2A 1W7HA 4ITHA 3HRFA 5AR8A 1IAJA 3NNXA 1WMKA 3W33A 2RL5A 3ZH8A 4IACA 4KNBA 2I0YA 1RE8A 3QRJA 3F61A 3F3UA 1OKWA 2OZOA 4JBOA 4IX3A 1A9UA 3FC1X 3UNZA 3R7EA 3EQRA 3WZUA 2P33A 3R1NA 2BRBA 2Y6OA 2VTPA 2ITUA 5AV3A 4PDPA 2I6LA 4A4LA 3LW0A 3RK7A 2QCSA 3Q5ZA 4AF3A 2OICA 1Q8WA 4XUFA 3QALE 5EW3A 4L3JA 3W18A 4L42A 3T9TA 4D4SA 3O17A 4E6CA 4O38A 3BPRA 3DB6A 3IPHA 5J5SA 1CKJA 3F7WA 3O50A 3NNWA 4FNXA 2WD1A 2VU3A 2J90A 3F5GA 4X6QC 1QMZA 3ZRKA 3NVMB 3GU7A 3PA4A 3I4BA 3BLHA 3KVWA 2QOOA 1J1BA 4G1WA 5KNJA 3VUHA 2W5BA 2GDOA 2CPKE 4EOQA 5C27A 2VWBA 3KMUA 4ASEA 3U9NA 1R3CA 4ZLOA 3MDYA 4GFGA 2C6IA 4M84A 4LUEA 1M7QA 2WPAA 4OBOA 4GT3A 4EZ5A 4FF8A 1VYZA 2V22A 4FNWA 5FRIA 4NYEA 3VO3A 3SV0A 3NW6A 1RJBA 1ZLTA 2VTSA 5FBOA 5AUXA 1FPUA 3D2KA 1JBPE 1H07A 4RIXB 4EBVA 4U9AA 3UG1A 4BCKA 2BUJA 2W9FB 3ORKA 1A48A 4V0GA 4HW7A 4MXYA 4NCTA 3WIGA 4E6QA 3LFCA 3LCTA 4IAKA 3HMIA 4F08A 2ZJWA 4MBIA 3P4KA 5IQFA 4PUZA 3UPXA 2X7OA 2VN9A 2WELA 2RFSA 3GC0A 4BGQA 1P2AA 2CGVA 2X81A 1J91A 3A7HA 1HOWA 4JX3A 3NUAA 4MCVA 5IEVA 3RAHA 3T3UA 5L2IA 2IPXA 3MS9A 4O91A 3BHUA 4FTNA 5ANKA 5HCXA 5HCYA 3UJGA 4KWPA 1P4FA 3QKKA 1XBCA 3WF9A 4JAIA 3LJ1A 4ZIMA 2YWVA 3QGYA 5I9UA 1YDRE 3KN5A 3NZ0A 4O7NA 3UOHA 5DR6A 1URCA 3VW8A 1LEZA 2QR8A 4KBCA 2W05A 4X3FB 2IW8A 3PE1A 5K4JA 3H4JA 2F7EE 3IDBA 4FKVA 1NW1A 4RQKA 1R78A 4ZZMA 2X8EA 3C5UA 3ROYA 4OTWA 1XH7A 3QQGA 3DNEA 3MSSA 1YXTA 3KQ7A 4HYHA 3GEQA 2I0EA 5CEIA 3MVJA 3OUNB 2R3PA 5HEZA 4DEDA 5M4IA 3AC5A 3E8NA 4EOKA 1LR4A 4JIAA 1PY5A 4DN5A 2ZV9A 5DH3A 4FV7A 1R1WA 4JG6A 2C5NA 3O8UA 1BLXA 4CT2A 2CN5A 5L6WL 4PTCA 2HAKA 2QLUA 3D83A 3CQEA 3FLSA 3LFNA 4XX9A 4IE9A 4BICA 1CSNA 1YW2A 2A1AB 3AC2A 4N6YA 3VHEA 3V5QA 1Z5MA 1GJOA 2UZLA 4TYJA 5E90A 4AFJA 4DHFA 3K5VA 4MXAA 3W2QA 3TZMA 2HWOA 5CANA 2XJ2A 2R3NA 1M17A 2E9UA 3HRCA 4EQUA 4DYMA 1J3HA 3IO7A 3LJ0A 5CSHA 4R5YA 3LXPA 5J1WA 3Q2JA 3KXXA 3ZDUA 3B8QA 4ZJVA 4H05A 3BYUA 5AAFA 3QKMA 1WFCA 3MIAA 5BYYA 5FD2A 5DA3A 3VN9A 4AACA 1XKKA 5BYZA 4O6LA 3DLZA 3DNDA 4U81A 3OF0A 2X4ZA 3E64A 3FWQA 3O7LB 3UTOA 3SXRA 4LRKA 4M69B 2I0VA 4EC8A 1UWHA 2BPMA 3GGFA 3FXWA 4XHKB 2E9OA 3F2NA 2HZ0A 4IFCA 1Y8GA 4LUDA 4IAYA 4RLKA 3TWJA 2PMOX 2W5HA 3OTUA 1OKZA 3DBQA 3A7FA 1H27A 4JDKA 4JS8A 4QMUA 4WBOA 4W9WA 4R1VA 5AUWA 3FYJX 3U6HA 2VTQA 4AA5A 2JBPA 3KRRA 3LHJA 3MV5A 4AFEA 4I5CA 1NY3A 2OKRA 1QCFA 4DLJA 3R1YA 4DH8A 1VZOA 3NNVA 4YZMA 5HG8A 3O2MA 4ID7A 3NMUF 2BIYA 5CU0A 3PIZA 2XNEA 3EN4A 1ZYJA 3TCPA 2JIVA 2XBJA 3UYTA 5ANIA 3KCFA 2XA4A 4C2WA 5L2TA 1ZWSA 4QMSA 5EQEA 1B38A 3A99A 3PY0A 2BALA 4MD8E 3U54A 3ZLSA 1TQIA 1SZMA 3ULIA 3TUCA 2XCKA 4MNEB 2JIIA 4N0SA 3H30A 4TWPA 4NSTA 3BE2A 5AP1A 1KE9A 1M7NA 5EM7A 1WAKA 3LXKA 2X2KA 1PJKA 2B9IA 4UWBA 2BZKB 1KE8A 1NVSA 2QQ7A 3QYWA 2WMQA 3E8DA 4FZ6A 4QPAA 3D14A 3EZVA 1SYKA 3VJOA 2W1EA 4L45A 3HNGA 1Y91A 3DQXA 3TKUA 4EEVA 4IZ7A 1GOLA 2B54A 5HE1A 4KSQA 4N6ZA 1R0PA 3GQLA 4OUCA 4TW9A 4CMTA 3UDBA 5IA1A 4E20A 4YJPA 3D5WA 4J96A 2PVFA 3VS3A 2JBOA 2CKQA 3PJ8A 4CV9A 5DGZA 5CEMA 1DAWA 4O82A 1FOTA 5JSMA 5E8TA 5FM2A 3DCVA 4C4IA 4I24A 4YNEA 4F99A 5A14A 3PTGA 4HGLA 4WNOA 3FMDA 4USDA 3FE3A 2FB8A 4WA9A 4WOVA 3QZGA 5CY3A 3NYVA 4FYNA 3OY1A 3FMJA 4C38A 3TM0A 4ZTSA 4S33A 4I20A 1B6CB 1GZNA 3FL4A 4YHTA 4FT0A 4NTSA 4DEAA 4UX9A 5JH6A 2B9FA 5BQ0A 3H10A 2XYUA 4Y85A 3D2IA 5EW9A 4YJUA 3A7JA 5HVJA 3HAMA 5CF6A 2R3QA 1RDQE 4ACDA 4O0TA 4XP2A 3SG8A 3Q2MA 3BELA 4HOKA 4OTGA 5BNJA 4NKSA 4YJTA 5KX8A 4F6SA 3AOXA 5I4NA 3DA6A 4H3PA 4I5HA 4YZ9A 2VGOA 1YHSA 3IW5A 5CSWA 4OT5A 3EJ1A 4FSZA 3QGWA 3V04A 3FI4A 4BWXA 2OZAA 2FH9A 4CFUA 3D5VA 4BCGA 1XWSA 3I0QA 3PJCA 4YJNA 1Q99A 1J1CA 4IFGA 4W4YA 5BMMA 2CNVA 2ETRA 4XOYA 3A4OX 4E26A 4FG8A 4FOCA 4BCPA 1MRUA 2C3IB 3K3IA 5LXMA 4QOXA 5CTPA 3MFRA 3R2YA 3W1FA 4QNYA 4DFZE 3NYNA 3EQFA 4HZSA 5F1ZA 1Q8YA 2XJ1A 2HELA 2VTMA 1X8BA 4XYFA 2RKUA 3A4PA 3CXWA 3QTXA 2PPQA 3O23A 2BHHA 4PWNA 5A9UA 4RPVA 4FVRA 5E4HA 3WF7A 3EZRA 1W0XC 2Y4IC 3FPQA 2PUNA 3CJGA 4D1XA 2PZRA 4EK5A 5JEBA 5J7HA 3BYVA 3ACKA 4YURA 3GENA 4C35A 2XH5A 4QMMA 1GZKA 4WT6A 3NUPA 3AT3A 2WQOA 2YDKA 4O83A 2YLFA 5G6VA 2CMWA 4KIQA 4E5AX 4RIYA 2QONA 2Y8OA 4KIKA 4MKCA 4UMPA 3RMFA 3ATTA 2O64A 4K8AA 4D58A 2UVYA 5C9CA 1NXKA 2PUPA 3MN3A 3DBFA 3QQLA 3VNTA 2E2BA 4BCQA 3JY0A 2YDIA 3DBDA 4X2KA 3EYHA 3KMWA 4IBMA 1IR3A 3EB0A 4BFMA 3MVHA 1XH9A 3E3BX 4J52A 4AW0A 1YQJA 4BTMA 2UUEA 4V0GB 3DOGA 5A3XA 5M53A 3W16A 3EFLA 3QZIA 4DEIA 3GP0A 2GHGA 2YACA 4ZSLA 4BI2A 4IVAA 5DEWA 2A0CX 4OBPA 4Z3VA 4ZJJA 1FVTA 1PYXA 5ETCA 3VW6A 2QVSE 4OGRA 2IW6A 3G2FA 5D11A 2WQEA 4BC6A 1ZOHA 2C3KA 1TQPA 4UZDA 3GBZA 2BDJA 5EM6A 2WEVA 3NS9A 5HTCA 2UZOA 4KRDA 4W8EA 5AUVA 2PZYA 4MD9E 4CFXA 3BEAA 3UO4A 1H08A 3TXOA 4ZZOA 4O0YA 3OOMA 2VWZA 4FX3A 4XP0A 5EFQA 2PVHA 5D7AA 4FE2A 3EL7A 4EH2A 1IASA 4ORKA 3VUKA 4P90A 2O63A 3UMXA 3G51A 3UIXA 5HKMA 2XK8A 4FEQA 4BIBA 4E73A 4O7ZA 5B7VA 3POOA 3QCSA 4L53A 3WF8A 4BVUA 4YR8A 4S32A 4TN6A 1YWNA 4Q9SA 4RWIA 3FKNA 5I9WA 1WBWA 4ITJA 3R9NA 3NW5A 5KZIA 4EHVA 3DXPA 3LQ3A 3H9FA 3ODYX 3SW7A 3M42A 3Q6UA 4TL0A 3P5KA 3GT8A 5K0XA 5M4UA 3BV3A 4UY9A 4I6QA 4L6QA 4BTFA 1SMHA 5FM3A 4GUEA 4PMPA 4NK9A 4DFBA 5JK3A 3KCKA 3QUDA 3F3ZA 2YFXA 4QPSA 3ZONA 4FG7A 4QMWA 1SNXA 3F69A 3IS5A 3NYXA 4IWDA 4LL5A 4WG3A 4YBKA 3W10A 2YCRA 5HI2A 4IM2A 5AR2A 3V3VA 1PMEA 3LOKA 3ZM4A 4A9UA 1ZZ2A 4Z55A 4I41A 1YOJA 1PW2A 4O2ZA 3OG7A 5IZFA 4FEXA 3ZYAA 1UA2A 4EJNA 4C7TA 1KV1A 2B1PA 4X2JA 2PMIA 1LP4A 2IN6A 3LFBA 1WBPA 2X4FA 3LFEA 4FT5A 3TKHA 4BBEA 2Y6MA 2BRMA 3C4WA 4HNIA 2IZUA 4JI9A 5EI2A 3UO5A 2LGCA 3O0GA 1YVJA 2CCIA 1WVXA 3A7IA 4NEUA 5EI8A 4EUUA 2V55A 5JFWA 2CGWA 4QMOA 3QFVA 3NUXA 1WVWA 3WILA 4C4FA 3UZRA 3CY3A 1UU9A 3EFKA 3QCXA 2XUUA 4TXCA 3ZFXA 3PXZA 4UBAA 2VTOA 4RJ7A 1IAHA 1QPJA 3O96A 3ANRA 1KUTA 2ITYA 3TIZA 4MTAA 3V01A 4GK3A 4DEHA 3WE4A 3KL8A 4DG3E 3MY5A 4QMLA 3IDCA 4TY1A 5HICA 2WAJA 2JKKA 5DOSA 1PRYA 2BZJA 4M66A 2BTRA 4PMSA 5L2WA 3OWKA 2OW3A 3W32A 5FTOA 4L7FA 3KXNA 3PXYA 3U6IA 4L3PA 4YPDA 2FSOX 4CMUA 1H8FA 2W1CA 5DT4A 4U44A 2F57A 2IZSA 1BKXA 4X21A 4G31A 4ZTNA 4DEEA 4YLKA 5IUHA 4GT4A 2ITNA 3F2AA 3EMGA 5JKGA 3TKIA 3OC1A 2VWUA 5CQWA 2XNOA 4I6BA 3POZA 4UEUA 3RALA 3M1SA 4PQNA 4RWKA 4Z7HA 2UW9A 4IJ9A 4TTHB 5E8VA 2OXYA 5EYDA 4BDJA 1FGKA 3LE6A 3S2PA 4CT1A 2BTSA 3UGCA 5A54A 4FNYA 2HXLA 2VUWA 4H58A 4QP3A 1GAGA 5LARA 3OXZA 4HGTA 4NIFB 2C5OA 2VAGA 3PA3A 5AR4A 4FOBA 2CHLA 1Z57A 3KRWA 3NX8A 5FWKK 1CKPA 3RPYA 3FLNC 4F9BA 2WGJA 4XLIA 5EDQA 2OO8X 4FTRA 2I7QA 1AD5A 4UZHA 5M06A 4EZ3A 3O8PA 2J0MB 4K1BA 3TEIA 3WIKA 3ZFYA 4FV5A 4CZUA 5BUJA 2Z60A 4QMQA 5LJJA 1PXPA 2Q0BA 2WMVA 4RX5A 5JMSA 2PSQA 5H8GA 4XS2A 4IX6A 2JDSA 4DGMA 4IAFA 2CNQA 4BCOA 4PPBA 3DJ6A 4G16A 2A2AA 2RSVA 1PXOA 2W1GA 5H3QA 2XNBA 4O7SA 5CVHA 2XM8A 3KEXA 1PXJA 1Q5KA 4H39A 4MYGA 2XRUA 3EH9A 2PY3A 5JN2A 3SA0A 2R2PA 2FO0A 2HZIA 4H3BA 4UYAA 3F2RA 3G15A 1RW8A 4G9RA 4BKYA 4HVHA 5HBJA 3V51A 1OL5A 1TQMA 2XIKA 2QOHA 2QOIA 4PL4A 3R7IA 4A9RA 4GYGA 2OH4A 2V7OA 2NRYA 4IWPA 3H0ZA 4BIEA 4E6AA 4BCJA 3R8LA 3WYYA 3QQKA 1PKGA 3P0MA 3VBTA 5TKDA 3C9WA 5F4NA 1U4DA 3T8OA 3C0GA 3KRJA 4O0XA 3FZTA 1OPLA 4ZLZA 2RFNA 4FC0A 2XJ0A 4LV5A 4XP3A 2GNJA 3R22A 1YWVA 3GB2A 4KBKA 5HBEA 5C01A 4M15A 5AADA 3UNKA 3R28A 5DBXA 2JFMA 4FIIA 2ZM1A 4O0SA 2UVZA 3C4EA 2RGPA 3AQVA 3KC3A 4FSYA 5DG5A 4YPSA 1ZXEA 4L00A 4YJOA 3VHKA 2C5XA 3QRUA 4MQ1A 3HMPA 4JNWA 4MNFA 5EM5A 3AC8A 5TT7A 2JC6A 2OG8A 2WMBA 4EOMA 2GS7A 4G3CA 5ANGA 4CEGA 2J50A 4EWQA 2OZAB 5KKRB 2DYLA 3Q04A 3UC4A 5BUIA 4DG2E 3TZ9A 2WQNA 3OCBA 3ZBXA 4R77A 3NIEA 5BVOA 1F0QA 4DBXA 2J4ZA 3BWJA 5FTQA 2JFLA 5HTIA 2C6EA 2XKFA 4FVQA 4J95A 4EHZA 4XG8A 5CI7A 4BRXA 4FKGA 2PZ5A 5LVNA 4HYUA 3PIYA 4G34A 4FTQA 4M12A 5EYKA 1GIIA 4B7TA 5EDRA 3NUUA 2SRCA 4I23A 5D1JA 3ERKA 3QF9A 4HVSA 5C1QB 2VTTA 3AD5A 4FI1A 4MK0A 1Y57A 4F6WA 2VWWA 5E1EA 3MBLA 3ORNA 3LFDA 3VIDA 4E5BA 2YM5A 3ZLXA 4U42A 2UZTA 4PPAA 4P4CA 2WTWA 4LRJA 1H28A 3OCSA 4A9YA 4RMZA 3UBDA 5H8EA 2XCHA 2OI4X 4ZK5A 4OTQA 3TV4A 3I79A 1QL6A 1R39A 5HIBA 3BLQA 3GCVA 1H1WA 1VR2A 4KIKB 1ZZLA 2FGIA 2WTJA 3RZBA 3TV6A 2HZNA 4DEBA 4CKJA 5M56A 3IDPA 5DIAA 2CGUA 2WMRA 2FUMA 2C5YA 3BZ3A 3GFEA 5G1XA 3PP0A 5JZNA 5EG3A 4I0TA 4G3GA 4I94A 3FMLA 4OTPA 4HYSA 5FLFA 4FT3A 3RPRA 3MGYA 2PZIA 2Y0AA 4IAZA 2X2MA 3VF8A 3TNQB 4D2RA 3CR0A 2YCSA 2JDOA 4M3QA 3DB8A 5DR9A 4EZ7A 4ERWA 3CD8A 3GOKA 4MXZA 2Z02A 2UW5A 2GCDA 1Y8YA 4EH4A 5HTBA 1NVQA 3LQ8A 4L8MA 3DKFA 4CZYB 2W4JA 3KMMA 2BFYA 1AGWA 2VTHA 2ZB0A 3BIZA 2QG7A 4FTCA 2YZAA 1JKLA 2B53A 5ACKA 4V05A 3MIYA 3TJDA 5DFPA 5K5XA 3BBTB 3Q3BA 1FMKA 4GIIA 4KA3A 5EHOA 5HU9A 1TKIA 2XIYA 4G6OA 5DRDA 5EI6A 3FI8A 2WO6A 3SGCA 5JGAA 1OKVA 1F3MC 2CSNA 2BKKA 2HW6A 3SC1A 5A4EA 3R63A 4BTKA 4E4XA 3FDNA 3GCQA 3NUSA 4BWPA 4OTIA 2OJIA 4QP4A 2GHMA 2X9EA 2XK4A 3PRIA 3NCZA 3O71A 4LRMA 3FC2A 4XEYA 4D1ZA 3R7VA 2JDTA 2X9FA 5HNIX 3U87A 3OBJA 3D4QA 3P86A 1P4OA 2QOBA 2OXDA 4MD7E 3LFQA 4GL9A 5B2LA 5AP7A 3AXWA 4DT9A 2C6LA 4AZWA 4IWQA 4R3PA 1WVYA 3ID6C 1BI8A 3R9RA 5CWZA 4KUJA 3RK9A 4F9YA 3TDVA 4E3CA 3UP7A 4LYNA 3RPSA 4CFVA 4YUQA 3JXWA 4FKPA 3MH1A 4QYYA 3BYOA 2YZLA 2G01A 3DKCA 3U55A 3GI3A 1ZARA 3QC4A 2QNJA 3I0OA 3LVPA 3QTWA 4ZTMA 2REIA 4IMYA 4FIEA 2QLQA 4FIHA 1U5RA 3HDMA 3PJ1A 4PF4A 4U5JA 5I3RA 5M51A 5M08A 5IG1A 5IMXA 4ZAUA 2ZDUA 2YABA 1YDSE 3V8WA 4E1ZA 2PZPA 3FZPA 4XV3A 3RWPA 4ALWA 1SVHA 4QMTA 3MA3A 5DPVA 4NTTA 4XG7A 2B55A 4XBUA 1OMWA 5CSVA 5TE0A 3AGMA 1K9AA 4CLJA 2WIHA 3ATSA 2XF0A 4A06A 4BHZA 3OWJA 2OJGA 3QTSA 5AV1A 2WQBA 5CX9A 5T3QA 3Q9ZA 2BAJA 2WTKB 4FT7A 3R9HA 4DH5A 4MH7A 2VZ6A 2WEIA 2BCJA 3R01A 5GZ9A 1V0PA 4KIOA 2WFYA 5CAOA 4ZOGA 3F66A 4LL0A 4DAWA 1L8TA 2BILB 4FTJA 3CGOA 4GG7A 5TO8A 3RAWA 3RKBA 3NWWA 4YO4A 3UNJA 4EONA 4JX7A 4XG2A 4E93A 2PVMA 3MPTA 3ZTXA 3QTZA 4L44A 4XRJA 4C8BA 4Y72A 5DMZA 2WOTA 1H24A 3BI6A 3QRIA 4QYHA 2R3MA 3QC9A 3MFSA 3ZSIA 4JBPA 4EOIA 5BVDA 3PLAE 2B7AA 4NU1A 1LEWA 3S4QA 2UW3A 5L3AA 3GC8A 1EH4A 2JEDA 1PXNA 2OJFE 3EQBA 3SDJA 4E5WA 2R3KA 3LLTA 4KRCA 5IQHA 3TUBA 4E4MA 2W9ZB 3CY2A 1P14A 4RIOA 2VTAA 4BHNA 5AR3A 5EKOA 3P1AA 2NP8A 5J9LA 5KUPA 4FV1A 3MVMA 3JR1A 5EOBA 4GV1A 5C03A 4EYMA 1VJYA 1BUHA 2XNNA 4D2SA 4BY9E 3DAKA 1KE6A 3PFQA 4R7HA 4ZSAA 4YLLA 2J2IB 4EH7A 2ZYBA 4CG8A 4XH6A 4YJQA 2QG5A 3D7ZA 5HU3A 2OU7A 3TN8A 4WIHA 3FLYA 2ITXA 4P7EA 1XO2B 4CVAA 2F2CB 4RJ6A 3M11A 5M4FA 2H34A 1Q24A 3BYMA 2FSLX 4Q2AA 5KHXA 4GH2A 3QCQA 2E9VA 4OAVB 1V0BA 2BRNA 3QLFA 4AX8A 3D9VA 2YIYA 1Q62A 4HVIA 3E63A 4O7VA 2BROA 5AM7A 1YHWA 1I09A 4RVKA 4C4EA 3DK7A 4F0IA 3V5PA 2ZMDA 3AGLA 3NSZA 1OIQA 3LFSA 3QA0A 3W8LA 2AC3A 4DFNA 1WBNA 1UU7A 5HGIA 5L2SA 2OH0E 1Q4LA 3PIXA 4L01A 4CFNA 3QD4A 4V01A 2HY81 2RG6A 5H2UA 3VUTA 5JGDA 5KMIA 4K2RA 3M2WA 2VWIA 1E1VA 2QKWB 1OBDA 1ZMVA 2G2FA 4HCVA 3W2OA 5LMKA 2OLCA 2P2HA 2XIXA 3PVBA 4FUXA 5FDXA 3CPBA 2WKMA 4WD5A 3A8WA 3C51A 3K2LA 3DZOA 3H3CA 3OMVA 5EH0A 3HVCA 4J99A 3RHKA 4AOIA 4F4PA 2P3GX 3EQCA 1Q8ZA 3E8EA 3NUNA 4IADA 4LV8A 3GC7A 3VBQA 2P55A 3MB7A 5C26A 2VTLA 3HUBA 4R7IA 5CXZA 2GTMA 1A06A 3V5TA 3R73A 4PMMA 4QD6A 2ZB1A 3CD3A 4GFOA 4YJSA 3NDMA 5AP0A 3ZEPA 4NZWB 5CT7A 4PTEA 3NRMA 3SLSA 3HV6A 4RFYA 4TWOA 4FL2A 4G3EA 3UQCA 1OB3A 4KIPA 5KZ0A 2A4LA 2XBAA 4ZZNA 4PNIA 2YN8A 3KA0A 2QURA 3MI9A 3O8TA 4YZBA 2C6MA 1YHVA 5AR7A 3AG9A 3E7VA 5HO8A 5IDPA 3QTRA 2VX1A 4K11A 3CEKA 4I4EA 4KKEA 4GJ3A 3VS1A 4QP6A 4AWIA 3AT4A 4CTCA 5KMKA 2AYPA 3DBEA 5IQCA 3OFMA 3S1HA 2C3JA 5J9YA 2RG5A 3PXKA 5ANOA 3BYSA 3LKMA 3PPZA 4A9SA 3MVLA 4ITIA 2J5EA 4LMNA 3ZDIA 2NPQA 1FQ1B 3LJ2A 3UQFA 4XOZA 4C4JA 3TL8A 4C0TA 3FXZA 2UW0A 3EYGA 4QNAA 4IM0A 4UMQA 3LCKA 2WMTA 2ACXA 2VO7A 4Y46A 2GS6A 4M0YA 3G0EA 5C8NA 5ANDA 4EH6A 5F95A 4FSQA 5CYIA 3DTWA 3ZRLA 3MFTA 2PE0A 2YIRA 2HWPA 3C50A 4GRBA 5KMMA 3NYOA 3DJ7A 4RLLA 2HW7A 4GUBA 4HGSA 3ZC6A 4FEUA 3C5IA 3FZOA 2IVUA 3F3TA 1FBNA 3P7BA 1STCE 4D9UA 1OITA 2IVSA 3F5XA 4TWNA 5DI1A 4BGGA 5HIEA 5IQEA 4E6DA 2QU5A 3KXMA 5CQUA 4Y8DA 2JITA 3FSKA 1T45A 3BQRA 3PVWA 5I9XA 3P79A 2ZV7A 3KK8A 1XR1A 4FIJA 1MUOA 3CC6A 3PJ3A 1H1QA 2GNGA 1GNGA 2J9MA 4RIWA 2W06A 3Q9WA 3R21A 4BYJA 2VTIA 4OTRA 4BKZA 3SOAA 3TACA 2C0OA 1OECA 3COKA 4AA4A 2ZM3A 2WMSA 1OPKA 4FZ7A 3DU8A 5JFXA 3D5UA 4EOSA 3EIDA 4AT4A 3CPCA 1H4LA 1F5QA 4D4RA 4D2PA 2I0HA 5AA9A 4X0MA 5I9YA 3LZBA 5EHYA 1FVRA 3UMWA 1OUYA 3GCPA 4XG6A 2R5TA 4RVMA 5GIOE 4BL1A 4DINA 4S34A 4RBLA 3FMHA 3VULA 5HORA 2R3OA 4WRSA 4IZYA 3JVRA 4O22A 5ETFA 2OFVA 3A61A 4JRVA 1H1SA 4QYFA 5BVFA 4OTFA 2HZ4A 4KKHA 3F88A 4RX8A 2X7GA 3KK9A 3LAUA 2BR1A 3FI2A 4ACMA 2O8YA 4FEWA 3TV7A 3TIYA 4FTLA 4YTCA 4O7LA 4IX4A 2W7XA 2BAKA 5HCZA 4EI4A 3A7GA 3TZ7A 2E9PA 2PWLA 4OW8A 4MBJA 4X2NA 4PV0A 3QD3A 2VTJA 4C58A 5KBQA 3CJFA 4FKUA 4EUTA 3I7BA 3MH3A 4O21A 3R7GA 4A4OA 3CS9A 3KREA 5C4KA 3LXNA 2GNFA 3QTQA 5C8MA 3NNUA 3W2PA 3MPAA 3U9CA 4L3LA 3EOCA 3QX2A 5EHLA 4M97A 2YIQA 3II5A 3BU6A 5CZIA 2B9JA 1U59A 5EYCA 4ACCA 5B2MA 4I6HA 4G3FA 4GYIA 4XMOA 2PTKA 4FICA 5GJFA 4C59A 4IZAA 4NJDA 2UZBA 5DVRA 3RP9A 4YZCA 5GZAA 3GCUA 3D0EA 2HY0A 3RWQA 3QU0A 3L8SA 2YJRA 2R3LA 4C36A 4CD0A 4F09A 3U8WA 4KAOA 5A46A 4F7NA 1BL7A 4ANLA 4CFMA 3EKKA 1G5SA 1YDTE 3FEGA 1XH4A 4HGEA 3UVQA 3FXXA 4BKJA 2CGXA 4IZ5A 5CZHA 3TDWA 2YM3A 3V5JA 3BV2A 3FHRA 3DKGA 2BHEA 4EK3A 3ORZA 5CLPA 3R71A 2GFSA 4U43A 2XZSA 2G2IA 5IEYA 4ASDA 3W8QA 2EB2A 2J0JA 2OFUA 4DFYA 4C3FA 4IIRA 3G0FA 5E92A 5LMBA 3NPCA 5HNBA 3JVSA 4X6RA 3RAKA 1WZYA 4GKHA 1K2PA 5KMNA 4M67A 4R3RA 4ZY6A 3VS6A 4ZS0A 3C4ZA 3PSBA 5EOLA 3BX5A 5I3OA 5IDNA 2BDWA 4O27B 3BCEA 3Q4CA 5HLPA 3PYYA 4DITA 2CKOA 3FYKX 1UU3A 5IQAA 1UNGA 1WBSA 2VO6A 3R2BA 2PU8A 3DQWA 4E8AA 3LCDA 2ITWA 3G5DA 1G8AA 4LFIA 5CI6A 4RX7A 2JIUA 4RVLA 4QMVA 3GC9A 1U5QA 2ITZA 4QP1A 4D2WA 4WG4A 3EN6A 4QP2A 3NUYA 4L67A 3QUEA 4PDSA 2VO3A 1YXUA 5DEYA 3OW3A 4DH1A 5I5ZA 4EQMA 4FNZA 5LVLA 3QXPA 1ZMUA 1ZMWA 3VWAA 5J95A 2R3GA 4AW2A 4TZRA 5T68A 1BYGA 4BI0A 1KOAA 2VWYA 3I60A 3ZEWA 4YP8A 2PL0A 4X3FC 4I4FA 3DGKA 3HX4A 2B4SB 3KU2A 2HK5A 3FI3A 4FSMA 2HYYA 3RM7A 2XS0A 3N4UA 1MQBA 2Y7JA 4ZMEA 4FUYA 4HYIA 4LMUA 2E9NA 2YA9A 1MRVA 4N57A 3UZPA 2CN8A 4AGDA 4IB3A 3ULZA 1YRPA 2ESMA 3NGAA 4ZTHA 1NT2A 3PXQA 4OTDA 2ETKA 3W2CA 4CTBA 1UKHA 3KULA 2YM4A 3IK3A 1O6LA 1SVEA 1YXXA 4FZDB 3LMIA 1Y6BA 4I0RA 2R4BA 3DDPA 1ZYCA 4AAAA 1OL6A 4EK6A 3SVVA 4IDTA 3SOCA 3ZM9A 4R5SA 3IW4A 5DE2A 2XYNA 5HESA 1JSUA 4XV9A 5FXSA 4HVGA 1H00A 4TYHA 3R9DA 3U6JA 3EFWA 1J7UA 3R0TA 4BDEA 4FTUA 4GS6A 4W4WA 4L46A 5ANEA 2G1TA 3AMBA 2PVJA 4QYEA 4BDFA 3F7ZA 1JKTA 5A6NA 4L52A 3ZSHA 3BKBA 3RINA 3H9RA 3A60A 1YWRA 4ZP5A 5DHJA 2UZUE 3BHHA 2QOLA 4ANOA 3KVXA 5FUTA 5KMJA 3Q5IA 2X6DA 3EKNA 4CRLA 1H1RA 2XB7A 4XLVA 4TPTA 2QHNA 2WQMA 4XNEA 3WI6A 4QO9A 3KGAA 4MXOA 1YXSA 4R1YA 2VNYA 4JDHA 3OEFX 4QMPA 3IW7A 4RFMA 5FEEA 2W1DA 3OXTA 5HIDA 2HOGA 3HMNA 4GVJA 2QOKA 3HMOA 4IB5A 2GNHA 4FKLA 3ZZEA 3IOKA 1WCCA 1MRYA 4MVFA 3EFJA 3GFWA 3HZTA 4DFXE 2KTYA 3CTQA 3ZLYA 2XEYA 2B9HA 2HCKA 2Z2WA 3EN9A 4LGHA 4I5PA 4XG4A 2R3IA 3DS6A 4JG7A 4F64A 5L6PA 4GMYA 4G6LA 5ICPA 1OIRA 2BZIB 3UOKA 3ZUTA 3JPVA 2R0UA 3ORIA 4ALVA 4G5PA 2C6DA 4O2PA 2BRHA 4OR5A 4ZJIA 4KABA 3QQFA 5E8YA 3ZS5A 4N70A 3FMEA 1OGUA 4RSSA 1XH5A 3MB6A 4ANSA 3PVGA 3OHTA 1QPEA 4TWCA 4FSWA 5CF4A 5HHWA 5AX9A 3B2WA 4FYOA 2ITQA 3FZRA 3L9NA 3EL8A 4W4VA 4F0FA 4AN9A 3S00A 5E8SA 5DWRA 5ANJA 3DDQA 4KB8A 2X39A 5AEPA 4AZTA 3LFFA 2QOFA 3JY9A 3OP5A 5FEQA 3IW8A 2QR7A 4CFWA 4ZLYA 4O7WA 1M2RA 3HP2A 4J71A 4MWIA 4K18A 4F9WA 4UYNA 3N4VA 4KBAA 4OBQA 3KN6A 3OTVA 4JL9A 4DH3A 4Z7GA 1CMKE 3NAYA 4AZEA 3ALOA 4TRLA 2EXEA 1CDKA 4IC7A 2WMWA 1S9JA 2IWIA 4GIHA 4RC3A 4CLIA 4D0XA 3EQPA 4YSMA 4YTHA 4RIWB 4C57A 3R7OA 3QYZA 4IANA 2JAVA 4CCUA 4EH5A 5C8KA 2CDZA 1JOWB 3R8MA 4QQTA 2YM7A 3MA6A 4O0UA 1XQZA 3PXFA 4D4VA 3AMYA 4AGUA 4FTTA 5KMLA 1S9IA 5LVPA 3R8PA 3L8VA 4IVDA 1GZOA 4CFFA 4MAOA 4U0IA 5D10A 4G5JA 4Y73A 4MBLA 4BDIA 4TNDA 4E4NA 4RC2A 3EHAA 5EK7A 3OW4A 2YIXA 4HPUE 3R83A 3FAAA 4LG4A 4IXPA 3KKVA 4KS7A 2IW9A 5ETAA 2PMNX 2EU9A 3IQ7A 4ZTLA 2XKEA 2JDRA 1OI9A 4GFMA 1R0EA 3GOPA 3QHWA 4DBNA 2CLQA 3DV3A 4IEBA 4BIDA 1PF8A 2UZEA 5JGBA 4G6NA 4GT5A 4B4LA 4LI5A 4QP8A 3DK6A 2X2LA 3FLQA 4AOTA 3E8CA 4C3PA 5HG5A 2F7XE 3FY2A 3D5XA 5JFSA 3F3WA 5D41A 3ZMMA 5FTGA 4IB1A 5BYLA 3DT1A 4APCA 1KOBA 2YISA 3QWKA 5BX0A 2DS1A 1PXLA 1Q8UA 4I21A 3QL8A 3UVPA 4TT7A 4FTOA 1B39A 4I0SA 1PYEA 2WXVA 4UMTA 4CQGA 3DY7A 3R8VA 5DT3A 4AW1A 3G6HA 2V62A 5HG9A 2RFDA 3FMKA 5HD4A 3Q6WA 2XP2A 2R7BA 2UZWE 5CALA 2QO9A 4I5MA 3IGGA 4USFA 2JLDA 4B8MA 1T46A 4QP7A 5IUIA 4HPTE 4AA0A 4R6VA 3WOWA 4A9TA 4FT9A 4PL5A 3QWJA 4WO5A 4BCFA 2P0CA 1CM8A 2OJJA 3D15A 4PNKA 1J7LA 4MEDA 5H9BA 4YJRA 2NNWB 4ZMFA 4RVTA 3GVUA 1W83A 4MXCA 2PVRA 4OTHA 3IW6A 3KXHA 2J0LA 5AP4A 4EKLA 2O5KA 3VS4A 2QOCA 3Q9YA 3PG1A 4M7IA 4XG3A 3CLYA 4FKRA 4D55A 5AUUA 5HZNA 4R78A 4BDKA 1IRKA 1GZ8A 3ANQA 4JAJA 4DGGA 4RIYB 4DTBA 2QODA 2IVVA 1KV2A 2BMCA 4KD1A 3W2SA 4DH7A 4O6EA 1OKYA 4ZTQA 3AC4A 1M14A 2H96A 3BHYA 3OT3A 3ZFMA 4D5HA 3ZBFA 1JNKA 3FHIA 2W17A 3K5UA 4GG5A 3UVRA 3HLLA 3FZSA 3WARA 1FGIA 2ONLA 5A6OA 1OZ1A 5AP6A 2OXXA 1J7IA 2I1MA 5IH5A 3V5LA 2EWAA 3DPKA 3PP1A 2Y9QA 2PE2A 4NCTC 5CEOA 2HXQA 3CSVA 2QO7A 5IA0A 2IZRA 4CG9A 3L9LA 1URWA 1PXMA 3SXFA 3ZO3A 3ZO4A 4BCMA 4BCNA 5DLSA 1P5EA 2WB8A 3QQJA 4E4LA 3G90X 5CSXA 4EK4A 3QUPA 4WHZA 5IMEA 3IG7A 3P7AA 2GNIA 5JQ5A 5KMOA 4YNOA 4CYJA 4N4SA 5CVFA 3FKOA 4Y95A 4EHEA 2YIWA 4RRVA 3Q96A 1XJDA 1KSWA 5FP6A 4UN0C 2W4KA 2BZHB 4FL1A 5EKNA 4H36A 4D9TA 5EDPA 1W8CA 2UVXA 3QXOA 2GQRA 4TYEA 1Z9XA 2C30A 3R7YA 4FKOA 3G6GA 5BVEA 4RJ3A 2XK6A 4QMZA 3RM6A 4NM0A 1W82A 4IQ6A 2HIWA 4FIGA 3VUGA 2GHLA 2ITTA 2QKRA 4C02A 2W5AA 2Z7LA 1PKDA 2NO3A 4HJOA 4FA2A 3IECA 4LGDA 4O81A 4DTAA 3PZHA 3C1XA 3HL7A 4X7QA 2XNPA 3KULB 3O51A 4BR3A 2V7AA 4NT4A 3TJCA 2C0TA 3CKXA 3VS2A 1ZYLA 2WHBA 1QPDA 5BPYA 5CASA 5FGKA 1XBAA 2VWXA 4XCUA 3C4CA 4EWHA 4ENXA 4AN2A 3L8XA 2ZVAA 3GU6A 4S2ZA 4C62A 5LOHA 1WBVA 1G8SA 4GU6A 4AT3A 4K77A 4TYHB 5IKWA 4W9XA 2Y4PA 4D5KA 5KO1A 1IA8A 4CGAA 4EJ7A 3E62A 4QQJA 4IB0A 1OPJA 1H0WA 4EK8A 4AE6A 4J7BA 5BVNA 5AR5A 4EOOA 1LUFA 5CEKA 4GEOA 5ETIA 5L8KA 2G2HA 5E8ZA 1JSVA 4DFLA 2EUFB 4FSRA 1DAYA 4GVAA 5LWMA 4EKKA 3MW1A 1CTPE 3Q60A 4ERKA 2ZMCA 4UWYA 2WU7A 4F7JA 2VTNA 5J79A 3SAYA 4MF0A 4AZVA 4EL9A 4ONAA 3O7LD 3CE3A 3SG9A 4O84A 2CKPA 3W55A 2WTVA 3WF6A 4BCHA 3QZHA 2YITA 4I6FA 2IG7A 4GKIA 3UG2A 2F9GA 3BGQA 4X2FA 5K0KA 4MF1A 3BU3A 3UIMA 4RX9A 2AC5A 2R3HA 3P08A 1NA7A 3R00A 4WSYA 5CU4A 3ZCLA 2Y4IB 3R04A 3PDTA
chains in the Genus database with same CATH superfamily
4GW8A 3C13A 5F9EA 5HE3A 4NFNA 4FGBA 4AP7A 2IO6A 4JQ7A 4QYGA 4IHPA 4ZSJA 4B9DA 4G17A 5HQ0A 1OM1A 4KINA 2X6EA 2BFXA 5K9IA 2YEXA 3HV7A 4NH1A 1UWJA 3AD4A 1K3AA 1TZDA 1UNHA 3KFAA 4PPCA 3SQQA 3WZEA 3AKLA 3ZXZA 4I6LA 2W1ZA 3HGKA 2XNMA 2FSMX 4YBJA 3VUIA 4QQ5A 4AT5A 3ZRMA 4AG8A 1PMNA 4QTCA 3NLBA 2PUIA 5DR2A 3RZFA 2Z7RA 4UXLA 5IEXA 3IONA 4MWHA 4DGLC 3AT2A 4WSQA 4E7WA 4AN3A 1TVOA 3OOGA 5A4QA 3F5UA 1UV5A 2ZAZA 5FXRA 5E8UA 5HE2A 3HECA 3LCOA 3PZEA 4FV6A 4U7ZA 3ZHPC 4IW0A 4Q5HA 4CYIA 2WTCA 3ENHA 3NEWA 3I81A 4W8DA 4J8NA 5IQDA 2PVYA 1VYWA 2EXCX 3Q53A 3ODZX 3V8SA 3W2RA 3DAEA 3FJQE 4FZAB 3Q4UA 3RVGA 4USEA 1QPCA 3CP9A 4WNPA 4JT3A 3RBWA 4C37A 5E8WA 3ZU7A 3JS2A 4EH8A 4RQVA 3Q4TA 4FKIA 3ZO1A 1H25A 2G15A 4F1OA 3QLGA 4CKRA 2H6DA 3KRLA 3ZXTA 3LMGA 4HCUA 4U41A 4YC3A 4BGHA 4MXXA 5CT0A 4FMQA 3UIUA 5K5NA 2PVLA 4Y83A 1SNUA 5CAQA 1UKIA 2XARA 1W2DA 1FVVA 1OL1A 2OF4A 1JKSA 4IC8A 5AAEA 3V5WA 2GNLA 3GXLA 3B8RA 4JG8A 4JBQA 1I44A 3BHVA 4XV1A 4O4EA 2CLXA 4K6ZA 2J51A 5IQGA 2C3LA 4FKJA 2OGVA 4QTDA 5K4IA 4FBXA 4PDOA 1M52A 3BE9A 3MTFA 3F6XA 3MWUA 3PSCA 3COHA 4C61A 4I1ZA 2ITOA 3E5AA 4C4GA 3DJ5A 4UALA 3E88A 5AP3A 4C4HA 5C4LA 1V0OA 2UW6A 3WZJA 3LM0A 4O7TA 1JLUE 5AP5A 3AC3A 3GU4A 4O1PA 2JAMA 3QD0A 4RG0A 2C68A 4MHAA 3RK5A 4EC9A 4G2FA 5JQ8A 5M07A 5AUZA 3HV3A 3TNWA 2VX3A 4BZDA 4DCAA 3CIKA 5T6KA 2C6KA 4QTBA 4DT8A 2QOQA 4RFZA 3D7TA 3C0IA 1JVPP 4RJ4A 5CENA 2FSTX 5BVKA 4JQ8A 3L9PA 5KKRC 5EM8A 1XH6A 3QX4A 4FIFA 3Q32A 3GU5A 5GIPE 3RTPA 5A4LA 4IH8A 5LQFA 1ST4A 3RNIA 3SRVA 3CGFA 4FZFB 2P4IA 3RNYA 3MESA 5FG8A 2GFCA 4WRGA 5E8XA 5I0BA 4TYIA 4K9YA 5EQYA 5LMAA 5GJGA 3ORMA 3PSDA 4W4XA 4FODA 4NM5A 3TNHA 4NW5A 4IDVA 4IVCA 2ZOQA 4RWJA 4CKIA 5IH6A 2ZV8A 3MTLA 3NIZA 3WE8A 2PK9A 5HOAA 2EVAA 5CU2A 3OEZA 3C7QA 3EQHA 5JRSA 5AA8A 2OIBA 5AM6A 3ORLA 2ZFYA 5LCKA 5M57A 4U40A 4BDAA 3VAPA 2VNWA 1SM2A 3WZDA 2W0JA 3CQWA 4L7SA 4RT7A 4AW5A 4D2VA 1YOMA 3F9NA 2QHMA 2XM9A 2PULA 1H1PA 2WTIA 4M0ZA 4C34A 4YLJA 2C6TA 3DZQA 4CZTA 3A62A 4FVPA 4Y5HA 1HCLA 3P7CA 4DCEA 4F1TA 4D28A 3TT0A 1PMUA 1JWHA 5L4QA 5CAUA 3FY0A 5CS6A 4U80A 1OUKA 5M55A 5AV0A 4NUSA 2WNTA 3CTHA 3GQIA 3I6WA 3PA5A 5K3YA 3FMMA 3R7UA 2YAAA 4ANNA 2IJMA 3DFCB 3HMMA 4MQ2A 4QP9A 1REKA 3PPJA 4BBFA 4O7YA 4NIFA 4IVBA 5A4TA 3E92A 4I92A 4M14A 1WBOA 2BRGA 3I5ZA 4ZY5A 4F6UA 3FQEA 3P23A 3QQHA 4L68A 5EW8A 3PJ2A 2C1BA 3DKOA 3DLSA 3GNIB 4DGNA 4EH3A 3OWPA 5F94A 3WZKA 4DEGA 3LQ5A 3S3IA 3VRZA 2VX0A 4CSVA 3UC3A 4AZSA 4II5A 2HENA 5HVYA 5B2KA 3SKCA 1DI8A 3ZO2A 4NWMA 4OT6A 2G9XA 5IU2A 3G33A 3Q52A 3C4FA 2PMLX 5LWNA 3R1QA 2XMYA 4CV8A 4NKAA 4XG9A 3QKLA 1M2QA 3SXSA 3OD6X 2QC6A 2F2UA 2O2UA 1PXKA 3R8ZA 2X1NA 2VD5A 3CCNA 3VQHA 3FMNA 1MQ4A 3H0YA 5AAGA 4WKQA 3TG1A 2X0GA 4AOJA 2JGZA 3N4TA 3COIA 2GQGA 3R6XA 1PHKA 4APPA 4FSTA 4AUAA 5CVGA 5D7VA 4J97A 4UV0A 4CXAA 5IH4A 4YTFA 3ET7A 3MPMA 1ZAOA 3KF7A 4FV3A 4JVGA 4XBRA 3NAXA 1O9UA 4FV2A 3LFAA 1W84A 4OLIA 3RGFA 3OCGA 3QQUA 2UW4A 2UW7A 3UP2A 5IQIA 2WMAA 2PUUA 3ZLWA 4Q9ZA 3QAME 4EHGA 5LVOA 3G9NA 4BJJA 4D4YA 3UZTA 3UDTA 4AXAA 3FKLA 4Z16A 3SD0A 4EOLA 3I1AA 1XH8A 5IQBA 4DE4A 2YDJA 3KF4A 4RA5A 4O1OA 4F63A 3HA6A 4QT1A 5E91A 4KS8A 4AGWA 3IOPA 2A19B 2H8HA 5DRBA 1JAMA 4IJPA 5IF1A 3JYAA 5DYJA 2X8DA 3W0QA 4HZRA 1IA9A 4J53A 5IA5A 4F65A 4D0WA 4EH9A 3UPZA 3FLZA 4F9AA 4K33A 4L9IA 5HX8A 3Q4ZA 4YSJA 4ARKA 3HYHA 3CTJA 3OUKA 4J1RA 5DNRA 5BVWA 1Q8TA 3FL5A 3MJ1A 4LM5A 5KE0A 2XRWA 2X7FA 1GIHA 5CU6A 3QZFA 5ACBC 4FTAA 5EYMA 2WTKC 2OJ9A 3TNIA 4F70A 5GNKA 5B0XA 3HAVA 5D12A 4AE9A 5L6OA 2ZM4A 3E87A 4RGJA 1PMVA 4ANBA 4FV4A 1NVRA 4LQMA 2XNGA 1UU8A 2UZDA 3KXZA 5A4CA 4F1MA 5CEPA 1ZRZA 5HX6A 5IUGA 4M68A 3WF5A 3FPMA 1PXIA 3VBWA 5AJQA 4RC4A 2OIQA 1U46A 3OROA 4JJRA 4U6RA 4AS0A 3BGZA 1KE5A 1JQHA 2AEGA 2BDFA 5IISA 2FVDA 5FP5A 4BI1A 1GIJA 1W98A 2VV9A 2X8IA 4FKWA 4FV9A 5FDPA 3TNPC 3UQGA 3N9XA 4CMOA 2VO0A 4H1JA 5AWMA 2Q83A 3BBWA 2FA2A 2YAKA 4AGCA 1V1KA 3JUHA 2JKOA 3TZ8A 4JIKA 4PP7A 4J8MA 3ZOSA 4H3QA 4B99A 4BB4A 5AV2A 2ITVA 4HNFA 4GK2A 5HNGA 5JRQA 2XK7A 4ASZA 3QD2B 4HCTA 2WTDA 3L8PA 3PY1A 5L2QA 2WMXA 3VS7A 1ZOEA 3GUBA 4WNMA 4C3RA 5CNOA 3PXRA 5J9ZA 4UMRA 2GU8A 1KE7A 2DWBA 2R3FA 3SX9A 3KXGA 3N51A 2YWPA 4BTJA 1ATPE 4RJ5A 3U51A 4AZFA 1UNLA 5HO6A 3D94A 4GK4A 2DQ7X 4TKSA 4EOJA 4D1SA 1U54A 5CAPA 1BX6A 4TYGA 3SW4A 2XEZA 3FV8A 2O0UA 4ANQA 3DTCA 1OL7A 4KKGA 4G9CA 2B52A 5J87A 3VRYA 4C33A 4F7LA 3DAJA 2J7TA 2BKZA 4O0RA 4BDBA 3I7CA 4HVDA 5TR6A 2XKDA 3TTJA 2J0KA 2CCHA 3NCGA 2WMUA 1H01A 5GJDA 5BMSA 3P9JA 4FSUA 5LCJA 2YM8A 2R9SA 2X0OA 2H9VA 4C2VA 1HCKA 3I5NA 1AQ1A 3OXIA 2UW8A 3VF9A 5AUTA 4U97A 5M09A 3GCSA 4F0GA 3A8XA 4NM7A 2Z8CA 4ZEGA 3UO6A 3V6SA 4PDYA 3RCJA 3VUMA 4QMNA 4I22A 4BZOA 2OK1A 2W96B 3E93A 3PVUA 4Y5QA 3ZUUA 4YZDA 4GU9A 4YHFA 5DN3A 2QI8A 1ZY5A 3DBCA 2EXMA 3HUCA 4L43A 4V04A 4FTKA 3PLSA 1OIUA 3VBVA 2R64A 2XIRA 3KRXA 2IVTA 2O65A 3ZZWA 3LCSA 4EOPA 4FKQA 3THBA 1O6KA 4JDIA 4DG0E 1O6YA 3SHEA 2W1FA 3KB7A 4IAIA 5E9EA 4RA4A 3ACJA 4XJ0A 4RZWA 2YHVA 5I9ZA 3L9MA 3D7TB 5FEDA 4FEVA 5GINE 3GU8A 4FKTA 2ERZE 4ZXTA 4CQEA 2CJMA 4TNBA 3T9IA 1FINA 2R0IA 2YJSA 4J98A 2JKQA 5L8JA 3ITZA 4I93A 4AU8A 5JFVA 1YI4A 4DF3A 2YCQA 3SRVB 5IA2A 4MX9A 5BUEA 1BI7A 1IEPA 2UZNA 1ND4A 3UODA 3ENMA 4QRCA 5M4CA 2V0DA 3F82A 2UZVA 2F49A 2Z7SA 3LLAA 1APME 3EN7A 3BQCA 3OT8A 3VS0A 4CCBA 1FMOE 3LM5A 5FQDC 3VVHA 1Q61A 4EBWA 3EQIA 4AXFA 2NRUA 2WZJA 4YU2A 5J5TA 2R3JA 3BU5A 4ZTRA 4RIXA 2Z7QA 4BCIA 1CKIA 1JSTA 5DT0A 4A4XA 4LOOA 2VGPA 4M13A 4XV2A 4BYIA 3COMA 3ORXA 3OZ6A 4JQEA 3RJCA 2BIKB 4KSPA 2LAVA 4WUAA 5JT2A 4R7BA 4PP9A 5E1SA 4ZSGA 3NR9A 3RAIA 4UWCA 3WBLA 2BAQA 3REPA 3PRFA 1M2PA 2ZV2A 3BL9A 3EWHA 5IA4A 5J7BA 2BVAA 4ACGA 2CKEA 3MY1A 5AFVA 2XKCA 2ETMA 3QHRA 4YO6A 1W2CA 5KHWA 2F7ZE 5KCVA 3OS3A 3P78A 4UXQA 3IGOA 1E9HA 5GZ8A 5AV4A 1OIYA 2ONLC 4PMTA 4PY1A 5CEQA 4WBBB 2JKMA 3BHTA 3RPVA 2GTNA 2C69A 3A2CA 3OVVA 1YOLA 1JKKA 2J6MA 5CXHA 1H26A 2A27A 1BL6A 3EQGA 4YZNA 4X3FA 4LOQA 4FGRA 4BWKA 3PWDA 4DFUA 2W1HA 3E3PA 4FTMA 4ZSEA 3ROCA 3U4UA 2R3RA 1ZOGA 3OWLA 3Q9XA 3E7OA 2VWVA 3FQSA 3HDNA 4WUNA 4PX6A 3BLRA 5TF9A 4CRSA 3VC4A 4IM3A 2RFEA 3FLWA 3RCDA 2JDVA 4I3ZA 3FQHA 3VBYA 4PL3A 4M8TA 3PUPA 5GHVA 4H1MA 3HKOA 3EQDA 5M44A 2VTRA 2W1IA 2XIZA 4U3ZA 4DGOA 4IWOA 1Q3WA 3K3JA 3L1SA 3OCTA 4G3DA 2KULA 3PWYA 4O96A 3PPKA 4JDJA 3LMHA 4FK6A 3UYSA 1Q97A 2RIOA 2PVNA 1IG1A 4JOAA 4JR7A 4QMYA 5AIRA 1H0VA 3R8UA 4EYJA 2B0QA 4FV0A 4EORA 2FYSA 3HRBA 3HA8A 1VEBA 3FBVA 5EQPA 4IX5A 4LGGA 3EN5A 4A7CA 3T3VA 2PHKA 5HE0A 4BJJB 5FBNC 2AUHA 3R30A 4RWLA 5CNNA 2EB3A 5CF8A 3CKWA 3S95A 1XHAA 2J0IA 3HP5A 4U8ZA 4R3CA 4ENYA 4YJVA 5LVMA 4BDHA 3VUDA 5E7RA 4ALUA 5J1VA 4YHJA 3BRBA 3ETAA 4M69A 3PY3A 3TTIA 3VS5A 4BF2A 1BMKA 3UE4A 4BBMA 4O86A 3QTUA 2XVDA 2OBJA 1YI3A 3ORPA 4YGAA 2GMXA 5CSPA 3LXLA 4ANMA 1OBGA 2OWBA 3S0OA 3ORTA 1G3NA 1Q3DA 5F20A 3TI1A 2GSFA 2PYWA 4O7RA 3RHXA 2C6OA 2QU6A 2PE1A 4QMXA 4BDCA 2IZTA 4GCJA 4O0WA 1Q41A 2W99B 3VQUA 4LOPA 3F5PA 4P2KA 5HLWA 1KWPA 1OL2A 2XK3A 2GS2A 2YLEA 3FZ1A 3ZC5A 3ZSGA 1G8JA 2XAOA 3DXNA 5HBHA 4DA5A 2YCFA 1YI6A 2C5VA 3QRKA 4WNKA 3HV4A 4Z9LA 4NW6A 4FG9A 4QTEA 2WU6A 4BDDA 4JLCA 1YXVA 3V8TA 3OBGA 1YKRA 3HEGA 4P5ZA 2R7IA 3W0OA 3NW7A 4B6LA 4DC2A 4RZVA 2XK9A 3LPBA 3AMAA 3MYGA 4FV8A 5FXQA 2P2IA 5AP2A 5HLNA 4U45A 1SVGA 4JR3A 4ASXA 4ZS4A 2CNUA 1UVRA 3LIJA 2VRXA 4S30A 4AQCA 1MP8A 3AD6A 3QA8A 3R1SA 4MNEA 4YMJA 4S31A 2YM6A 3K54A 4O4CA 3FSFA 2W4OA 2ERKA 2I40A 2QO2A 5D9HA 5ITAA 4R8QA 5J8IA 5TOZA 4WG5A 3U4WA 4EQCA 4NL0A 3ELJA 5HD7A 3MY0A 3UIBA 2V5QA 2ZDTA 3MH2A 4F7SA 3QBNA 5CAVA 4P5QA 3BGPA 3C0HA 3AC1A 4O4BB 1DS5A 1ERKA 1GY3A 2C47A 2ITPA 4JXFA 5IPJA 4UMUA 3MFUA 4O0VA 4IAAA 4PRJA 4XRLA 4F9CA 3CBLA 3DFAA 2JD5A 2WOUA 3MH0A 2OF2A 3G9LX 4FK3A 4YC6A 4DLIA 1ZYDA 3R9OA 4DHZA 5H8BA 2QD9A 1XBBA 2WIPA 3F3VA 3PG3A 3OY3A 4NJ3A 4B8LA 1OVEA 3FUPA 1L3RE 4FL3A 4D2TA 4X3JA 3QTIA 5IA3A 4JBVA 4DTKA 4BZNA 3UOLA 5HG7A 3VBXA 2F4JA 2GPHA 1LPUA 1ZY4A 3BEGA 3PE2A 4GJ2A 2OIDA 5JZJA 2UV2A 4U79A 3RI1A 2J5FA 3C4XA 4LV7A 1REJA 1U54B 1Y6AA 5AMNA 5L8LA 4ZY4A 2RF9A 4A07A 4FR4A 4Q5EA 2C1AA 1JPAA 4QTAA 4FSNA 4QPMA 2PVKA 3DK3A 3ZUVA 3R02A 5AX3A 4BN1A 4QQCA 4PTGA 1RQQA 4YTIA 1ZYSA 4NM3A 3I6UA 5KBRA 1DI9A 4BDGA 1E1XA 3TUDA 3UOJA 4OAUC 2XALA 4K0YA 3H9OA 4CNHA 2YERA 3B2TA 3MJ2A 4JRNA 4B0GA 5HVKA 3DXQA 4ACHA 3NVKI 4FTIA 4NFMA 2GQSA 4U3YA 5HO7A 4MUQA 4QDEA 3CQUA 3IKAA 3WYXA 3ALNA 5AIKA 3RPOA 2O3PA 2OSCA 5CU3A 3QRTA 2Q0NA 4FKSA 2DUVA 3BWFA 2C4GA 4X2GA 5I9VA 3KY2A 3QCYA 3VJNA 5LMKC 4AXEA 2X0PA 4YC8A 2C0IA 4FJVA 5CF5A 3HV5A 4GSBA 1WBTA 4RJ8A 3V6RA 4UB7A 5AUYA 1DM2A 1W7HA 4ITHA 3HRFA 5AR8A 1IAJA 3NNXA 1WMKA 3W33A 2RL5A 3ZH8A 4IACA 4KNBA 2I0YA 1RE8A 3QRJA 3F61A 3F3UA 1OKWA 2OZOA 4JBOA 4IX3A 1A9UA 3FC1X 3UNZA 3R7EA 3EQRA 3WZUA 2P33A 3R1NA 2BRBA 1ST0A 2Y6OA 2VTPA 2ITUA 5AV3A 4PDPA 2I6LA 4A4LA 3LW0A 3RK7A 2QCSA 3Q5ZA 4AF3A 2OICA 1Q8WA 4XUFA 3QALE 5EW3A 3VONA 4L3JA 3W18A 4L42A 3T9TA 4D4SA 3O17A 4E6CA 4O38A 3BPRA 3DB6A 3IPHA 5J5SA 1CKJA 3F7WA 3O50A 2IEWA 3NNWA 4FNXA 2WD1A 2VU3A 2J90A 3F5GA 4X6QC 1QMZA 3ZRKA 3NVMB 3GU7A 3PA4A 3I4BA 3BLHA 3KVWA 2QOOA 1J1BA 4G1WA 5KNJA 3VUHA 2W5BA 2GDOA 2CPKE 4EOQA 5C27A 2VWBA 3KMUA 4ASEA 3U9NA 1R3CA 4ZLOA 3MDYA 4GFGA 2C6IA 4M84A 4LUEA 1M7QA 2WPAA 4OBOA 4GT3A 4EZ5A 4FF8A 1VYZA 2V22A 4FNWA 4O4DA 5FRIA 4NYEA 3VO3A 3SV0A 3NW6A 1RJBA 1ZLTA 2VTSA 5FBOA 5AUXA 1FPUA 3D2KA 1JBPE 1H07A 4RIXB 4EBVA 4U9AA 3UG1A 4BCKA 2BUJA 2W9FB 3ORKA 1A48A 4V0GA 4HW7A 4MXYA 4NCTA 3WIGA 4E6QA 3LFCA 3LCTA 4IAKA 3HMIA 4F08A 2ZJWA 4MBIA 3P4KA 5IQFA 4PUZA 3UPXA 2X7OA 2VN9A 2WELA 2RFSA 3GC0A 4BGQA 1P2AA 2CGVA 2X81A 1J91A 3A7HA 1HOWA 4JX3A 3NUAA 3AKJA 4MCVA 5IEVA 3RAHA 3T3UA 5L2IA 2IPXA 3MS9A 4O91A 3BHUA 4FTNA 5ANKA 5HCXA 5HCYA 3UJGA 4KWPA 1P4FA 3QKKA 1XBCA 3WF9A 4JAIA 3LJ1A 4ZIMA 2YWVA 3QGYA 5I9UA 1YDRE 3KN5A 3NZ0A 4O7NA 3UOHA 5DR6A 1URCA 3VW8A 1LEZA 2QR8A 4KBCA 2W05A 4X3FB 2IW8A 3PE1A 5K4JA 3H4JA 2F7EE 3IDBA 4FKVA 1NW1A 4RQKA 1R78A 4ZZMA 2X8EA 3C5UA 3ROYA 4OTWA 1XH7A 3QQGA 3DNEA 3MSSA 1YXTA 3KQ7A 4HYHA 3GEQA 2I0EA 5CEIA 3MVJA 3OUNB 2R3PA 5HEZA 4DEDA 5M4IA 3AC5A 3E8NA 4EOKA 1LR4A 4JIAA 1PY5A 4DN5A 2ZV9A 5DH3A 4FV7A 1R1WA 4JG6A 2C5NA 3O8UA 1BLXA 4CT2A 2CN5A 5L6WL 4PTCA 2HAKA 2QLUA 3D83A 3CQEA 3FLSA 3LFNA 4XX9A 4IE9A 4BICA 1CSNA 1YW2A 2A1AB 3AC2A 4N6YA 3VHEA 3V5QA 1Z5MA 1GJOA 2UZLA 4TYJA 5E90A 4AFJA 4DHFA 3K5VA 4MXAA 3W2QA 3TZMA 2HWOA 5CANA 2XJ2A 2R3NA 1M17A 2E9UA 3HRCA 4EQUA 4DYMA 1J3HA 3IO7A 3LJ0A 5CSHA 4R5YA 3LXPA 5J1WA 3Q2JA 3KXXA 3ZDUA 3B8QA 4ZJVA 4H05A 3BYUA 5AAFA 3QKMA 1WFCA 3MIAA 5BYYA 5FD2A 5DA3A 3VN9A 4AACA 1XKKA 5BYZA 4O6LA 3DLZA 3DNDA 4U81A 3OF0A 2X4ZA 3E64A 3FWQA 3O7LB 3UTOA 3SXRA 4LRKA 4M69B 2I0VA 4EC8A 1UWHA 2BPMA 3GGFA 3FXWA 4XHKB 2E9OA 3F2NA 2HZ0A 4IFCA 1Y8GA 4LUDA 4IAYA 4RLKA 3TWJA 2PMOX 2W5HA 3OTUA 1OKZA 3DBQA 3A7FA 1H27A 4JDKA 4JS8A 4QMUA 4WBOA 4W9WA 4R1VA 5AUWA 3FYJX 3U6HA 2VTQA 4AA5A 2JBPA 3KRRA 3LHJA 3MV5A 4AFEA 3UDSA 4I5CA 1NY3A 2OKRA 1QCFA 4DLJA 3R1YA 4DH8A 1VZOA 3NNVA 4YZMA 5HG8A 3O2MA 4ID7A 3NMUF 2BIYA 5CU0A 3PIZA 2XNEA 3EN4A 1ZYJA 3TCPA 2JIVA 2XBJA 3UYTA 5ANIA 3KCFA 2XA4A 4C2WA 5L2TA 1ZWSA 4QMSA 5EQEA 1B38A 3A99A 3PY0A 2BALA 4MD8E 3U54A 3ZLSA 1TQIA 1SZMA 3ULIA 3TUCA 2XCKA 4MNEB 2JIIA 4N0SA 3H30A 4TWPA 4NSTA 3TYKA 3BE2A 5AP1A 1KE9A 1M7NA 5EM7A 1WAKA 3LXKA 2X2KA 1PJKA 2B9IA 4UWBA 2BZKB 1KE8A 1NVSA 2QQ7A 3QYWA 2WMQA 3E8DA 4FZ6A 4QPAA 3D14A 3EZVA 1SYKA 3VJOA 3AKKA 2W1EA 4L45A 3HNGA 1Y91A 3DQXA 3TKUA 4EEVA 4IZ7A 1GOLA 2B54A 5HE1A 4KSQA 4N6ZA 1R0PA 3GQLA 4OUCA 4TW9A 4CMTA 3UDBA 3O5AA 4LDTA 5IA1A 4E20A 4YJPA 3D5WA 4J96A 2PVFA 3VS3A 2JBOA 2CKQA 3PJ8A 4CV9A 5DGZA 5CEMA 1DAWA 4O82A 4FRFA 1FOTA 5JSMA 5E8TA 5FM2A 3DCVA 4C4IA 4I24A 4YNEA 4F99A 5A14A 3PTGA 4HGLA 4WNOA 3FMDA 4USDA 3FE3A 2FB8A 4WA9A 4WOVA 3QZGA 5CY3A 3NYVA 4FYNA 3OY1A 3FMJA 4C38A 3TM0A 4ZTSA 4S33A 4I20A 1B6CB 1GZNA 3FL4A 4YHTA 4FT0A 4NTSA 4DEAA 4UX9A 5JH6A 2B9FA 5BQ0A 3H10A 2XYUA 4Y85A 3D2IA 5EW9A 4YJUA 3A7JA 5HVJA 3HAMA 4DDGA 5CF6A 2R3QA 1RDQE 4ACDA 4O0TA 4XP2A 3SG8A 4DHJA 3Q2MA 3BELA 4HOKA 4OTGA 5BNJA 4NKSA 4YJTA 5KX8A 4F6SA 3AOXA 5I4NA 3DA6A 4H3PA 4I5HA 4YZ9A 2VGOA 1YHSA 3IW5A 5CSWA 4OT5A 3EJ1A 4FSZA 3QGWA 3V04A 3FI4A 4BWXA 2OZAA 2FH9A 4CFUA 3D5VA 4BCGA 4AXCA 1XWSA 3I0QA 3PJCA 4YJNA 1Q99A 1J1CA 4IFGA 4W4YA 5BMMA 2CNVA 2ETRA 4XOYA 3A4OX 4E26A 4FG8A 4FOCA 4BCPA 1MRUA 2C3IB 3K3IA 5LXMA 4QOXA 5CTPA 3MFRA 3R2YA 3W1FA 4QNYA 4DFZE 3NYNA 3EQFA 4HZSA 5F1ZA 1Q8YA 2XJ1A 2HELA 2VTMA 1X8BA 4XYFA 2RKUA 3A4PA 3CXWA 3QTXA 2PPQA 3O23A 2BHHA 4PWNA 5A9UA 4RPVA 4FVRA 5E4HA 3WF7A 3EZRA 1W0XC 2Y4IC 3FPQA 2PUNA 3CJGA 4D1XA 2PZRA 4EK5A 5JEBA 5J7HA 3BYVA 3ACKA 4YURA 3GENA 4C35A 2XH5A 4QMMA 1GZKA 4WT6A 3NUPA 3AT3A 2WQOA 2YDKA 4O83A 2YLFA 5G6VA 2CMWA 4KIQA 4E5AX 4RIYA 2QONA 2Y8OA 4KIKA 4MKCA 4UMPA 3RMFA 3ATTA 2O64A 4K8AA 4D58A 2UVYA 5C9CA 1NXKA 2PUPA 3MN3A 3DBFA 3QQLA 3VNTA 2E2BA 4BCQA 3JY0A 2YDIA 3DBDA 4X2KA 3EYHA 3KMWA 4IBMA 1IR3A 3EB0A 4BFMA 3MVHA 1XH9A 3E3BX 4J52A 4AW0A 1YQJA 4BTMA 2UUEA 4V0GB 3DOGA 5A3XA 5M53A 3W16A 3EFLA 3QZIA 4DEIA 3GP0A 2GHGA 2YACA 4ZSLA 4BI2A 4IVAA 5DEWA 2A0CX 4OBPA 4Z3VA 4ZJJA 1FVTA 1PYXA 5ETCA 3VW6A 2QVSE 4OGRA 2IW6A 3G2FA 5D11A 2WQEA 4BC6A 1ZOHA 2C3KA 1TQPA 4UZDA 3GBZA 2BDJA 5EM6A 2WEVA 3NS9A 5HTCA 2UZOA 4KRDA 4W8EA 5AUVA 2PZYA 4MD9E 4CFXA 3BEAA 3UO4A 1H08A 3TXOA 4ZZOA 4O0YA 3OOMA 2VWZA 4FX3A 4XP0A 5EFQA 2PVHA 5D7AA 3PFYA 4FE2A 3EL7A 4EH2A 1IASA 4ORKA 3VUKA 4P90A 2O63A 3UMXA 3G51A 3UIXA 5HKMA 2XK8A 4FEQA 4BIBA 4E73A 4O7ZA 5B7VA 3POOA 3QCSA 4L53A 3WF8A 4BVUA 4YR8A 4S32A 4TN6A 1YWNA 4Q9SA 4RWIA 3FKNA 5I9WA 1WBWA 4ITJA 3R9NA 3NW5A 5KZIA 4EHVA 1OGYA 3DXPA 3LQ3A 3H9FA 3ODYX 3SW7A 3M42A 3Q6UA 4TL0A 3P5KA 3GT8A 5K0XA 5M4UA 3BV3A 4UY9A 4I6QA 4L6QA 4BTFA 1SMHA 5FM3A 4GUEA 4PMPA 4NK9A 4DFBA 5JK3A 3KCKA 3QUDA 3F3ZA 2YFXA 4QPSA 3ZONA 4FG7A