4QO9A

Mst3 in complex with danusertib
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
281
structure length
280
Chain Sequence
ADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords SERINE/THREONINE-PROTEIN KINASE 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 280
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qo9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qo9A01
2JGZA 3PSDA 2CPKE 3VF8A 5IQIA 5CZHA 5AM6A 1Q4LA 4ZXTA 4AG8A 2W7XA 2IZRA 4ANNA 5J79A 5M4UA 3DNEA 4YR8A 5K5NA 2Z7SA 3FLQA 2OXDA 4BI0A 4LGDA 5KMNA 4CD0A 3KRXA 1W0XC 3A7FA 3EQRA 4FKJA 4AA0A 3HUCA 1GAGA 3O8UA 3MVJA 4NKSA 5E8ZA 4G6NA 4O83A 3LXLA 4RPVA 4H05A 3VVHA 5AV1A 2WTJA 4O7TA 1UWJA 3FYJX 3QRKA 5KX8A 4FKSA 4HPUE 4QMQA 2C30A 2VWWA 3V01A 1PYXA 4FZDB 5HQ0A 1Q62A 3EN7A 2VO7A 5HNBA 4LM5A 3LFEA 5A14A 3MIYA 3U87A 2X7FA 4K8AA 1NT2A 4XX9A 3L9MA 1NVSA 1XH9A 4AOJA 2ITPA 4LFIA 4PP9A 1HCLA 4EONA 1YI3A 2XCHA 1U4DA 4YURA 4BCOA 4MD8E 5AP1A 3FLZA 2OXYA 2OJFE 4X3FB 5M51A 3BLRA 3HA6A 4N6YA 4DBNA 5TT7A 4O1PA 3FMNA 3T3VA 3ITZA 3ZOSA 4A9YA 2XIRA 1PXOA 2ZV7A 4BCNA 4FNWA 3LFCA 5IZFA 2JAVA 5C4KA 1QPDA 3BU5A 3QU0A 5T68A 1H08A 3FI4A 4LUEA 2UZTA 1A06A 4YP8A 4CZTA 2OF2A 4GSBA 3OZ6A 4X2FA 5K0KA 4EH4A 5EQEA 3FLSA 4JIKA 4Q2AA 1XBAA 1YHVA 3HDNA 3PIYA 4ALWA 1GIIA 4W9WA 4MNFA 3TJCA 4XG6A 4ZZNA 3MY5A 1FGIA 2XNMA 3IDCA 4RC3A 3N4VA 4G31A 3Q4ZA 3R7IA 4EH2A 2Q0NA 2E2BA 1OL2A 4I5HA 4JDKA 5A6OA 2UVXA 3R7GA 3R0TA 3HEGA 2V7OA 1Q8ZA 4IWPA 3PUPA 1ZZLA 4BDJA 1XO2B 3BYMA 3C4FA 3EQFA 3L1SA 5I0BA 1V0OA 2QR8A 3ATTA 5BNJA 2YIQA 4BN1A 4EKKA 4KIOA 1CTPE 2JC6A 3ZBXA 2OIDA 2OZAB 3IPHA 1DM2A 4BCKA 3TUCA 2J2IB 3R9HA 5ANKA 3D83A 1A9UA 4E3CA 3GU6A 3VHEA 4CFVA 4YSMA 4TPTA 4EH8A 2WTKC 2BZHB 3QD3A 4L45A 5CENA 4TWCA 4E73A 2PPQA 2IW6A 3L9LA 1XBBA 4QYEA 2UW5A 1YHWA 4UWYA 3EIDA 3ZO3A 2YJRA 2C0OA 2BFXA 4G6LA 2W1ZA 3OTUA 4R6VA 2VWYA 5AMNA 5E8XA 3SRVB 3TTJA 4NEUA 4JDJA 4YTIA 5HBJA 4XG7A 3QALE 4GYIA 3E87A 4IM2A 2JBOA 4RJ7A 5A3XA 4EOPA 4AW0A 3NVMB 2NO3A 3NIEA 3CQUA 2YM3A 3BHUA 3HVCA 3ODYX 4IC7A 5FEQA 2OICA 2WTDA 3P08A 3QGWA 4IVDA 3W2RA 4CQEA 2CLQA 2BROA 1E9HA 3DOGA 3WI6A 2JKQA 3C0IA 4FTMA 3NZ0A 4MF1A 5CY3A 5BVFA 4NSTA 3SOCA 5IQHA 3CY2A 2O3PA 5AUXA 4GW8A 4IX3A 3IQ7A 3FY0A 3KRRA 5EDRA 4I6BA 2GQRA 3AT4A 2I0VA 4RX7A 4E7WA 4FKVA 4RZVA 4UMPA 4M14A 2PUIA 3LCDA 3E3PA 5HESA 4GKIA 2W9FB 4C7TA 3D4QA 3HRFA 3BELA 2BHHA 2ZV9A 4XOZA 5A9UA 3MN3A 3P0MA 2Z02A 4L3LA 5D12A 3C5IA 4TWNA 3KC3A 4W4YA 3I81A 4LQMA 1R3CA 2OW3A 2VO3A 3OWJA 4U79A 4XMOA 3M2WA 1F3MC 3A99A 5HICA 2GHMA 2H9VA 4HJOA 3KMWA 1SVGA 4YLJA 3LFDA 5C8MA 4O21A 4FTOA 3NUXA 3RZFA 2XJ0A 3NAYA 3PJ1A 5DBXA 5HLWA 5EW9A 3OWKA 4AA4A 1K3AA 2ZM4A 3F61A 4M66A 3HAVA 4QP2A 3ZFYA 3HL7A 4EBVA 4Y46A 3DXQA 4L00A 5DR6A 3FJQE 3FEGA 4HCTA 4ZLOA 4CEGA 4IM0A 3DQWA 3NW5A 3ZHPC 3RI1A 2BAKA 2RL5A 4I20A 5FQDC 2KULA 4O38A 2C4GA 4EZ3A 4EOOA 3COMA 4FTLA 3R7OA 4O7SA 2F9GA 1VZOA 1CMKE 3D2IA 4QMYA 3V8TA 3D2KA 4FTIA 4GVJA 4HYSA 4IAIA 4KSPA 3PA3A 5HU9A 3ZONA 3KFAA 4KSQA 5BVOA 3GFEA 4UX9A 5HI2A 3UBDA 4G5PA 5E8SA 1UV5A 4YZNA 3OOMA 4EK6A 3ORXA 2UW7A 4FODA 5KKRC 3FBVA 2F2UA 4NW5A 2JLDA 5AP3A 3OEFX 3VW6A 5I9UA 1GJOA 5EM6A 1KSWA 3TI1A 4B8LA 5HGIA 4CYIA 4F9BA 1MQBA 4K6ZA 3RPRA 4DA5A 3EKKA 4OTHA 2GNIA 4L67A 1PXKA 5ANIA 2QVSE 2YN8A 3HKOA 5DEYA 4O81A 3I0OA 4GUEA 4Y8DA 3BZ3A 4LMNA 1URCA 2BDWA 3WE4A 2XK3A 3BBTB 4R8QA 5CS6A 4D2TA 5BUJA 1T46A 2XM8A 4JVGA 4D55A 2VX3A 3F3ZA 3BEAA 4TKSA 2CGVA 5ETIA 5IQEA 2FGIA 4EI4A 4G5JA 4B6LA 2OJIA 4I24A 3SC1A 2W0JA 1DAYA 3TKHA 5HCYA 2OH4A 3BPRA 4PPCA 2CMWA 3KRWA 4QYYA 4C34A 2C68A 2OU7A 3EQCA 3FHRA 3L9PA 3D0EA 3QZGA 4KA3A 4KABA 5FP6A 2Z7QA 2YM7A 3DBEA 2RFEA 4FEXA 4RX8A 1TQIA 4EUUA 5L2WA 5FXSA 4FTNA 5EI2A 2W5HA 5KO1A 4CLIA 4UZDA 1J7UA 2V22A 1OL7A 2ETRA 2PUUA 2XK8A 3E63A 1SM2A 2UZNA 3CSVA 4IXPA 3RNYA 4CRSA 3QA8A 4N0SA 5KZIA 3SOAA 3ZSIA 4PP7A 4YTFA 3OD6X 3OWPA 3UNKA 4IC8A 4ZS4A 1YXXA 2XCKA 4FSNA 4QPAA 1ZYDA 4A9TA 2PTKA 4IX4A 3OVVA 1CM8A 4C38A 4PL4A 2C47A 4FOCA 4RQVA 1Q8TA 4QPMA 4A4LA 3N4TA 3Q9XA 3UQGA 2C6LA 5BYLA 5IMEA 4ZTRA 2C6TA 4G3EA 4BWPA 2X81A 5CNNA 5AJQA 3D94A 4GV1A 3FAAA 4ALVA 3S1HA 3DJ5A 2PU8A 3FQHA 4YMJA 5LVLA 2JIUA 4FTCA 4B4LA 3CQEA 4E4XA 5AM7A 3WZJA 2W1DA 5A6NA 3HMIA 2LAVA 2VTLA 3W10A 3K3JA 4YO4A 3S2PA 4ZMFA 4JOAA 3U6HA 4XV9A 2YA9A 4MD7E 4FNXA 3QAME 1PXJA 4C8BA 1Q99A 2VX0A 2IWIA 2HIWA 3GOPA 3C4CA 3I79A 3LXKA 4IBMA 2IVUA 1JVPP 4ITIA 4L6QA 4WRGA 2YJSA 3V5JA 4MQ1A 4GG7A 4G3CA 4YNEA 5ETFA 5HVJA 3VBVA 3VQHA 2JKOA 3RMFA 5C8KA 4LYNA 2OZOA 5DVRA 5HIDA 4QQ5A 2EXEA 4C3RA 3NDMA 4DTBA 3E7OA 1P4FA 1WVWA 4FNZA 3OHTA 4PY1A 1F0QA 5J7HA 4EBWA 5JZJA 3QQUA 4FSMA 2BAQA 4AUAA 4G16A 5IH4A 5F95A 4D2WA 3AD4A 1FQ1B 4TYHA 4P5ZA 3NPCA 3S0OA 3LMIA 3I4BA 4E6CA 2PL0A 1K2PA 2WAJA 3NRMA 4JR7A 3ZFMA 4G3FA 5KHWA 4AGUA 4Z16A 3Q4TA 4EOLA 4D2VA 1YI4A 4RZWA 3HMPA 5AAFA 2RG6A 2PUPA 4RLKA 4AW1A 4CFUA 4UB7A 4R3PA 2ZV8A 5G6VA 5CTPA 2NP8A 3THBA 2XNPA 3P9JA 3U8WA 5DN3A 2QLQA 5HE3A 2EVAA 3V6SA 2BIYA 2ZVAA 5L2QA 4DCEA 4H3QA 3ULIA 4NTTA 4PMTA 3W2OA 1BL6A 1P5EA 4WUAA 2B0QA 3VAPA 2P2IA 3F7WA 1I44A 2HWPA 2P33A 5CEMA 2FO0A 4F99A 3MI9A 2VD5A 2WB8A 4C4IA 2ITOA 4RA5A 2HOGA 5M56A 1BL7A 1OI9A 3VS4A 4C4EA 5CX9A 2UW6A 2WOUA 2QOHA 3QHWA 3MVMA 1LUFA 2GHLA 2J6MA 3QTRA 5BVDA 2F2CB 2QHMA 2QO9A 4EC8A 4FTTA 3TWJA 2UW9A 4DG2E 3A7IA 4EL9A 3UZTA 2PVJA 4EK4A 2W4OA 3DPKA 3UDBA 3REPA 3DBDA 4C35A 4O0RA 3TUBA 1KOBA 3DDPA 4O0UA 4FTAA 4OT5A 2UZOA 5F20A 2YEXA 3AGLA 4FKIA 4I0RA 4MXCA 4IAAA 5AR4A 5AR5A 1P14A 3E8DA 5CSXA 5B2KA 4FKTA 3ALOA 3DK6A 2R5TA 4LV5A 4TZRA 4ZAUA 2XEZA 2ITUA 1LPUA 1H25A 3DGKA 4XNEA 4O2PA 3E92A 3IW4A 3G5DA 4FIFA 4GUBA 5F4NA 2OWBA 4YZ9A 2DUVA 4W8DA 3MVLA 4XG2A 3VBTA 1PXIA 5DGZA 4LRKA 4JLCA 4FV7A 3PXFA 5D11A 2HY0A 4C2WA 3UZPA 4AZEA 3KXGA 3I6UA 1AD5A 2CKQA 3CS9A 1ZOEA 4F6SA 5DI1A 5E8UA 4MWHA 4GVAA 4HW7A 4QTAA 2A2AA 3MYGA 4PDSA 5HO8A 2ACXA 4P2KA 2VRXA 5TF9A 3GU4A 2VTOA 2B52A 5HVYA 3LE6A 2VTQA 3OF0A 4F09A 3QD0A 1ZY5A 4MAOA 4BTMA 4HNFA 4NIFB 4RIWB 5C03A 4AZVA 3ZZEA 4C33A 5IF1A 4FR4A 3O50A 2WO6A 3KGAA 2Y6MA 2YAKA 2ZM1A 3PXQA 4TWOA 4CTCA 2XJ2A 4FKOA 4D5KA 4H3BA 2JDVA 2HCKA 2WMUA 4AFJA 4IDVA 4BKZA 2YERA 3VUKA 2X4FA 4RJ5A 4ZSAA 4GFOA 4O7VA 4QMWA 4D0XA 1KV2A 3UNZA 2CGXA 3F3WA 3OFMA 4U45A 3ORLA 3UO5A 5HX6A 1OIQA 2QOIA 3U9CA 3FZSA 5K9IA 2PMIA 3U54A 3H9RA 4W4VA 1ZWSA 3MWUA 1OKWA 3I7CA 3O8TA 4EK8A 1OM1A 3TDWA 4X2NA 4YNOA 2XRUA 5IISA 4CSVA 1ZMVA 2X9EA 3DTWA 2FA2A 4PF4A 3HZTA 3OBJA 2PK9A 2R3HA 4J8NA 4ARKA 4BCGA 3KY2A 4EOIA 3MGYA 3B8QA 4B0GA 5JKGA 1OUYA 4JAIA 5EDPA 2VTIA 1XH4A 1U5RA 1WZYA 3RPYA 4F65A 3R7EA 4J7BA 3DV3A 2YHVA 1OL5A 1YVJA 2C6DA 2R3FA 2OFUA 3MB7A 2OF4A 2B9JA 4MQ2A 3TZ9A 4C4FA 4IB5A 4LOOA 2DYLA 3G33A 3A8WA 4ZTHA 5CAVA 4JBVA 3CE3A 4X7QA 4DEEA 4JRVA 2HWOA 2PVYA 4C59A 4G3DA 5JGBA 3PVWA 2C3KA 4NM0A 4O96A 3V5WA 3EWHA 4AU8A 4BHNA 5K4JA 4ZIMA 3ZUUA 5GJGA 5AV4A 4UWCA 3RM6A 5JFWA 4HVDA 3UQCA 3FI8A 4QPSA 4FTQA 4BBMA 5CF8A 3TNIA 2YM5A 5HE0A 4KWPA 2C6KA 3PLSA 3ZLWA 3SG8A 2CNQA 4KS7A 2XF0A 1BUHA 4W4WA 2PSQA 3FZPA 4U44A 4FL1A 4WG5A 3ZSHA 4A9RA 4IM3A 4EJNA 4NYEA 4ACHA 5C4LA 4O7YA 2QOLA 4FKQA 5A4EA 5EHLA 3CPCA 2A4LA 3LHJA 4PTEA 3TDVA 5CSWA 4D4RA 3O7LD 5BMSA 4U42A 4JXFA 3JR1A 2PVFA 4FGBA 3WF8A 2BZKB 3Q6UA 4AQCA 2P3GX 4TYEA 2WEIA 3T3UA 5M53A 4XS2A 5BPYA 3BCEA 3R21A 4QP1A 3WZEA 3D7TA 2VTJA 1Z9XA 2R0UA 3BKBA 1UKIA 4I5CA 3PE2A 4ORKA 3QTUA 1M2RA 3AT2A 3NX8A 3TNPC 3LJ1A 4QT1A 4P7EA 4YPSA 2C6IA 4FSWA 3UYTA 3DBFA 3DQXA 3KB7A 3QBNA 4J97A 4K1BA 5HIBA 5DPVA 3PG1A 4X2KA 4DG3E 3DK7A 4AGDA 3ZFXA 5IDPA 5CQWA 3LKMA 1LEWA 4JX3A 2H34A 4RFMA 4QD6A 4CTBA 3R22A 4Y72A 1QPEA 3HV6A 3KK8A 3MY0A 3FZOA 4WSQA 5CSHA 3I1AA 4RG0A 4EH9A 4GJ3A 3HDMA 2WQBA 4Q9ZA 2ESMA 5IUHA 4I21A 1REJA 1TQMA 1M14A 1U59A 2QC6A 3BHTA 5A4LA 5GZ8A 5KMIA 1H27A 4YC6A 5DR9A 2XP2A 5M08A 4BIDA 2XK7A 3LFFA 2WFYA 4L01A 5EI8A 3L8XA 4DN5A 3CTQA 3Q9YA 3FL4A 3ZXZA 5CF6A 5D7VA 3I7BA 2WKMA 3C0GA 4NCTC 5H2UA 3R9RA 5M09A 2QU5A 4Q5EA 3W33A 3C4WA 3PWYA 4R78A 3C51A 4EK3A 1WAKA 5CT0A 3FSKA 4F63A 3RK7A 5EKOA 3AC2A 3VJOA 2VV9A 1ZYSA 3GU8A 4I6HA 3R04A 4UALA 5FTOA 5EK7A 4EHZA 4F7LA 3RP9A 4CCBA 4LGHA 4DFLA 5KHXA 4CT2A 3LCSA 3LMHA 3ZRLA 3RPSA 5ANDA 2XKEA 4C02A 2X4ZA 4U6RA 1GNGA 3ZUTA 3OP5A 1Q3WA 3ET7A 2HYYA 1J1BA 4ERWA 4Y85A 3NW6A 4MXXA 3HNGA 3C5UA 4BCFA 2XK4A 3IO7A 3MH2A 1JPAA 4D2SA 4FV3A 3G0FA 4WUNA 4MEDA 5EFQA 4DTAA 4DLJA 3QKKA 2BZIB 4D2RA 1VEBA 5C8NA 3LIJA 3QX4A 2R3IA 1PMNA 2QKRA 3VS2A 4JBOA 2W1EA 3GC8A 5TE0A 1WBOA 3R8UA 4ZLYA 2OJ9A 3FYKX 4DGOA 2XNGA 5HG8A 4DFZE 2VWXA 3PRFA 2PUNA 4A06A 3NYOA 5FUTA 2GFCA 2RGPA 4NL0A 1RE8A 2X39A 5B0XA 3DTCA 5GZAA 2I0EA 2P2HA 3Q4UA 3VJNA 3VW8A 3KXNA 2G1TA 1YOMA 4CCUA 4DYMA 1U54B 1W82A 3R2YA 2CDZA 3MFSA 1VJYA 1ND4A 2IN6A 2XKDA 5BQ0A 2JDSA 3AMAA 2HY81 1QCFA 4BTJA 4ZZOA 2ZOQA 4IMYA 1MRUA 3F5XA 4YC8A 4GKHA 4HGEA 3QL8A 4PMMA 5H8EA 4E93A 3MFUA 5M57A 3M11A 4S30A 2X8DA 4XJ0A 3DY7A 1NVRA 3O71A 3QCYA 4PTCA 1OGUA 5HO7A 2YZLA 1H00A 4N6ZA 4AZTA 2OSCA 5KMJA 4IVCA 3V51A 1W8CA 5HLPA 1UVRA 3CP9A 5AR8A 4GIIA 3BWJA 3IGOA 3A4PA 2QURA 5KUPA 5EM7A 4UY9A 4DFYA 4WRSA 2JAMA 2C5XA 5L8JA 3DZQA 3N9XA 3MPMA 5HTBA 4L3JA 4CMTA 4IAKA 2HZ4A 4J53A 5HG7A 3AC3A 4V0GB 4EQUA 3M1SA 5AFVA 4C3PA 4C2VA 4E4NA 3FMHA 3KCKA 4L7FA 3SV0A 3QCSA 1HOWA 2B1PA 3RPVA 3KULA 3LCOA 3GEQA 4IVBA 3WILA 3WZUA 4E6QA 4F1MA 1Y6AA 3LXPA 4CKIA 3B8RA 2QONA 4M97A 3WZKA 1GOLA 5A54A 2R3QA 3AC4A 1LP4A 2C6OA 4NCTA 5KE0A 4JQ7A 4QO9A 4ASDA 5L6OA 1WBPA 2CJMA 4FC0A 4FK6A 2PVLA 3OXIA 3HMMA 1QL6A 3DJ7A 3UQFA 3OCSA 4J95A 1DAWA 2GFSA 3R01A 4U43A 3T9TA 3DS6A 3C1XA 2J7TA 1K9AA 4ASXA 3F5UA 1H1RA 3ROYA 2PZYA 4RIYA 3ULZA 3GNIB 3OCTA 4XUFA 4Y5HA 4YJNA 3NUPA 2W5AA 4JX7A 3V5QA 4BDDA 2V0DA 4XCUA 2QU6A 4BVUA 2J51A 3MIAA 3NUYA 5E92A 5M55A 4E6AA 4QQTA 3FDNA 2EXCX 4ANLA 3GGFA 4FYNA 2GNGA 4AF3A 1NXKA 4C0TA 1L8TA 1H28A 3R83A 5EOBA 4I5MA 1NA7A 4O0VA 2JIIA 4APCA 1M7QA 4CT1A 4PPBA 3L8SA 5HO6A 1SVHA 2IW8A 5BX0A 3PY1A 4EWHA 1FMKA 5FDXA 4ZMEA 3GBZA 5AAGA 4YZDA 4FG9A 4FTJA 3VS0A 4RX9A 4ZTSA 1Y57A 3RM7A 4BI2A 2YCRA 4BIEA 5KNJA 2R9SA 4RFYA 3CD8A 3FI2A 2YIRA 5CT7A 4RLLA 1YXTA 2CKPA 3UJGA 4TYHB 4U5JA 2UZLA 3OEZA 2VWZA 4UN0C 1YOLA 3F69A 5J9YA 2ZV2A 5EQPA 4KKGA 2UZWE 3LQ8A 4I94A 4V04A 1SNUA 4QTCA 2ITZA 5DWRA 4MK0A 3TCPA 5KBRA 2OLCA 3TEIA 1H1QA 2YM6A 2J5EA 3R7UA 5LXMA 3DAKA 4KNBA 4RX5A 2VN9A 2X6EA 1J7IA 1YWNA 2EU9A 2W96B 4F9WA 5M44A 4ZSJA 3GU7A 3KXXA 3RTPA 3Q96A 1ATPE 5JMSA 4CMUA 3RAKA 2G2HA 4XLVA 4DITA 3ALNA 3EH9A 5IA2A 3AOXA 1OUKA 3VRYA 3BLQA 3CC6A 4DTKA 4ITHA 3RHKA 5KMLA 4X2GA 5FBNC 2R3LA 2VTAA 4ZY6A 1PMUA 1ZZ2A 3PWDA 3TV7A 3JUHA 5ICPA 3Q53A 5DOSA 2FSLX 1VR2A 3GT8A 2BDJA 3PIXA 1IAJA 5J9LA 3A4OX 3K3IA 5T6KA 3ORKA 5TO8A 3VS6A 4KB8A 4TY1A 4P4CA 3ODZX 3M42A 2I0HA 3V8WA 4DFUA 4TXCA 2XUUA 4KBKA 4ZJJA 4D5HA 1UNHA 4FV9A 2BDFA 1RDQE 2PE0A 3PTGA 5LQFA 3CQWA 3NIZA 1PHKA 3F6XA 3BEGA 3EQPA 1Q3DA 3GUBA 4IVAA 5GNKA 3EN5A 2F57A 4MHAA 3WF9A 3E93A 3AD6A 3GXLA 4XG8A 5LVNA 4MCVA 2WTIA 3IS5A 3R00A 5IQGA 3FMEA 1MRYA 1DI8A 3PPJA 3PYYA 4D4YA 2BRGA 4K9YA 4CRLA 5E4HA 3PZEA 5IA1A 4O0SA 4F64A 3GCVA 5AAEA 2CCIA 2WQMA 1H0WA 3R9OA 1J1CA 3WARA 4I6QA 1JAMA 3W8LA 5DT0A 4FTRA 3PXRA 3G51A 4A9SA 1YOJA 2XMYA 1OIRA 3PA5A 4L68A 4UMTA 1R0PA 4ZP5A 3KXZA 3RNIA 3VF9A 5CWZA 4IACA 3G9NA 3H9OA 1O9UA 1XHAA 3UOKA 5J7BA 3R8LA 2Y7JA 4UXLA 3EKNA 4XRJA 4N57A 1PXMA 3FXZA 2PVMA 2ZB0A 3BYSA 3EFKA 4C36A 3UIMA 5HTCA 3VUDA 3G6HA 4KIKB 2BKKA 3R6XA 4ANBA 5BVNA 3HECA 4DF3A 4PUZA 2EWAA 1ZXEA 2B54A 2BR1A 5DNRA 3BQCA 1YXSA 2ZM3A 4FV8A 2WMQA 3R1YA 3U51A 4FSRA 4DEBA 3NLBA 4K0YA 3BHYA 3F66A 3MH1A 4PL3A 5HNGA 5IPJA 1R0EA 3QYWA 2WMWA 5FGKA 4QMVA 4D9UA 2W99B 3F2RA 5HG5A 4D1ZA 4QMLA 3C13A 3VS7A 4M13A 3NUSA 2RIOA 3DK3A 5DMZA 3KMMA 5KMMA 4X3FC 2YDIA 2V5QA 3QXPA 3BV2A 1Y6BA 4N4SA 4QP7A 4WHZA 3TG1A 3UVPA 4DEGA 4CXAA 4CV8A 3TL8A 3MB6A 4RVLA 2ITXA 4ZK5A 3HLLA 4R3RA 4LMUA 3DFAA 2HZ0A 3O7LB 4FZAB 4EQMA 5LMKC 4KUJA 4PNKA 1YWVA 5BUEA 3TZ8A 3LM0A 3QCQA 5IKWA 3RAWA 1Q8YA 4DEIA 3VUMA 4U8ZA 4U0IA 2UW4A 3WZDA 3QQJA 4EZ7A 3ANRA 3ZXTA 4O1OA 5LARA 3PJ2A 2C1AA 2Y6OA 3H9FA 4ANOA 4F1OA 4PDYA 5FTGA 4EOJA 3VC4A 3FI3A 5T3QA 4AP7A 4YJUA 2AC5A 2VWIA 4IAZA 2WMVA 2XIYA 5K4IA 3W16A 1OZ1A 4HOKA 2IZUA 5LOHA 1RW8A 5TKDA 4C4JA 2CN8A 4ONAA 2J0IA 3GQLA 4Y95A 5G1XA 3MFTA 3PFQA 1GZ8A 3D14A 1ZYCA 2XKFA 3FSFA 5E8YA 3WIGA 2J5FA 5EOLA 4OAUC 2OFVA 3UPXA 2HXQA 2H6DA 3JYAA 5JRSA 2ERKA 3TNQB 2QD9A 3BE2A 2AYPA 2C1BA 2E9PA 3FXXA 4DEHA 3DKCA 4QYHA 4I3ZA 1UNLA 4FIGA 2YCFA 4KINA 3ZZWA 3AG9A 3OWLA 4C57A 2UVZA 5IA4A 5AUVA 4BR3A 4LI5A 4FV5A 4DT8A 3E7VA 2AC3A 4E5WA 2CKEA 4IZYA 4J99A 4BC6A 3IKAA 1GZOA 4YHFA 2Q0BA 4IWQA 4F70A 2B9HA 2BZJA 4FT3A 3BI6A 1P2AA 4AT3A 2VTMA 5L6WL 3TV4A 2WQNA 3QYZA 5KMKA 1BMKA 4GU6A 4A4OA 5AWMA 2WIPA 4LOQA 3ORTA 3F3UA 1GZKA 1PXLA 2C0IA 1BYGA 3TNHA 5AIKA 3UG1A 4QMPA 4IW0A 3LW0A 3MJ1A 3ENHA 5HORA 3D15A 4BCIA 3SD0A 3FKNA 4BIBA 3LJ2A 3HV4A 3SXFA 4R5YA 4O7RA 2UV2A 2JD5A 2XIZA 3P86A 2I7QA 2ONLC 1JOWB 1JKKA 2VNYA 1REKA 3COKA 3CTHA 4QQJA 2CHLA 5H3QA 4HCUA 3GVUA 4M7IA 4OTQA 2CGWA 4FL2A 2WPAA 1W83A 4IJPA 1OKYA 3BQRA 5CAOA 5LVOA 5J1WA 3RAHA 3A8XA 4OR5A 4G2FA 5HOAA 5DYJA 5LMAA 4PWNA 3QQKA 1E1VA 3SW4A 3JY9A 4ZY4A 2JFLA 2J0KA 1UU8A 3U6JA 1YKRA 3QUPA 5GZ9A 2Y4PA 4O91A 2WZJA 3Q6WA 4BDGA 1JQHA 3QLGA 1FOTA 1XWSA 3FPMA 2JDTA 2FUMA 4F7SA 3SDJA 4EK5A 3BGZA 3GB2A 4OT6A 2J4ZA 4YLLA 1SNXA 3TUDA 2BVAA 4BDHA 3LZBA 3IDPA 1KV1A 2R3OA 3W2SA 4FV0A 5CU4A 4CFMA 4IEBA 2UZUE 1OIYA 3QA0A 4FKGA 4A7CA 2OKRA 5CQUA 3U6IA 3LM5A 2GMXA 4XG9A 1FBNA 4E8AA 1M7NA 2CCHA 1GIHA 1OIUA 4HCVA 3UP2A 4M67A 3W55A 5L6PA 4QP8A 3CTJA 3V5TA 5LWMA 3NYNA 3NUAA 3FPQA 4CG8A 1DS5A 4MBLA 4NM7A 4BCPA 3AMBA 4KIQA 2R2PA 5FXQA 2AUHA 5J8IA 3W2QA 3QRJA 3TKIA 4UMUA 2W4JA 5EM8A 4EZ5A 2VTPA 5FEEA 5EM5A 1M2QA 3HRCA 5AP0A 2C0TA 2KTYA 4QQCA 3PVUA 3ZDUA 2QNJA 2IVSA 5CEPA 2UUEA 5IA3A 5LCJA 1J3HA 3CXWA 5LVPA 5I5ZA 5HX8A 3DBCA 2R64A 3QTSA 4GJ2A 3II5A 2V7AA 4RFZA 3EQIA 5AV2A 5CEQA 2HELA 3WYYA 4QP4A 4GK3A 2B4SB 4RVMA 3ELJA 3P79A 4AS0A 4DFXE 4RIXA 3RHXA 5AR3A 3N51A 4OBPA 4H39A 4PRJA 2UW8A 3LFNA 1YXVA 3ZEPA 4DC2A 4EHGA 2BRNA 3ZC6A 5EYCA 2X8EA 5CZIA 4P5QA 1H01A 3V6RA 1JBPE 2PMOX 2P55A 4E20A 3A62A 4DBXA 4JIAA 1XH8A 4XEYA 2Z2WA 4ZZMA 1IRKA 3CBLA 4IAYA 4GU9A 4NT4A 3PXZA 2WQEA 5ETCA 5IQCA 2BRMA 2VWVA 2EB3A 4U3ZA 4CYJA 1PRYA 3IGGA 4GFGA 3W2PA 5DE2A 4OTGA 4IWDA 3OXTA 3OY3A 3GQIA 4LUDA 4DINA 2CKOA 2FSMX 3E8NA 3I5ZA 4YC3A 4MBIA 5F9EA 5E7RA 3ZS5A 4NZWB 1JLUE 3EQDA 3IDBA 4FYOA 4KBCA 4M68A 2R3NA 1MUOA 4JBPA 4H1JA 4Z7HA 3LQ3A 3ZSGA 1W84A 2ZDUA 2O8YA 1P4OA 4AAAA 1A48A 4DE4A 2XNBA 4TW9A 1H1WA 2VAGA 4HZRA 4JI9A 4BRXA 3D5VA 3F88A 3MS9A 4CFFA 3OUNB 1HCKA 3SGCA 2NRUA 3KCFA 3SQQA 2R3KA 2X2LA 4L46A 4O27B 3CY3A 3Q2MA 3NUNA 2RFDA 3AD5A 5ACBC 5I9XA 3IOPA 3FLWA 5K5XA 3V5PA 1LR4A 4ZOGA 4DH1A 3ACJA 3P7BA 1OKZA 4ZEGA 3KULB 4R3CA 3MV5A 2R3JA 4LL0A 5DIAA 5E91A 4EOQA 3W1FA 4BI1A 5EW3A 3V04A 4FBXA 5D9HA 5E9EA 1WBNA 3OUKA 2W17A 1X8BA 4MD9E 2C69A 4I5PA 3N4UA 4ZTMA 2PVRA 1TQPA 1Q97A 3EFWA 3MH3A 4PDOA 3E3BX 3UVQA 4YJOA 3QQLA 4GEOA 4IZAA 5JGAA 5ANJA 4QTBA 1FPUA 1BI7A 1Q24A 2GS6A 2VTTA 5E8WA 3UMXA 5EQYA 2E9UA 3GC0A 4IAFA 3PDTA 2VTNA 3GI3A 2F7ZE 5AUWA 1EH4A 2JKMA 3FKLA 5JZNA 4O0TA 1ZYJA 4DGGA 3CGOA 3QGYA 4CLJA 3DFCB 3H10A 3GC9A 4WIHA 1Y8GA 3SVVA 3F9NA 3EN6A 3WBLA 5FXRA 3TNWA 3G15A 3FLYA 3VN9A 3Q5IA 3QFVA 3QLFA 3B2WA 4O7WA 5AA8A 4ANQA 4RBLA 3RJCA 4JRNA 3R8PA 4XBRA 1OPKA 3OROA 1FVVA 4X3JA 5HHWA 3QCXA 4GG5A 2GSFA 4NM3A 4QTDA 3MPAA 4Y5QA 3OT8A 4AW5A 4JQ8A 2SRCA 4S33A 4EJ7A 2ETKA 1XR1A 4EHVA 3LQ5A 1KE5A 2G2IA 5EH0A 3EOCA 1WBWA 3RBWA 4DAWA 4J71A 3QQGA 3PJ8A 2QLUA 4WG3A 4CFNA 3GCUA 4AWIA 3WIKA 2J90A 4EEVA 2F49A 4WO5A 1YI6A 5HD4A 2V62A 3OC1A 4IZ7A 5FDPA 1KE9A 4TYIA 1IG1A 4I93A 1FVTA 4MXYA 3MW1A 4FL3A 5AUYA 1CDKA 4DEDA 5CNOA 2Y4IB 1H26A 3PXYA 4JAJA 1RQQA 3PP0A 2NRYA 4L44A 3LFBA 4IE9A 4OTDA 1PJKA 2YABA 4KRCA 5BUIA 4BZDA 4CKRA 3NR9A 3CKWA 1MRVA 4FIIA 3TACA 4IDTA 4O7LA 2ZYBA 3NNWA 2IG7A 4XHKB 4WBBB 3ZO4A 4BYJA 2VO0A 3QC9A 3ZUVA 4WNKA 1YDSE 2UW3A 4AX8A 5I9WA 5GJFA 2XVDA 4IANA 5DHJA 3OT3A 4IZ5A 2J50A 5F1ZA 5J9ZA 3UC3A 2IJMA 2BILB 1JKLA 2GDOA 2ITNA 2WMXA 3LJ0A 3Q9WA 2B7AA 3TJDA 5AIRA 2XYUA 4RGJA 2ZAZA 4O86A 5FWKK 4BDCA 4ZS0A 3VIDA 4ACGA 4QP6A 5DT4A 3TXOA 2CLXA 4CFXA 4DLIA 4E5AX 5EYMA 2B9IA 3S95A 3KQ7A 5LVMA 3NS9A 3O51A 4EYJA 4ACCA 3UIXA 4FZFB 2OI4X 4X6RA 2FSTX 3QZIA 3FMDA 1ZMWA 4D4SA 4NUSA 3FQSA 3TZ7A 5KMOA 2FVDA 1M52A 1PXNA 2Z60A 4FKLA 1TKIA 4QMXA 1YW2A 5J5TA 3FQEA 3D5UA 2VU3A 4HYUA 4RWKA 5HIEA 4G1WA 2PZPA 2ZJWA 1XH5A 2GNJA 3FMKA 3HYHA 4FSZA 3PP1A 2Q83A 1V1KA 4I22A 4LGGA 4OLIA 3UVRA 4YU2A 3FXWA 4J52A 3QUEA 3W18A 3CJFA 4U81A 2OK1A 3SKCA 4D0WA 5C26A 4FVQA 3EL8A 4II5A 4JNWA 5BYZA 1QMZA 4EUTA 4U97A 4O7NA 3O8PA 2GTMA 5IUGA 3QX2A 2JEDA 1B6CB 2F7EE 4X2JA 3UOLA 1GIJA 3NEWA 3MA3A 3VBYA 2QOFA 3DJ6A 4RJ3A 2R3RA 1KE7A 3H3CA 2OO8X 3GCPA 3CIKA 3LVPA 3PY0A 4M15A 2YIWA 4O6EA 3EYGA 3GU5A 3BGQA 3IG7A 4EOSA 4FG7A 5FTQA 1KE6A 3P5KA 3PJCA 3DXNA 3HRBA 2C3JA 1M17A 4DT9A 5ANGA 3O17A 3QZFA 5DG5A 5CALA 3QRTA 3W2CA 2X6DA 5DT3A 3O0GA 3Q5ZA 3MH0A 5K0XA 1BKXA 4PNIA 1M2PA 1Y91A 2DS1A 3Q4CA 3R73A 1MQ4A 2IVTA 4BICA 1OB3A 3F2AA 4PX6A 4AA5A 2Y8OA 1XJDA 2YLEA 4RA4A 3R63A 4AT4A 4BZOA 5M4FA 2C5VA 4XBUA 3JPVA 3EN4A 1O6YA 3ORNA 2WEVA 4O0XA 3ZH8A 3G2FA 4H36A 4H3PA 1FGKA 4HVSA 1V0PA 2BHEA 3PPKA 4RJ4A 5JFXA 2W9ZB 4WNMA 3T8OA 5C9CA 4QMNA 5JH6A 3NMUF 4YBJA 2ITVA 3GC7A 3R7YA 2VO6A 3PSBA 4KKEA 4TT7A 3QTWA 3F3VA 3UOHA 1OVEA 3L9NA 4XV1A 5HVKA 2O0UA 4IB0A 1PKDA 3PJ3A 4RWIA 2WTKB 4R1VA 5AR7A 3R1NA 4MX9A 5HEZA 3E88A 4FV4A 4NWMA 3CGFA 1ZOHA 4AZFA 5FM3A 3QTZA 2PMNX 3KA0A 4S32A 5DRDA 4CNHA 3AXWA 5ITAA 3UPZA 1ZARA 3FUPA 4B9DA 4OUCA 4YHJA 4H58A 4D1XA 2VWBA 3DKOA 4PDPA 4ITJA 1XBCA 2XBAA 4XLIA 5E1SA 3BRBA 3SXRA 4AT5A 3RGFA 3ZDIA 3ZLYA 3LFSA 4QMSA 4IX6A 5E90A 2HAKA 4O7ZA 5DFPA 2PE1A 3UG2A 4ENYA 5L2IA 1BI8A 4YJQA 3RVGA 4R7IA 1L3RE 2HW6A 3C4ZA 4G6OA 4HZSA 3VQUA 3VUGA 4C4HA 5M07A 3JVRA 3B2TA 4ANSA 2BIKB 1Q61A 3FE3A 4XP2A 5CLPA 4KAOA 5JEBA 2BTRA 3UE4A 3G6GA 5IA0A 2I1MA 3C50A 3Q9ZA 2ITWA 4U3YA 4KKHA 1BX6A 4FG8A 1W98A 2R3PA 4DCAA 3NCZA 2X0GA 4MF0A 2QOQA 5EHOA 4MWIA 3KXMA 4DGMA 2XKCA 4EORA 3IW6A 3TZMA 2E9NA 2Y9QA 3ORPA 4CGAA 3PVGA 4Q9SA 5IH6A 4OW8A 2ITYA 2XJ1A 4G9CA 4EKLA 2WU7A 3D5XA 2YZAA 3OW4A 3ZU7A 5JQ8A 3MESA 5CEIA 4JDHA 4F9CA 4GS6A 4YJPA 3P4KA 4V01A 4EHEA 3RWPA 4I0SA 3HGKA 1PY5A 4FICA 3GFWA 4FKPA 4RJ6A 2IZSA 3BV3A 4IH8A 4QYGA 4UEUA 3I5NA 3TIZA 3TN8A 5JGDA 4CZUA 3RK5A 4NIFA 4RIWA 4BBFA 2WGJA 3MDYA 3QTIA 1KE8A 1Q8WA 2C6EA 4ASEA 3CCNA 3LPBA 1OKVA 3QTXA 3R30A 4BTFA 4F0FA 3EB0A 3CPBA 4BB4A 3AT3A 3HV7A 1STCE 3NYXA 4IFCA 1ZRZA 3W32A 4A9UA 4L43A 4BF2A 4OAVB 3R1QA 4FSTA 3KMUA 1CKJA 4ZY5A 2WHBA 3POOA 2RFNA 3EQHA 5GIPE 1UNGA 2O5KA 2RKUA 4K18A 1WMKA 5KKRB 2FH9A 3F7ZA 3QWKA 4YZMA 3I0QA 2FYSA 3MFRA 1S9JA 2OIBA 4M69A 3HP5A 4BWXA 4S34A 1H24A 1QPCA 4GL9A 4F0IA 4JG7A 2VGOA 4HGLA 4F0GA 3ORIA 1OPJA 1OITA 4QNYA 5F94A 3SX9A 3QF9A 4OGRA 3R28A 4C37A 2C5OA 3HV3A 4JR3A 4RWLA 5EDQA 5FEDA 5CAPA 2BKZA 3IECA 1OMWA 3QQFA 4BDAA 5FM2A 4WNPA 3U9NA 3HX4A 4BWKA 5L2SA 3V3VA 3KF7A 3BHVA 1WBSA 3SA0A 4QP3A 5H9BA 5J1VA 3HAMA 3F3TA 4D28A 5DEWA 3EQGA 3BBWA 4BKYA 5GIOE 5CSPA 1YDRE 3KKVA 4IIRA 4QRCA 4O22A 4QOXA 3TKUA 1F5QA 3PIZA 5AP4A 4BHZA 4Z7GA 2WMAA 3RCJA 3ZRKA 3BWFA 5EHYA 5CEOA 2IZTA 3UODA 3UYSA 3DB6A 4EH5A 2OH0E 1YWRA 3OS3A 4BL1A 5DR2A 3KK9A 5EYDA 3EZVA 5IQBA 2YITA 4MBJA 3ZBFA 3WF5A 3ORZA 4FVPA 3NCGA 4U40A 3SG9A 4RIOA 4BZNA 4FK3A 1O6LA 4CMOA 3L8PA 3F5PA 4I1ZA 4EC9A 5A4QA 4KRDA 4Y73A 1SYKA 3COIA 2QI8A 3R8MA 2IO6A 2NPQA 3O2MA 4RIXB 3UO4A 3V5LA 3KREA 4FEVA 4C62A 1NVQA 2BRBA 3F2NA 3QKMA 4MVFA 4IHPA 3SXSA 2WQOA 4FV1A 4GT3A 5AUTA 4J96A 2RFSA 4BDFA 3PLAE 3R8VA 3G0EA 2VWUA 4R1YA 2ZB1A 4HPTE 4EOKA 4DGLC 4H1MA 3VHKA 4XG3A 2OXXA 1OL6A 4I4FA 4FX3A 3KVXA 5KZ0A 2PHKA 4GIHA 2YFXA 1QPJA 4I23A 4JT3A 1TVOA 3FMMA 4PQNA 5IEVA 4UWBA 4E6DA 4QNAA 2X8IA 2J0MB 2REIA 3NWWA 3VBQA 4HGSA 4YJSA 1IEPA 1E1XA 4YPDA 2FSOX 4ZSLA 4I4EA 3WF6A 5DH3A 4O82A 3H30A 4G17A 4JBQA 2YCSA 4IB1A 2J0LA 4USFA 4FKRA 3IW8A 3FL5A 3PSCA 4BDEA 1O6KA 3A61A 4FF8A 4BBEA 3GENA 2O63A 5HNIX 5J95A 4FKWA 3C4XA 3FZTA 3R02A 4TYGA 4S31A 4C58A 4YUQA 4K11A 3UC4A 5JK3A 4UZHA 4NKAA 4ZSEA 1UU7A 4FIHA 2C6MA 4G3GA 4XP3A 4F6WA 2OGVA 1J7LA 1PF8A 4PL5A 1LEZA 2I40A 4Q5HA 4YZCA 4GK4A 2UW0A 2VGPA 3JVSA 2GS2A 4AGWA 5HTIA 4W9XA 2WOTA 3COHA 3OTVA 3QZHA 4BGHA 5FP5A 4CZYB 2C5YA 3D9VA 2NNWB 3AC8A 2WMBA 2QR7A 4DFBA 4EH3A 1Y8YA 2YM4A 4E1ZA 4M12A 5DLSA 5L2TA 1FVRA 3P78A 2EB2A 3AGMA 2C3IB 2O2UA 4F9AA 3AC1A 1OPLA 4MTAA 4GMYA 5E1EA 3KVWA 4BFMA 3IK3A 3OCBA 3A7GA 4QMZA 4AFEA 2C3LA 3FLNC 3KL8A 4R7BA 3RAIA 5M06A 1ZAOA 2W1FA 3LFAA 3T9IA 2R4BA 3Q52A 1J91A 3DLSA 1DI9A 3QD4A 4WD5A 2YWVA 4QMMA 4FI1A 3JXWA 4M0ZA 4RMZA 4RT7A 3VBWA 3POZA 4U41A 5CVGA 1WBVA 4FIEA 4MNEA 2RF9A 1WVYA 2OJJA 3A60A 4L52A 4C4GA 4EYMA 2X2MA 1KWPA 2XA4A 4JDIA 2C5NA 3QTQA 2QHNA 5HBEA 4BGGA 4IFGA 5BVKA 1H1SA 5GINE 3WE8A 3ETAA 3LXNA 1Q5KA 2WIHA 2XM9A 4DGNA 2GNFA 2WTVA 2BUJA 3PG3A 3HUBA 3MPTA 5DA3A 3DCVA 4W4XA 4QTEA 2RG5A 3S00A 4BCMA 4WBOA 2VX1A 4UYAA 3EFLA 1JSUA 3H0YA 4Z3VA 4ZJVA 1OL1A 1V0BA 3FHIA 1ERKA 4G9RA 4GFMA 3IW5A 5FBOA 4O84A 4OBOA 5AV3A 1W7HA 3QXOA 2ZMDA 2W05A 4O0WA 4BDIA 2H96A 1U54A 1B38A 3HP2A 2ZDTA 2ITQA 4X6QC 2HENA 3QRIA 1ZY4A 1SMHA 3VS3A 4RC4A 4A07A 4EQCA 5CAUA 5JFVA 2YIYA 5HBHA 3ZLSA 4AE9A 5M4CA 4BTKA 2PVHA 4ZJIA 2O64A 2X1NA 2YLFA 3ANQA 3S4QA 4DH3A 4IJ9A 5CANA 3GCSA 4HVGA 1CKIA 3GP0A 5IEXA 5IH5A 3DU8A 3O96A 2QG7A 1G8AA 3EHAA 4MYGA 4ERKA 2ETMA 4K2RA 3VRZA 2CN5A 4D9TA 3QC4A 4FNYA 1PKGA 4WG4A 4MKCA 2WTCA 1KUTA 1IASA 3VUHA 1NY3A 2XIXA 3DB8A 2XNEA 2GNHA 3MY1A 3KN5A 4GK2A 3CLYA 1FMOE 2F4JA 4I6FA 4J1RA 3P23A 5CU2A 3DA6A 2W1IA 3U55A 3QD2B 4ZLZA 4Z9LA 4ASZA 3NNUA 3BHHA 4QMTA 1BLXA 3NW7A 3D7TB 2QO7A 3TTIA 5CF4A 2PVNA 3K54A 5J5SA 4V0GA 4UV0A 4FSYA 3RPOA 3BLHA 3UIUA 4OTIA 5AADA 2HK5A 2JDRA 3F5GA 3ZM9A 2QO2A 4RRVA 1H1PA 2W06A 2IVVA 4FV6A 3QQHA 3U4WA 3Q2JA 3GCQA 1YQJA 2B55A 3EJ1A 5HG9A 4FE2A 3RALA 2FB8A 3K5VA 4RC2A 3LMGA 4N70A 5GJDA 2PVKA 3IW7A 2ITTA 2UZVA 5BVEA 3EZRA 4A4XA 5JSMA 2EXMA 2XK9A 5L4QA 1URWA 4ID7A 3IOKA 2DQ7X 3LCTA 1Z57A 3QUDA 3RINA 4CVAA 2GCDA 3BU3A 4FGRA 4FMQA 4QMUA 3ENMA 3ZM4A 5L8KA 2GQSA 4TRLA 2F7XE 4DH8A 4X3FA 5LMBA 4F1TA 3ZTXA 2HXLA 3DDQA 4XV2A 3ID6C 2XZSA 2HZIA 3FZ1A 4LRJA 1YHSA 1H4LA 4E26A 4IX5A 5ETAA 5AUZA 1JKSA 5HKMA 4FZ7A 5LMKA 2R0IA 5CYIA 2W4KA 1ZYLA 5IU2A 2E9OA 2YDKA 3K5UA 1H0VA 5HLNA 1GZNA 3UOJA 3KF4A 4I0TA 5I3RA 5J87A 2UZDA 4JS8A 3DT1A 5AP2A 5C1QB 4I92A 4WNOA 4D58A 4BY9E 2GTNA 3A2CA 4NH1A 4BDKA 5LWNA 4UYNA 4GT5A 2OBJA 3OMVA 4L9IA 4QMOA 4AN3A 3WF7A 3BGPA 4G34A 3EL7A 4HVHA 1AGWA 1H07A 2X7OA 2A27A 4K77A 5D7AA 5AP5A 4EH7A 4APPA 1U46A 4DH5A 3A7HA 3CR0A 2PZ5A 4J8MA 4GH2A 4FZ6A 2XYNA 4NJDA 4IADA 5K3YA 3WOWA 3BE9A 2R7BA 4XYFA 1JWHA 1JKTA 3K2LA 4ZSGA 4LL5A 2QOOA 3L8VA 5CU6A 4FSQA 2PZRA 3R1SA 2X9FA 4JJRA 1UKHA 5ANEA 5I4NA 3MTFA 5D10A 4Z55A 5AEPA 2OZAA 5KCVA 5IQFA 3PPZA 4AN2A 2ERZE 2XNNA 4V05A 4IQ6A 2XNOA 1B39A 4D2PA 4PMPA 3VO3A 4USDA 1PXPA 3DAEA 4RWJA 3H4JA 1CSNA 2W1CA 4BCQA 5EKNA 2CNVA 4J98A 5AA9A 1YXUA 5AP7A 4L53A 4K33A 5D41A 3UP7A 5BYYA 5AX9A 1CKPA 5HU3A 2XK6A 3LCKA 4ANMA 4AW2A 2P0CA 2BCJA 3W8QA 3DZOA 5EI6A 4B8MA 2YCQA 1YRPA 3SRVA 2VZ6A 2J0JA 4ACDA 2HW7A 4GCJA 4CV9A 2OIQA 2YIXA 3BIZA 3D5WA 5BMMA 2W1HA 2QOCA 3AQVA 3UIBA 3NSZA 5FLFA 5I9VA 4OTPA 4U9AA 5CXHA 4FEUA 5CU0A 3JY0A 3QWJA 3U4UA 3PVBA 2PZIA 1PW2A 4NW6A 3LLTA 4OTWA 5EYKA 3SLSA 2ONLA 2UVYA 3SAYA 3RK9A 3P1AA 5B7VA 1YDTE 2HZNA 1IAHA 4JQEA 1UA2A 5FG8A 4QYFA 3JS2A 4L3PA 4NU1A 5HD7A 4AZWA 4AACA 3G9LX 3NAXA 4ENXA 3S3IA 5LCKA 1OBGA 5CI7A 3ZMMA 2QQ7A 5IQAA 4FT0A 3E62A 2A19B 3TM0A 3HMNA 3BU6A 4FV2A 3FV8A 1G8SA 4BKJA 2G9XA 4CKJA 2IPXA 4YTCA 4NFNA 1IR3A 4PMSA 2IW9A 4S2ZA 3OBGA 4USEA 3HMOA 2WXVA 3UZRA 3DLZA 5I9ZA 2PMLX 5B2LA 5FD2A 4L42A 5CVHA 4UBAA 4TNDA 5ACKA 3FC1X 2XRWA 1VYWA 2GU8A 3LOKA 1XH6A 5H8GA 2JFMA 2V55A 3DNDA 1OECA 1R78A 2PY3A 2VTSA 3DKGA 3VNTA 4AOTA 4CQGA 4R77A 4ACMA 4FOBA 1JSTA 4YSJA 4KIKA 4YBKA 5I9YA 4R7HA 2DWBA 2VNWA 3RZBA 1AQ1A 3ERKA 4B7TA 5IEYA 2JDOA 3TT0A 3V8SA 4DH7A 4HGTA 5L3AA 2XEYA 2XS0A 4XV3A 4AN9A 4RIYB 4UMRA 4GYGA 3FZRA 2R3MA 4MXOA 5CEKA 3TV6A 2W1GA 5IG1A 3NNVA 5CAQA 2ZMCA 4HYIA 2EUFB 4OTRA 5ANOA 1XKKA 3BYOA 2XBJA 2RSVA 3C7QA 1S9IA 5HZNA 5JN2A 2G01A 1PMEA 4OBQA 3A7JA 3G90X 5AV0A 4L7SA 5GHVA 1G3NA 3ZCLA 5KBQA 4PTGA 4FUYA 2BRHA 4TWPA 4AXAA 4GT4A 1IA9A 3CKXA 3CJGA 2WTWA 3BYVA 2Z7LA 4R5SA 4FVRA 2Y0AA 3EFJA 3E64A 3R9NA 3PE1A 4F9YA 4M69B 2QOBA 3KN6A 3VUTA 3HA8A 3RWQA 3VBXA 1UU3A 1UWHA 2PWLA 2CGUA 3UO6A 4M84A 3TIYA 2XH5A 2O65A 2VTHA 4F6UA 4KS8A 4NFMA 5IA5A 4KIPA 3IONA 5A4CA 3BX5A 3NNXA 1H8FA 4HNIA 3PZHA 3R8ZA 2GNLA 2VUWA 4LV8A 5FRIA 4NK9A 4M3QA 4BYIA 4F08A 3ZO2A 3NUUA 5E8VA 3HV5A 2GPHA 2QODA 2YISA 4F7NA 3WYXA 2XIKA 2WMTA 3C0HA 2A1AB 1RJBA 2I0YA 4WA9A 4WT6A 2CNUA 4HYHA 5LJJA 2WMSA 4M0YA 4O0YA 2PE2A 4M8TA 2Z8CA 4WOVA 4XG4A 3DBQA 4UMQA 4LG4A 2GQGA 1Z5MA 4FUXA 1JSVA 3F82A 3MTLA 3VS5A 1WVXA 4OTFA 5JT2A 4U80A 4RSSA 4WSYA 3C4EA 4LOPA 4LRMA 4NJ3A 5CF5A 3AC5A 4MXAA 3R9DA 2YAAA 2I6LA 2X2KA 4YLKA 5EG3A 2PULA 2PYWA 1WCCA 2WNTA 2YWPA 4TN6A 5AX3A 4TL0A 3FMLA 4NM5A 1UU9A 3EQBA 1PMVA 4PPAA 2YM8A 3EYHA 5H8BA 1WBTA 2JBPA 4IB3A 2QKWB 4FA2A 5IMXA 4D4VA 3O23A 5CVFA 4YO6A 5JQ5A 2BALA 4JG6A 5A46A 1IA8A 4ZTQA 4RVTA 4HVIA 4C61A 5CU3A 3ROCA 2UZBA 3CEKA 4UXQA 2R7IA 2GS7A 4CFWA 1Q41A 4XOYA 2BAJA 2QOKA 3ZLXA 4O2ZA 3H0ZA 3ZEWA 3KEXA 3P7CA 5TR6A 1U5QA 3UNJA 3PA4A 4E5BA 4E4MA 1KOAA 5AP6A 1ZMUA 3Q60A 5CASA 3LFQA 5I3OA 2WELA 3R71A 1NW1A 3PY3A 4QP9A 2WMRA 5CI6A 1R1WA 1MP8A 2WD1A 3PRIA 4FTKA 3KU2A 4TYJA 2G2FA 3FY2A 4JL9A 3I60A 4PV0A 4FT5A 2P4IA 3ZC5A 3Q32A 3Q3BA 4JG8A 3E5AA 5D1JA 4DFNA 4FEQA 2YACA 4ALUA 3QRUA 3AMYA 4FT7A 4F7JA 3MJ2A 3MVHA 5CSVA 3R2BA 4RQKA 4KD1A 5M4IA 5L8LA 3OW3A 4BCHA 5HCZA 3FMJA 3ATSA 3ACKA 4X0MA 4BDBA 4U7ZA 4YJVA 3OOGA 3OXZA 2CSNA 4RVKA 4B99A 2E9VA 2VTRA 3FWQA 3QHRA 3KRLA 5HE1A 3DXPA 3E8EA 3NGAA 3ZO1A 3UMWA 5JRQA 3VUIA 4F4PA 4AOIA 5JFSA 3P7AA 1SVEA 3LAUA 2XB7A 4W8EA 5C01A 3NYVA 3OY1A 1XQZA 3LLAA 1ZOGA 5IDNA 1ZLTA 3I6WA 4FTUA 4RJ8A 4ZTNA 1OBDA 1SZMA 5IUIA 2J9MA 2BTSA 2JITA 3KRJA 4EH6A 4KBAA 4FIJA 2B53A 5B2MA 4YTHA 3RKBA 4AZSA 3OCGA 2R3GA 3VWAA 3CD3A 1APME 2A0CX 3EMGA 3DKFA 2X7GA 4YJTA 3SW7A 3GOKA 2GHGA 4BGQA 4MNEB 3NVKI 3Q04A 4XH6A 5AR2A 2OJGA 3FKOA 5E8TA 1T45A 4XP0A 3DAJA 4FEWA 4GRBA 4AGCA 4EWQA 2BFYA 5CXZA 4ZTLA 5BVWA 4D1SA 4I41A 5IQDA 3UTOA 2LGCA 4O6LA 4IWOA 3QKLA 4DEAA 3ORMA 4E4LA 4NTSA 3BYUA 2BMCA 2B9FA 2YDJA 4BCJA 2JKKA 3MA6A 1I09A 4L8MA 3ZYAA 4YJRA 1GY3A 4AE6A 2QG5A 4YZBA 3OG7A 4FT9A 4FKUA 3MBLA 5DRBA 3PXKA 4C3FA 4FSUA 3SHEA 3EN9A 4EOMA 1VYZA 3KXHA 2G15A 5A4TA 4TTHB 5AUUA 4Y83A 2JIVA 4YHTA 4P90A 2Y4IC 1FINA 2UZEA 1R39A 1PYEA 2Z7RA 4YGAA 3E8CA 5C27A 2WU6A 2W5BA 3C9WA 4WKQA 5EW8A 3D7ZA 5HCXA 4MXZA 3FC2A 2H8HA 2OG8A 2BPMA 1JNKA 3R7VA 3VS1A 4DG0E 4X21A 1XH7A 3VULA 5TOZA 3MSSA 4XRLA 4CG9A 1Q8UA 3RCDA 4DHFA 1G5SA 4MH7A 4TNBA 3UGCA 5HE2A 2QCSA 1WFCA 3ZRMA
chains in the Genus database with same CATH superfamily
2JGZA 3PSDA 2CPKE 3VF8A 5IQIA 5CZHA 5AM6A 1Q4LA 4ZXTA 4AG8A 2W7XA 2IZRA 4ANNA 5J79A 5M4UA 3DNEA 4YR8A 5K5NA 2Z7SA 3FLQA 2OXDA 4BI0A 4LGDA 5KMNA 4CD0A 3KRXA 1W0XC 3A7FA 3EQRA 4FKJA 4AA0A 3HUCA 1GAGA 3O8UA 3MVJA 4NKSA 5E8ZA 4G6NA 4O83A 3LXLA 4RPVA 4H05A 3VVHA 5AV1A 2WTJA 4O7TA 1UWJA 3FYJX 3QRKA 5KX8A 4FKSA 4HPUE 4QMQA 2C30A 2VWWA 3V01A 1PYXA 4FZDB 5HQ0A 1Q62A 3EN7A 2VO7A 5HNBA 4LM5A 3LFEA 5A14A 3MIYA 3U87A 2X7FA 4K8AA 1NT2A 4XX9A 3L9MA 1NVSA 1XH9A 4AOJA 2ITPA 4LFIA 4PP9A 1HCLA 4EONA 1YI3A 2XCHA 1U4DA 4YURA 4BCOA 4MD8E 5AP1A 3FLZA 2OXYA 2OJFE 1W2FA 4X3FB 5M51A 3BLRA 3HA6A 4N6YA 4DBNA 5TT7A 4O1PA 3FMNA 3T3VA 3ITZA 3ZOSA 4A9YA 2XIRA 1PXOA 2ZV7A 4BCNA 4FNWA 3LFCA 5IZFA 2JAVA 5C4KA 1QPDA 3BU5A 3QU0A 5T68A 1H08A 3FI4A 4LUEA 2UZTA 1A06A 4YP8A 4CZTA 2OF2A 4GSBA 3OZ6A 4X2FA 5K0KA 4EH4A 5EQEA 2XAMA 3FLSA 4JIKA 4Q2AA 1XBAA 1YHVA 3HDNA 3PIYA 4ALWA 1GIIA 4W9WA 4MNFA 3TJCA 4XG6A 4ZZNA 3MY5A 1FGIA 2XNMA 3IDCA 4RC3A 3N4VA 4G31A 3Q4ZA 3R7IA 4EH2A 2Q0NA 2E2BA 1OL2A 4I5HA 4JDKA 5A6OA 2UVXA 3R7GA 3R0TA 3HEGA 2V7OA 1Q8ZA 4IWPA 3PUPA 1ZZLA 4BDJA 1XO2B 3BYMA 3C4FA 3EQFA 3L1SA 5I0BA 1V0OA 2QR8A 3ATTA 5BNJA 2YIQA 4BN1A 4EKKA 4KIOA 1CTPE 2JC6A 3ZBXA 2OIDA 2OZAB 3IPHA 1DM2A 4BCKA 3TUCA 2J2IB 3R9HA 5ANKA 3D83A 1A9UA 4E3CA 3GU6A 3VHEA 4CFVA 4YSMA 4TPTA 4EH8A 2WTKC 2BZHB 3QD3A 4L45A 5CENA 4TWCA 4E73A 2PPQA 2IW6A 3L9LA 1XBBA 4QYEA 2UW5A 1YHWA 4UWYA 3EIDA 3ZO3A 2YJRA 2C0OA 2BFXA 4G6LA 2W1ZA 3OTUA 4R6VA 2VWYA 5AMNA 5E8XA 3SRVB 3TTJA 4NEUA 4JDJA 4YTIA 5HBJA 4XG7A 3QALE 4GYIA 3E87A 4IM2A 2JBOA 4RJ7A 5A3XA 4EOPA 4AW0A 3NVMB 1G8KA 2NO3A 3NIEA 3CQUA 2YM3A 3BHUA 3HVCA 3ODYX 4IC7A 5FEQA 2OICA 2WTDA 3P08A 3QGWA 4IVDA 3W2RA 4CQEA 2CLQA 2BROA 1E9HA 3DOGA 3WI6A 2JKQA 3C0IA 4FTMA 3NZ0A 4MF1A 5CY3A 5BVFA 4NSTA 3SOCA 5IQHA 3CY2A 2O3PA 5AUXA 4GW8A 4IX3A 3IQ7A 3FY0A 3KRRA 5EDRA 4I6BA 2GQRA 3AT4A 2I0VA 4RX7A 4E7WA 4FKVA 4RZVA 4UMPA 4M14A 2PUIA 3LCDA 3E3PA 5HESA 4GKIA 2W9FB 4C7TA 3D4QA 3HRFA 3BELA 2BHHA 2ZV9A 4XOZA 5A9UA 3MN3A 3P0MA 2Z02A 4L3LA 5D12A 3C5IA 4TWNA 3KC3A 4W4YA 3I81A 4LQMA 1R3CA 2OW3A 2VO3A 3OWJA 4U79A 4XMOA 3M2WA 1F3MC 3A99A 5HICA 2GHMA 2H9VA 4HJOA 3KMWA 4O4EA 1SVGA 3TYKA 4YLJA 3LFDA 5C8MA 4O21A 4FTOA 3NUXA 3RZFA 2XJ0A 3NAYA 3PJ1A 5DBXA 5HLWA 5EW9A 3W0MA 3OWKA 4AA4A 1K3AA 2ZM4A 3F61A 4M66A 3HAVA 4QP2A 3ZFYA 3HL7A 4EBVA 4Y46A 3DXQA 4L00A 5DR6A 3FJQE 3FEGA 4HCTA 4ZLOA 4CEGA 4IM0A 3DQWA 3NW5A 3ZHPC 3RI1A 2BAKA 2RL5A 4I20A 5FQDC 2KULA 4O38A 2C4GA 4EZ3A 4EOOA 3COMA 4FTLA 3R7OA 4O7SA 2F9GA 1VZOA 1CMKE 3D2IA 4QMYA 3V8TA 3D2KA 4FTIA 4GVJA 4HYSA 4IAIA 4KSPA 3PA3A 5HU9A 3ZONA 3KFAA 4KSQA 5BVOA 3GFEA 4UX9A 5HI2A 3UBDA 4G5PA 5E8SA 1UV5A 4YZNA 3OOMA 4EK6A 3ORXA 2UW7A 4FODA 5KKRC 3FBVA 2F2UA 4NW5A 2JLDA 5AP3A 3OEFX 3VW6A 5I9UA 1GJOA 5EM6A 1KSWA 3TI1A 4B8LA 5HGIA 4CYIA 4F9BA 1MQBA 4K6ZA 3RPRA 4DA5A 3EKKA 4OTHA 2GNIA 4FJVA 4L67A 1PXKA 5ANIA 4F78A 2QVSE 2YN8A 3HKOA 5DEYA 4O81A 3I0OA 4GUEA 4Y8DA 3BZ3A 4LMNA 1URCA 2BDWA 3WE4A 2NYAA 2XK3A 3BBTB 4R8QA 5CS6A 4D2TA 5BUJA 1T46A 2XM8A 4JVGA 4D55A 2VX3A 3F3ZA 3BEAA 4TKSA 2CGVA 5ETIA 5IQEA 2FGIA 4EI4A 4G5JA 4B6LA 2OJIA 4I24A 3SC1A 2W0JA 1DAYA 3TKHA 5HCYA 2OH4A 3BPRA 4PPCA 2CMWA 3KRWA 4QYYA 4C34A 2C68A 2OU7A 3EQCA 3FHRA 3L9PA 3D0EA 3QZGA 4KA3A 4KABA 5FP6A 2Z7QA 2YM7A 3DBEA 2RFEA 4FEXA 4RX8A 1TQIA 4EUUA 5L2WA 5FXSA 4FTNA 5EI2A 2W5HA 5KO1A 4CLIA 3AKJA 4UZDA 1J7UA 2V22A 1OL7A 2ETRA 2PUUA 2XK8A 3E63A 1SM2A 2UZNA 3CSVA 4IXPA 3RNYA 4CRSA 3QA8A 4N0SA 5KZIA 3SOAA 3ZSIA 4PP7A 4YTFA 3OD6X 3OWPA 3UNKA 4IC8A 4ZS4A 1YXXA 2XCKA 4FSNA 4QPAA 1ZYDA 4A9TA 2PTKA 4IX4A 3OVVA 1CM8A 4C38A 4PL4A 2C47A 4FOCA 4RQVA 1Q8TA 4QPMA 4A4LA 3N4TA 3Q9XA 3UQGA 2C6LA 5BYLA 5IMEA 4ZTRA 2C6TA 4G3EA 4BWPA 2X81A 5CNNA 5AJQA 3D94A 4GV1A 3FAAA 4ALVA 3S1HA 3DJ5A 2PU8A 3FQHA 4YMJA 5LVLA 2JIUA 4FTCA 4B4LA 3CQEA 4E4XA 5AM7A 3WZJA 2W1DA 5A6NA 3HMIA 2LAVA 2VTLA 3W10A 3K3JA 4YO4A 3S2PA 4ZMFA 4JOAA 3U6HA 4XV9A 2YA9A 4MD7E 4FNXA 3QAME 1PXJA 4C8BA 1Q99A 2VX0A 2IWIA 2HIWA 3GOPA 3C4CA 3I79A 3LXKA 4IBMA 2IVUA 1JVPP 4ITIA 4L6QA 4WRGA 2YJSA 3V5JA 4MQ1A 4GG7A 4G3CA 4YNEA 5ETFA 5HVJA 3VBVA 3VQHA 2JKOA 3RMFA 5C8KA 4LYNA 2OZOA 5DVRA 5HIDA 4QQ5A 2EXEA 4C3RA 3NDMA 4DTBA 3E7OA 1P4FA 1WVWA 4FNZA 3OHTA 4PY1A 1F0QA 5J7HA 4EBWA 5JZJA 3QQUA 4FSMA 2BAQA 4AUAA 4G16A 5IH4A 5F95A 4D2WA 3AD4A 1FQ1B 4TYHA 4P5ZA 3NPCA 3S0OA 3LMIA 3I4BA 4E6CA 2PL0A 1K2PA 2WAJA 3NRMA 4JR7A 3ZFMA 4G3FA 5KHWA 4AGUA 4Z16A 3Q4TA 4EOLA 4D2VA 1YI4A 4RZWA 3HMPA 5AAFA 2RG6A 2PUPA 4RLKA 4AW1A 4CFUA 4UB7A 4R3PA 2ZV8A 5G6VA 5CTPA 2NP8A 3THBA 2XNPA 3P9JA 3U8WA 5DN3A 3BLAA 2QLQA 5HE3A 2EVAA 3V6SA 2BIYA 2ZVAA 5L2QA 4DCEA 4H3QA 3ULIA 4NTTA 4PMTA 3W2OA 1BL6A 1P5EA 4WUAA 2B0QA 3VAPA 2P2IA 3F7WA 1I44A 2HWPA 2P33A 5CEMA 2FO0A 4F99A 3MI9A 2VD5A 2WB8A 4C4IA 2ITOA 4RA5A 2HOGA 5M56A 1BL7A 1OI9A 3VS4A 4C4EA 5CX9A 2UW6A 2WOUA 2QOHA 3QHWA 3MVMA 1LUFA 2GHLA 2J6MA 3QTRA 5BVDA 2F2CB 2QHMA 2QO9A 4EC8A 4FTTA 3TWJA 2UW9A 4DG2E 3A7IA 4EL9A 3UZTA 2PVJA 4EK4A 2W4OA 3DPKA 3UDBA 3REPA 3DBDA 4C35A 4O0RA 3TUBA 1KOBA 3DDPA 4O0UA 4FTAA 3BL9A 4OT5A 2UZOA 5F20A 2YEXA 4I6LA 3AGLA 4FKIA 4I0RA 4MXCA 4IAAA 5AR4A 5AR5A 1P14A 3E8DA 5CSXA 5B2KA 4FKTA 3ALOA 3DK6A 2R5TA 4LV5A 4TZRA 4ZAUA 4FRFA 2XEZA 2ITUA 1LPUA 1H25A 3DGKA 4XNEA 4O2PA 3E92A 3IW4A 3G5DA 4FIFA 4GUBA 5F4NA 2OWBA 4YZ9A 2DUVA 4W8DA 3MVLA 4XG2A 3VBTA 1PXIA 5DGZA 4LRKA 4JLCA 4FV7A 3PXFA 5D11A 2HY0A 4C2WA 3UZPA 4AZEA 3KXGA 3I6UA 1AD5A 2CKQA 3CS9A 1ZOEA 4F6SA 5DI1A 5E8UA 4MWHA 4GVAA 4HW7A 4QTAA 2A2AA 3MYGA 4PDSA 5HO8A 2ACXA 4P2KA 2VRXA 5TF9A 3GU4A 2VTOA 2B52A 5HVYA 3LE6A 2VTQA 3OF0A 4F09A 3QD0A 1ZY5A 4MAOA 4BTMA 4HNFA 4NIFB 4RIWB 5C03A 4AZVA 3ZZEA 4C33A 5IF1A 4FR4A 3O50A 2WO6A 3KGAA 2Y6MA 2YAKA 2ZM1A 3PXQA 4TWOA 4CTCA 2XJ2A 4FKOA 4D5KA 4H3BA 2JDVA 2HCKA 2WMUA 4AFJA 4IDVA 4BKZA 2YERA 3VUKA 2X4FA 4RJ5A 4ZSAA 4GFOA 4O7VA 4QMWA 4D0XA 1KV2A 3UNZA 2CGXA 3F3WA 3OFMA 4U45A 3ORLA 3UO5A 5HX6A 1OIQA 2QOIA 3U9CA 3FZSA 5K9IA 2PMIA 3U54A 3H9RA 4W4VA 1ZWSA 3MWUA 1OKWA 3I7CA 3O8TA 4EK8A 1OM1A 3TDWA 4X2NA 4YNOA 2XRUA 5IISA 4CSVA 1ZMVA 2X9EA 3DTWA 2FA2A 4PF4A 3HZTA 3OBJA 2PK9A 2R3HA 4J8NA 4ARKA 4BCGA 3KY2A 4EOIA 3MGYA 3B8QA 4B0GA 5JKGA 1OUYA 4JAIA 5EDPA 2VTIA 1XH4A 1U5RA 1WZYA 3RPYA 4F65A 3R7EA 4J7BA 3DV3A 2YHVA 1OL5A 1YVJA 2C6DA 2R3FA 2OFUA 3MB7A 2OF4A 2B9JA 4MQ2A 3TZ9A 4C4FA 4IB5A 4LOOA 3W0QA 2DYLA 3G33A 3A8WA 4ZTHA 5CAVA 4JBVA 3CE3A 4X7QA 4DEEA 4JRVA 2HWOA 2PVYA 4C59A 4G3DA 5JGBA 3PVWA 2C3KA 4NM0A 4O96A 3V5WA 3EWHA 4AU8A 4BHNA 5K4JA 4ZIMA 3ZUUA 5GJGA 5AV4A 4UWCA 3RM6A 5JFWA 4HVDA 3UQCA 3FI8A 4QPSA 4UEUA 4FTQA 4BBMA 5CF8A 3TNIA 2YM5A 5HE0A 4KWPA 2C6KA 3PLSA 3ZLWA 3SG8A 2CNQA 4KS7A 2XF0A 1BUHA 4W4WA 2PSQA 3FZPA 4U44A 4FL1A 4WG5A 3ZSHA 4A9RA 4IM3A 4EJNA 4NYEA 4ACHA 5C4LA 4O7YA 2QOLA 4FKQA 5A4EA 5EHLA 3CPCA 2A4LA 3LHJA 4PTEA 3NFFB 3TDVA 5CSWA 4D4RA 3O7LD 5BMSA 4U42A 4JXFA 3JR1A 2PVFA 4FGBA 3WF8A 2BZKB 3Q6UA 4AQCA 2P3GX 4TYEA 2WEIA 3T3UA 5M53A 4XS2A 5BPYA 3BCEA 3R21A 4QP1A 3WZEA 3D7TA 2VTJA 1Z9XA 2R0UA 3BKBA 1UKIA 4I5CA 3PE2A 4ORKA 3QTUA 1M2RA 3AT2A 3NX8A 3TNPC 3LJ1A 4QT1A 4P7EA 4YPSA 2C6IA 4FSWA 3UYTA 3DBFA 3DQXA 3KB7A 3QBNA 4J97A 4K1BA 5HIBA 5DPVA 3PG1A 4X2KA 4DG3E 3DK7A 4AGDA 3ZFXA 5IDPA 5CQWA 3LKMA 1LEWA 4JX3A 2H34A 4RFMA 4QD6A 4CTBA 3R22A 4Y72A 1QPEA 3HV6A 3KK8A 3MY0A 3FZOA 4WSQA 5CSHA 3I1AA 4RG0A 4EH9A 4GJ3A 1ST0A 3HDMA 2WQBA 4Q9ZA 2ESMA 5IUHA 4I21A 1REJA 1TQMA 1M14A 1U59A 2QC6A 3BHTA 5A4LA 5GZ8A 5KMIA 1H27A 4YC6A 5DR9A 2XP2A 5M08A 4BIDA 2XK7A 3LFFA 2WFYA 4L01A 5EI8A 3L8XA 4DN5A 3CTQA 3Q9YA 3FL4A 3ZXZA 5CF6A 5D7VA 3I7BA 2WKMA 3C0GA 4NCTC 5H2UA 3R9RA 5M09A 2QU5A 4Q5EA 3W33A 3C4WA 3PWYA 4R78A 3C51A 4EK3A 1WAKA 5CT0A 3FSKA 4F63A 3RK7A 5EKOA 3AC2A 3VJOA 2VV9A 1ZYSA 3GU8A 4I6HA 3R04A 4UALA 5FTOA 5EK7A 4EHZA 4F7LA 3RP9A 4CCBA 4LGHA 4DFLA 5KHXA 4CT2A 3LCSA 3LMHA 3ZRLA 3RPSA 5ANDA 2XKEA 4C02A 2X4ZA 4U6RA 1GNGA 3ZUTA 3OP5A 1Q3WA 3ET7A 2HYYA 1J1BA 4ERWA 4Y85A 3NW6A 4MXXA 3HNGA 3C5UA 4BCFA 2XK4A 3IO7A 3MH2A 1JPAA 4D2SA 4FV3A 3G0FA 4WUNA 4MEDA 5EFQA 4DTAA 4DLJA 3QKKA 2BZIB 4D2RA 1VEBA 5C8NA 3LIJA 3QX4A 2R3IA 1PMNA 2QKRA 3VS2A 4JBOA 2W1EA 3GC8A 5TE0A 1WBOA 3R8UA 4ZLYA 2OJ9A 3FYKX 4DGOA 2XNGA 5HG8A 4DFZE 2VWXA 3PRFA 2PUNA 4A06A 3NYOA 5FUTA 2GFCA 2RGPA 4NL0A 4BJJA 1RE8A 2X39A 5B0XA 3DTCA 5GZAA 2I0EA 2P2HA 3Q4UA 3VJNA 3VW8A 3KXNA 2G1TA 1YOMA 4CCUA 4DYMA 1U54B 1W82A 3R2YA 2CDZA 3MFSA 1VJYA 1ND4A 2IN6A 2XKDA 5BQ0A 2JDSA 3AMAA 2HY81 1QCFA 4BTJA 4ZZOA 2ZOQA 4IMYA 1MRUA 3F5XA 4YC8A 4GKHA 4HGEA 3QL8A 4PMMA 5H8EA 4E93A 3MFUA 5M57A 3M11A 4S30A 2X8DA 4XJ0A 3DY7A 1NVRA 3O71A 3QCYA 4PTCA 1OGUA 5HO7A 2YZLA 1H00A 4N6ZA 4AZTA 2OSCA 5KMJA 4LV7A 4IVCA 3V51A 1W8CA 5HLPA 1UVRA 3CP9A 5AR8A 4GIIA 3BWJA 3UDSA 3IGOA 3A4PA 2QURA 5KUPA 5EM7A 4UY9A 4DFYA 4WRSA 2JAMA 2C5XA 5L8JA 3DZQA 3N9XA 3MPMA 5HTBA 4L3JA 4CMTA 4IAKA 2HZ4A 4J53A 5HG7A 3AC3A 4V0GB 4EQUA 3M1SA 5AFVA 4C3PA 4C2VA 4E4NA 3FMHA 3UDTA 3KCKA 4L7FA 3SV0A 3QCSA 1HOWA 2B1PA 3RPVA 3KULA 3LCOA 3GEQA 4IVBA 3WILA 3WZUA 4E6QA 4F1MA 1Y6AA 3LXPA 4CKIA 3B8RA 5BV3A 2QONA 4M97A 3WZKA 1GOLA 5A54A 2R3QA 3AC4A 1LP4A 2C6OA 4NCTA 5KE0A 4JQ7A 4QO9A 4ASDA 5L6OA 1WBPA 2CJMA 4FC0A 4FK6A 2PVLA 3OXIA 3HMMA 1QL6A 3DJ7A 3UQFA 3OCSA 1W2DA 4J95A 1DAWA 2GFSA 3R01A 4U43A 3T9TA 3DS6A 3C1XA 2J7TA 1K9AA 4ASXA 3F5UA 4AXDA 1H1RA 3ROYA 2PZYA 4RIYA 3ULZA 3GNIB 3OCTA 4XUFA 4Y5HA 4YJNA 3NUPA 2W5AA 4JX7A 3V5QA 4BDDA 2V0DA 4XCUA 2QU6A 4BVUA 2J51A 3MIAA 3NUYA 5E92A 5M55A 4E6AA 4QQTA 3FDNA 2EXCX 4ANLA 3GGFA 4FYNA 2GNGA 4AF3A 1NXKA 4C0TA 1L8TA 1H28A 3R83A 5EOBA 4I5MA 1NA7A 4O0VA 2JIIA 4APCA 1M7QA 4CT1A 4PPBA 3L8SA 5HO6A 1SVHA 2IW8A 5BX0A 3PY1A 4EWHA 1FMKA 5FDXA 4ZMEA 3GBZA 5AAGA 4YZDA 4FG9A 4FTJA 3VS0A 4RX9A 4ZTSA 1Y57A 3RM7A 4BI2A 2YCRA 4BIEA 4AQKA 5KNJA 2R9SA 4RFYA 3CD8A 3FI2A 2YIRA 5CT7A 4RLLA 1YXTA 2CKPA 3UJGA 4TYHB 4U5JA 2UZLA 3OEZA 2VWZA 4UN0C 1YOLA 3F69A 5J9YA 2ZV2A 5EQPA 4KKGA 2UZWE 3LQ8A 4I94A 4V04A 1SNUA 4QTCA 2ITZA 5DWRA 4MK0A 3TCPA 5KBRA 2OLCA 4DDIA 3TEIA 1H1QA 2YM6A 2J5EA 3R7UA 5LXMA 3DAKA 4KNBA 4RX5A 2VN9A 2X6EA 1J7IA 1YWNA 2EU9A 2W96B 4F9WA 5M44A 4ZSJA 3GU7A 3KXXA 3RTPA 3Q96A 1ATPE 5JMSA 4CMUA 3RAKA 2G2HA 4XLVA 4DITA 3ALNA 3EH9A 5IA2A 3AOXA 1OUKA 3VRYA 3BLQA 3CC6A 4DTKA 4ITHA 3RHKA 5KMLA 4X2GA 5FBNC 2R3LA 2VTAA 4ZY6A 1PMUA 1ZZ2A 3PWDA 3TV7A 3JUHA 1ST4A 5ICPA 3Q53A 5DOSA 2FSLX 1VR2A 3GT8A 2BDJA 3PIXA 1IAJA 5J9LA 3A4OX 3K3IA 5T6KA 3ORKA 5TO8A 3VS6A 4KB8A 4TY1A 4P4CA 3ODZX 3M42A 2I0HA 3V8WA 4DFUA 4TXCA 2XUUA 4KBKA 4ZJJA 4D5HA 1UNHA 4FV9A 2BDFA 1RDQE 2PE0A 3PTGA 5LQFA 3CQWA 3NIZA 1PHKA 3F6XA 3BEGA 3EQPA 1Q3DA 3GUBA 4IVAA 5GNKA 3EN5A 2F57A 4MHAA 3WF9A 3E93A 3AD6A 3GXLA 4XG8A 5LVNA 4MCVA 2WTIA 3IS5A 3R00A 5IQGA 3FMEA 1MRYA 1DI8A 3PPJA 3PYYA 4D4YA 2BRGA 4K9YA 4CRLA 5E4HA 3PZEA 5IA1A 4O0SA 4F64A 3GCVA 3PFYA 5AAEA 2CCIA 2WQMA 1H0WA 3R9OA 1J1CA 3WARA 4I6QA 1JAMA 3W8LA 5DT0A 4FTRA 3PXRA 3G51A 4A9SA 1YOJA 2XMYA 1OIRA 3PA5A 4L68A 4UMTA 1R0PA 4ZP5A 3KXZA 3RNIA 3VF9A 5CWZA 4IACA 3G9NA 3H9OA 1O9UA 1XHAA 3UOKA 5J7BA 3R8LA 2Y7JA 4UXLA 3EKNA 4XRJA 4N57A 1W2CA 1PXMA 4O4BB 3FXZA 2PVMA 2ZB0A 3BYSA 3EFKA 4C36A 3UIMA 5HTCA 3VUDA 3G6HA 4KIKB 2BKKA 3R6XA 4ANBA 5BVNA 3HECA 4DF3A 4PUZA 2EWAA 1ZXEA 2B54A 2BR1A 5DNRA 3BQCA 1YXSA 2XARA 2XANA 2ZM3A 4FV8A 2WMQA 3R1YA 3U51A 4FSRA 4DEBA 3NLBA 4K0YA 3BHYA 3F66A 3MH1A 4PL3A 5HNGA 5IPJA 1R0EA 2X0OA 2WMWA 3QYWA 4QMVA 5FGKA 4D9UA 2W99B 3F2RA 5HG5A 4D1ZA 4QMLA 3C13A 3VS7A 4M13A 3NUSA 2RIOA 3DK3A 5DMZA 3BL7A 3KMMA 5KMMA 4X3FC 2YDIA 2V5QA 3QXPA 3BV2A 1Y6BA 4N4SA 4QP7A 4WHZA 3TG1A 3UVPA 4DEGA 4CXAA 4CV8A 3TL8A 3MB6A 4RVLA 2ITXA 4ZK5A 3HLLA 4R3RA 4LMUA 3DFAA 2HZ0A 3O7LB 4FZAB 4EQMA 5LMKC 4KUJA 4PNKA 1YWVA 5BUEA 3TZ8A 3LM0A 3QCQA 5IKWA 3RAWA 3W0PA 1Q8YA 4DEIA 3VUMA 4U8ZA 4U0IA 2UW4A 3WZDA 3QQJA 4EZ7A 3ANRA 3ZXTA 4O1OA 5LARA 3PJ2A 2C1AA 2Y6OA 3H9FA 4ANOA 4F1OA 4PDYA 5FTGA 4EOJA 3VC4A 3KIOC 3FI3A 5T3QA 4AP7A 4YJUA 2AC5A 2VWIA 4IAZA 2WMVA 2XIYA 5K4IA 3W16A 3PUFC 1OZ1A 4HOKA 2IZUA 5LOHA 1RW8A 5TKDA 4C4JA 2CN8A 4ONAA 2J0IA 3GQLA 4Y95A 5G1XA 3MFTA 3PFQA 1GZ8A 3D14A 1VLRA 1ZYCA 2XKFA 3FSFA 5E8YA 3WIGA 2J5FA 5EOLA 4OAUC 2OFVA 3UPXA 2HXQA 2H6DA 3JYAA 5JRSA 2ERKA 3TNQB 2QD9A 3BE2A 2AYPA 2C1BA 4AAYA 2E9PA 3FXXA 4DEHA 4DDGA 3DKCA 4QYHA 4I3ZA 1UNLA 4FIGA 2YCFA 4KINA 3ZZWA 3AG9A 3OWLA 4C57A 2UVZA 5IA4A 5AUVA 4BR3A 4LI5A 4FV5A 4DT8A 3E7VA 2AC3A 4E5WA 2CKEA 4IZYA 4J99A 4BC6A 3IKAA 1GZOA 4YHFA 2Q0BA 4IWQA 4F70A 2B9HA 2BZJA 4FT3A 3BI6A 1P2AA 4AT3A 2VTMA 5L6WL 3TV4A 2WQNA 3QYZA 5KMKA 1BMKA 4GU6A 4A4OA 5AWMA 1TZDA 2WIPA 4LOQA 3ORTA 3F3UA 1GZKA 1PXLA 2C0IA 1BYGA 3TNHA 5AIKA 3UG1A 4QMPA 4IW0A 3LW0A 3MJ1A 3ENHA 5HORA 3D15A 4BCIA 3SD0A 3FKNA 4BIBA 3LJ2A 3HV4A 3SXFA 4R5YA 4O7RA 2UV2A 2JD5A 2XIZA 3P86A 2I7QA 2ONLC 1JOWB 1JKKA 2VNYA 1REKA 3COKA 3CTHA 4QQJA 2CHLA 5H3QA 4HCUA 3GVUA 4M7IA 4OTQA 2CGWA 4FL2A 2WPAA 1W83A 4IJPA 1OKYA 3BQRA 5CAOA 5LVOA 5J1WA 3RAHA 3A8XA 4OR5A 4G2FA 5HOAA 5DYJA 5LMAA 4PWNA 3QQKA 1E1VA 3SW4A 3JY9A 4ZY4A 2JFLA 2J0KA 1UU8A 3U6JA 1YKRA 3QUPA 5GZ9A 2Y4PA 4O91A 2WZJA 3Q6WA 4BDGA 1JQHA 3QLGA 1FOTA 1XWSA 3FPMA 2JDTA 2FUMA 4F7SA 3SDJA 4EK5A 3BGZA 3GB2A 4OT6A 2J4ZA 4YLLA 1SNXA 3TUDA 2BVAA 4LDTA 4BDHA 3LZBA 3IDPA 1KV1A 2R3OA 3W2SA 4FV0A 5CU4A 4CFMA 4IEBA 2UZUE 1OIYA 3QA0A 4FKGA 4A7CA 2OKRA 5CQUA 3U6IA 3LM5A 2GMXA 4XG9A 1FBNA 4E8AA 1M7NA 2CCHA 1GIHA 1OIUA 4HCVA 3UP2A 4M67A 3W55A 5L6PA 4QP8A 3CTJA 3V5TA 5LWMA 3NYNA 3NUAA 3FPQA 4CG8A 1DS5A 4MBLA 4NM7A 4BCPA 3AMBA 4KIQA 2R2PA 5FXQA 2AUHA 5J8IA 3W2QA 3QRJA 3TKIA 4UMUA 2W4JA 4JMQA 5EM8A 4EZ5A 2VTPA 5FEEA 5EM5A 1M2QA 3HRCA 5AP0A 2C0TA 2KTYA 4QQCA 3PVUA 3ZDUA 2QNJA 2IVSA 5CEPA 2UUEA 5IA3A 5LCJA 1J3HA 3CXWA 5LVPA 5I5ZA 5HX8A 3DBCA 2R64A 3QTSA 4GJ2A 3II5A 2V7AA 4RFZA 3EQIA 5AV2A 5CEQA