4RRVA

Crystal structure of pdk1 in complex with atp and piftide
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
284
structure length
283
Chain Sequence
KKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A small-molecule mimic of a peptide docking motif inhibits the protein kinase PDK1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords 3-phosphoinositide-dependent protein kinase 1
total genus 81
structure length 283
sequence length 284
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4rrvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4rrvA01
4FGBA 3QZHA 3WI6A 2XRWA 3H0YA 4MBLA 4F7LA 3CJGA 4NJDA 3JXWA 3KRWA 3NUUA 4FKTA 4MVFA 4W4WA 4ZLOA 3U4UA 3R83A 5HD7A 2UZNA 2C3KA 4X6RA 1QPCA 4PL5A 4YTIA 5KUPA 3UZTA 4U97A 3SRVA 4L43A 4APPA 4W9WA 1VJYA 2JDOA 3RWPA 1UKHA 2PVFA 1CKJA 4C4EA 3AC2A 2VX1A 2JDTA 3UQFA 2BMCA 4DTKA 2QCSA 5CZIA 4O2PA 4G6LA 1P4FA 3TTJA 5M08A 2WTKC 3NZ0A 4E5BA 3QUEA 3R1NA 3LFDA 4MF1A 2WHBA 1W7HA 3MVLA 4NTTA 3QKMA 2PVHA 2BZKB 2YCSA 4KS8A 4UZHA 3ANRA 3OT8A 1KV1A 5J1WA 3CSVA 4DTBA 3EL8A 3MH3A 4BCKA 1TKIA 3S1HA 4OAUC 4MH7A 3VUMA 4BR3A 3D5VA 1OGUA 3BIZA 2YIXA 2Z2WA 1Q8YA 3BI6A 5AR7A 4BGQA 5CSHA 1SNUA 2ZM1A 3R73A 4CGAA 2R7BA 3PJ3A 5CF8A 4FE2A 4ZTNA 4K8AA 4XP3A 3LCOA 4WT6A 4C2WA 3KRJA 4IIRA 4TY1A 3AC1A 4O2ZA 4ZEGA 3GBZA 2ITVA 3QD0A 5M09A 3MTLA 1JKTA 4H3PA 4GT5A 4R1YA 3G15A 2CGVA 2PVLA 2W4JA 5EG3A 2HIWA 4I5MA 1ZXEA 4CFMA 3DLSA 2GQGA 1OITA 4QMQA 5LWNA 5AAFA 3ZUTA 3R2YA 4X0MA 3U6JA 2CPKE 3QLFA 3SA0A 4BYIA 3JR1A 3GENA 4J53A 4R7BA 1OPKA 3MH2A 2ZV9A 5HE1A 5IQIA 5HTIA 4I6HA 3O8PA 3R04A 4G34A 2R3FA 3A2CA 4BCIA 3G5DA 4EC9A 3MFRA 1Q62A 2FSTX 4UBAA 4FSUA 4GSBA 4EH2A 4EH5A 1FGKA 5FTGA 3HAMA 4BDDA 5A46A 2XIZA 2BRBA 4DAWA 2PSQA 4FKOA 4F7JA 2Y4IB 3QRKA 5M53A 1OB3A 1STCE 3BWJA 3FXZA 4DGLC 4F08A 5IQCA 2ITUA 3NVMB 3KK8A 4G2FA 3ITZA 4QYGA 5LMKA 3HUCA 3PWDA 3G0FA 4PP7A 4I21A 2XK8A 5K9IA 2OF2A 2VTQA 4FSNA 5GINE 2RG5A 3BPRA 4LV8A 3V6SA 2HW7A 1JKKA 4MQ2A 4WIHA 4CFUA 3VHKA 3O7LB 4J7BA 5L4QA 1IG1A 3RALA 3C0IA 1DI8A 5D7AA 5A4LA 4QPAA 5L2TA 3TUDA 3H4JA 3QYWA 4XH6A 4XUFA 3UC4A 2GMXA 3FWQA 2O3PA 1YDTE 4HCTA 3PG3A 3UO4A 4ALUA 2UZUE 4IC7A 3A4OX 3S00A 3PUPA 5TF9A 3S3IA 5FEEA 1URCA 2XA4A 2FA2A 3H0ZA 3IECA 2WB8A 4LRKA 4BICA 3C4ZA 5AM7A 3BHVA 3BZ3A 3L9NA 3LCKA 4YURA 4NU1A 2HCKA 4RJ5A 3FLQA 4QMTA 3ET7A 1VR2A 2XZSA 2B9FA 2XKFA 4FI1A 4M0ZA 4XNEA 4X2KA 4I94A 2QKRA 2UW5A 3DXQA 4HPUE 4M84A 5KMMA 4KD1A 5BVNA 4R78A 5FDXA 4EKLA 3MI9A 5CLPA 3TNPC 1CMKE 1KOAA 2WMWA 2XVDA 4TWPA 4AOIA 4QTCA 2EB3A 2RL5A 2CLXA 2XNMA 4BB4A 5J1VA 2W1CA 1WAKA 1UV5A 3SV0A 4D9TA 4AW1A 4W8EA 3RBWA 3FPQA 3QKLA 4NCTC 2C6DA 2JKOA 3WF9A 4C37A 3M1SA 2A1AB 3BU6A 2J9MA 5AADA 4DN5A 2WU6A 1OPLA 2Q0NA 4XP2A 3FEGA 4RC3A 1M2PA 3TXOA 2OFVA 4ACHA 3E88A 2H6DA 2X9FA 5HLNA 3G51A 3IGGA 4KWPA 3HGKA 5C27A 3Q4CA 1W83A 2FGIA 5HTBA 5M4CA 3KXMA 4W9XA 2IPXA 4CG9A 3MY0A 3KXHA 1GIHA 4A4OA 2VTRA 3M2WA 2JIIA 1H28A 5D7VA 4ANBA 5CSWA 1SM2A 4AXAA 3OEZA 3ZDUA 2BROA 2A19B 3GOPA 4TKSA 5HGIA 5BYZA 2ETRA 3LXKA 4D2RA 5BVOA 4KA3A 3Q9WA 2R3MA 1M7QA 4ZMFA 1ERKA 4RJ3A 5E8UA 1TQPA 4OTPA 3MFTA 2QOIA 2ZVAA 1MRYA 1YOMA 4EK3A 1DAYA 3PIYA 4DFZE 1G3NA 5FP6A 3VS2A 2WD1A 2FO0A 4WA9A 3P4KA 3VS0A 4UXQA 3QYZA 3C4EA 3R7EA 5M56A 4P4CA 3I81A 1FOTA 5M4IA 3QHWA 5ANEA 3EYHA 4FODA 3CR0A 3IKAA 4TYIA 2PE2A 3IO7A 4CMTA 5EI8A 4GV1A 3HDNA 2ZDUA 4J52A 3RKBA 4F6WA 2UZWE 1Z5MA 3DQXA 2XKDA 3LMGA 3R00A 1Y91A 5ANIA 2RFDA 5IH6A 3FI4A 3Q53A 4WG3A 4XOYA 3CKXA 5JH6A 3ZM9A 2J0JA 4YZDA 4IJ9A 4AE6A 4D4SA 3I1AA 3GFEA 4O21A 4HGTA 1JBPE 4W4YA 5HEZA 4XJ0A 3HA6A 2F7ZE 4BWPA 2WQMA 4NFMA 5JN2A 4O0UA 4EORA 3P7AA 2Z02A 4LRJA 3EFLA 5E4HA 5JQ8A 2ZJWA 3W32A 4LUDA 4KRDA 5F94A 4AA0A 2I0YA 1Z57A 3L8XA 4J8MA 2WTCA 4X2JA 5IH5A 2EVAA 3BHUA 2F2CB 2R3RA 2E9OA 2PZYA 3I7BA 4H58A 3H9FA 3WZDA 3GCSA 2IW8A 4BCHA 4YO4A 3DXNA 2HW6A 5I3RA 4BHNA 3U8WA 3ATSA 4DC2A 4H1JA 4IX5A 2WMQA 4FKLA 3SX9A 1FVTA 2WIPA 4IHPA 4Y5HA 5BNJA 2X7FA 5AP4A 3DK6A 3HEGA 1PF8A 3FMHA 4N0SA 4L6QA 4IX6A 4NUSA 5CU6A 1ZOEA 3EN7A 3QC9A 3N4UA 3ORNA 3I60A 1YXVA 4XOZA 4ZY5A 3E8EA 1YDSE 2RSVA 4CLJA 4BDAA 2JBOA 1Q8ZA 3DKCA 5IA2A 4XG4A 4NJ3A 2B7AA 3TN8A 3B2WA 3IW5A 5EKNA 4MXCA 2PUIA 3POOA 4FV6A 2B0QA 4FX3A 3AD6A 2CKQA 1RDQE 1SMHA 2YIQA 3ODYX 1IEPA 4M67A 1PXMA 1Q97A 3MB6A 4O27B 3UC3A 3WBLA 5EQEA 3VRYA 1PJKA 3E93A 4IX3A 5TT7A 3G9NA 1U5QA 2ONLA 2J0IA 2VWVA 4PMPA 3DXPA 3LQ8A 4QRCA 4H39A 3IW6A 3QTUA 3ZSGA 4PDPA 4DEBA 2OJJA 4FG9A 4QYFA 3LFCA 4C59A 4BDIA 4XG3A 5A6NA 5KNJA 5AV2A 1BL6A 5LOHA 2X39A 5DA3A 2PMOX 4CYIA 4YLKA 3TIZA 1R1WA 1HOWA 2CNVA 2AC5A 4D4RA 2BRNA 3VQHA 5HU3A 3QWJA 5J9LA 2QO2A 3GI3A 4JR3A 3PZEA 5EYKA 4QYYA 1OL7A 3QQLA 3CIKA 4P90A 4Z55A 3HUBA 5AM6A 3BRBA 2HY81 3PE1A 3PJCA 4HOKA 5IMXA 3BGZA 4FKUA 4DT9A 3IONA 4GKHA 2VX3A 2VU3A 4PF4A 3GU8A 5J87A 1DS5A 4EK6A 1TVOA 1YRPA 5IEVA 5DIAA 4E3CA 4UX9A 1UNHA 3UIXA 4YTCA 4FV7A 1P14A 4R8QA 5E8VA 5IH4A 3C0GA 4UYAA 5HE3A 4AT3A 5CEPA 3LHJA 4WOVA 4CKIA 3FYJX 3NNVA 1FGIA 2J4ZA 5I0BA 2H96A 4II5A 5JRSA 1YWNA 3MY1A 4U42A 2PE0A 3FZSA 3P7CA 3UOLA 5AA9A 3R28A 1Q24A 3KQ7A 1BX6A 2GS2A 3IW4A 4OTQA 4C7TA 3P79A 5I3OA 3QQGA 3C4FA 2ETMA 4CFVA 5EYMA 5J9ZA 1NVQA 3FI3A 1XJDA 3F9NA 3II5A 4FKPA 4BWKA 3EN5A 3AXWA 2SRCA 2ZM3A 4NL0A 4NYEA 4ZTHA 2FUMA 4U80A 3V6RA 1W8CA 3QGYA 4FTJA 5KMKA 4JAJA 4KKHA 2Y6MA 3VUDA 3KMMA 3A60A 3BYMA 3REPA 2R3HA 3F88A 4HNFA 2BRHA 3ACJA 4OTRA 3VIDA 4HCVA 3COHA 5JZNA 2OBJA 3KK9A 5CU0A 3HX4A 2UW8A 1PXIA 5AP3A 4F63A 3OWLA 3DB6A 2B53A 3OXTA 5HCXA 3UIMA 2OJIA 4DH8A 2V7AA 4HVGA 4BTKA 4EOOA 3GB2A 3HRFA 2X7OA 4JBQA 5GNKA 3ZO1A 3ZFYA 4EJ7A 3RVGA 3UQGA 2C1AA 3SXFA 2XBAA 1M2QA 3PIZA 3DBEA 4Q9ZA 5CEIA 5J5SA 5HLWA 3FXWA 5EI6A 4R7IA 4BY9E 4FKSA 4D0WA 3F3UA 3EQDA 4ZZMA 5M51A 3ZZWA 4UALA 2FSOX 2NP8A 4F9CA 3S0OA 2R3LA 1P5EA 2B55A 1J91A 3E8DA 3D2IA 2QLQA 4FIJA 4MXZA 3ZZEA 4FV5A 1BKXA 2C1BA 2XM9A 2Y4IC 3ODZX 3TNQB 4BDEA 3KY2A 4GKIA 2R3OA 1NVRA 4I4FA 4WG4A 2B4SB 4LM5A 4YC8A 4D5HA 2PL0A 3CGFA 5F4NA 4AAAA 2FB8A 1M52A 3TKIA 3BBTB 4B0GA 4EH8A 1R39A 3NVKI 3RZFA 2CHLA 2YABA 4OTHA 3ZSIA 4XG8A 2C6MA 4QP2A 2X8EA 4IZ5A 1O6KA 3O96A 4L52A 4USFA 2YLFA 4I41A 5CU2A 4U5JA 5D41A 3VS6A 1W0XC 4QMLA 3EZVA 5T3QA 3FL4A 3PJ8A 2UW0A 1YVJA 2JAVA 3B8QA 2YACA 4FR4A 4R7HA 1UU3A 1XH4A 3AT4A 2X81A 3BE2A 3PA3A 4G3GA 5DN3A 4JT3A 3NEWA 2YJRA 4YZNA 2H9VA 4RGJA 2GS7A 3QF9A 3TV4A 4OLIA 5IUHA 3NYNA 5DH3A 5T6KA 4ZY6A 3G33A 2BFXA 3MFSA 3VJOA 4M8TA 1I44A 1R3CA 4KRCA 1XO2B 5CT0A 1W82A 1Q5KA 2OZAA 5KHXA 1PY5A 5IQDA 3L9PA 3NGAA 4YBKA 2Z7QA 4TNDA 3T8OA 2ERKA 3QX4A 4DFLA 3M11A 5EKOA 1O9UA 5FM3A 1JKSA 2VO7A 4FV4A 2VTSA 1H4LA 3LCTA 2W1ZA 4XP0A 3FZTA 3HZTA 4L45A 3QD3A 2GHMA 3W8LA 1BL7A 2UZEA 4P5QA 4CFWA 1YOJA 4ACDA 3F61A 4FG7A 4MKCA 4NW5A 5CZHA 4AU8A 5I4NA 1Q8WA 5FRIA 5C1QB 5KBRA 2W1IA 2ZYBA 1GY3A 3WZJA 1XH5A 1XH6A 3H3CA 1XKKA 3MDYA 1ZLTA 3LCSA 4MX9A 3QLGA 2NRUA 2VTHA 2VTNA 5D10A 4A4XA 2RF9A 5HNGA 4EHGA 5CXZA 4IM3A 1WBPA 4OW8A 2OO8X 2G2FA 4ANNA 1U5RA 4JLCA 3V8TA 3G9LX 4CZUA 1MQ4A 2YITA 4AZWA 2NRYA 5HOAA 3P78A 5ANOA 1DI9A 4ZLZA 2ZV8A 5IDPA 2Q83A 3ZLYA 2I0EA 4D9UA 5IU2A 5E90A 2EUFB 3UG1A 2OI4X 3EB0A 3V01A 4BYJA 4BZDA 2XK4A 5HG9A 3TZMA 4IAIA 3SDJA 4EK4A 4O7YA 1PMEA 3QCSA 4IVCA 4RWKA 4D2SA 2QHMA 4ANMA 1KE9A 3KC3A 1PMNA 4J1RA 5G1XA 1UWHA 4GFMA 4C35A 3C4WA 2YWVA 1OUKA 3AC4A 4YHJA 5A4CA 3R8UA 4O6EA 4AGCA 4QNAA 4YJUA 3FI8A 2JDSA 4R5SA 4HVDA 4QTDA 4RC4A 4N6YA 5GZ8A 4GMYA 5J5TA 4M0YA 5K4IA 4EQUA 1RJBA 2CN8A 4D2VA 3QTSA 4BCPA 5HO7A 3KFAA 4FV8A 4I22A 5BUIA 2W7XA 3FHRA 3FYKX 2BHEA 2CGWA 3OOMA 5IQHA 3PXRA 3LFNA 3R7GA 3UMXA 2VWXA 3QQUA 1NXKA 4D1ZA 3F5XA 3I0OA 4NIFB 5E1SA 3THBA 3UPXA 3CC6A 4FIFA 4EKKA 5I9VA 2X4ZA 1OZ1A 2OIBA 2YIWA 4WSYA 2Q0BA 4XG2A 4HVSA 3NAXA 2C5NA 4ERWA 2JKMA 3Q9XA 3GUBA 2C30A 2OW3A 5C8NA 5CU3A 3HAVA 3SGCA 2QVSE 2PMIA 4KS7A 4E6DA 3IDBA 4KINA 2OSCA 4ZS0A 2UZDA 4IJPA 5E8ZA 1H1QA 3ZC5A 3G2FA 3ZRLA 2O63A 4EHEA 1YXSA 2I0HA 4FYNA 4ORKA 1LR4A 4LMNA 5H8BA 2W9ZB 4ZK5A 3ERKA 2OWBA 3U4WA 3VBVA 3ORPA 3RM7A 5F95A 4LOPA 5M06A 4RFMA 4DEIA 4IXPA 4BN1A 1BMKA 1UU7A 3A7IA 1M17A 1FMKA 2UW3A 4X3FC 2WFYA 1VEBA 4FL2A 2C0TA 2YLEA 3PYYA 4C34A 4ZXTA 2PUPA 1P4OA 4F9AA 2GFCA 2WMAA 2ZM4A 4YMJA 5AUZA 4MBJA 4L3JA 4BIEA 3C13A 5CF6A 3LAUA 4H36A 1XBAA 2ZV7A 3VBXA 1REKA 5L8JA 3NRMA 3GU6A 1BI7A 4GJ2A 4CTBA 3UOJA 2XK7A 4NM5A 4IFCA 1H1SA 4FTLA 4O1PA 5IG1A 2VTIA 5IUGA 2C6OA 3R0TA 5DPVA 2Y9QA 3VBTA 3O2MA 4NEUA 3GT8A 3SHEA 4JVGA 3WYYA 3ZRMA 5DT4A 5BVKA 3LW0A 3RPOA 4ZY4A 3NUAA 3UJGA 2WIHA 4KNBA 4EZ3A 4F99A 4BTMA 5HO8A 5LMKC 4TT7A 3LE6A 4USDA 4IMYA 1IASA 1OM1A 3PFQA 2QC6A 5CY3A 5EW8A 2J6MA 3VC4A 1BI8A 3S4QA 3I6UA 3WF5A 4EWHA 3MB7A 5FLFA 4EOPA 4L7SA 4OT6A 4R5YA 2OICA 4WSQA 5ACKA 3T3VA 4FKQA 3O7LD 2QG7A 4NT4A 2VGPA 3LFFA 4CZTA 4NSTA 5DYJA 1OPJA 2R3GA 2P2IA 3GC8A 2IZSA 4IAKA 4W4XA 3V5QA 3KF7A 3TCPA 5TOZA 1JQHA 2BILB 4YJVA 2BDFA 3DDQA 2IJMA 3ELJA 4W4VA 3FMDA 2WEVA 5EM8A 4QQTA 4FIEA 4E4LA 2ZOQA 4FT9A 3RZBA 4DFYA 5EHOA 4FSMA 1CM8A 3C0HA 4ITHA 3V8SA 2QLUA 4JQEA 3MA6A 3AGLA 4O38A 1YXXA 2QOCA 2DWBA 2RKUA 2XIXA 3RNYA 1U54B 2PZRA 3OC1A 4B8LA 1ZMUA 1M7NA 3Q9YA 4I0RA 5AX9A 3P1AA 4M13A 4IB3A 4O0TA 3GC0A 4BVUA 1Q61A 4RIOA 1OKYA 4RBLA 5AUWA 3RK7A 3VS4A 4BKZA 1P2AA 5KZIA 4FNZA 4EEVA 4PMTA 4AZSA 4O0VA 5JT2A 3UOKA 2BRGA 4ZJJA 2QURA 3FKLA 4E4MA 1SZMA 2C6TA 2F7EE 3DK7A 3R1YA 1VYWA 3AC3A 4RA5A 3TDVA 4U81A 1WVXA 3NDMA 1PXLA 4XBRA 5BVDA 3DNDA 4AGUA 4U8ZA 3R1QA 3LXNA 3RWQA 3NYOA 3DS6A 4HVIA 4EL9A 2REIA 4AN3A 3SLSA 2C3JA 3QTRA 3EMGA 1JPAA 3MH0A 4C58A 2BAQA 2C6EA 5AP5A 4YSJA 1H1RA 5EQPA 2C0OA 2C6KA 5EDRA 4JAIA 2R4BA 3RP9A 4KSQA 2XCHA 5IEYA 3VBYA 5FDPA 4WNMA 2ETKA 2HWPA 4MD9E 2W99B 2I7QA 3F3WA 3UIUA 1XHAA 1JAMA 3I7CA 3QD4A 2XM8A 3A99A 4RQKA 3VBWA 3ZUUA 4YBJA 3MTFA 2IVSA 3WYXA 4C0TA 2R3PA 1V1KA 4O0YA 5L6OA 3OWPA 1Z9XA 4GUBA 5HBHA 4F9BA 3G0EA 3LMIA 2G1TA 4AGWA 4QMXA 1AQ1A 4F0IA 2WZJA 3PPJA 4WRSA 3SXRA 4XYFA 3MESA 3HMOA 4K2RA 3KKVA 1ZZLA 1TQIA 2X8DA 3QGWA 5IUIA 3PPZA 4S31A 3SW4A 5CASA 2JKQA 4X2NA 2JIVA 3ZH8A 5E1EA 3V5WA 3TIYA 2QOQA 4ALWA 3COMA 3CLYA 4M68A 2QOLA 4USEA 2W06A 4V04A 3A8XA 4HZRA 2Z8CA 2RG6A 4QP6A 3R7UA 4DT8A 4L67A 4QP1A 2EXEA 4YTHA 5HIDA 1SVGA 4UWYA 1H08A 3L8SA 1JKLA 4XLIA 2HENA 4ANOA 4H3BA 4MXAA 2WMRA 4RFZA 3ZLSA 1Q8TA 2BZJA 2QOBA 2YAAA 3KXGA 3PPKA 2R0UA 3NCGA 4GFGA 3ZSHA 1ND4A 4NM3A 2CGUA 2E9UA 3NAYA 5BVEA 2ERZE 4O81A 1AGWA 2XNGA 5JRQA 4O7TA 4ZS4A 1H1WA 1AD5A 3VWAA 2IO6A 3DA6A 3KULA 3RJCA 3UVQA 4DGGA 4F1MA 5LQFA 2JLDA 4WNOA 3VRZA 4EUTA 2E2BA 4CD0A 1J7LA 2VTOA 2C3IB 1H24A 2UV2A 4DG3E 4FBXA 1OI9A 1OUYA 5E8YA 4ZIMA 1T46A 4C4HA 5HZNA 4E7WA 4P5ZA 2UUEA 1WVYA 2Y4PA 4LOOA 4M69A 4Z3VA 5LVOA 2WTJA 5I9YA 4YZ9A 3OUKA 1APME 4XMOA 5B0XA 4DLIA 1J3HA 3TJDA 3KVXA 3PVWA 4H05A 5FWKK 5JGAA 5D1JA 4AW0A 4RJ6A 4ASXA 4EBWA 5BQ0A 5CVGA 2PMNX 4BTFA 4CNHA 5FXRA 3LVPA 2C4GA 4GS6A 3BLRA 2O2UA 4I5HA 4EH6A 2W5BA 3VF8A 3AC8A 4WD5A 3MPAA 4BF2A 2OKRA 3SKCA 2PYWA 4BBMA 3VS3A 4JDKA 2VD5A 3CPBA 1KE5A 4O0WA 3FMLA 4RRVA 3PZHA 1GZOA 3ROYA 3V04A 3E87A 3HRCA 3COKA 1NY3A 4ZOGA 2BHHA 4O86A 3PA4A 5EFQA 4GT4A 3ZFXA 1FBNA 4RSSA 5EOBA 4ARKA 2EB2A 2CCIA 2W9FB 4TPTA 4DFNA 1RQQA 3G90X 3FZRA 3IW8A 5AR4A 2VWZA 1SVEA 4IBMA 4TYEA 4BI0A 4U44A 3R2BA 2YM4A 3F3ZA 3U9CA 5IQFA 2IW9A 3PLAE 4EQCA 3AG9A 4E6QA 4ZTQA 1XBBA 5KZ0A 4BCOA 3RPRA 3TI1A 4A7CA 3BEGA 3KULB 3Q2JA 1CTPE 2G01A 2C68A 3DJ5A 4FKIA 4Y73A 1ZY5A 3SOCA 4CQEA 5FD2A 4IAAA 4R77A 5CT7A 3EWHA 4L01A 2R3IA 4I6QA 4FV2A 2R2PA 3OP5A 3CJFA 1Q8UA 4CV8A 3VUGA 5KKRC 4YZCA 4DBNA 3W2RA 2BIYA 2YIYA 5ETIA 3QZFA 4GIHA 4AE9A 1JVPP 4IVBA 3FSFA 3VNTA 1ZRZA 2VWBA 3ZBXA 3ULIA 3ZEWA 4LGGA 3NW5A 3VVHA 4EHZA 2W5HA 3QAME 2YM6A 3FLZA 4M66A 4TYJA 4CFNA 1ATPE 2BUJA 2CCHA 2BALA 4Z7GA 3AQVA 3NNXA 4ZZNA 3R9RA 4GVAA 5EI2A 3OWJA 5BMSA 3ZEPA 4S34A 3LOKA 3HMMA 3COIA 5HG8A 3RMFA 4EOKA 3O8TA 1A06A 1XH9A 3Q32A 3KVWA 4OBOA 3GU7A 5IKWA 5CEMA 4FF8A 5HNIX 2C69A 3P9JA 3MH1A 2R9SA 3TWJA 3HRBA 5LMBA 3EQCA 2ITTA 4O91A 4YSMA 3ZDIA 2ZV2A 3KCKA 2YISA 2BAKA 5KE0A 3CCNA 3E5AA 4Y85A 4AACA 5DG5A 4DG2E 3NMUF 4B7TA 1WBWA 3DK3A 5I9XA 3H9RA 5ANJA 2C6LA 2VTAA 3IK3A 5HLPA 3MPTA 2Y6OA 3JY0A 4JDJA 4IH8A 3VS1A 3VS7A 2XK3A 2WO6A 2WTWA 5KMIA 4MNFA 3IOPA 2E9VA 5AV1A 4EI4A 3I0QA 3EOCA 3ORZA 1F5QA 1K3AA 3OCGA 4C3PA 5I9WA 2OFUA 5HO6A 4IAFA 2F7XE 4I0SA 3BHYA 3BV2A 3GQIA 5AEPA 3KN6A 3QRIA 5CI7A 5J79A 4WKQA 4ALVA 4IM2A 2CNUA 4FSWA 4YUQA 4DFUA 1QPEA 2XCKA 3QZGA 5CI6A 4E5WA 2XNNA 3F2AA 3F5UA 1LEWA 3AMYA 3OXIA 4IACA 4JBPA 4BI2A 3TUCA 1UNGA 4L46A 4LQMA 5HI2A 4CVAA 5DHJA 4BL1A 5AA8A 3VW8A 4QD6A 3QXOA 3I5ZA 3BCEA 2PE1A 5LCJA 3BU3A 4BWXA 4NTSA 4ZMEA 4YU2A 5IPJA 4D1XA 4BC6A 4FG8A 2UZVA 4IE9A 3QFVA 2OXYA 4G3FA 3FY0A 5G6VA 1FQ1B 4V05A 2Z7SA 2F49A 4K77A 1Q4LA 4EK5A 3VO3A 4DH5A 3HV4A 3KF4A 4FSTA 5IMEA 2YDKA 3L9MA 3NPCA 4L68A 5F1ZA 3DTCA 4D28A 3R8VA 3DBDA 3U6IA 3FQEA 3QHRA 5I9ZA 4AW2A 4XRLA 3VULA 4C57A 3E7OA 3BKBA 3ID6C 5GJGA 1O6YA 2BKZA 3UP7A 3P08A 4RIWB 4O0XA 2WXVA 2W0JA 2OJ9A 3R7YA 2IZUA 4H3QA 4IC8A 4IB5A 4XEYA 2HXLA 3GCPA 4Q5EA 4LFIA 2XJ2A 3TT0A 4E20A 2UVXA 2OZAB 3QXPA 4PPCA 2VTPA 3F6XA 4QP4A 5BX0A 4EH4A 3RCDA 3U6HA 3VW6A 3VS5A 2ZAZA 5HX8A 4PTGA 3FMKA 3V5JA 1W98A 4YJTA 3T9IA 1U46A 1KE6A 3QCYA 3NR9A 4LGHA 2XEZA 1OIQA 4B8MA 4BKJA 3HKOA 4F1TA 3LKMA 3N4TA 4BKYA 2XS0A 4E4XA 3L1SA 3D15A 4I20A 1XWSA 2BDJA 5AAGA 2XJ1A 1DAWA 4RVKA 2J5EA 4YJRA 5AP0A 3DBCA 4MQ1A 3D7ZA 1XBCA 2IW6A 4QTBA 3MN3A 3P23A 4MD8E 2GNIA 4R3CA 4Y83A 5K0KA 4DINA 5CAOA 2GNFA 4XG7A 3OG7A 3R02A 1ZYLA 4S2ZA 2WU7A 2QQ7A 5ETCA 3ZXZA 2R0IA 2F9GA 5CU4A 5EM5A 5LCKA 4FNYA 2F4JA 3WIGA 2UZOA 4BBEA 5AP6A 3P7BA 4CEGA 5E92A 4L53A 2VX0A 5CENA 4ZSAA 2PY3A 4IWDA 3CKWA 3PSDA 4TXCA 4C33A 5AAEA 4TWCA 3EQHA 3OY1A 2WQBA 3HP2A 5BVFA 4QMSA 4XHKB 4F7SA 2WNTA 4DEDA 4DITA 1KSWA 3RPSA 4BCGA 4Q9SA 3R22A 3EQIA 3R9DA 3TZ9A 3QRJA 4AN2A 4RX5A 3QRUA 4E6CA 4O7SA 5C03A 4K6ZA 3KN5A 3HMPA 5K4JA 4MCVA 5CNOA 5GZAA 3C51A 3QTZA 4FT7A 5K0XA 4YJOA 3PXYA 2BTSA 4PUZA 5CF5A 1L3RE 2BTRA 3HL7A 4X2GA 3HECA 3MWUA 3Q4TA 5JQ5A 3PRFA 2ITNA 1YI4A 4AOJA 1GNGA 4YJNA 5DT0A 3Q04A 5DI1A 4XCUA 5CSVA 3PY3A 5CX9A 3NWWA 4AA5A 1ZWSA 3DPKA 5FXQA 5HKMA 5GJFA 5FTOA 5AUTA 3I6WA 5F9EA 2GDOA 1VYZA 4QMWA 4F09A 4D2PA 4RLLA 3DAJA 4K18A 4UMPA 2EWAA 2X2LA 1Y6BA 3NUPA 3EQBA 2AYPA 4FVQA 4PPAA 2Z60A 3OT3A 2G2HA 2HXQA 4R1VA 2Z7LA 5HNBA 4O1OA 4NM7A 2WTIA 2YN8A 4TWOA 2QOFA 5JFVA 2XB7A 4U40A 5LVNA 1WBTA 3BGQA 4K33A 4OBQA 3WF8A 2P33A 3HDMA 3NW7A 3LJ2A 3OBGA 2ITQA 2OXXA 4EH9A 5L2WA 3BBWA 4OGRA 3GP0A 5I9UA 4F6SA 4GYGA 3OOGA 1OKZA 4DGMA 3IG7A 5M4FA 5IISA 3EQGA 5A3XA 3OWKA 4OT5A 3BX5A 4YHTA 5JGDA 4CCUA 3D5WA 3FUPA 1LP4A 3QC4A 4IQ6A 4DG0E 2VNWA 3FI2A 4FT5A 4O96A 1QL6A 4LV5A 1UVRA 4XG9A 5TE0A 3VUTA 2IVVA 4HW7A 2YM8A 3OFMA 3JVRA 4YPDA 1OL6A 4FTTA 4CMUA 1ZYCA 5FBNC 2XYNA 5LVMA 2QD9A 4CFXA 3KMWA 2VNYA 3ZC6A 2XK6A 1XH8A 4AN9A 2KTYA 2VN9A 2CDZA 4GH2A 4YHFA 3RPYA 5KHWA 2X2MA 1E1VA 4MF0A 5D9HA 4KIQA 5LVPA 2YAKA 4M97A 4QMVA 4F7NA 4FYOA 5AIRA 4JL9A 2B1PA 1KE8A 3UIBA 4EONA 4G5PA 4HYSA 5H8EA 2GSFA 2ZB0A 4MHAA 3FL5A 4YTFA 3A4PA 2B9JA 3FXXA 4FK6A 3RK9A 3GVUA 2XMYA 3GU5A 3V5PA 4O7LA 3TZ7A 4MXXA 5CALA 1J1BA 4U41A 5JFSA 1G8SA 1OIRA 2P55A 4AUAA 1YW2A 3F3TA 3K2LA 2FSMX 3WOWA 4JX7A 4GU6A 4RWLA 5HBEA 2GNHA 4FTKA 4Y95A 1ZMVA 4KKEA 3RAIA 3FMNA 2QOHA 2R7IA 2GCDA 3EYGA 3OCBA 1FINA 5CYIA 3UBDA 1GZ8A 1M2RA 2P2HA 2YM5A 3ZUVA 3ZONA 5L2SA 4QPSA 4E4NA 4PPBA 3MYGA 5C26A 5LVLA 5C4KA 3KGAA 3D5UA 4I0TA 4ZTLA 4BDBA 3WE8A 2J50A 3ANQA 4MBIA 1YDRE 3NUSA 4CG8A 3CE3A 2ESMA 4LG4A 4U79A 3R9NA 4BTJA 4LMUA 4CRLA 4AT5A 3DZQA 3TACA 5A4QA 2YA9A 4L3PA 3E62A 2OK1A 1SYKA 3PJ1A 5ACBC 4ENXA 2AUHA 2H8HA 3G6GA 2WMSA 1ZMWA 4A9SA 3OTVA 5EK7A 1PXJA 5AR3A 2J51A 4YJPA 1SNXA 2GPHA 3D5XA 4PNKA 5AP1A 2F57A 2HAKA 4F65A 2FVDA 3PP0A 3RAKA 3PVBA 2QU6A 5KX8A 2PVYA 4ASZA 4EZ5A 2J7TA 1I09A 4A9YA 3IS5A 2VO3A 4X3FB 5L2QA 3WZKA 4J97A 3EN6A 4Y46A 4JS8A 5HX6A 5L6PA 2Y7JA 3AD5A 2XNBA 3HVCA 3IDPA 4FZ7A 2UW7A 2PZIA 3JVSA 4FICA 4FTRA 4FK3A 3QRTA 3HMNA 5CS6A 2XIYA 2ITOA 4FZAB 4RA4A 3W16A 2WOTA 3R9HA 4DFXE 3Q2MA 1LUFA 1Q3DA 5HCYA 4APCA 3LLAA 2IZTA 2BVAA 3JS2A 1PRYA 4BBFA 4F4PA 4KBKA 1H26A 5GJDA 3OZ6A 2WMVA 4TYHB 4EH7A 5JMSA 3MJ1A 3LPBA 4PMMA 4QP9A 4WNKA 5DRDA 3R7OA 4AFEA 4CT1A 2GQRA 4DGNA 4RIWA 3BU5A 3ENHA 4E5AX 3EJ1A 5HVJA 2W4OA 1RE8A 3NIEA 4M15A 4F64A 3LFSA 5C9CA 2DUVA 4BDCA 4MD7E 4V01A 1FMOE 2X9EA 3MA3A 5DE2A 3TTIA 4M69B 2UZLA 2X1NA 3Q6WA 3A8WA 4I1ZA 5L3AA 4CRSA 1OECA 3HV6A 3LQ5A 4O0RA 2XNPA 3KB7A 4GCJA 3TNHA 5BMMA 4I5CA 3BEAA 1UU9A 2X6EA 4IB1A 3QALE 3UZRA 2J0LA 4O22A 3A7GA 4C36A 3Q60A 1IAJA 5FGKA 3AMAA 3FQHA 3RAWA 4LOQA 4OTDA 1GZKA 4KIOA 3ZS5A 2GFSA 5GIOE 2XH5A 3NUYA 4ACGA 4RVMA 2C0IA 2W4KA 3DKFA 3G6HA 3POZA 4JRVA 4FUXA 2O0UA 4FKRA 4TTHB 4Q2AA 2GTNA 4BDFA 4JXFA 3W10A 5JKGA 3SQQA 5DRBA 3N4VA 3R21A 4AZVA 4FT3A 3F69A 4NFNA 3F7WA 3HLLA 4MYGA 4RMZA 5EQYA 3PSCA 4M3QA 1WZYA 4IANA 4BIDA 1CKIA 3EQFA 2XJ0A 3QTXA 3IPHA 4QO9A 3ORKA 3CXWA 4GU9A 4G9RA 1ZOHA 3Q4ZA 3EKNA 2YWPA 3VHEA 4C4IA 3DLZA 3DJ7A 4ZSGA 3WZEA 3EL7A 4DH7A 5BYYA 4KABA 3OW4A 1MP8A 3WF6A 1PXKA 5I5ZA 4GG7A 1DM2A 3U51A 3CTJA 4FNXA 3D7TA 3BELA 4HJOA 4QMUA 4U0IA 2CLQA 4YO6A 2HZIA 5EHYA 5KCVA 5LJJA 3DV3A 4XBUA 4QP7A 1Q41A 3PXFA 2YM7A 4DYMA 4AQCA 4WBBB 4HCUA 2R3QA 4Y5QA 3OCTA 2IVUA 2YJSA 4OTFA 3NNWA 4E93A 2C5XA 3DZOA 4EYMA 5L8LA 3R8LA 2QR8A 2VTMA 4ZSJA 3F5PA 4C02A 3K54A 2WMXA 2I6LA 4CYJA 5IA1A 4S32A 4Y8DA 2EU9A 2OJFE 2VWYA 2IG7A 3UP2A 2A0CX 1IRKA 1YI3A 3C1XA 1RW8A 3N51A 3EIDA 3HMIA 4KBCA 1PW2A 3S2PA 4L9IA 4EBVA 5HU9A 5ETAA 3NYVA 1UKIA 3FPMA 5HORA 5AMNA 3LQ3A 4B6LA 5DR9A 1CSNA 1OL1A 3SRVB 3PTGA 5HQ0A 3KU2A 2VWUA 5AUUA 4IWQA 4YR8A 1EH4A 5DWRA 4IEBA 2JITA 2YCRA 3SXSA 3UVRA 1KUTA 3GU4A 4G17A 4FV1A 4OTIA 1V0PA 4UXLA 4CMOA 1H1PA 4HYUA 3Q52A 2XNOA 2ZB1A 4U3ZA 3E7VA 2Z7RA 3ZHPC 4QMMA 3GCVA 4AZEA 3MW1A 3Q9ZA 4ERKA 3OUNB 5M07A 1PYXA 2ITPA 4NKSA 2C3LA 5CWZA 3CQEA 2C6IA 4ZTRA 4HVHA 4O7RA 4V0GB 4QMOA 4BIBA 4EOJA 3U54A 4ZP5A 4XRJA 4UMQA 1HCKA 4JBOA 4BZNA 3DNEA 4WRGA 2O65A 2BFYA 5TKDA 3E3BX 4QMNA 2VWWA 2OG8A 4PMSA 2X2KA 4HGLA 4IDTA 3FSKA 3TG1A 4AWIA 1UU8A 3K5VA 3ZFMA 4ASEA 1PMUA 2VTLA 2ITZA 3O8UA 1YXTA 3DAEA 5IA5A 1HCLA 3BV3A 4UMUA 2PU8A 4RJ8A 4M14A 2W05A 4HGEA 4JI9A 4FTOA 5CF4A 4FL1A 4GFOA 4WUNA 2QOKA 3MVJA 3WF7A 4DGOA 4QT1A 4NKAA 4QNYA 1H25A 1GOLA 3EFKA 2BZIB 4X6QC 5DR2A 4DEEA 1IR3A 4DFBA 1WBOA 2XYUA 3ORMA 4IAYA 3EFWA 4LGDA 5J95A 3TV6A 3DT1A 2XRUA 4FV0A 3LJ0A 1ZZ2A 5EDPA 2EXCX 4RJ7A 3D0EA 4AA4A 1KWPA 3PDTA 3C5UA 4FTMA 4A07A 4NW6A 4FKVA 4B9DA 1LEZA 5DNRA 4J71A 5GIPE 1Q3WA 1J1CA 3ETAA 5A4TA 1TQMA 4A9RA 4DE4A 2BCJA 3RNIA 3AT3A 3D2KA 3MJ2A 3R01A 3OMVA 4U7ZA 4N57A 2FH9A 1FVRA 3UNZA 3CY2A 1JNKA 3QD2B 4YZBA 4WBOA 2XKEA 5AX3A 2VRXA 3OD6X 3MBLA 5L6WL 3IW7A 4MTAA 4KUJA 3JUHA 2GHGA 4MNEA 5CAVA 3IGOA 4QQ5A 4JG8A 3QCQA 4D4YA 2EXMA 2O64A 3BQRA 3LCDA 2HZ0A 5BPYA 4X7QA 3OY3A 4A9UA 4XG6A 2OGVA 2CNQA 5AJQA 1ZARA 5IQGA 1NA7A 5HG5A 2DYLA 2AC3A 3ROCA 3FC1X 3FLSA 4K9YA 3W8QA 5IF1A 4FEVA 3ORLA 3B2TA 5C8KA 3F7ZA 2QU5A 5IEXA 2HY0A 5L8KA 4CTCA 2Y0AA 4FTIA 2X4FA 4Q5HA 3V8WA 5JFXA 3OBJA 3L8VA 4BFMA 1Y57A 3PLSA 2PWLA 3NX8A 4JRNA 1XH7A 2NPQA 2R3JA 4YNEA 1KV2A 3QL8A 2RFEA 2ZMDA 4OR5A 4TZRA 5CSXA 4EOLA 3MS9A 4OTGA 5HICA 3OW3A 3Q96A 3KEXA 1IA8A 3ZLXA 4GW8A 3K3IA 5CANA 4H1MA 3O50A 3DB8A 4FNWA 4LL0A 2YIRA 3BLHA 4TYHA 2VZ6A 1YHVA 5CAQA 3NUXA 2PULA 2RFNA 4IAZA 2C5OA 1XQZA 3UE4A 1H27A 5DT3A 1R0PA 1CKPA 1V0BA 2B9IA 4GK2A 4B99A 5JGBA 3QU0A 1B39A 3EZRA 4UMRA 4WHZA 2A4LA 2VO0A 2WQEA 5CSPA 5JSMA 3CY3A 4YC3A 3O23A 4G3EA 2QNJA 4D5KA 1PXNA 2GS6A 3F66A 4EOIA 4O84A 5EW9A 3RINA 3KREA 2HYYA 2HZ4A 2V55A 4XV1A 3SD0A 3OROA 2Y8OA 4GK4A 3ZM4A 4AOTA 3BHTA 5AUXA 3SC1A 1G8AA 4G3CA 2VO6A 4D4VA 4QTEA 4BDGA 4EK8A 1L8TA 2W1GA 2E9PA 1JOWB 3O51A 5EDQA 3LMHA 5CTPA 4AZFA 3R63A 4FEUA 2HK5A 1OVEA 5HVKA 2OLCA 1PKDA 2YDJA 1Q99A 4IB0A 3EQPA 4RJ4A 5FEQA 5HE2A 4RPVA 2PVMA 2OF4A 5BVWA 4B4LA 1FPUA 5FQDC 4MEDA 4YJSA 3DQWA 5CVHA 4QP3A 4TNBA 5TR6A 5FP5A 4A9TA 1ZAOA 1ZYDA 3W55A 4CV9A 3TV7A 3FLYA 3T9TA 1LPUA 3BYVA 3U9NA 3MPMA 5EM7A 3ZOSA 4DF3A 4ZTSA 4MWHA 3MVHA 2C5VA 3PG1A 5HE0A 3BGPA 3LIJA 4QYEA 3DOGA 4QPMA 3F3VA 4EQMA 4U3YA 5BUEA 4R3PA 1H00A 4NK9A 5H2UA 1J7IA 5J7BA 3Q4UA 3NCZA 2QO9A 4ZJVA 2ZMCA 1OBDA 3UOHA 1U4DA 3R30A 2CGXA 2HELA 2X8IA 5GHVA 2R64A 3WIKA 1QPDA 3DKGA 1F3MC 4FKWA 4OTWA 4QMZA 2YEXA 1XR1A 1NVSA 3NLBA 1H07A 5A54A 1QPJA 2UW6A 2VUWA 2J0MB 5CAPA 4IZ7A 2YERA 2OJGA 4BCMA 5KBQA 4BCJA 3MGYA 2BPMA 3RGFA 1ZOGA 4FVPA 2GNLA 5B2KA 4PL3A 3QQJA 1WCCA 3GOKA 3LM0A 4UV0A 3VAPA 2YFXA 3T3UA 4GT3A 2RFSA 4FV3A 3MY5A 5DLSA 3AGMA 4K1BA 3AC5A 4KAOA 4U9AA 4FA2A 4X2FA 4L00A 4G31A 4X21A 3SAYA 2XBJA 1PKGA 4FKJA 4FT0A 5JFWA 2C47A 4CLIA 4PDYA 4GUEA 5AR8A 5DEWA 1G5SA 3D9VA 5T68A 4FSYA 4PL4A 2I0VA 3ALOA 2V5QA 2QR7A 3L9LA 2JFMA 3OF0A 4JDHA 3QQHA 4PP9A 5D12A 4E73A 4FEWA 4R3RA 3VJNA 3GEQA 3HV7A 1ZYJA 2QI8A 3EFJA 4NH1A 3KRLA 4NIFA 3UQCA 4OUCA 4GJ3A 2R3KA 5HIEA 4IFGA 3R7VA 4V0GA 3C5IA 4PDOA 2BRMA 4D2TA 4UB7A 4AF3A 3A7HA 1WBSA 2P4IA 3LM5A 5DVRA 4L44A 4IWOA 2PTKA 1OL5A 2HWOA 2XIKA 3DDPA 3LFBA 4IVDA 5DFPA 4AGDA 3OVVA 2J5FA 3ACKA 5H9BA 3DBFA 4AS0A 4GK3A 5CEKA 5JZJA 5ANKA 1PXPA 1WMKA 4M7IA 3ORTA 3EHAA 4RZWA 4RX9A 3MVMA 3ZCLA 4FL3A 2XNEA 3ORIA 5IQEA 3ZMMA 3E3PA 3ZLWA 3KA0A 3QA8A 5DGZA 1OIUA 5ANDA 2CSNA 3C9WA 3EN9A 3KXXA 4G16A 3ALNA 5HD4A 1E9HA 4BGGA 2QODA 4BCNA 3RM6A 5DR6A 2LGCA 3DKOA 5J8IA 2YCFA 4CKRA 4TWNA 4MAOA 2YHVA 3H10A 3ZO4A 4M12A 1PMVA 3CD3A 2J0KA 3V5LA 3HV5A 4JIAA 2JBPA 3MIYA 4BDHA 4GVJA 3FE3A 2J2IB 2PVKA 4L7FA 5IQAA 3RK5A 1BLXA 4J8NA 4E8AA 4PWNA 2JAMA 3GFWA 5K5XA 1WBNA 1R0EA 4F9WA 1URWA 4UYNA 2WEIA 2CKOA 2JGZA 4ZSEA 2UVZA 1K2PA 4FV9A 4YGAA 4KKGA 1REJA 4FGRA 4IDVA 4NZWB 5AV3A 4JOAA 2XEYA 4UEUA 3UVPA 5IZFA 5JK3A 5AUVA 2JKKA 4C38A 2YDIA 2GNJA 4KBAA 5F20A 3GCUA 2FSLX 4OBPA 3MIAA 4RIYA 3H9OA 3JPVA 1IA9A 3UNKA 3U55A 4RX7A 3RTPA 5E8XA 3FC2A 2GU8A 4W8DA 1KOBA 2WOUA 3D94A 3Q5ZA 4U45A 4WNPA 5GZ9A 4ZSLA 4RWIA 3UZPA 4QMYA 3W18A 3KRXA 3C4CA 3WZUA 4ANSA 4U43A 3FKOA 2WMUA 2DQ7X 4YPSA 3P0MA 4NM0A 5TO8A 4KB8A 5L2IA 4N70A 3CTQA 3VBQA 4GRBA 1YI6A 1H01A 2WQOA 1K9AA 4S30A 5AP2A 4J96A 4O7NA 4RVTA 2JC6A 2UZBA 4FSRA 4E1ZA 5C4LA 2H34A 1QMZA 5HESA 2WGJA 1R78A 2WTVA 4L3LA 4ACMA 2OXDA 3CTHA 3CS9A 3GC9A 3SW7A 4DEAA 4DEHA 4FIIA 3RPVA 4DHFA 1H0WA 3FLWA 5H3QA 4F0FA 3W33A 3CBLA 3QCXA 4P7EA 3BYSA 3QX2A 5E9EA 5A4EA 4I6BA 3TDWA 2WQNA 1H0VA 4C62A 2RGPA 5AR2A 4BI1A 4FTNA 5C8MA 4FVRA 3W2OA 4G5JA 4N4SA 4JNWA 3RCJA 4XV9A 3D14A 3FLNC 5H8GA 3WE4A 3Q3BA 5HVYA 5B7VA 5KKRB 5FUTA 3E8CA 1F0QA 3CD8A 1OBGA 4LL5A 4CFFA 3UTOA 2V7OA 3FY2A 4J98A 4CT2A 4FZDB 2RIOA 3BQCA 4S33A 4EOMA 3UG2A 4G6OA 4BCFA 4QP8A 4RIYB 4P2KA 3ZBFA 5D11A 3QUPA 4FSQA 5CAUA 4PTCA 5KO1A 5IQBA 3EQRA 2B52A 2WPAA 1B6CB 3UMWA 1JWHA 4BGHA 1OIYA 2A2AA 3F2NA 3HV3A 1GJOA 5AR5A 4DCEA 3D4QA 5FG8A 4JG7A 3O17A 4FOBA 1IAHA 3E8NA 3NIZA 4NWMA 3R8ZA 1NW1A 3I5NA 3C50A 3FMEA 3FZOA 4BCQA 5DBXA 4AZTA 4ZLYA 4FTAA 5AWMA 3ATTA 4D55A 1W84A 3PVGA 4C61A 3NW6A 2PZ5A 1NT2A 3VN9A 3WARA 4GL9A 5B2MA 4XX9A 4FC0A 4Z7HA 3V3VA 4I92A 3DY7A 3QWKA 2UZTA 4RC2A 1JSTA 5IA4A 4FMQA 4YJQA 4GEOA 3LJ1A 4CZYB 2YM3A 3E63A 2HOGA 5M55A 3OTUA 4K0YA 3ZTXA 4C4FA 1OKWA 3IOKA 1BYGA 2VWIA 3KXZA 4LUEA 5FBOA 4UN0C 2XIRA 2CN5A 2P0CA 4C4GA 4EC8A 3R1SA 5AUYA 5CEOA 2WMTA 5CEQA 4C2VA 4PTEA 2W5AA 3TJCA 4D58A 4N6ZA 2PK9A 3R7IA 3PY1A 4ZAUA 1PXOA 3R71A 3IDCA 4RIXA 3EKKA 4EHVA 4F0GA 5KMOA 4OAVB 3UODA 4FIHA 4FOCA 5LWMA 2QO7A 2W96B 2PVRA 3NUNA 3DTWA 3E92A 2ITYA 4ITIA 5BUJA 1V0OA 4EYJA 2JDVA 3DCVA 1YHWA 5A14A 4RVLA 3QTIA 5DMZA 4IZYA 4O0SA 4FEQA 4ONAA 4XLVA 4FUYA 4IX4A 3H30A 3FZPA 2JEDA 5E7RA 1UA2A 2X6DA 3OCSA 3OHTA 4JDIA 3L8PA 2WAJA 2XUUA 3FZ1A 4I4EA 5EYCA 2R3NA 2R5TA 3HA8A 5M4UA 4I93A 4JR7A 5B2LA 4EJNA 1Y8YA 3CQUA 4BHZA 5EH0A 4O82A 3TUBA 3CP9A 4FTUA 5DEYA 3FBVA 2PPQA 5J7HA 1U59A 3BYUA 1JSUA 3W2SA 5M57A 1YXUA 3Q5IA 5DOSA 5AP7A 4BDKA 2CMWA 3UNJA 4CXAA 4K11A 4ZJIA 3ZO3A 5EW3A 4FZ6A 3DFAA 5FEDA 3VUHA 5EOLA 3GC7A 4AX8A 5K5NA 2G15A 4TYGA 1OMWA 2OU7A 3BYOA 3MFUA 4WUAA 3DFCB 4MWIA 4MXOA 3QQFA 3P86A 4DLJA 5ITAA 2OIQA 3D83A 3F82A 2W1DA 4KIKA 3O71A 1GIJA 4LYNA 5JEBA 2IN6A 5K3YA 2W1EA 4JJRA 3R8PA 5HHWA 3ENMA 3FDNA 4IZAA 4JX3A 4F70A 2QKWB 4D0XA 2JIUA 4RIXB 2PHKA 4NCTA 4C3FA 2W1HA 4LRMA 1KE7A 4HNIA 1FVVA 3VF9A 2BZHB 4O83A 4C8BA 2GTMA 1YHSA 2DS1A 3E64A 4EOQA 3R9OA 3QKKA 4FSZA 4PNIA 1GAGA 3I4BA 4FTCA 4IADA 4JG6A 4MNEB 3V51A 4CSVA 2XKCA 3GQLA 2B54A 2LAVA 1E1XA 2A27A 2J90A 2XK9A 3MSSA 3LXPA 4TL0A 2JFLA 1CDKA 4TW9A 2XP2A 3LLTA 2CJMA 4DA5A 3JYAA 2BDWA 4JIKA 2IZRA 1A48A 2QOOA 2HZNA 2I1MA 3DU8A 3HP5A 3RI1A 5KMJA 3VQUA 5A6OA 3SG9A 2PMLX 4YNOA 1QCFA 2WELA 4ZTMA 4HPTE 5KMNA 3TZ8A 2OIDA 2VAGA 4L42A 5M44A 3F2RA 3QUDA 3NYXA 1JSVA 4J95A 2XF0A 3PWYA 3PY0A 4FZFB 4WG5A 1UNLA 5ICPA 1ZY4A 5CVFA 4DTAA 3P5KA 4A06A 2UW4A 4UZDA 5AV4A 4C4JA 1WBVA 3O0GA 2FYSA 3ZO2A 4CCBA 3CPCA 1MRVA 2OH0E 4BRXA 4DEGA 3AT2A 5J9YA 3BE9A 1T45A 4HYHA 3TNIA 3UYSA 5E91A 1YQJA 3ZYAA 3U87A 4UWCA 3UPZA 1Y8GA 1PYEA 3EN4A 3NNUA 1JLUE 4PRJA 4O7ZA 4RWJA 4KIKB 4GYIA 3BWFA 1YOLA 3C7QA 3LFQA 3V5TA 4PQNA 5A9UA 2ACXA 4ANQA 3QTWA 4UWBA 2ONLC 2WMBA 3LXLA 4FKGA 4G9CA 3DJ6A 3GGFA 1H8FA 2YCQA 3A7FA 3DGKA 4MK0A 4RLKA 5AIKA 2PVNA 3EH9A 3QQKA 4QOXA 2WTDA 4I24A 4F6UA 3HNGA 4QTAA 1A9UA 2PVJA 2QG5A 4C3RA 3C4XA 3RHXA 4RX8A 4HYIA 4XV3A 3WILA 2O5KA 2QONA 4BDJA 4CQGA 3N9XA 1M14A 3RHKA 4ACCA 2GQSA 2F2UA 3UO5A 1YWRA 2V62A 2YZAA 3FMJA 3PJ2A 1OL2A 1GIIA 4O6LA 5CNNA 4YP8A 3UGCA 2YZLA 3RAHA 3PXKA 3W2PA 5EYDA 4AW5A 2UVYA 3R6XA 5EHLA 3A62A 3R8MA 5CQWA 4UY9A 4R6VA 4AP7A 4EUUA 2W1FA 2UW9A 4E6AA 2P3GX 5FXSA 4KSPA 3CEKA 3K3JA 2ZDTA 4U6RA 1YWVA 3GXLA 5ETFA 3Q6UA 3PSBA 3PXZA 2X7GA 2QHNA 1MRUA 1S9JA 4L8MA 4Y72A 3UO6A 4YLLA 1GZNA 4RT7A 5HCZA 4ENYA 3DBQA 4PV0A 2V22A 3ULZA 3KMUA 4A4LA 4DCAA 2NO3A 4ID7A 5C01A 3FHIA 2VTJA 3JY9A 3LZBA 4JQ8A 3KCFA 4IWPA 3BLQA 2G9XA 3CGOA 2O8YA 4G6NA 3TKUA 4EOSA 4Z16A 3PIXA 2V0DA 4PY1A 4IM0A 5IDNA 3FQSA 4KIPA 4JBVA 5E8WA 3W2QA 2E9NA 4TRLA 4AT4A 3DAKA 4F1OA 4GG5A 4RZVA 3BHHA 2BR1A 3KL8A 5FM2A 5IA3A 5HG7A 5E8SA 3ZXTA 2I40A 2ITWA 3QZIA 3SVVA 4FEXA 4QMPA 3AMBA 3CQWA 4DH3A 4WO5A 3FMMA 4HZSA 2OZOA 4LI5A 2VGOA 2ITXA 3UDBA 4QQCA 4ANLA 1MUOA 2VTTA 4D1SA 4CKJA 2BAJA 3A61A 4O7VA 4AFJA 5HIBA 2CKPA 2PUUA 3FKNA 4DBXA 1WVWA 5HBJA 3QTQA 4IVAA 4AG8A 4QQJA 5BYLA 4UMTA 1X8BA 3OS3A 2C5YA 2PZPA 3LFAA 3PA5A 1YKRA 1ZYSA 2GNGA 3TL8A 3GCQA 4I5PA 4E26A 3OXZA 3PVUA 4ITJA 3F5GA 1SVHA 4FTQA 5AV0A 3TEIA 4HGSA 3UYTA 3ORXA 4DH1A 4ZZOA 4J99A 3KXNA 3PRIA 3A7JA 2OH4A 3W2CA 4BZOA 3S95A 3I79A 4RFYA 2KULA 4GIIA 4JQ7A 4RG0A 4D2WA 3AOXA 5LXMA 4ASDA 4QYHA 3NSZA 3FV8A 3LFEA 2CKEA 1S9IA 1VZOA 2WKMA 3PP1A 4MXYA 3FJQE 4G1WA 5KMLA 4EWQA 2PUNA 1U54A 1OKVA 2B9HA 5FTQA 3ZU7A 2NNWB 2WTKB 4FIGA 2IWIA 2JD5A 4G3DA 4X3FA 3VUKA 5CXHA 3GNIB 5ANGA 4O7WA 3SG8A 3ZRKA 2BIKB 4XS2A 5E8TA 3B8RA 3TM0A 3M42A 3TKHA 3QA0A 3W1FA 2X0GA 4X3JA 5CQUA 4EH3A 2G2IA 3QBNA 4TN6A 5LMAA 1Y6AA 3HYHA 1MQBA 5LARA 1WFCA 4PDSA 3TNWA 5HTCA 2W17A 4I6FA 4IW0A 4I3ZA 4F9YA 3K5UA 3OEFX 3D7TB 4XV2A 3PE2A 3KRRA 2IVTA 2JDRA 4I23A 1O6LA 2VV9A 4EZ7A 2GHLA 3NS9A 1PHKA 3MV5A 1UWJA 3SOAA 3VUIA 5AFVA 4YZMA 3AD4A 1J7UA 3PXQA 4PX6A 1BUHA 4YLJA 4RQVA 4Z9LA 3IQ7A 5EM6A 3FAAA 5IA0A 1B38A 4YC6A 2BKKA
chains in the Genus database with same CATH superfamily
4FGBA 3QZHA 3WI6A 2XRWA 3H0YA 4MBLA 4F7LA 3CJGA 4NJDA 3JXWA 3KRWA 3NUUA 4FKTA 4MVFA 4W4WA 4ZLOA 3U4UA 3R83A 5HD7A 2UZNA 2C3KA 4X6RA 1QPCA 4PL5A 4YTIA 5KUPA 3UZTA 4U97A 3SRVA 4L43A 4APPA 4W9WA 1VJYA 2JDOA 3RWPA 1UKHA 2PVFA 1CKJA 4C4EA 3AC2A 2VX1A 2JDTA 3UQFA 2BMCA 4DTKA 2QCSA 5CZIA 2XAOA 4O2PA 4G6LA 1P4FA 3TTJA 5M08A 2WTKC 3NZ0A 4E5BA 3QUEA 3R1NA 3LFDA 4MF1A 2WHBA 1W7HA 3MVLA 4NTTA 3QKMA 2PVHA 2BZKB 2YCSA 4KS8A 4UZHA 3ANRA 3OT8A 1KV1A 5J1WA 3CSVA 4DTBA 3EL8A 3MH3A 4BCKA 1TKIA 3S1HA 4OAUC 4AXEA 4MH7A 3VUMA 4BR3A 3D5VA 1OGUA 3BIZA 2YIXA 2Z2WA 1Q8YA 3BI6A 5AR7A 4BGQA 4I6LA 5CSHA 1SNUA 2ZM1A 3R73A 4CGAA 2R7BA 3PJ3A 5CF8A 4FE2A 4ZTNA 4K8AA 4XP3A 3LCOA 4WT6A 4C2WA 3KRJA 4IIRA 4TY1A 3AC1A 4O2ZA 4ZEGA 3GBZA 2ITVA 3QD0A 5M09A 3MTLA 1JKTA 4H3PA 4GT5A 4R1YA 3G15A 2CGVA 2PVLA 2W4JA 5EG3A 2HIWA 4I5MA 1ZXEA 4CFMA 3DLSA 2GQGA 1OITA 4QMQA 5LWNA 5AAFA 3ZUTA 3R2YA 4X0MA 3U6JA 2CPKE 3QLFA 3SA0A 4BYIA 3JR1A 3GENA 4J53A 4R7BA 1OPKA 3MH2A 2ZV9A 5HE1A 5IQIA 5HTIA 4I6HA 3O8PA 3R04A 4G34A 2R3FA 3A2CA 4BCIA 3G5DA 4EC9A 3MFRA 1Q62A 2FSTX 4UBAA 4FSUA 4GSBA 4EH2A 4EH5A 1FGKA 5FTGA 3HAMA 4BDDA 5A46A 2XIZA 2BRBA 4DAWA 2PSQA 4QDVA 4FKOA 4F7JA 2Y4IB 3QRKA 5M53A 1OB3A 1STCE 3BWJA 3FXZA 4DGLC 4F08A 5IQCA 2ITUA 3NVMB 3KK8A 4G2FA 3ITZA 4QYGA 5LMKA 3HUCA 3PWDA 3G0FA 4PP7A 4I21A 2XK8A 5K9IA 2OF2A 2VTQA 4FSNA 5GINE 2RG5A 3BPRA 4LV8A 3V6SA 2HW7A 1JKKA 4MQ2A 4WIHA 4CFUA 3VHKA 3O7LB 4J7BA 5L4QA 1IG1A 3RALA 3C0IA 1DI8A 5D7AA 5A4LA 4QPAA 5L2TA 3TUDA 3H4JA 3QYWA 4XH6A 4XUFA 3UC4A 2GMXA 3FWQA 2O3PA 1YDTE 4HCTA 3PG3A 3UO4A 4ALUA 2UZUE 4IC7A 3A4OX 3S00A 3PUPA 5TF9A 3S3IA 5FEEA 1URCA 2XA4A 2FA2A 3H0ZA 3IECA 2WB8A 4LRKA 4BICA 3C4ZA 4AXCA 5AM7A 3BHVA 3BZ3A 3L9NA 3LCKA 4YURA 2ZFYA 4NU1A 2HCKA 4RJ5A 3FLQA 4QMTA 3ET7A 1VR2A 2XZSA 2B9FA 2XKFA 4FI1A 4M0ZA 4XNEA 4X2KA 4I94A 2QKRA 2UW5A 3DXQA 4HPUE 4M84A 5KMMA 4KD1A 5BVNA 4R78A 5FDXA 4EKLA 3MI9A 5CLPA 3TNPC 1CMKE 1KOAA 2WMWA 2XVDA 4TWPA 4AOIA 4QTCA 2EB3A 2RL5A 2CLXA 2XNMA 4BB4A 5J1VA 2W1CA 1WAKA 1UV5A 3SV0A 4D9TA 4AW1A 4W8EA 3RBWA 3FPQA 3QKLA 4NCTC 2C6DA 2JKOA 3WF9A 4C37A 3M1SA 2A1AB 3BU6A 2J9MA 5AADA 4DN5A 2WU6A 1OPLA 2Q0NA 4XP2A 3FEGA 4RC3A 1M2PA 3TXOA 2OFVA 4ACHA 3E88A 2H6DA 2X9FA 5HLNA 3G51A 3IGGA 4KWPA 3HGKA 5C27A 3Q4CA 1W83A 2FGIA 5HTBA 5M4CA 3KXMA 4W9XA 2IPXA 4CG9A 3MY0A 3KXHA 1GIHA 4A4OA 2VTRA 3M2WA 2JIIA 1H28A 5D7VA 4ANBA 5CSWA 1SM2A 4AXAA 3OEZA 3ZDUA 2BROA 2A19B 3GOPA 4TKSA 5HGIA 5BYZA 2ETRA 3LXKA 4D2RA 5BVOA 4KA3A 3Q9WA 2R3MA 1M7QA 4ZMFA 1ERKA 4RJ3A 5E8UA 1TQPA 4OTPA 3MFTA 2QOIA 2ZVAA 1MRYA 1YOMA 4EK3A 1DAYA 3PUFC 3PIYA 4DFZE 1G3NA 5FP6A 3VS2A 2WD1A 2FO0A 4WA9A 3P4KA 3VS0A 4UXQA 3QYZA 3C4EA 3R7EA 5M56A 4P4CA 3I81A 1FOTA 5M4IA 3QHWA 5ANEA 3EYHA 4FODA 3CR0A 3IKAA 4TYIA 2PE2A 3IO7A 4CMTA 5EI8A 4GV1A 3HDNA 2ZDUA 4J52A 3RKBA 4F6WA 2UZWE 1Z5MA 3DQXA 2XKDA 3LMGA 3R00A 1Y91A 5ANIA 2RFDA 5IH6A 3FI4A 3Q53A 4WG3A 4XOYA 3CKXA 5JH6A 3ZM9A 2J0JA 4DDGA 4YZDA 4IJ9A 4AE6A 4D4SA 3I1AA 3GFEA 4O21A 4HGTA 1JBPE 4W4YA 5HEZA 4XJ0A 3HA6A 2F7ZE 4BWPA 2WQMA 4NFMA 5JN2A 4O0UA 4EORA 3P7AA 2Z02A 4LRJA 3EFLA 5E4HA 5JQ8A 2ZJWA 3W32A 4LUDA 4KRDA 5F94A 4AA0A 2I0YA 1Z57A 3L8XA 4J8MA 2WTCA 4X2JA 5IH5A 2EVAA 3BHUA 2F2CB 2R3RA 2E9OA 2PZYA 3I7BA 4H58A 3H9FA 3WZDA 3GCSA 2IW8A 4BCHA 4YO4A 3DXNA 2HW6A 5I3RA 4BHNA 3U8WA 3ATSA 4DC2A 4H1JA 4IX5A 2WMQA 4FKLA 3SX9A 1FVTA 2WIPA 4IHPA 4Y5HA 5BNJA 2X7FA 5AP4A 3DK6A 3HEGA 1PF8A 3FMHA 4N0SA 4L6QA 4IX6A 4NUSA 5CU6A 1ZOEA 3EN7A 3QC9A 3N4UA 3ORNA 3I60A 1YXVA 4XOZA 4ZY5A 3E8EA 1YDSE 2RSVA 4CLJA 4BDAA 2JBOA 1Q8ZA 3DKCA 5IA2A 4XG4A 4NJ3A 2B7AA 3TN8A 3B2WA 3IW5A 5EKNA 4MXCA 2PUIA 3POOA 4FV6A 2B0QA 4FX3A 3AD6A 2CKQA 1RDQE 1SMHA 2YIQA 3ODYX 1IEPA 4M67A 1PXMA 5BV3A 1Q97A 3MB6A 4O27B 3UC3A 3WBLA 5EQEA 3VRYA 1PJKA 3E93A 4IX3A 5TT7A 3G9NA 1U5QA 2ONLA 2J0IA 2VWVA 4PMPA 3DXPA 3LQ8A 4QRCA 4H39A 3IW6A 3QTUA 3ZSGA 4PDPA 4DEBA 2OJJA 4FG9A 4QYFA 3NFGB 3LFCA 4C59A 4BDIA 4XG3A 5A6NA 5KNJA 5AV2A 1BL6A 5LOHA 2X39A 5DA3A 2PMOX 4CYIA 4YLKA 3TIZA 1R1WA 1HOWA 2CNVA 2AC5A 4D4RA 2BRNA 3VQHA 5HU3A 3QWJA 5J9LA 2QO2A 3GI3A 4JR3A 3PZEA 5EYKA 4QYYA 1OL7A 3QQLA 3CIKA 4P90A 4Z55A 3HUBA 5AM6A 3BRBA 2HY81 3PE1A 3PJCA 4HOKA 5IMXA 3BGZA 4FKUA 4DT9A 3IONA 4GKHA 2VX3A 2VU3A 4PF4A 3GU8A 5J87A 1DS5A 4EK6A 3W0SA 1TVOA 1YRPA 5IEVA 5DIAA 4E3CA 4UX9A 1UNHA 3UIXA 4YTCA 4FV7A 1P14A 4R8QA 5E8VA 5IH4A 3C0GA 4UYAA 5HE3A 4AT3A 5CEPA 3AKLA 3LHJA 4WOVA 4CKIA 3FYJX 3NNVA 3TYKA 1FGIA 2J4ZA 5I0BA 2H96A 4II5A 5JRSA 1YWNA 3MY1A 4U42A 2PE0A 1W2FA 3FZSA 3P7CA 3UOLA 5AA9A 3R28A 1Q24A 3KQ7A 1BX6A 2GS2A 3IW4A 4OTQA 4C7TA 3P79A 5I3OA 3QQGA 3C4FA 2ETMA 4CFVA 5EYMA 5J9ZA 1NVQA 3FI3A 1XJDA 3F9NA 3II5A 4FKPA 4BWKA 3EN5A 3AXWA 2SRCA 2ZM3A 4NL0A 4NYEA 4ZTHA 2FUMA 4U80A 3V6RA 1W8CA 3QGYA 4FTJA 5KMKA 4JAJA 4KKHA 2Y6MA 3VUDA 3KMMA 3A60A 3BYMA 3REPA 2R3HA 3F88A 4HNFA 2BRHA 3ACJA 4OTRA 3VIDA 4HCVA 3COHA 5JZNA 2OBJA 3KK9A 5CU0A 3HX4A 2UW8A 1PXIA 5AP3A 4F63A 3OWLA 3DB6A 2B53A 3OXTA 5HCXA 3UIMA 2OJIA 4DH8A 2V7AA 4HVGA 4BTKA 4EOOA 3GB2A 3HRFA 2X7OA 4JBQA 5GNKA 3ZO1A 3ZFYA 4EJ7A 3RVGA 3UQGA 2C1AA 3SXFA 2XBAA 1M2QA 3PIZA 3DBEA 4Q9ZA 5CEIA 5J5SA 5HLWA 3FXWA 5EI6A 4R7IA 4BY9E 4FKSA 4D0WA 3F3UA 3EQDA 4ZZMA 5M51A 3ZZWA 4UALA 2FSOX 2NP8A 4F9CA 3S0OA 2R3LA 1P5EA 2B55A 1J91A 3E8DA 3D2IA 2QLQA 4FIJA 4MXZA 3ZZEA 4FV5A 1BKXA 2C1BA 2XM9A 2Y4IC 3ODZX 3TNQB 4BDEA 3KY2A 4GKIA 2R3OA 1NVRA 4I4FA 4WG4A 2B4SB 4LM5A 4YC8A 4D5HA 2PL0A 3CGFA 5F4NA 4AAAA 2FB8A 1M52A 3TKIA 3BBTB 4B0GA 4EH8A 1R39A 3NVKI 3RZFA 2CHLA 2YABA 4OTHA 3ZSIA 4XG8A 2C6MA 4QP2A 2X8EA 4IZ5A 1O6KA 3O96A 4L52A 4USFA 2YLFA 4I41A 5CU2A 4U5JA 5D41A 3VS6A 1W0XC 4QMLA 3EZVA 5T3QA 3FL4A 3PJ8A 2A98A 2UW0A 1YVJA 2JAVA 3B8QA 2YACA 4FR4A 4R7HA 1UU3A 1XH4A 3AT4A 2X81A 3BE2A 3PA3A 4G3GA 5DN3A 4JT3A 3NEWA 2YJRA 4YZNA 2H9VA 4RGJA 2GS7A 3QF9A 3TV4A 4OLIA 5IUHA 3NYNA 5DH3A 5T6KA 4ZY6A 3G33A 2BFXA 3MFSA 4O4BB 3VJOA 4M8TA 1I44A 1R3CA 4KRCA 1XO2B 5CT0A 1W82A 1Q5KA 2OZAA 5KHXA 1PY5A 5IQDA 3L9PA 3NGAA 4YBKA 2Z7QA 4TNDA 3T8OA 2ERKA 3QX4A 4DFLA 3M11A 5EKOA 1O9UA 5FM3A 1JKSA 2VO7A 4FV4A 2VTSA 1H4LA 3LCTA 2W1ZA 4XP0A 3FZTA 3HZTA 4L45A 3QD3A 2GHMA 3W8LA 1BL7A 2UZEA 4P5QA 4CFWA 1YOJA 4ACDA 3F61A 4FG7A 4MKCA 4NW5A 5CZHA 4AU8A 5I4NA 1Q8WA 5FRIA 5C1QB 5KBRA 2W1IA 2ZYBA 1GY3A 3WZJA 1XH5A 1XH6A 3H3CA 1XKKA 3MDYA 1ZLTA 3LCSA 4MX9A 3QLGA 2NRUA 2VTHA 2VTNA 5D10A 4A4XA 1W2DA 2RF9A 5HNGA 4EHGA 4AQKA 5CXZA 4IM3A 1WBPA 4OW8A 2OO8X 2G2FA 4ANNA 1U5RA 4JLCA 3V8TA 3G9LX 4CZUA 1MQ4A 2YITA 4AZWA 2NRYA 5HOAA 3P78A 5ANOA 1DI9A 4ZLZA 2ZV8A 5IDPA 2Q83A 3ZLYA 2I0EA 4D9UA 5IU2A 5E90A 2EUFB 3UG1A 2OI4X 3EB0A 3V01A 4BYJA 4BZDA 4F78A 2XK4A 5HG9A 3TZMA 4IAIA 3SDJA 4EK4A 4O7YA 1PMEA 3QCSA 4IVCA 4RWKA 4D2SA 2QHMA 4ANMA 1KE9A 3KC3A 1PMNA 4J1RA 5G1XA 1UWHA 4GFMA 4C35A 3C4WA 2YWVA 1OUKA 3AC4A 4YHJA 5A4CA 3R8UA 4O6EA 4AGCA 4QNAA 4YJUA 3FI8A 2JDSA 4R5SA 4HVDA 4QTDA 4RC4A 4N6YA 5GZ8A 4GMYA 5J5TA 4M0YA 5K4IA 4EQUA 1RJBA 2CN8A 4D2VA 3QTSA 4BCPA 5HO7A 3KFAA 4FV8A 4I22A 5BUIA 2W7XA 3FHRA 3FYKX 2BHEA 2CGWA 3OOMA 5IQHA 3PXRA 3LFNA 3R7GA 3UMXA 2VWXA 3QQUA 1ST0A 1NXKA 4D1ZA 3F5XA 3I0OA 4NIFB 5E1SA 3THBA 3UPXA 3CC6A 4FIFA 4EKKA 5I9VA 2X4ZA 1OZ1A 2OIBA 2YIWA 4WSYA 2Q0BA 4XG2A 4HVSA 3NAXA 2C5NA 4ERWA 2JKMA 3Q9XA 3GUBA 2C30A 2OW3A 5C8NA 5CU3A 3HAVA 3SGCA 2QVSE 2PMIA 4KS7A 4E6DA 2IF8A 3IDBA 4KINA 2OSCA 4ZS0A 2UZDA 4IJPA 5E8ZA 3AKKA 1H1QA 3ZC5A 3G2FA 3ZRLA 2O63A 4EHEA 1YXSA 2I0HA 4FYNA 4ORKA 1LR4A 4LMNA 5H8BA 2W9ZB 4ZK5A 3ERKA 2OWBA 3U4WA 3VBVA 3ORPA 3RM7A 5F95A 4LOPA 5M06A 4RFMA 4DEIA 4IXPA 4BN1A 1BMKA 1UU7A 3A7IA 1M17A 1FMKA 2UW3A 4X3FC 2WFYA 1VEBA 4FL2A 2C0TA 2YLEA 3PYYA 4C34A 4ZXTA 2PUPA 1P4OA 4F9AA 2GFCA 2WMAA 2ZM4A 4YMJA 5AUZA 4MBJA 4L3JA 2X0QA 4BIEA 3C13A 5CF6A 3LAUA 4H36A 1XBAA 2ZV7A 3VBXA 1REKA 5L8JA 3NRMA 3GU6A 1BI7A 4GJ2A 4CTBA 3UOJA 2XK7A 4NM5A 4IFCA 1H1SA 4FTLA 4O1PA 2X0PA 5IG1A 2VTIA 5IUGA 2C6OA 3R0TA 5DPVA 2Y9QA 3VBTA 3O2MA 4NEUA 4O4DA 3GT8A 3SHEA 4JVGA 3WYYA 3ZRMA 5DT4A 5BVKA 3LW0A 3RPOA 4ZY4A 3NUAA 3UJGA 2WIHA 4KNBA 4EZ3A 4F99A 4BTMA 5HO8A 5LMKC 4TT7A 3LE6A 4USDA 4IMYA 1IASA 1OM1A 3PFQA 2QC6A 5CY3A 5EW8A 2J6MA 3VC4A 1BI8A 3S4QA 3I6UA 3WF5A 4EWHA 3MB7A 5FLFA 4EOPA 4L7SA 4OT6A 4R5YA 2OICA 4WSQA 5ACKA 3T3VA 4FKQA 3W0RA 3O7LD 2QG7A 4NT4A 2VGPA 3LFFA 4CZTA 4NSTA 5DYJA 1OPJA 2R3GA 2P2IA 3GC8A 2IZSA 4IAKA 4W4XA 3V5QA 1G8KA 3KF7A 4LDTA 3TCPA 5TOZA 1JQHA 2BILB 4YJVA 2BDFA 3DDQA 2IJMA 3ELJA 4W4VA 3FMDA 2WEVA 5EM8A 4QQTA 4FIEA 4E4LA 2ZOQA 4FT9A 3RZBA 4DFYA 5EHOA 4FSMA 1CM8A 3C0HA 4ITHA 3V8SA 2QLUA 4JQEA 3MA6A 3AGLA 4O38A 1YXXA 2QOCA 2DWBA 2RKUA 2XIXA 3RNYA 1U54B 2PZRA 3OC1A 4B8LA 1ZMUA 1M7NA 3Q9YA 4I0RA 5AX9A 3P1AA 4M13A 4IB3A 4O0TA 3GC0A 4BVUA 1Q61A 4RIOA 1OKYA 4RBLA 5AUWA 3RK7A 3VS4A 4BKZA 1P2AA 5KZIA 4FNZA 4EEVA 4PMTA 4AZSA 4O0VA 5JT2A 3UOKA 2BRGA 1XMLA 4ZJJA 2QURA 3FKLA 4E4MA 1SZMA 2C6TA 2F7EE 3DK7A 3R1YA 1VYWA 3AC3A 4RA5A 3TDVA 4U81A 1WVXA 3NDMA 1PXLA 4XBRA 5BVDA 3DNDA 4AGUA 4U8ZA 3R1QA 3LXNA 3RWQA 3NYOA 3DS6A 4HVIA 4EL9A 2REIA 4AN3A 3SLSA 2C3JA 3QTRA 3EMGA 1JPAA 3MH0A 4C58A 2BAQA 2C6EA 5AP5A 4YSJA 1H1RA 5EQPA 2C0OA 2C6KA 5EDRA 4JAIA 2R4BA 3RP9A 4KSQA 2XCHA 5IEYA 3VBYA 5FDPA 4WNMA 2ETKA 1TFFA 2HWPA 4MD9E 2W99B 2I7QA 3F3WA 3UIUA 1XHAA 1JAMA 3I7CA 3QD4A 2XM8A 3A99A 4RQKA 3VBWA 3ZUUA 4YBJA 3MTFA 2IVSA 3WYXA 4C0TA 2R3PA 1V1KA 4O0YA 5L6OA 3OWPA 1Z9XA 4GUBA 5HBHA 4F9BA 3G0EA 3LMIA 2G1TA 4AGWA 4QMXA 1AQ1A 4F0IA 2WZJA 3PPJA 4WRSA 3SXRA 4XYFA 3MESA 3HMOA 4K2RA 3KKVA 1ZZLA 1TQIA 2X8DA 3QGWA 5IUIA 3PPZA 4S31A 3SW4A 5CASA 2JKQA 4X2NA 2JIVA 3ZH8A 5E1EA 3V5WA 3TIYA 2QOQA 4ALWA 3COMA 3CLYA 4M68A 2QOLA 4USEA 2W06A 4V04A 3A8XA 4HZRA 2Z8CA 2RG6A 4QP6A 3R7UA 4DT8A 4L67A 4QP1A 2EXEA 4YTHA 5HIDA 1SVGA 4UWYA 1H08A 3L8SA 1JKLA 4XLIA 2HENA 4ANOA 4H3BA 4MXAA 3UDZA 2WMRA 4RFZA 3ZLSA 1Q8TA 2BZJA 2QOBA 2YAAA 3KXGA 3PPKA 2R0UA 3NCGA 4GFGA 3ZSHA 1ND4A 4NM3A 2CGUA 2E9UA 3NAYA 5BVEA 2ERZE 4O81A 1AGWA 2XNGA 5JRQA 4O7TA 4ZS4A 1H1WA 1AD5A 3VWAA 2IO6A 3DA6A 3KULA 3RJCA 3UVQA 4DGGA 4F1MA 5LQFA 2JLDA 4WNOA 3VRZA 4EUTA 2E2BA 4CD0A 1J7LA 2VTOA 2C3IB 1H24A 2UV2A 4DG3E 4FBXA 1OI9A 1OUYA 5E8YA 4ZIMA 1T46A 4C4HA 5HZNA 4E7WA 4P5ZA 2UUEA 1WVYA 2Y4PA 4LOOA 4M69A 4Z3VA 5LVOA 2WTJA 5I9YA 4YZ9A 3OUKA 1APME 4XMOA 5B0XA 4DLIA 1J3HA 3TJDA 3KVXA 3PVWA 4H05A 5FWKK 5JGAA 5D1JA 4AW0A 4RJ6A 4ASXA 4EBWA 5BQ0A 5CVGA 2PMNX 4BTFA 4CNHA 5FXRA 4LV7A 3LVPA 2C4GA 4GS6A 3BLRA 2O2UA 4I5HA 4EH6A 2W5BA 3VF8A 3AC8A 4WD5A 3MPAA 4BF2A 2OKRA 3SKCA 2PYWA 4BBMA 3VS3A 4JDKA 2VD5A 3CPBA 1KE5A 4O0WA 3FMLA 4RRVA 3PZHA 1GZOA 3ROYA 3V04A 3E87A 3HRCA 3COKA 1NY3A 4ZOGA 2BHHA 4O86A 3PA4A 5EFQA 4GT4A 3ZFXA 1FBNA 4RSSA 5EOBA 4ARKA 2EB2A 2CCIA 2W9FB 4TPTA 4DFNA 1RQQA 3G90X 3FZRA 3IW8A 5AR4A 2VWZA 1SVEA 4IBMA 4TYEA 4BI0A 4U44A 3R2BA 2YM4A 3F3ZA 3U9CA 5IQFA 2IW9A 3PLAE 4EQCA 3AG9A 4E6QA 4ZTQA 1XBBA 5KZ0A 4BCOA 3RPRA 3TI1A 4A7CA 3BEGA 3KULB 3Q2JA 1CTPE 2G01A 2C68A 3DJ5A 4FKIA 4Y73A 1ZY5A 3SOCA 4CQEA 5FD2A 4IAAA 4R77A 5CT7A 3EWHA 4L01A 2R3IA 4I6QA 4FV2A 2R2PA 3OP5A 3CJFA 1Q8UA 4CV8A 3VUGA 5KKRC 4YZCA 4DBNA 3W2RA 2BIYA 2YIYA 5ETIA 3QZFA 4GIHA 4AE9A 1JVPP 4IVBA 3FSFA 3VNTA 1ZRZA 2VWBA 3ZBXA 3ULIA 3ZEWA 4LGGA 3NW5A 3VVHA 4EHZA 2W5HA 3QAME 2YM6A 3FLZA 4M66A 4TYJA 4CFNA 1ATPE 2BUJA 2CCHA 2BALA 4Z7GA 3AQVA 3NNXA 4ZZNA 3R9RA 4GVAA 5EI2A 3OWJA 5BMSA 3ZEPA 4S34A 3LOKA 3HMMA 3COIA 5HG8A 3RMFA 4EOKA 3O8TA 1A06A 1XH9A 3Q32A 3KVWA 4OBOA 3GU7A 5IKWA 5CEMA 4FF8A 5HNIX 2C69A 3P9JA 3MH1A 2R9SA 3TWJA 3HRBA 5LMBA 3EQCA 2ITTA 4O91A 4YSMA 3ZDIA 2ZV2A 3KCKA 2YISA 2BAKA 5KE0A 3CCNA 3E5AA 4Y85A 4AACA 5DG5A 4DG2E 3NMUF 4B7TA 1WBWA 3DK3A 5I9XA 3H9RA 5ANJA 2C6LA 2VTAA 3IK3A 3KIOC 5HLPA 3MPTA 2Y6OA 3JY0A 4JDJA 4IH8A 3VS1A 3VS7A 2XK3A 2WO6A 2WTWA 5KMIA 4MNFA 3IOPA 2E9VA 5AV1A 4EI4A 3I0QA 3EOCA 3ORZA 1F5QA 1K3AA 3OCGA 4C3PA 5I9WA 2OFUA 5HO6A 4IAFA 2F7XE 4I0SA 3BHYA 3BV2A 3GQIA 5AEPA 3KN6A 3QRIA 5CI7A 5J79A 4WKQA 4ALVA 4IM2A 2CNUA 4FSWA 4YUQA 4DFUA 1QPEA 2XCKA 3QZGA 5CI6A 4E5WA 2XNNA 3F2AA 3F5UA 1LEWA 3AMYA 3OXIA 4IACA 4JBPA 4BI2A 3TUCA 1UNGA 4L46A 4LQMA 5HI2A 4CVAA 5DHJA 4BL1A 5AA8A 3VW8A 4QD6A 3QXOA 3I5ZA 3BCEA 2PE1A 5LCJA 3BU3A 4BWXA 4NTSA 4ZMEA 4YU2A 5IPJA 4D1XA 4BC6A 4FG8A 2UZVA 4IE9A 3QFVA 2OXYA 4G3FA 3FY0A 5G6VA 1FQ1B 4V05A 2Z7SA 2F49A 4K77A 1Q4LA 4EK5A 3VO3A 4DH5A 3HV4A 4O4EA 3KF4A 4FSTA 5IMEA 2YDKA 3L9MA 3NPCA 4L68A 5F1ZA 3DTCA 4D28A 3R8VA 3DBDA 3U6IA 3FQEA 3QHRA 5I9ZA 4AW2A 4XRLA 3UDSA 3VULA 4C57A 3E7OA 3BKBA 3ID6C 5GJGA 1O6YA 2BKZA 3UP7A 3P08A 4RIWB 4O0XA 2WXVA 2W0JA 2OJ9A 3R7YA 2IZUA 4H3QA 4IC8A 4IB5A 4XEYA 2HXLA 1TZDA 3GCPA 4LFIA 2XJ2A 4Q5EA 3TT0A 4E20A 2UVXA 2OZAB 3QXPA 4PPCA 2VTPA 3F6XA 4QP4A 5BX0A 4EH4A 3RCDA 3U6HA 3VW6A 3VS5A 2ZAZA 5HX8A 4PTGA 3FMKA 3V5JA 1W98A 4YJTA 3T9IA 1U46A 1KE6A 3QCYA 3NR9A 4LGHA 2XEZA 1OIQA 4B8MA 4BKJA 3HKOA 4F1TA 3LKMA 3N4TA 4BKYA 2XS0A 4E4XA 3L1SA 3D15A 4I20A 1XWSA 2BDJA 5AAGA 2XJ1A 1DAWA 4RVKA 2J5EA 4YJRA 5AP0A 3DBCA 4MQ1A 3D7ZA 1XBCA 2IW6A 4QTBA 3MN3A 3P23A 4MD8E 2GNIA 4R3CA 4Y83A 5K0KA 4DINA 5CAOA 2GNFA 4XG7A 3OG7A 3R02A 1ZYLA 4S2ZA 2WU7A 2QQ7A 5ETCA 3ZXZA 2R0IA 2F9GA 5CU4A 5EM5A 5LCKA 4FNYA 2F4JA 3WIGA 2UZOA 4BBEA 5AP6A 3P7BA 4CEGA 5E92A 4L53A 2VX0A 5CENA 4ZSAA 2PY3A 4IWDA 3CKWA 3PSDA 4TXCA 4C33A 5AAEA 4TWCA 3EQHA 3OY1A 2WQBA 3HP2A 5BVFA 4QMSA 4XHKB 4F7SA 2WNTA 4DEDA 4DITA 1KSWA 3RPSA 4BCGA 4Q9SA 3R22A 3EQIA 3R9DA 3TZ9A 3QRJA 4AN2A 4RX5A 3QRUA 4E6CA 2NYAA 4O7SA 5C03A 4K6ZA 3KN5A 3HMPA 5K4JA 4MCVA 5CNOA 5GZAA 3C51A 3QTZA 4FT7A 5K0XA 4YJOA 1OGYA 3PXYA 2BTSA 4PUZA 5CF5A 1L3RE 2BTRA 3HL7A 4X2GA 3HECA 3MWUA 3Q4TA 5JQ5A 3PRFA 2ITNA 1YI4A 4AOJA 1GNGA 4YJNA 5DT0A 3Q04A 5DI1A 4XCUA 5CSVA 3PY3A 5CX9A 3NWWA 4AA5A 1ZWSA 3DPKA 5FXQA 5HKMA 5GJFA 5FTOA 4O4FA 5AUTA 3I6WA 5F9EA 2GDOA 1VYZA 4QMWA 4F09A