4RRVA

Crystal structure of pdk1 in complex with atp and piftide
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
284
structure length
283
Chain Sequence
KKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title A small-molecule mimic of a peptide docking motif inhibits the protein kinase PDK1.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 283
sequence length 284
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4rrvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4rrvA01
4O1PA 4MD8E 5DFPA 4USFA 4FL3A 2IVUA 2IJMA 4BCIA 4NIFB 3L9LA 4E7WA 2QKRA 5D1JA 5J7BA 4WUNA 3ZDUA 3GOPA 4FTQA 5ACKA 2QODA 3DLZA 3MA6A 3Q9ZA 3UP7A 3NWWA 3OC1A 3EQBA 3WIKA 2I7QA 4NM3A 5IQEA 3D7TA 3FV8A 4QMOA 4GKIA 2IPXA 4D9UA 3P7BA 5IF1A 3IW8A 2R3JA 3FI4A 4LGDA 5E8UA 4AZTA 3NUPA 2XCKA 4IIRA 4F64A 1WAKA 3HLLA 2ACXA 5FXQA 5TKDA 1LEZA 2C6DA 1AD5A 2C6IA 3FLWA 4BHNA 1PMEA 4OBOA 5AR7A 3ANRA 2YERA 4KIQA 4MQ2A 4M84A 3O7LB 1DS5A 3DBFA 4H1JA 4TYGA 5J95A 3S3IA 4GU9A 5HGIA 4NU1A 4JAIA 5HVJA 4IANA 4CVAA 1GOLA 4K77A 3ZS5A 3FSFA 4KAOA 4OTHA 4RX8A 1J7UA 2OIQA 2GNJA 5KBRA 4FV5A 4YHFA 4LG4A 5LCKA 3LM0A 1XBAA 5JMSA 3BU5A 4DE4A 4C4GA 3UZRA 4JI9A 5LQFA 4CYJA 1CKJA 1KUTA 1E1XA 2ZM1A 2ERKA 2OZOA 3V8WA 2PZPA 4E6AA 4CG9A 4JQEA 2GCDA 2VWZA 4FODA 4O7YA 4M3QA 4OTIA 5JZNA 4CCUA 3TWJA 3W8LA 2WMBA 4J53A 3HA6A 4EBVA 4HVGA 4ACMA 3MDYA 1QL6A 2QOFA 3ENMA 3OWPA 4RSSA 1W0XC 2V62A 4EWQA 5HX8A 4UMQA 3UIXA 1O6KA 3VS2A 2JBOA 4C2VA 3C4ZA 3DXNA 2OIBA 5E1SA 3WF9A 4S33A 4CMOA 3MYGA 4FICA 2VO6A 3DA6A 1B6CB 4ZJJA 3R7UA 4C36A 4D1ZA 4IFGA 1H0WA 5L2WA 3OVVA 3PP0A 3L9MA 4EOSA 3AMAA 1VZOA 3POOA 4FOCA 4DG3E 4IAFA 5HCYA 2BDWA 5L6OA 3R8PA 3TNQB 4U81A 2YLEA 3VUKA 4CTBA 5JGBA 4AUAA 1ZRZA 4ANBA 2DYLA 1NY3A 3I7BA 4IVCA 3VQUA 3R8ZA 3V5JA 4RC4A 5HCZA 4TT7A 3E8DA 3ZO3A 2OJ9A 2VTSA 5BMSA 5KO1A 1M7NA 2OJIA 4IACA 5D10A 5F94A 3F3VA 4YJTA 3MB6A 2RL5A 3I5ZA 4BTKA 3FYJX 3PE1A 3IECA 3CY3A 3BI6A 1JWHA 3CD3A 4DLJA 2HK5A 5CQWA 4GFMA 3S1HA 1PXOA 4EH9A 5ICPA 2CKOA 2QKWB 2JITA 3QF9A 2WQBA 4IX3A 1KE7A 5KZIA 4WNPA 3W8QA 5C4KA 3K54A 2R3KA 2WTIA 4EL9A 3SW4A 4EBWA 1ZZ2A 4NM7A 2E9UA 4FZDB 3QYZA 4CLIA 5CU0A 4TPTA 2WGJA 1UNHA 4X2GA 4CZYB 4F9AA 3BBTB 3BQCA 4XUFA 2R7BA 3O7LD 4OT6A 5DIAA 4FV1A 3UO4A 3ZONA 4TY1A 4AGCA 5EDPA 1H26A 5HESA 3L9NA 3U55A 5CQUA 3KN6A 3P08A 5EYDA 3MGYA 4EI4A 4YMJA 2R3OA 4CCBA 1Z5MA 4DTBA 2E9PA 2EB2A 2ETKA 2RG6A 4XX9A 4YHTA 4XEYA 3KEXA 1JKTA 3MY5A 5KMKA 4EH3A 3NS9A 3A7IA 2UW3A 4WG3A 4DGNA 2X8DA 4MBIA 1GIJA 1YOMA 4X0MA 1HCLA 4A7CA 1YXXA 4EZ7A 5HE1A 2UW9A 3P9JA 5CALA 4KKEA 4UZDA 2X4FA 1UU7A 3P79A 2J0IA 2WXVA 4UMUA 4RWLA 1H01A 5IDPA 3ZHPC 3LAUA 1PW2A 3VO3A 2GFSA 3ZU7A 2JIVA 2X6DA 3GQLA 1J1CA 1URCA 5C8MA 3I4BA 4YZMA 4WSYA 3H4JA 3RVGA 4CFWA 4X7QA 4Z16A 5HCXA 3IOPA 3UDBA 1QPJA 3NW5A 4I4FA 4XV1A 3TACA 3DJ5A 1YVJA 3GCQA 1U46A 2GSFA 2BFXA 3AC8A 3BKBA 4OTFA 3ZXZA 4AN2A 4AN3A 4LMNA 2UW4A 3NUSA 1NA7A 4FSMA 4EONA 2GS7A 3DZOA 4O38A 5CENA 5D11A 3MN3A 2J7TA 4KBCA 4WNMA 4JL9A 2GU8A 4DINA 3PFQA 3QZIA 4WHZA 3F88A 4XRJA 2EXCX 5DRBA 3U8WA 4NJ3A 5HORA 3H0ZA 3U9NA 4PL5A 4DGMA 4IVBA 1FMKA 3R9OA 4XG7A 1PMNA 4YJSA 2RFEA 4TYEA 5LMKA 4DF3A 4RMZA 5CWZA 1OIRA 4N0SA 5G1XA 4EK8A 1JSVA 5KCVA 2IVSA 1GZNA 2WFYA 3OWKA 3QU0A 5CI6A 2CGVA 3QQJA 4L44A 2P55A 5AP2A 5EDQA 4I5MA 5FEEA 1DAWA 2GTMA 5CSVA 2QLUA 3DCVA 3KK9A 4EZ3A 4BKYA 2PK9A 3R83A 4K6ZA 3D4QA 4UWCA 2EXMA 5H8GA 3RCDA 5IA3A 3CJFA 5BPYA 2XK4A 3A60A 1S9JA 3HRCA 2WOUA 1Y8YA 3PXKA 4FIIA 4DEDA 4XG6A 3FMMA 5EDRA 1T45A 4EOJA 1Q41A 3DKGA 3W2RA 3BQRA 4E4LA 5IQBA 5M55A 2X9EA 3KRXA 5HICA 1YDRE 3ZRKA 2X9FA 1P14A 5EHOA 2WQEA 2HAKA 4ZY6A 3FLZA 3TXOA 3RZFA 4N57A 1ZOHA 2OXYA 1Q4LA 2VGOA 3NVMB 4WRGA 1GAGA 3AC1A 5IMEA 3ORZA 2GTNA 4DG0E 3DT1A 4ID7A 3OCGA 2OK1A 1PYXA 1H00A 3Q32A 4J97A 3UMXA 3RZBA 2C1AA 4QP3A 3SW7A 3BBWA 4I23A 3ORKA 5DI1A 4EQCA 4ZLOA 2CNQA 2HZIA 3FZOA 4AFEA 4ERKA 3OW3A 2YJSA 4WNOA 3GU7A 3MW1A 3R1YA 5DR2A 4DAWA 4WIHA 2Y6OA 5JRSA 1P4FA 4A06A 5IH5A 4BCJA 1PF8A 3JR1A 4V0GA 2OKRA 2QOIA 3CR0A 5DLSA 4YR8A 2R3HA 4W4XA 3SRVB 4BZDA 2JDSA 2YIYA 1FGKA 4F7NA 4MXCA 3OCSA 5FLFA 1XQZA 4IAIA 3HV6A 3P23A 2YAKA 3WOWA 3LFQA 3DK3A 3OROA 4YPDA 3N4VA 5M08A 2O64A 3Q96A 2G2IA 5F4NA 1Q8UA 4FG7A 4PDPA 2XNPA 3BGQA 3BELA 3WF5A 2BRBA 4QMZA 5E90A 4HYIA 3LW0A 4JBOA 5A14A 1W7HA 1M2PA 1M7QA 4ACCA 2C3LA 2VTJA 2Y0AA 4FZFB 4ERWA 1IA9A 4IWQA 3POZA 3Q6WA 1WZYA 4EUUA 3QLGA 2PUIA 3RM6A 2VZ6A 3DLSA 3GU8A 3NX8A 5HX6A 3OXIA 2XK9A 4Y72A 3HGKA 3R7OA 3OTUA 2UZEA 4ZP5A 2CNVA 4FR4A 4DCEA 4H36A 1UWHA 2O3PA 4FVQA 4YC6A 3OWJA 3PJ1A 4FTUA 2WU6A 3KMMA 3F5PA 4HVSA 3JUHA 1OZ1A 2FSMX 1H1QA 3UTOA 4CV9A 4N6YA 3LFFA 2CKQA 4CG8A 1H8FA 1XR1A 4IDTA 3NCZA 4B8MA 2BROA 1UVRA 3EQRA 1ZARA 2C5XA 5CX9A 2E9VA 5HLPA 1ZY5A 4X21A 2GS2A 3BV3A 3DKCA 1OUYA 5AAFA 2F4JA 3CS9A 3RAWA 4O7LA 2CLXA 4RVMA 2DQ7X 3A8WA 3SG8A 4QMXA 4F7SA 3F2AA 4ZY4A 3UVPA 3IS5A 2XIKA 1IR3A 3QD4A 3FZ1A 2I40A 4RIXA 3MPMA 4WA9A 4CZUA 4QQTA 1PRYA 4BGQA 3D5UA 2C1BA 4PUZA 3FMJA 3JVRA 4JDJA 4A9YA 3VN9A 3R30A 4KB8A 4RPVA 2BZIB 4AGWA 4Q2AA 2EU9A 3EN5A 3RJCA 2PMOX 2JKQA 4RX9A 3OD6X 1Q24A 3ALOA 4PTCA 3CQWA 2GPHA 1YXSA 2IZUA 5DG5A 2GNGA 3KL8A 3ZM4A 4UZHA 3BGPA 4X3FA 2VWUA 4FT7A 3A99A 2RKUA 5IPJA 5A4EA 5AAGA 2WB8A 3BE2A 2OI4X 3ZXTA 1AGWA 3L9PA 4UXLA 3QYWA 1A06A 2W1GA 3OT8A 1CKIA 1F5QA 3W55A 3GUBA 5KE0A 5EHLA 2JIUA 4L8MA 2YACA 3Q52A 2B9IA 5TE0A 2IW8A 4BZNA 4NYEA 1GNGA 4G3GA 5JZJA 2WMRA 4P4CA 4C58A 1H0VA 4IH8A 5CU6A 4APPA 1H07A 3F9NA 3DTWA 4TWOA 2B53A 3N51A 5HU9A 4QP9A 3WZUA 3TNHA 3VUMA 4DG2E 3E88A 1W82A 1O6YA 2IWIA 3G9LX 4K1BA 2C6TA 2ZJWA 3NW6A 4CT2A 3MFRA 5HNBA 2ESMA 1M52A 3ZO2A 3TEIA 4ANQA 1OL5A 3UOKA 5AUUA 4YTHA 2R3RA 4IX6A 4NCTC 4O21A 4QQJA 4ONAA 3SKCA 4QRCA 2QOOA 2W4JA 3SAYA 4FTMA 3VRYA 4XOYA 5AR2A 3OT3A 4KIOA 4DEGA 2WHBA 4FMQA 4JBVA 3Q9XA 4I0RA 3OEZA 3MWUA 2Z7SA 2W4OA 1H24A 4Y83A 4QOXA 5L8JA 3JY9A 3FXXA 3UP2A 4F7JA 1UNLA 5E8YA 4GG7A 3MJ2A 4JDKA 2YFXA 5BVFA 4C02A 1YDTE 4L43A 2P2HA 3C0GA 4LV5A 4YPSA 5GNKA 1WBSA 3RGFA 3TZ9A 4C4JA 4D5HA 3A8XA 3WF6A 2EXEA 5FDXA 5J9ZA 4V0GB 1JKSA 3O8TA 3KGAA 5E8TA 3HMIA 4II5A 3S4QA 4ZTRA 2EB3A 2XYNA 3II5A 5EFQA 5CEIA 3KY2A 3WZJA 3ZSGA 1CSNA 3GGFA 3QQKA 2A4LA 3NRMA 3HRBA 3HKOA 3RTPA 3ZUUA 1OL6A 3AT2A 4BTMA 5IQFA 4YJOA 2XKDA 3QTUA 4BRXA 3OEFX 4XV3A 1SM2A 5GHVA 3LCTA 4I94A 4K2RA 4ZTQA 4L9IA 4U40A 4F99A 4BDEA 3QX4A 2PULA 1G5SA 2YA9A 4LL0A 3LQ5A 4ENYA 1XH7A 2VX3A 3DPKA 4EH2A 2XH5A 3MB7A 2BIKB 5HVKA 4BCQA 4IQ6A 4G6OA 3MS9A 5AP0A 4EC8A 3CKWA 5J87A 3PRFA 1QPDA 4DEIA 5E7RA 3AMBA 3CIKA 3EYGA 1NVSA 4EJ7A 4I4EA 4ZLZA 1PHKA 3EN9A 3Q3BA 2C47A 3RKBA 2W1ZA 3NEWA 5KHWA 4Y46A 1M17A 3KRLA 4W8DA 1OMWA 3DS6A 5BX0A 3E3BX 2C5NA 4CRLA 2QCSA 3LFSA 2QOLA 4NTSA 5GZ8A 5LMBA 3OUNB 3VS6A 2W1CA 5ANIA 1SVGA 3T3VA 4EJNA 2YM6A 3CTQA 4GEOA 3NPCA 5CAQA 4ZEGA 3UPZA 3QZHA 4RQKA 3JVSA 2HW7A 3B2WA 4ZK5A 4D2PA 4F6SA 4GT4A 5M09A 2HELA 5AEPA 3UBDA 5A46A 2PYWA 5GIOE 1Q61A 2XKFA 4WRSA 3SX9A 3KCKA 1M2RA 3ALNA 4BDFA 3UG1A 4QTDA 5LVOA 5AFVA 2PVMA 2XZSA 4FNXA 3IGOA 2EVAA 4FIFA 1REKA 4PTEA 4CKJA 4PX6A 4WBBB 5A6NA 5CYIA 3FY2A 1AQ1A 3QRTA 3UIBA 1VJYA 3VBQA 2UW5A 2JC6A 5FP6A 4F65A 3UOJA 4EZ5A 4CFXA 2KULA 4IX5A 4QTCA 4DITA 3LIJA 5GIPE 4BGGA 1G8SA 1BI8A 2W5AA 3LJ1A 4E20A 4R3CA 3VBTA 3BYUA 1K3AA 2B55A 4OTDA 5J9YA 3BU3A 2H96A 3P4KA 4P5ZA 3VW6A 4BICA 4I6FA 2WTJA 5DH3A 4PMPA 2BKKA 3UNKA 3UO5A 1LUFA 2QLQA 4IHPA 4JNWA 3HA8A 4GK3A 5IQCA 4D5KA 4FKPA 4OTRA 4RG0A 5KX8A 5KMMA 4XH6A 3F5GA 4AX8A 3FKNA 2GHLA 3R7EA 2C0OA 1OPJA 5HLNA 3LJ0A 1XBBA 2YM4A 2WEVA 1K9AA 2UZNA 3TT0A 5BVEA 4BDAA 4QYHA 2F7EE 2CPKE 4FVRA 4YGAA 3FC1X 1SVEA 4D9TA 2NPQA 3OP5A 2PL0A 3KA0A 4LOQA 5DOSA 5E4HA 5KMLA 3BHHA 5IUIA 3VHKA 4NEUA 3AC4A 3PZEA 4YC8A 5E92A 4FTKA 5CZIA 4IWDA 4IAAA 5AUVA 3ZLSA 5KKRC 3EL7A 2R9SA 3IPHA 4HOKA 4EORA 5HVYA 1FPUA 4JXFA 4ASEA 4RWJA 4YLLA 2PMNX 4GT5A 4O0TA 3V6RA 2P0CA 4L3JA 5AM6A 3VVHA 2VWVA 3QUDA 1YHVA 3HP2A 4BBMA 4DFYA 4FT3A 4CLJA 4M67A 4R3RA 2WTWA 2OBJA 4HZRA 4M15A 4BL1A 4M12A 4O6EA 4UB7A 4USDA 4C61A 1XKKA 3BCEA 4FT9A 5HTCA 3AG9A 5I4NA 5LCJA 2Z02A 4EH7A 3KCFA 4L45A 1G3NA 3Q4ZA 4FSZA 3AD4A 4DEEA 4AT3A 5HTIA 3BE9A 3MBLA 4MXYA 2PWLA 1F3MC 1WBOA 3NUUA 3SXRA 2WTKC 1GY3A 4LOPA 3GFWA 5BVWA 3ERKA 3RK9A 4QO9A 4ZXTA 4Y5QA 4AF3A 3NYOA 2C3IB 3A7JA 2ETMA 1UA2A 4JRNA 1SYKA 4JIKA 3N4TA 3DV3A 2X1NA 3LFAA 4G16A 4CT1A 4DEHA 1JSTA 3PP1A 4FSWA 4X6RA 3RNIA 4RX5A 3HNGA 1UNGA 3FQSA 2ZB1A 3QFVA 2WPAA 5AR4A 3VBYA 4F4PA 5EW8A 3ORTA 4UMPA 2AC5A 1UV5A 3LLAA 2QHMA 4ZSAA 3I60A 4D2VA 3F7ZA 4YJVA 1XO2B 2IZSA 4BGHA 5DA3A 4IADA 3GI3A 4PDOA 2QO2A 2VWBA 2OFVA 4IE9A 3A4PA 4GSBA 4CTCA 4UALA 1SNXA 3PVGA 5AP1A 4O81A 5CASA 2FA2A 3FLYA 4CNHA 3EB0A 5A9UA 2H6DA 5HG5A 4BR3A 5AUYA 1FVVA 2PZYA 2XA4A 3P5KA 4YBJA 4DFUA 2XIRA 4FKVA 4EQUA 1JNKA 3DK7A 4R1VA 3D5XA 2P3GX 4LOOA 5JSMA 3FL5A 2X4ZA 3DK6A 4C2WA 4FTOA 4YTIA 3PJCA 4TRLA 5BNJA 2GQSA 2YCSA 3ENHA 3IQ7A 4CEGA 4MTAA 2YM3A 3FLSA 2NP8A 3FEGA 4TYJA 2VX0A 3D7ZA 3H0YA 2FSLX 2VU3A 4EHGA 3QQHA 4Z9LA 3VF9A 2W05A 5TO8A 1UWJA 4E73A 4H3QA 4F9BA 5BVKA 5BUIA 3LHJA 5HBJA 1RJBA 4XJ0A 5FEQA 5HG9A 4FGRA 2AUHA 4YZNA 4F6WA 3AT4A 4HVHA 4PP7A 3PSCA 3PG1A 2Q83A 3OBGA 2XKEA 2ONLC 1NT2A 3O51A 4FTJA 3FI2A 4X3JA 4PY1A 4J96A 2QURA 5FWKK 3UIUA 1YQJA 4CD0A 3DB6A 4QYGA 5KMNA 5M07A 5BMMA 5DEYA 5LOHA 3TZ8A 1Q3DA 3E93A 4RLLA 4CZTA 3Q60A 3C5IA 4X2JA 3ZLXA 2WTVA 4LI5A 2YWVA 2QO7A 5HIBA 4IEBA 2QC6A 4G31A 5CU2A 1PMUA 4MXXA 4NJDA 4PP9A 3W33A 2VO3A 4GG5A 4ASXA 4Q9ZA 5K0XA 2GHMA 3U54A 4OLIA 4X2NA 5IH4A 4BIBA 2PUUA 2OZAB 3E62A 4WT6A 4G1WA 1NXKA 3EQCA 4IAZA 3I5NA 4D0WA 5JQ5A 1Q8ZA 4NT4A 4KWPA 1OL2A 5EM5A 3VS3A 3OXTA 1T46A 4C38A 2WO6A 1FMOE 3OG7A 4EHZA 4Q5HA 2PVRA 3I0OA 4JQ7A 3G6GA 2OLCA 3EKNA 3KU2A 3PXRA 1FOTA 1ZOGA 4MXOA 3D9VA 3BV2A 2XBJA 3FQHA 3D94A 3E8CA 2BUJA 3GC0A 3QBNA 4O91A 4OBPA 2V5QA 4ZTNA 4F63A 4G3EA 2WU7A 3S00A 3DFAA 4UV0A 2W4KA 4BYIA 3QGWA 5M44A 4NWMA 2HXQA 5CSWA 3ULIA 4IWOA 3MH3A 5B2MA 2HOGA 1VR2A 2WNTA 3QWJA 4JBQA 5HBEA 4FTIA 4L7SA 4YLKA 5IZFA 2R4BA 4BKJA 3TZ7A 3AC5A 4U8ZA 3WYXA 5C03A 1PKDA 3R9NA 5EQYA 3R1NA 4MF0A 4EH8A 2UZTA 3BHTA 3IDBA 3H9OA 3R71A 4YZBA 4HGTA 4BB4A 4Y95A 5CEQA 3SGCA 4TNBA 4I21A 1TQMA 3CJGA 3KMUA 2EWAA 4CFNA 5LWNA 3TDVA 4E8AA 2ZV8A 5EH0A 3MY1A 5AP3A 4R77A 4C57A 3HX4A 4FKOA 2XP2A 4BCKA 3JS2A 3MFSA 1H4LA 3F7WA 2XRWA 4F9CA 4CSVA 3NCGA 4PNIA 5EKOA 3ZDIA 4F9WA 1XH5A 4XCUA 3E63A 3BHUA 3QUPA 5L2TA 4FZ7A 4JJRA 2XBAA 2JAVA 2R7IA 2XEYA 3ET7A 4MBLA 4W4VA 4XG4A 3R9DA 3ZOSA 2RFDA 3EN4A 4BIEA 3SQQA 4NM5A 3QTQA 2WELA 3P0MA 3PWDA 5DE2A 4AT5A 1CMKE 3VHEA 2XNEA 1OIYA 3ZSIA 1HCKA 3UODA 3V5LA 5CAOA 4E4XA 3BWFA 5H8EA 2IZTA 2GFCA 3DZQA 2BPMA 3PG3A 3IW4A 4OGRA 5ANGA 4UN0C 4FKQA 4W8EA 2A1AB 3NYVA 4BCHA 4F0GA 2HZ0A 2OJJA 3SA0A 2UW6A 4EOQA 5ANDA 3R9RA 2PY3A 4YP8A 3UOHA 4KIKB 4B4LA 2XNNA 4V05A 3W2CA 3MVMA 3R6XA 5HG8A 3WF8A 4IWPA 3IG7A 3ULZA 5JRQA 3ZRLA 3ZTXA 4H05A 3PY0A 3KXMA 2X2LA 2DS1A 4O96A 5CAUA 4M14A 5AMNA 5FUTA 2VRXA 2VTOA 3FMHA 4C7TA 1TQPA 5BVOA 3SRVA 3GT8A 4K11A 5AX3A 3R28A 3EQIA 4YJRA 4DT9A 5IH6A 2XYUA 4ZTSA 4EUTA 3LXLA 4ASZA 3IDPA 4ZTHA 2PUPA 5H8BA 3QX2A 3TKHA 3FSKA 4Y8DA 4YNEA 1JQHA 3F5UA 4IB3A 4I24A 5HE3A 4AW0A 4YUQA 3R73A 3EIDA 4FIEA 4FKLA 4YLJA 2PVJA 3B8QA 4AWIA 2W17A 4OTQA 3CC6A 4LV8A 3TCPA 3TZMA 4J52A 3QALE 2B4SB 3CPCA 5CSHA 3TDWA 3WIGA 3IONA 3LCKA 4FIGA 4PNKA 4CGAA 2VV9A 3C5UA 3QTRA 4HGLA 4BF2A 4UX9A 4QPMA 2BR1A 4OTGA 5CNNA 2VTHA 5JFSA 3VS1A 3QD0A 4U3ZA 4YZ9A 3DQXA 5AADA 1OM1A 3PUPA 3PYYA 5IDNA 4IJPA 3FPMA 3SOCA 4FV8A 3UC4A 4L52A 2OXXA 2WMWA 2UZUE 2XM9A 3O0GA 4FG8A 4IAYA 3W32A 5CXHA 5FBNC 4QP2A 3RPYA 2YDKA 5CAPA 1PXNA 3BX5A 3PWYA 4JX3A 5EW9A 4FX3A 3W18A 3FMNA 3VBVA 4IX4A 4HZSA 5J1VA 4PMTA 3ZSHA 4DT8A 2W06A 2BALA 5EW3A 3MFUA 4HNFA 1Y57A 1HOWA 3PE2A 4QYEA 3FWQA 4GUEA 3F3TA 4IW0A 4RVTA 5CSXA 4AZFA 5ETAA 2UZWE 1ZYCA 3FUPA 1CTPE 2JDOA 5EG3A 3L8XA 3TKIA 4AOIA 2XNGA 4KSPA 5CEPA 5EM8A 5CXZA 4GVJA 3BU6A 5AUXA 2ZDUA 2Z60A 3LCOA 3ZC6A 4MWIA 4QP8A 4L53A 2Y8OA 1R1WA 3HMMA 3UQGA 1K2PA 5J8IA 3ODYX 4YJNA 4DBNA 5IA2A 3GU5A 3WYYA 2W1FA 3A4OX 4FTAA 3UNJA 2B54A 2ZV2A 2JBPA 4KKGA 4HCTA 3W16A 3ZO1A 3LXNA 4DFBA 2JKKA 1APME 3MVJA 4L01A 3U87A 4V04A 3ZLWA 4GVAA 4D4YA 5JQ8A 4BYJA 1Y6AA 4AGUA 1Q8YA 4FTRA 4F08A 2UZVA 3U6HA 4LUEA 2ITOA 3EZRA 4DH1A 1OIUA 4YU2A 2HXLA 2C3JA 2V22A 2ITPA 3DBQA 3RWQA 3NUXA 4FVPA 4AU8A 3EQPA 4YHJA 3DNDA 4FEXA 2B9HA 4AQCA 4MNEA 4O0SA 1J91A 1RW8A 4PTGA 4TKSA 4FKGA 5DPVA 3WARA 1X8BA 5JFXA 4CKRA 1YWVA 4WNKA 3CD8A 4I1ZA 3TUCA 3BRBA 3LFCA 2V0DA 2JD5A 3FMEA 3QXOA 4TW9A 4FE2A 3KF4A 5EKNA 2NRUA 3UQFA 3FMKA 4ANNA 4K8AA 2CDZA 2PHKA 1ATPE 5HO7A 3BEAA 2YIRA 3KK8A 4FL1A 4TTHB 3F66A 1LEWA 4FZAB 1H1SA 4P2KA 3UVQA 4E6CA 4TN6A 4PPAA 3O8UA 3FLQA 3CXWA 5KBQA 3FHRA 1W98A 2NRYA 3BYMA 3NZ0A 4A4OA 5FD2A 2VWXA 4FYOA 3KXZA 4AP7A 4R7BA 5CU3A 4BZOA 4X2KA 4BCNA 2ZOQA 4LRJA 4C33A 5IU2A 3R7GA 4HYUA 3GCVA 4FKUA 4BCMA 2RFNA 1YWRA 4A9TA 1O6LA 4EH5A 4EOMA 3IO7A 2R3PA 3HEGA 3WE8A 1JPAA 4R6VA 3VAPA 4UMRA 1PJKA 3TI1A 2CSNA 3IK3A 3RBWA 4BDJA 1Q99A 2VNWA 3G6HA 4W9XA 2XKCA 2ZM4A 3HMNA 4O0YA 4C4HA 5BYYA 2NO3A 4AT4A 1MRVA 1WVWA 4TYIA 2QD9A 1JSUA 1IEPA 4BDHA 1A48A 4GCJA 4QMSA 2QG7A 5E9EA 2YEXA 3Q4CA 1YWNA 3COKA 4E6DA 3U4WA 1WFCA 4PL3A 1WBNA 1M14A 2W96B 3RK7A 4RBLA 3OWLA 3VJNA 3A62A 2C68A 2PU8A 2BAKA 3JY0A 4O0XA 2J0MB 3A7GA 3CP9A 4AE6A 3M2WA 5IA0A 4O0UA 5ETFA 4C34A 2CKEA 3PXFA 4YNOA 4NKSA 4E5BA 4QD6A 4NSTA 3P1AA 1OKVA 5IQIA 5IQHA 2FVDA 4XLIA 5K0KA 4FI1A 4HGEA 2XM8A 2VO7A 3PTGA 2O0UA 4ZIMA 1WCCA 1XJDA 4G34A 3GB2A 5FP5A 2J0JA 4WG5A 1U5QA 3OTVA 4E5WA 4NKAA 4KSQA 2GNFA 1ZWSA 4U43A 1PXPA 3OCBA 5L3AA 2O5KA 3LFDA 3PA3A 4U44A 5ANJA 5LMKC 3WBLA 2ETRA 3PLSA 4TWPA 3VS5A 4RT7A 4EYJA 5JT2A 3DXQA 1XH4A 3FY0A 3FDNA 4ZJIA 1MRUA 3FMDA 3KN5A 3CTHA 1XBCA 1Y6BA 1JKLA 2Z2WA 5H3QA 2X7FA 2R3QA 2C5VA 3OY1A 3W2QA 1BLXA 4B8LA 2VTMA 4FK6A 1R39A 4I20A 4K33A 4DGGA 4G17A 4CV8A 1KWPA 4RJ7A 3HZTA 3C50A 3NUAA 2QR8A 1ND4A 4DA5A 2PZRA 4HJOA 4NW6A 3QRJA 5E91A 5AUZA 3GC9A 3F61A 4HPTE 4JG8A 2CHLA 5FBOA 4IVDA 3ZYAA 3RWPA 3RK5A 2G1TA 4QMVA 3UYTA 4LL5A 4RIWA 1YXUA 4EOKA 5LVPA 5GINE 2OH4A 3BIZA 5K4IA 4G3CA 4G9CA 3TKUA 2YDIA 5AP7A 3ZCLA 4E93A 1ZAOA 3U51A 3N9XA 2PSQA 4NZWB 5HKMA 3FZRA 3G2FA 4Z7HA 3ODZX 2ZVAA 2IG7A 5EQEA 4QMUA 3HV5A 3BYOA 5CT7A 5IUGA 2Q0NA 2Y4PA 3THBA 3GXLA 2X7GA 2X8IA 5LWMA 3UO6A 5LJJA 3T3UA 3DDQA 5HU3A 1Q8TA 3UZPA 4B9DA 3QRKA 4DCAA 4GIHA 5CLPA 4F1MA 5KMOA 4IM3A 4I6QA 5CI7A 5HZNA 4NM0A 4Q9SA 4F0IA 2V7AA 5BUEA 4JG6A 2P4IA 4O86A 3FXWA 4XBRA 4NFNA 4MNEB 1SVHA 3LZBA 4U79A 1Q3WA 5M57A 3PVBA 3KXNA 3QXPA 3VW8A 3GU6A 5JFVA 4C0TA 3DKFA 3PPKA 4ZTMA 2YCFA 4RA4A 5DMZA 1WVYA 3ZFXA 4S2ZA 4DFZE 3LFBA 2XEZA 2XK6A 4PMMA 4FIHA 5F1ZA 1VYZA 4ZSLA 3S95A 1MP8A 2KTYA 4XG3A 2OICA 4FUYA 4J8MA 4LRKA 2X2MA 4R8QA 4RZWA 4O7VA 4YO6A 2GNHA 3CE3A 1W8CA 2ZMCA 2HZNA 4QNYA 4V01A 4YJQA 1U54B 2C69A 2I0YA 5F9EA 1KE5A 2QI8A 3FKOA 4XV2A 4ZJVA 3H3CA 4WD5A 5KNJA 2QU5A 4PL4A 1UU3A 1H08A 3C4EA 4WUAA 2BCJA 3EN6A 5E8VA 1P4OA 3FMLA 4E26A 4WSQA 4AGDA 4FKTA 3KF7A 4FV9A 2W5BA 1Y8GA 4GYGA 5HO8A 3SDJA 5IQAA 3G0FA 5H9BA 2FSOX 2W9ZB 1DI9A 1J3HA 2WIHA 5HO6A 2BHHA 4FEUA 3T8OA 4I5CA 3BYSA 3G51A 2OG8A 2X81A 4TNDA 4U41A 4EK4A 2HIWA 4JBPA 4AA0A 5CANA 4GK2A 4R7HA 2I6LA 3EQHA 3G5DA 3NAXA 3LFNA 3OW4A 4E6QA 4IZ7A 1OBGA 4NTTA 4RGJA 5CY3A 4O7WA 4J71A 4PQNA 4D58A 4RC2A 5LXMA 2BAJA 3Q5IA 4F1OA 1UU9A 3RPVA 5HIDA 2ITVA 3GENA 5M4UA 2R3GA 2UW7A 2PE2A 2XNMA 3QLFA 2PVNA 2QU6A 3COMA 5HE2A 4I92A 1BYGA 4F9YA 5FEDA 3WE4A 1TQIA 1VEBA 5IEYA 3SD0A 1H1PA 3DFCB 5DWRA 1BMKA 2C6LA 3RP9A 2OJFE 4BWPA 4H39A 4UXQA 4AACA 3LJ2A 5HG7A 3VWAA 4QP4A 3QTIA 3AD6A 2XIYA 4XLVA 1GZ8A 4X3FC 4QMMA 4YURA 2ZV9A 4E4NA 5CEOA 2VAGA 4MYGA 3TNPC 2QHNA 3L8PA 4WG4A 4L42A 3QCYA 5LVMA 1G8AA 4Z3VA 2WQOA 3CGOA 3RPOA 3PDTA 3E8NA 3LLTA 3GBZA 2J2IB 4KKHA 2HY0A 4KUJA 4I5PA 4MAOA 4BI1A 3C4FA 3R00A 1RQQA 4RJ5A 2CN5A 2J5EA 2W9FB 3NW7A 3EOCA 4L3PA 4EOOA 5L2SA 1R0EA 5L8KA 3I7CA 3GNIB 5TOZA 4RIWB 5J1WA 4M0ZA 3OBJA 1H25A 3NIEA 2JGZA 3V6SA 5JN2A 2JFMA 4ZSEA 3VUGA 2CN8A 1TKIA 4FF8A 4BC6A 4FKIA 3QWKA 4C4IA 4EHEA 3HUBA 5AV3A 5FM2A 4BFMA 3NLBA 4U45A 5FGKA 3KULB 2GNIA 4IJ9A 2BDJA 4IVAA 2YAAA 3COIA 4BIDA 3TTIA 4C37A 1W84A 3ATSA 1OL7A 2CGUA 2J4ZA 4S32A 3VBWA 3VJOA 4D4RA 4ZSGA 2OZAA 3HUCA 4J1RA 3UQCA 3R2BA 4DTAA 4FSUA 1QPCA 3TUBA 3DBEA 3ZFYA 2I1MA 4IB0A 2VWWA 4W4YA 4L6QA 4J95A 5JEBA 2Y4IC 3NUYA 2BRHA 3TV7A 4IMYA 5DT4A 2B1PA 4O7SA 3BGZA 2VTAA 4BHZA 4QTEA 3ELJA 3KREA 2FUMA 3ROCA 1KSWA 2QG5A 2ZMDA 3MIYA 1V0OA 4FNYA 3GCUA 4BBFA 5BVNA 2BFYA 3V51A 3VNTA 4AZSA 4C4EA 5M53A 3ZM9A 3QZFA 2QONA 5EYCA 2UZLA 1ZOEA 3D83A 4JIAA 2ITTA 1JOWB 3TL8A 5JGAA 2C3KA 2QNJA 4FEWA 1LR4A 3NVKI 2WEIA 5HIEA 3FI8A 2F7ZE 4EKKA 2W1HA 5FDPA 5L2IA 4O82A 3GCPA 4MH7A 4C35A 2R0UA 3OS3A 3ZO4A 4O7ZA 3DU8A 4ZMEA 2C30A 2R5TA 2VTQA 4LYNA 2Y6MA 1IA8A 4U80A 1SZMA 3QCQA 3G15A 1RE8A 2OGVA 2Z7QA 1WVXA 3PXZA 1ZYJA 3WZDA 5KZ0A 4D2SA 4F70A 4CYIA 3ORIA 4EOLA 3O71A 3SLSA 3DB8A 4L3LA 4AAAA 2YABA 4GKHA 1ZYSA 2ITNA 4USEA 5ETIA 3VS7A 3NMUF 2X8EA 4ACHA 4BDKA 4ZMFA 3RM7A 4LQMA 3QTSA 2P33A 3NR9A 5L2QA 2ZYBA 2FH9A 4TWNA 3V5WA 5HI2A 4IB5A 3FBVA 3OUKA 5J79A 4RC3A 3ANQA 2GHGA 2BZHB 2NNWB 2W99B 1PXMA 2WKMA 4GL9A 5IA5A 3SXFA 2EUFB 3ETAA 3FC2A 1OKWA 1L3RE 3ZUVA 2RGPA 3ZFMA 4B6LA 1L8TA 4DGOA 3D5VA 1KOAA 5ITAA 2YCRA 3LFEA 3PIZA 4M7IA 2CNUA 3E5AA 5CTPA 4FK3A 3PPZA 3QRIA 1EH4A 2PTKA 3Q2JA 5AIRA 1OIQA 2CGWA 3AXWA 3MVHA 2YJRA 1OI9A 1OVEA 3IGGA 3QHWA 4R78A 2Z7LA 3TV4A 4D2TA 2H34A 3AD5A 5EOLA 4DH3A 1YKRA 4GRBA 2ERZE 2YLFA 3C4XA 4KIKA 2W1DA 2R0IA 3NSZA 3QQGA 4RJ4A 5CZHA 2HCKA 2HW6A 3MTFA 4NFMA 4PDYA 4RQVA 4XRLA 3VBXA 3GEQA 3M11A 4A07A 3WI6A 2C6KA 1B39A 3VQHA 2YZLA 4ZTLA 2FSTX 5B2LA 3LOKA 4DN5A 1GJOA 4YTCA 2C6MA 2WMSA 3FZPA 4QMYA 4DFLA 3ZUTA 2WMAA 5C27A 3QTWA 1PKGA 2F2UA 3MH1A 3G0EA 5FQDC 3UYSA 4ZZOA 4GS6A 2WTKB 3F5XA 2FGIA 5CEKA 3N4UA 3GC7A 4JT3A 4ZOGA 4N6ZA 4D4SA 1JKKA 4ZS0A 1OPKA 2VTPA 2XCHA 5AV1A 4FA2A 3U4UA 1NVQA 4RFMA 3ZH8A 1DM2A 2YM8A 1JAMA 3MSSA 3PIXA 4M69A 4OTWA 5CF5A 2DWBA 3MH2A 3NNVA 4DH8A 3HVCA 4EOIA 4OTPA 4DFXE 2RIOA 3TIZA 3EQFA 3BLRA 4H1MA 3QTXA 3R02A 3R21A 4XS2A 3M42A 3NNUA 2Q0BA 3LXKA 3EHAA 2UZOA 4BTFA 1ZYDA 3AT3A 3DJ7A 3LVPA 4DC2A 3PZHA 4BDBA 3U6JA 3GOKA 3D2KA 3FJQE 4FV6A 4RX7A 2IO6A 2OO8X 2VWYA 3KRWA 3QQLA 4X2FA 4EC9A 3MH0A 3CQEA 3TN8A 3ACKA 2QR7A 4G5PA 3ZRMA 4DGLC 4DLIA 1B38A 1XH8A 5DHJA 3EYHA 2UVXA 4FKSA 2G2HA 4FNWA 1QCFA 2HWPA 1ZMUA 3E64A 3KRJA 4L7FA 3K3JA 3VUIA 3QC9A 3QTZA 3GP0A 4IFCA 1WBTA 1OKYA 2VO0A 5CSPA 4D1SA 1VYWA 4MK0A 4AA4A 3TNIA 4KIPA 2WD1A 3PY3A 3MESA 2FYSA 3QHRA 5EK7A 4UMTA 1YRPA 2QQ7A 3R8MA 2BZJA 2QO9A 5AP4A 4O0VA 3ZZEA 2X7OA 4ZZNA 4C8BA 2WMXA 4IZ5A 4UYAA 3EH9A 4GIIA 4M8TA 1XHAA 3R7YA 4MXAA 1IG1A 5EM7A 5M56A 1IASA 4IB1A 2A0CX 2X39A 3H30A 5J5TA 1ZZLA 1P5EA 2OIDA 4IC8A 4RZVA 2BAQA 3EMGA 2OSCA 2BRMA 3W2PA 2PMLX 4RJ3A 2LAVA 3JXWA 4QQCA 2C4GA 2JKMA 3A7FA 3OFMA 3HAVA 2W1IA 2SRCA 4MHAA 5J5SA 3JYAA 3HAMA 4HYHA 4QMLA 5FTOA 3K3IA 5L6WL 5AR3A 2F2CB 2H9VA 1W83A 3I0QA 4JLCA 4D55A 5FM3A 4MBJA 4IC7A 3KQ7A 4WOVA 4BI0A 5DN3A 1CM8A 4GW8A 2JIIA 2PVHA 5ETCA 4G5JA 2Z7RA 4C3PA 4AE9A 4AFJA 4L67A 3AQVA 5K9IA 2G01A 2YIXA 4KS7A 4KRDA 3CCNA 5EI2A 4I6BA 1ZLTA 3W1FA 3H9FA 2YIQA 2ITXA 1KOBA 4ANMA 2RG5A 3R1SA 5ANOA 3LXPA 5KMIA 4J99A 4IZYA 4O27B 1F0QA 3I81A 4QMQA 4ZY5A 2ZAZA 3GC8A 4MF1A 5AP5A 1CDKA 5M4CA 4Y73A 5DEWA 4AXAA 3EFWA 3FZTA 4B0GA 2F7XE 1U4DA 5HOAA 4E1ZA 4EH4A 5IEXA 3R04A 3SVVA 4NL0A 1PMVA 4MKCA 3ACJA 2ZV7A 3W2SA 1S9IA 3V5TA 3MPTA 3FE3A 1YOLA 4O7TA 1BL7A 4CKIA 4YC3A 3R2YA 4EYMA 1J7LA 3F3WA 4G6NA 3HECA 4F1TA 4R5SA 1WBVA 3KXXA 5GJDA 3NYXA 1ZMVA 4HW7A 2VGPA 3Q04A 2CJMA 3T9TA 2JDVA 2WOTA 3AC2A 3EQGA 2XJ1A 4LM5A 2J90A 1PXJA 3EQDA 3TNWA 5E8SA 4LFIA 3Q9YA 4TZRA 1KE6A 1SNUA 2OWBA 5DR9A 5AV0A 2W1EA 2I0VA 2I0HA 2JDRA 3RINA 3PLAE 3WF7A 4FTCA 2VTNA 2PVLA 3RPRA 3P78A 3K5VA 4EK6A 3GVUA 5J7HA 1J7IA 2CCIA 4U6RA 3B8RA 3MIAA 3A61A 2UZBA 4PF4A 4QTBA 2J9MA 3KXGA 4M69B 4A9UA 4QPSA 2XF0A 3VULA 2XK3A 4M0YA 4R5YA 4E3CA 3VS0A 1MQ4A 2B9JA 4RVLA 5DRDA 3LMHA 3RHKA 2YITA 2QOCA 3E8EA 4LRMA 4ITHA 1V0PA 2PUNA 1MRYA 4FV0A 3BLQA 4FTLA 4XBUA 3S0OA 1PXIA 5CVGA 4ANLA 1FINA 3E7OA 3KVXA 3R0TA 4RLKA 4RWKA 5CF8A 3QD2B 2UV2A 3VUDA 1FVRA 2FO0A 4MX9A 4C59A 3OZ6A 2H8HA 4KBAA 5C01A 3HMOA 3PA4A 2J5FA 3FI3A 3MFTA 5C1QB 2PMIA 2CGXA 2PVFA 3D14A 4FBXA 4FKWA 4HCVA 2IN6A 1BL6A 4JS8A 5T6KA 1FBNA 2Z8CA 1GZOA 4TL0A 3OF0A 5G6VA 2QOQA 4ZSJA 2OXDA 4LGGA 4CQGA 3UMWA 3LQ3A 2BTRA 2XVDA 1ERKA 2HENA 3IW7A 2JKOA 3C51A 2OH0E 3FAAA 2X6EA 2YZAA 3ITZA 1BX6A 3UJGA 4D28A 2O8YA 5B2KA 2I0EA 4ENXA 4HPUE 3D7TB 4IZAA 5L4QA 4N70A 5HBHA 4YO4A 3LMIA 3HL7A 2CMWA 4YSJA 2BMCA 5ACBC 4XOZA 3BLHA 2WMUA 3R7VA 4FV3A 4MVFA 3HYHA 5K5NA 3L8SA 3SC1A 4DBXA 3G9NA 2J50A 4IM2A 2UVYA 3OOGA 3VUTA 4BI2A 4O1OA 3FYKX 2FB8A 5AWMA 3PJ3A 3BPRA 3PJ2A 5LVLA 4ALWA 2YM5A 1YXVA 4AW1A 1MUOA 2YISA 3QUEA 4FKJA 3ZEWA 4AZWA 3B2TA 2X2KA 3ZC5A 4FGBA 1E9HA 1V1KA 1UKHA 2HY81 4CMTA 1I09A 4QT1A 3TJDA 4I0TA 4BWXA 4L00A 3QKLA 3QL8A 5AM7A 4ZAUA 3I79A 3MPAA 5FG8A 4BTJA 1LP4A 3DY7A 3F2NA 4EEVA 3LE6A 3HDNA 5M4IA 3UIMA 2JAMA 2WQNA 3ORPA 4I0SA 5E8WA 4OAVB 2YHVA 3HRFA 3W10A 4DFNA 1R3CA 2DUVA 3TTJA 3BYVA 3EZVA 2PVYA 1V0BA 5A3XA 4TXCA 4JX7A 2VX1A 3C4WA 5DYJA 1ZMWA 4BDIA 1IAHA 2OFUA 3S2PA 5TF9A 4GH2A 1Y91A 3DDPA 1XWSA 4P5QA 4FEQA 4YBKA 4G2FA 3E92A 1NW1A 4DHFA 1LPUA 4GV1A 4MXZA 3VRZA 1OECA 5HQ0A 3RNYA 1U54A 4IBMA 2V7OA 2IW6A 5BYZA 5A6OA 4ASDA 5CU4A 4MD7E 2J0KA 2WMTA 2AYPA 5GZ9A 2XIZA 3IW6A 2JFLA 3ORNA 3QAME 4U97A 3GCSA 4LGHA 5I9UA 2A2AA 4QMWA 5BUJA 3GU4A 3FZSA 5L8LA 5LMAA 1Q62A 4FSYA 4EOPA 1BUHA 4PWNA 2F49A 3GFEA 5I9VA 2WMQA 2B0QA 3P7CA 3OMVA 2XMYA 4TYHA 3A7HA 3RAKA 4ZS4A 4ZZMA 3H9RA 4JDHA 3QKKA 4O7RA 5CVFA 3OOMA 3DQWA 3R9HA 3ATTA 1PXLA 5CVHA 4K0YA 3QC4A 3SHEA 1ZY4A 3KMWA 2J51A 4FUXA 1DAYA 1WBPA 3VS4A 3DBCA 3WZKA 5T3QA 4A4LA 3QCXA 3F6XA 3QQFA 3MVLA 3PSDA 5GZAA 3ORMA 4RIYA 4N4SA 4GFGA 4Y5HA 2VTLA 4YZDA 3Q6UA 3C0IA 5DT0A 4ACDA 2BTSA 2UZDA 4NW5A 2WTCA 3PVUA 1M2QA 4O6LA 5D7VA 2PZIA 3NDMA 5AAEA 2OF4A 2VTRA 4ALUA 4D1XA 1O9UA 5BYLA 3SG9A 4G9RA 3JPVA 3BHYA 3Q53A 5FTGA 4FKRA 4WKQA 3IKAA 3TV6A 4NCTA 2UVZA 1OL1A 3AC3A 5E8ZA 1YW2A 4RJ8A 4JR7A 4LUDA 4BCPA 1I44A 4FNZA 4KBKA 5HE0A 5AR8A 2XK8A 3COHA 4AOTA 3SV0A 5FXRA 5F95A 3O8PA 5AA9A 2C6EA 3LPBA 3H10A 4IM0A 5DR6A 5I9XA 5I9YA 2GQRA 5IQDA 2W7XA 4ORKA 4OUCA 3RHXA 4U9AA 5HNGA 3AGLA 1YHWA 2WIPA 4R7IA 3HDMA 3Q5ZA 4FT0A 4OR5A 2JEDA 4BKZA 3BEGA 4S30A 4I6HA 2BRGA 3UVRA 3DXPA 1H27A 3DAEA 1P2AA 5EYKA 1UU8A 3LQ8A 5LARA 3V3VA 5A54A 2XRUA 2UW0A 2C5OA 3DAJA 4UYNA 4D2WA 1REJA 3D0EA 4FZ6A 3KKVA 3R8VA 4JQ8A 4FL2A 2BVAA 3F82A 5A4CA 2G15A 2RFSA 4W4WA 4YTFA 3UNZA 1GIHA 3CEKA 4PPCA 4CXAA 1IAJA 3ZEPA 5CF6A 2B52A 3QD3A 4C3RA 3I1AA 4Q5EA 4DEBA 3Q2MA 3KULA 2J6MA 1KE9A 3QQUA 3KB7A 4D2RA 4EK5A 4YZCA 3KC3A 4GJ3A 3P86A 4A4XA 5CEMA 4JR3A 4NUSA 3DTCA 4O22A 5DNRA 3VC4A 1TVOA 2W0JA 3FPQA 5JK3A 4QMPA 4U42A 3ROYA 3V01A 1OBDA 3QA0A 2YM7A 4EK3A 4R1YA 4I3ZA 2CKPA 4UEUA 2BDFA 4I5HA 3W2OA 3Q4TA 5HLWA 3C1XA 5DT3A 4EKLA 3C13A 5BQ0A 5IMXA 2VD5A 3E3PA 5AP6A 1R0PA 2C0IA 4ITJA 3HV7A 2CLQA 3HMPA 3KFAA 4U7ZA 2C0TA 5K3YA 2YIWA 4FV4A 3MI9A 5IG1A 5IISA 1A9UA 1E1VA 3CKXA 3NUNA 3MY0A 5M4FA 3CGFA 3C4CA 2XNBA 5AUWA 4E5AX 5A4LA 4PPBA 3QRUA 4RFZA 3U9CA 4CFUA 3C0HA 4YSMA 4QP1A 3OHTA 5EI6A 2CCHA 5HD4A 1Z9XA 3QA8A 4IDVA 5I0BA 4C4FA 3C9WA 5HTBA 2G9XA 1KE8A 4UBAA 4TWCA 5ANEA 4OAUC 1MQBA 1PY5A 4FEVA 1J1BA 2A27A 3RAIA 5M51A 4QNAA 4K9YA 2OW3A 3RCJA 4XYFA 3V5PA 4FTNA 3V04A 5I9WA 1Q5KA 4JOAA 3K5UA 1H1RA 2V55A 3EFKA 3VF8A 4A9SA 2IVTA 4QYYA 2B9FA 4O0RA 2GQGA 3V8SA 1Z57A 3NYNA 4JAJA 1BI7A 2YN8A 4P7EA 3ZLYA 1XH6A 4M66A 5B7VA 1U5RA 4BWKA 4TYHB 3RAHA 3R22A 1OITA 5E8XA 1JBPE 4KINA 4DTKA 2UUEA 4JVGA 2VUWA 5AJQA 3D15A 1STCE 4FSTA 3NGAA 4EH6A 5C8NA 2GNLA 3L1SA 1WMKA 2QOBA 4FG9A 1ZYLA 5H2UA 4CMUA 5HNIX 2X0GA 4H58A 3RALA 2BILB 5HHWA 1U59A 4BY9E 5F20A 4JG7A 4RIYB 4RRVA 1H1WA 3BWJA 4ZLYA 5I9ZA 4L46A 4O84A 3V5QA 4EQMA 4Z7GA 5IA4A 5E1EA 2XS0A 2ITWA 4S31A 4QMNA 5D12A 3GQIA 4BDGA 3ID6C 1KV2A 1OB3A 2XK7A 2YCQA 3IW5A 4O2ZA 4A9RA 4AZEA 5CAVA 3F69A 2RSVA 5IKWA 1GIIA 3E87A 2YDJA 2RF9A 4M68A 5AX9A 5IA1A 4M13A 3IDCA 4XP2A 4O0WA 3DAKA 4FSRA 3QZGA 1PYEA 3TIYA 3EFJA 3EWHA 4XV9A 2PZ5A 3ZBXA 2PPQA 3UOLA 3UGCA 1IRKA 3SXSA 3Q4UA 4Y85A 3FHIA 3OCTA 5DBXA 1Q97A 3FKLA 2BKZA 3EJ1A 5ANKA 4F7LA 4CFVA 4G6LA 3TJCA 5IQGA 3FLNC 1ZXEA 3WILA 3VIDA 1YHSA 2R2PA 2XB7A 4O7NA 2JDTA 3HP5A 2XNOA 3ZZWA 5L6PA 4I22A 5KHXA 5AIKA 2R3LA 2VNYA 4GU6A 4F09A 4BCFA 4WBOA 4AS0A 3AOXA 4QTAA 3DGKA 4OT5A 4QMTA 3O2MA 4RFYA 3FL4A 4MWHA 2YWPA 4QP6A 2R3IA 5T68A 4APCA 2ITQA 4RJ6A 3FQEA 3QCSA 5HD7A 4FT5A 3HV3A 2G2FA 4F0FA 4XNEA 2R3FA 4XG8A 4YJPA 5FTQA 1JVPP 2R3NA 4U3YA 4K18A 4F6UA 3R8UA 2AC3A 3NIZA 3PPJA 3A2CA 4FYNA 3EKKA 4LMUA 4MEDA 1OUKA 3RI1A 3UC3A 4FSNA 3MA3A 5CS6A 2O65A 5A4TA 3RPSA 4J98A 4ARKA 2ITYA 5FRIA 3PXYA 2A19B 2HZ4A 4GFOA 3G33A 2VWIA 4MNFA 4XP0A 4RIXB 1QMZA 1XH9A 3ZBFA 4W9WA 3C7QA 4C3FA 4XP3A 5D9HA 3R1QA 4EWHA 5EQPA 3LMGA 4J8NA 4BBEA 3R01A 5IEVA 3KRRA 3DBDA 4AW2A 4UY9A 3K2LA 3V8TA 4G3FA 3R63A 4EHVA 5BVDA 2C5YA 3CY2A 5I3RA 2QOKA 4XG9A 4DH5A 2HYYA 4FSQA 4Z55A 4X3FB 4IAKA 4RIOA 2O2UA 3ORLA 3PXQA 4M97A 5HEZA 1R78A 2XJ0A 5JH6A 2XUUA 4GMYA 1CKPA 1SMHA 3AGMA 3UG2A 4RWIA 4NIFA 3F3UA 4I41A 3PIYA 5AV4A 2C6OA 2R3MA 3IOKA 3LKMA 4G3DA 4E4MA 3P7AA 2PE0A 3LCSA 4RA5A 4J7BA 4FC0A 2GMXA 5C9CA 3CQUA 4DYMA 4B7TA 3QKMA 2XIXA 4GK4A 2R64A 4MCVA 4GUBA 3ZMMA 3KVWA 2J0LA 2ONLA 4BDCA 5JFWA 3MJ1A 4O2PA 3TG1A 3T9IA 5C8KA 5IUHA 4KNBA 4OBQA 3O23A 4H3BA 3PSBA 1WBWA 5DVRA 5GJGA 2E2BA 2Y9QA 3LM5A 1PXKA 4PV0A 2P2IA 4BDDA 3TUDA 4DEAA 2WAJA 4NK9A 4UWYA 2E9NA 2WMVA 3SOAA 5D41A 4QYFA 3O50A 2BHEA 3D5WA 3M1SA 4AOJA 3O96A 4UWBA 4CQEA 3HV4A 2IZRA 1YOJA 1KV1A 1URWA 5EHYA 1FVTA 1YXTA 2BZKB 4GJ2A 3Q9WA 4KD1A 5C4LA 4S34A 4O83A 1Q8WA 2HWOA 2W5HA 2BRNA 3NNWA 4XG2A 5AA8A 2ZB0A 4KA3A 1FQ1B 3G90X 1YI6A 2ZM3A 3PA5A 5AR5A 1YI3A 3I6UA 4MD9E 3NNXA 4ANSA 2Y4IB 3CLYA 4FTTA 2QVSE 5EOBA 1RDQE 3PJ8A 1OPLA 2VTTA 3REPA 5C26A 1OKZA 1FGIA 4I93A 5EYMA 3RMFA 3EL8A 4JRVA 4P90A 4BCOA 3F3ZA 4AN9A 1OGUA 2VTIA 5CNOA 3FXZA 1H28A 4U0IA 4NH1A 5EM6A 4ITIA 3R8LA 3I6WA 4ANOA 3R7IA 2F57A 3PVWA 4R3PA 5JKGA 5KKRB 4FV7A 2JLDA 3DKOA 3DNEA 3D2IA 2QOHA 3NAYA 4AG8A 2VN9A 4FV2A 4JDIA 4QP7A 3CSVA 1NVRA 3EFLA 2REIA 2Y7JA 4U5JA 2E9OA 4HNIA 3UE4A 4XHKB 3KXHA 4D0XA 4CRSA 2OF2A 5K4JA 3L8VA 2WZJA 4QQ5A 3LCDA 4BCGA 3BZ3A 1GZKA 2ITZA 4MQ1A 3UPXA 4AW5A 2IW9A 5GJFA 4BN1A 1DI8A 5M06A 4CFMA 1BKXA 3ORXA 5EI8A 4CFFA 1UKIA 2GS6A 4OW8A 3EN7A 3F2RA 5B0XA 3VUHA 4GT3A 5JGDA 2OU7A 3CPBA 3CBLA 2UW8A 3DJ6A 3CTJA 4AZVA 2GDOA 4AA5A 3OXZA 1QPEA 4H3PA 2PE1A 4PDSA 5AUTA 3OY3A 4BVUA 2WQMA 3DOGA 3O17A 4YJUA 4HYSA 3PRIA 5KMJA 4PMSA 5J9LA 5TT7A 2WTDA 2F9GA 4ALVA 4HVDA 4RVKA 2O63A 5DGZA 2IVVA 3QGYA 5D7AA 4B99A 2OJGA 4QPAA 3WZEA 4X6QC 4HVIA 5CT0A 3TM0A 5KUPA 2LGCA 3E7VA 1YI4A 4WO5A 4KABA 5I3OA 5LVNA 3BHVA 3MTLA 3UZTA 4HGSA 3U6IA 2ITUA 4IXPA 4XMOA 5CF4A 3AMYA 4D4VA 4C62A 4ACGA 4KRCA 4PRJA 5TR6A 4DH7A 2BIYA 2XJ2A 4FIJA 1YDSE 4L68A 1JLUE 5AV2A 4HCUA 5K5XA 2B7AA 2PVKA 2ZDTA 5FXSA 5A4QA 3MV5A 4FOBA 4KS8A 5I5ZA 3PY1A 4GYIA
chains in the Genus database with same CATH superfamily
4O1PA 4MD8E 5DFPA 4USFA 4FL3A 2IVUA 2IJMA 4BCIA 4NIFB 3L9LA 4E7WA 2QKRA 3NFFB 5D1JA 5J7BA 4WUNA 3ZDUA 3GOPA 4FTQA 5ACKA 2QODA 3DLZA 3MA6A 3Q9ZA 3UP7A 3NWWA 3OC1A 3EQBA 3WIKA 2I7QA 4NM3A 5IQEA 3D7TA 3FV8A 4QMOA 4GKIA 2IPXA 4D9UA 3P7BA 5IF1A 3IW8A 2R3JA 3FI4A 4LGDA 5E8UA 4AZTA 3NUPA 2XCKA 4IIRA 4F64A 1WAKA 3HLLA 2ACXA 2IF8A 5FXQA 5TKDA 1LEZA 2C6DA 1AD5A 2C6IA 3FLWA 4O4CA 1PMEA 4OBOA 4BHNA 5AR7A 3ANRA 2YERA 4KIQA 4MQ2A 4M84A 3O7LB 1DS5A 3DBFA 4H1JA 4TYGA 5J95A 3S3IA 4GU9A 5HGIA 4NU1A 4JAIA 5HVJA 4IANA 4CVAA 1GOLA 4K77A 3ZS5A 3FSFA 4KAOA 4OTHA 4RX8A 1J7UA 2OIQA 2GNJA 5KBRA 4FV5A 4YHFA 4LG4A 5LCKA 3LM0A 1XBAA 5JMSA 3BU5A 4DE4A 2XAMA 4C4GA 3UZRA 4JI9A 5LQFA 4CYJA 1CKJA 1KUTA 1E1XA 2ZM1A 2ERKA 2OZOA 3V8WA 2PZPA 4E6AA 4CG9A 4JQEA 2GCDA 2VWZA 4FODA 4O7YA 4M3QA 4OTIA 5JZNA 4CCUA 3TWJA 3W8LA 2WMBA 4J53A 3HA6A 4EBVA 4HVGA 4ACMA 3MDYA 1QL6A 2QOFA 3ENMA 3OWPA 4RSSA 1W0XC 2V62A 4EWQA 5HX8A 4UMQA 3UIXA 1O6KA 3VS2A 2JBOA 4C2VA 3C4ZA 3DXNA 4QDEA 2OIBA 5E1SA 3WF9A 4S33A 4CMOA 3MYGA 4FICA 2VO6A 3DA6A 1B6CB 4ZJJA 3R7UA 4C36A 4D1ZA 4IFGA 1H0WA 5L2WA 3OVVA 3PP0A 3L9MA 4EOSA 3AMAA 1VZOA 3POOA 4FOCA 4DG3E 4IAFA 5HCYA 2BDWA 5L6OA 3R8PA 3TNQB 4U81A 2YLEA 3VUKA 4CTBA 5JGBA 4AUAA 1ZRZA 4ANBA 2DYLA 1NY3A 3I7BA 4IVCA 3VQUA 3R8ZA 3V5JA 4RC4A 2X0QA 5HCZA 4TT7A 3E8DA 3ZO3A 2OJ9A 2VTSA 5BMSA 5KO1A 1M7NA 2OJIA 4IACA 5D10A 5F94A 3F3VA 4YJTA 3MB6A 2RL5A 3I5ZA 4BTKA 3FYJX 3PE1A 3IECA 3CY3A 3BI6A 1JWHA 3CD3A 4DLJA 2HK5A 2X0PA 4GFMA 5CQWA 3S1HA 1PXOA 4EH9A 5ICPA 2CKOA 2QKWB 2JITA 3QF9A 2WQBA 4IX3A 3W0PA 1KE7A 5KZIA 4WNPA 3W8QA 5C4KA 3K54A 2R3KA 2WTIA 4EL9A 3SW4A 4EBWA 1ZZ2A 4NM7A 2E9UA 4FZDB 3QYZA 4CLIA 5CU0A 4TPTA 2WGJA 1UNHA 4X2GA 4CZYB 4F9AA 3BBTB 3BQCA 4XUFA 2R7BA 3O7LD 4OT6A 5DIAA 4FV1A 3UO4A 3ZONA 4TY1A 4AGCA 5EDPA 1H26A 5HESA 3L9NA 3U55A 5CQUA 1VLRA 3KN6A 3P08A 5EYDA 4BJJB 3MGYA 4EI4A 4YMJA 2R3OA 4CCBA 1Z5MA 4DTBA 2E9PA 2EB2A 2ETKA 2RG6A 4XX9A 4YHTA 4XEYA 3KEXA 1JKTA 3MY5A 5KMKA 4EH3A 3NS9A 3A7IA 2UW3A 4WG3A 4DGNA 2X8DA 4MBIA 1GIJA 1YOMA 4X0MA 1HCLA 4A7CA 1YXXA 4EZ7A 5HE1A 2UW9A 3P9JA 5CALA 4KKEA 4UZDA 2X4FA 1UU7A 3P79A 2J0IA 2WXVA 4UMUA 4RWLA 1H01A 5IDPA 3ZHPC 3LAUA 3AKKA 1PW2A 3VO3A 2GFSA 3ZU7A 2JIVA 2X6DA 3GQLA 1J1CA 1URCA 5C8MA 3I4BA 4YZMA 4WSYA 3H4JA 3RVGA 4CFWA 4X7QA 4Z16A 5HCXA 3IOPA 3UDBA 1QPJA 3NW5A 4I4FA 4XV1A 3TACA 3DJ5A 1YVJA 3GCQA 1U46A 2GSFA 2BFXA 3AC8A 3BKBA 4OTFA 3ZXZA 4AN2A 4AN3A 4LMNA 2UW4A 3NUSA 1NA7A 4FSMA 3O5AA 4EONA 2GS7A 3DZOA 4O38A 5CENA 5D11A 3MN3A 2J7TA 4KBCA 4WNMA 4JL9A 2GU8A 4DINA 3PFQA 3QZIA 4WHZA 3F88A 4XRJA 2EXCX 5DRBA 3U8WA 4NJ3A 5HORA 3H0ZA 3U9NA 4PL5A 4DGMA 4IVBA 1FMKA 3R9OA 4XG7A 1PMNA 4YJSA 2RFEA 4TYEA 5LMKA 4DF3A 4RMZA 5CWZA 1OIRA 4N0SA 5G1XA 4EK8A 1JSVA 5KCVA 2IVSA 1GZNA 2WFYA 3OWKA 3QU0A 5CI6A 2CGVA 3QQJA 4L44A 2P55A 5AP2A 5EDQA 4I5MA 5FEEA 1DAWA 2GTMA 5CSVA 2QLUA 3DCVA 3KK9A 4EZ3A 4BKYA 2PK9A 3R83A 4K6ZA 3D4QA 4UWCA 2EXMA 5H8GA 3RCDA 5IA3A 3CJFA 5BPYA 2XK4A 3A60A 1S9JA 3HRCA 2WOUA 1Y8YA 3PXKA 4FIIA 4DEDA 3KIOC 4XG6A 3FMMA 5EDRA 1T45A 4EOJA 1Q41A 3DKGA 3W2RA 3BQRA 4E4LA 5IQBA 5M55A 2X9EA 3KRXA 5HICA 1YDRE 3ZRKA 2X9FA 1P14A 5EHOA 2WQEA 2HAKA 4ZY6A 3FLZA 3TXOA 3RZFA 4N57A 1ZOHA 2OXYA 1Q4LA 2VGOA 3NVMB 4WRGA 1GAGA 3AC1A 5IMEA 3ORZA 2GTNA 4DG0E 3DT1A 4ID7A 3OCGA 2OK1A 3AKLA 1PYXA 1H00A 3Q32A 4J97A 3UMXA 3RZBA 2C1AA 4QP3A 3SW7A 3BBWA 4I23A 3ORKA 5DI1A 4EQCA 4ZLOA 2CNQA 2HZIA 3FZOA 4AFEA 4ERKA 3OW3A 2YJSA 4WNOA 3GU7A 3MW1A 3R1YA 5DR2A 4DAWA 4WIHA 2Y6OA 5JRSA 1P4FA 4A06A 5IH5A 4BCJA 1PF8A 3JR1A 4V0GA 2OKRA 2QOIA 3CR0A 5DLSA 4YR8A 2R3HA 4W4XA 3SRVB 4BZDA 2JDSA 2YIYA 1FGKA 4F7NA 4MXCA 3OCSA 5FLFA 1XQZA 4IAIA 3HV6A 3P23A 2YAKA 3WOWA 3LFQA 3DK3A 3OROA 4YPDA 3N4VA 5M08A 2O64A 3Q96A 2G2IA 5F4NA 1Q8UA 4FG7A 4PDPA 2XNPA 3BGQA 3BELA 3WF5A 2BRBA 4QMZA 5E90A 4HYIA 3LW0A 4JBOA 5A14A 1W7HA 1M2PA 1M7QA 4ACCA 2C3LA 2VTJA 2Y0AA 4FZFB 4ERWA 1IA9A 4IWQA 3POZA 3Q6WA 1WZYA 4EUUA 3QLGA 2PUIA 3RM6A 2VZ6A 3DLSA 3GU8A 3NX8A 5HX6A 3OXIA 2XK9A 4Y72A 3HGKA 3R7OA 3OTUA 2UZEA 4ZP5A 2CNVA 4FR4A 4DCEA 4H36A 1UWHA 2O3PA 4FVQA 4YC6A 3OWJA 3PJ1A 4FTUA 2WU6A 3KMMA 3F5PA 4HVSA 3JUHA 1OZ1A 2FSMX 1H1QA 3UTOA 4CV9A 4N6YA 3LFFA 2CKQA 4CG8A 1H8FA 1XR1A 4IDTA 3NCZA 4B8MA 2BROA 1UVRA 3EQRA 1ZARA 2C5XA 5CX9A 2E9VA 5HLPA 1ZY5A 4X21A 2GS2A 3BV3A 3DKCA 1OUYA 5AAFA 2F4JA 3CS9A 3RAWA 4O7LA 2CLXA 4RVMA 2DQ7X 3A8WA 3SG8A 4QMXA 4F7SA 3F2AA 4ZY4A 3UVPA 3IS5A 2XIKA 1IR3A 3QD4A 3FZ1A 2I40A 4RIXA 3MPMA 4WA9A 4CZUA 4QQTA 2ZFYA 1PRYA 4BGQA 3D5UA 2C1BA 4PUZA 3FMJA 3JVRA 4JDJA 4A9YA 3VN9A 3R30A 4KB8A 4RPVA 2BZIB 4AGWA 4Q2AA 2EU9A 3EN5A 3RJCA 2PMOX 2JKQA 3W0NA 4RX9A 3OD6X 1Q24A 3ALOA 4PTCA 3CQWA 2GPHA 1YXSA 2IZUA 5DG5A 2GNGA 3KL8A 3ZM4A 3VONA 4UZHA 3BGPA 4X3FA 2XAOA 2VWUA 4FT7A 3A99A 2RKUA 5IPJA 5A4EA 5AAGA 2WB8A 3BE2A 2OI4X 3ZXTA 1AGWA 3L9PA 4UXLA 3QYWA 1A06A 2W1GA 3OT8A 1CKIA 1F5QA 2AEGA 3W55A 3GUBA 5KE0A 5EHLA 2JIUA 4L8MA 2YACA 3Q52A 2B9IA 5TE0A 2IW8A 4BZNA 4NYEA 1GNGA 4G3GA 5JZJA 2WMRA 4P4CA 4C58A 1H0VA 4IH8A 5CU6A 4APPA 1H07A 3F9NA 3DTWA 4TWOA 2B53A 3N51A 5HU9A 4QP9A 3WZUA 3TNHA 3VUMA 4DG2E 4DHIB 3E88A 1W82A 1O6YA 2IWIA 3G9LX 4K1BA 2C6TA 2ZJWA 3NW6A 4CT2A 3MFRA 5HNBA 2ESMA 1M52A 2XARA 3ZO2A 3TEIA 4ANQA 1OL5A 3UOKA 5AUUA 4YTHA 2R3RA 4IX6A 4NCTC 4O21A 4QQJA 4ONAA 3SKCA 4QRCA 2QOOA 2W4JA 3SAYA 4FTMA 3VRYA 4XOYA 5AR2A 3OT3A 4KIOA 4DEGA 2WHBA 4FMQA 4JBVA 3Q9XA 4I0RA 3OEZA 3MWUA 2Z7SA 2W4OA 1H24A 4Y83A 4QOXA 5L8JA 3JY9A 3FXXA 3UP2A 4F7JA 1UNLA 5E8YA 4GG7A 3MJ2A 4JDKA 2YFXA 5BVFA 4C02A 1YDTE 4L43A 2P2HA 3C0GA 4LV5A 4YPSA 5GNKA 1WBSA 3RGFA 3TZ9A 4C4JA 4D5HA 3A8XA 3WF6A 2EXEA 5FDXA 5J9ZA 4V0GB 1JKSA 3O8TA 3KGAA 5E8TA 3HMIA 4II5A 3S4QA 4ZTRA 2EB3A 2XYNA 3II5A 5EFQA 5CEIA 3KY2A 3WZJA 3ZSGA 1CSNA 3GGFA 3QQKA 2A4LA 3NRMA 3HRBA 3HKOA 3RTPA 3ZUUA 1OL6A 3AT2A 4BTMA 5IQFA 4FJVA 4YJOA 2XKDA 3QTUA 4BRXA 3OEFX 4XV3A 1SM2A 5GHVA 3LCTA 4I94A 4K2RA 4ZTQA 4L9IA 4U40A 4F99A 4BDEA 3QX4A 2PULA 1G5SA 2YA9A 4LL0A 3LQ5A 4ENYA 1XH7A 2VX3A 3DPKA 4EH2A 2XH5A 3MB7A 2BIKB 5HVKA 4BCQA 4IQ6A 4G6OA 3MS9A 5AP0A 4EC8A 3CKWA 5J87A 3PRFA 1QPDA 1XMLA 4DEIA 5E7RA 3AMBA 3CIKA 3EYGA 1NVSA 4EJ7A 4I4EA 4ZLZA 1PHKA 3EN9A 3Q3BA 2C47A 3RKBA 2W1ZA 3NEWA 5KHWA 4Y46A 1M17A 3KRLA 4W8DA 1OMWA 3DS6A 5BX0A 3E3BX 2C5NA 4CRLA 2QCSA 3LFSA 2QOLA 4NTSA 5GZ8A 5LMBA 3OUNB 3VS6A 2W1CA 5ANIA 1SVGA 3T3VA 4EJNA 2YM6A 3CTQA 4GEOA 4DDGA 3NPCA 5CAQA 4ZEGA 3UPZA 3QZHA 4RQKA 3JVSA 2HW7A 3B2WA 4ZK5A 4D2PA 4F6SA 4GT4A 5M09A 2HELA 5AEPA 3UBDA 5A46A 2PYWA 5GIOE 1Q61A 2XKFA 4WRSA 3SX9A 3KCKA 1M2RA 3ALNA 4BDFA 3UG1A 4QTDA 5LVOA 5AFVA 2PVMA 2XZSA 4FNXA 3IGOA 2EVAA 4FIFA 1REKA 4PTEA 4CKJA 4PX6A 4WBBB 5A6NA 5CYIA 5BV3A 3FY2A 1AQ1A 3QRTA 3UIBA 1VJYA 3VBQA 2UW5A 2JC6A 5FP6A 4F65A 3UOJA 4EZ5A 4CFXA 2KULA 4IX5A 4QTCA 4DITA 3LIJA 5GIPE 4BGGA 1G8SA 1BI8A 2W5AA 3LJ1A 4E20A 4R3CA 3VBTA 3BYUA 1K3AA 2B55A 4OTDA 5J9YA 3BU3A 2H96A 3P4KA 4P5ZA 3VW6A 4BICA 4I6FA 2WTJA 5DH3A 4PMPA 2BKKA 3UNKA 3UO5A 1LUFA 2QLQA 4IHPA 4JNWA 3HA8A 4GK3A 5IQCA 4D5KA 4FKPA 4OTRA 4RG0A 5KX8A 5KMMA 3UDTA 4XH6A 3F5GA 4AX8A 3FKNA 2GHLA 3R7EA 2C0OA 1OPJA 5HLNA 3LJ0A 1XBBA 2YM4A 2WEVA 1K9AA 2UZNA 3TT0A 5BVEA 4BDAA 4QYHA 2F7EE 2CPKE 4FVRA 4YGAA 3FC1X 1SVEA 4D9TA 2NPQA 3OP5A 2PL0A 3KA0A 4LOQA 5DOSA 5E4HA 5KMLA 3BHHA 5IUIA 3VHKA 4NEUA 3AC4A 3PZEA 4YC8A 5E92A 4FTKA 5CZIA 4IWDA 4IAAA 5AUVA 3ZLSA 5KKRC 3EL7A 2R9SA 3IPHA 4HOKA 4EORA 5HVYA 1FPUA 4JXFA 4ASEA 4RWJA 4YLLA 2PMNX 4GT5A 4O0TA 3V6RA 2P0CA 4L3JA 5AM6A 3VVHA 2VWVA 3QUDA 1YHVA 3HP2A 4BBMA 4DFYA 4FT3A 4CLJA 4M67A 4R3RA 2WTWA 2OBJA 4HZRA 4M15A 4BL1A 4M12A 4O6EA 4UB7A 4USDA 4C61A 1XKKA 3BCEA 4FT9A 5HTCA 3AG9A 5I4NA 5LCJA 2Z02A 4EH7A 3KCFA 4L45A 1G3NA 3Q4ZA 4FSZA 3AD4A 4DEEA 4AT3A 5HTIA 3BE9A 3MBLA 4MXYA 2PWLA 1F3MC 1WBOA 3NUUA 3SXRA 2WTKC 1GY3A 4LOPA 3GFWA 5BVWA 3ERKA 3RK9A 4QO9A 4ZXTA 4Y5QA 4AF3A 3NYOA 2C3IB 3A7JA 2ETMA 1UA2A 4JRNA 1SYKA 4JIKA 3N4TA 3DV3A 2X1NA 3LFAA 4G16A 4CT1A 4DEHA 1JSTA 3PP1A 4FSWA 4X6RA 3RNIA 4RX5A 3HNGA 1UNGA 3FQSA 2ZB1A 3QFVA 2WPAA 5AR4A 3VBYA 4F4PA 5EW8A 3ORTA 4UMPA 2AC5A 1UV5A 3LLAA 2QHMA 4ZSAA 3I60A 4D2VA 3F7ZA 4YJVA 1XO2B 2IZSA 2XANA 4BGHA 5DA3A 4IADA 3GI3A 4PDOA 2QO2A 2VWBA 2OFVA 4IE9A 3A4PA 4GSBA 4CTCA 4UALA 1SNXA 3PVGA 5AP1A 4O81A 5CASA 2FA2A 3FLYA 4CNHA 3EB0A 5A9UA 2H6DA 5HG5A 4BR3A 5AUYA 1FVVA 2PZYA 2XA4A 3P5KA 4YBJA 4DFUA 2XIRA 4FKVA 4EQUA 1JNKA 3DK7A 4R1VA 3D5XA 2P3GX 4LOOA 5JSMA 3FL5A 2X4ZA 3DK6A 4C2WA 4FTOA 4YTIA 3PJCA 4TRLA 5BNJA 2GQSA 2YCSA 3ENHA 3IQ7A 4CEGA 4MTAA 2YM3A 3FLSA 2NP8A 3FEGA 4TYJA 2VX0A 3D7ZA 3H0YA 2FSLX 2VU3A 4EHGA 3QQHA 4Z9LA 3VF9A 2W05A 5TO8A 1UWJA 4E73A 4H3QA 4F9BA 5BVKA 5BUIA 3LHJA 5HBJA 1RJBA 4XJ0A 5FEQA 5HG9A 4FGRA 2AUHA 4YZNA 4F6WA 3AT4A 4HVHA 4PP7A 3PSCA 3PG1A 2Q83A 3OBGA 2XKEA 2ONLC 1NT2A 3O51A 4FTJA 3FI2A 4X3JA 4PY1A 4J96A 2QURA 5FWKK 3UIUA 1YQJA 4CD0A 3DB6A 4QYGA 5KMNA 5M07A 5BMMA 4BJJA 5DEYA 5LOHA 3TZ8A 1Q3DA 3E93A 4RLLA 4CZTA 3Q60A 3C5IA 4X2JA 3ZLXA 2WTVA 4LI5A 2YWVA 2QO7A 5HIBA 3BL9A 4IEBA 2QC6A 4G31A 5CU2A 1PMUA 4MXXA 4NJDA 4PP9A 3W33A 2VO3A 4GG5A 4ASXA 4Q9ZA 5K0XA 2GHMA 3U54A 4OLIA 4X2NA 5IH4A 4BIBA 2PUUA 2OZAB 3E62A 4WT6A 4G1WA 1NXKA 3EQCA 4IAZA 3I5NA 4D0WA 5JQ5A 1Q8ZA 4NT4A 4KWPA 1OL2A 5EM5A 3VS3A 3OXTA 1T46A 4C38A 2WO6A 1FMOE 3OG7A 4EHZA 4Q5HA 2PVRA 3I0OA 4JQ7A 3G6GA 2OLCA 3EKNA 3KU2A 3PXRA 1FOTA 1ZOGA 4MXOA 3D9VA 3BV2A 2XBJA 3FQHA 3D94A 3E8CA 1ST0A 2BUJA 3GC0A 3QBNA 4O91A 4OBPA 2V5QA 4ZTNA 4F63A 4G3EA 2WU7A 3S00A 3DFAA 4UV0A 4AXDA 2W4KA 4BYIA 3QGWA 5M44A 4NWMA 2HXQA 5CSWA 3ULIA 4IWOA 3MH3A 5B2MA 2HOGA 1VR2A 2WNTA 3QWJA 4JBQA 5HBEA 3W0SA 4FTIA 4L7SA 4YLKA 5IZFA 2R4BA 4BKJA 3TZ7A 3AC5A 4U8ZA 3WYXA 5C03A 1PKDA 3R9NA 5EQYA 3R1NA 4MF0A 4EH8A 2UZTA 3BHTA 3IDBA 3H9OA 3R71A 4YZBA 4HGTA 4BB4A 4Y95A 5CEQA 3SGCA 4TNBA 4I21A 1TQMA 3CJGA 3KMUA 2EWAA 4CFNA 5LWNA 3TDVA 4E8AA 2ZV8A 5EH0A 3MY1A 5AP3A 4R77A 4C57A 3HX4A 4FKOA 2XP2A 4BCKA 3JS2A 3MFSA 1H4LA 3F7WA 2XRWA 4F9CA 4CSVA 3NCGA 4PNIA 5EKOA 3ZDIA 4F9WA 1XH5A 4XCUA 3E63A 3BHUA 3QUPA 5L2TA 4FZ7A 4JJRA 2XBAA 2JAVA 2R7IA 2XEYA 3ET7A 4MBLA 4W4VA 4XG4A 3R9DA 3ZOSA 2RFDA 3EN4A 4BIEA 3SQQA 4NM5A 3QTQA 2WELA 3P0MA 3PWDA 5DE2A 4AT5A 1CMKE 3VHEA 2XNEA 1OIYA 3ZSIA 1HCKA 3NFGB 3UODA 3V5LA 5CAOA 4E4XA 3BWFA 5H8EA 2IZTA 2GFCA 3DZQA 2BPMA 3PG3A 3IW4A 4OGRA 5ANGA 4UN0C 4FKQA 4W8EA 2A1AB 3NYVA 4BCHA 4F0GA 2HZ0A 2OJJA 3SA0A 2UW6A 4EOQA 5ANDA 3R9RA 2PY3A 4YP8A 3UOHA 4KIKB 4B4LA 2XNNA 4O4DA 4V05A 3W2CA 3MVMA 3R6XA 5HG8A 3WF8A 4IWPA 3IG7A 3ULZA 5JRQA 3ZRLA 3ZTXA 4H05A 3PY0A 3KXMA 2X2LA 2DS1A 4O96A 5CAUA 4M14A 5AMNA 5FUTA 2VRXA 2VTOA 3FMHA 4C7TA 1TQPA 5BVOA 3SRVA 3GT8A 4K11A 5AX3A 3R28A 3EQIA 4YJRA 4DT9A 5IH6A 2XYUA 4ZTSA 4EUTA 3LXLA 4ASZA 3IDPA 4ZTHA 2PUPA 5H8BA 3QX2A 3TKHA 3FSKA 4Y8DA 4YNEA 1JQHA 3F5UA 4IB3A 4I24A 5HE3A 4AW0A 4YUQA 3R73A 3EIDA 4FIEA 4FKLA 4YLJA 2PVJA 3B8QA 4AWIA 2W17A 4OTQA 3CC6A 4LV8A 3TCPA 3TZMA 4J52A 3QALE 2B4SB 3CPCA 5CSHA 3TDWA 3WIGA 3IONA 3LCKA 4FIGA 4PNKA 4CGAA 2VV9A 3C5UA 3QTRA 4HGLA 4BF2A 4UX9A 4QPMA 2BR1A 4OTGA 5CNNA 2VTHA 5JFSA 3VS1A 3QD0A 4U3ZA 4YZ9A 3DQXA 5AADA 1OM1A 3PUPA 3PYYA 5IDNA 4IJPA 3FPMA 3SOCA 4FV8A 3UC4A 4L52A 2OXXA 2WMWA 2UZUE 2XM9A 3O0GA 4FG8A 4IAYA 3W32A 4F78A 5CXHA 1W2FA 5FBNC 4QP2A 3RPYA 2YDKA 5CAPA 1PXNA 3BX5A 3PWYA 4JX3A 5EW9A 4FX3A 3W18A 3FMNA 3VBVA 4IX4A 4HZSA 5J1VA 4PMTA 3ZSHA 4DT8A 2W06A 2BALA 5EW3A 3MFUA 4HNFA 1Y57A 1HOWA 3PE2A 4QYEA 3FWQA 4GUEA 3F3TA 4IW0A 4RVTA 5CSXA 4AZFA 5ETAA 2UZWE 1ZYCA 3FUPA 1CTPE 2JDOA 5EG3A 3L8XA 3TKIA 4AOIA 2XNGA 4KSPA 5CEPA 5EM8A 5CXZA 4GVJA 3BU6A 5AUXA 2ZDUA 2Z60A 3LCOA 3ZC6A 4MWIA 4QP8A 4L53A 2Y8OA 1R1WA 3HMMA 3UQGA 1K2PA 5J8IA 3ODYX 4YJNA 4DBNA 5IA2A 3GU5A 3WYYA 2W1FA 3A4OX 4FTAA 3UNJA 2B54A 2ZV2A 2JBPA 4KKGA 4HCTA 3W16A 3ZO1A 3LXNA 4DFBA 2JKKA 1APME 3MVJA 4L01A 3U87A 4V04A 3ZLWA 4GVAA 4D4YA 5JQ8A 4BYJA 1Y6AA 4AGUA 1Q8YA 4FRFA 4FTRA 2UZVA 4F08A 3U6HA 4LUEA 2ITOA 3EZRA 4DH1A 1OIUA 4YU2A 2HXLA 2C3JA 2V22A 2ITPA 3DBQA 3RWQA 3NUXA 4FVPA 4AU8A 3EQPA 4YHJA 3DNDA 4FEXA 2B9HA 4AQCA 4MNEA 4O0SA 1J91A 1RW8A 4PTGA 4TKSA 4FKGA 5DPVA 3WARA 1X8BA 5JFXA 4CKRA 1YWVA 4WNKA 3CD8A 4I1ZA 3TUCA 3BRBA 3LFCA 2V0DA 2JD5A 3FMEA 3QXOA 4TW9A 4FE2A 3KF4A 5EKNA 2NRUA 3UQFA 3FMKA 4ANNA 4K8AA 2CDZA 2PHKA 1ATPE 5HO7A 3AKJA 3BEAA 2YIRA 3KK8A 4FL1A 4TTHB 3F66A 1LEWA 4FZAB 1H1SA 4P2KA 3UVQA 4E6CA 4TN6A 4PPAA 3O8UA 3FLQA 3CXWA 5KBQA 3FHRA 1W98A 2NRYA 3BYMA 3NZ0A 4A4OA 5FD2A 2VWXA 4FYOA 3KXZA 4AP7A 4R7BA 5CU3A 4BZOA 4X2KA 4BCNA 2ZOQA 4LRJA 4C33A 5IU2A 3R7GA 4HYUA 3GCVA 4FKUA 4BCMA 2RFNA 1YWRA 4A9TA 1O6LA 4EH5A 4EOMA 3IO7A 2R3PA 3HEGA 3WE8A 1JPAA 4R6VA 3VAPA 4UMRA 1PJKA 3TI1A 2CSNA 3IK3A 3RBWA 4BDJA 1Q99A 2VNWA 3G6HA 4W9XA 2XKCA 2ZM4A 3HMNA 4O0YA 4C4HA 5BYYA 2NO3A 4AT4A 1MRVA 1WVWA 4TYIA 2QD9A 1JSUA 1IEPA 4BDHA 1A48A 4GCJA 4QMSA 2QG7A 5E9EA 2YEXA 3Q4CA 1YWNA 3COKA 4E6DA 3U4WA 1WFCA 4PL3A 1WBNA 1M14A 2W96B 3RK7A 4RBLA 3OWLA 3VJNA 3A62A 2C68A 2PU8A 2BAKA 3JY0A 4O0XA 2J0MB 3A7GA 3CP9A 4AE6A 3M2WA 5IA0A 4O0UA 5ETFA 4C34A 2CKEA 3PXFA 4YNOA 4NKSA 4E5BA 4QD6A 4NSTA 3P1AA 1OKVA 5IQIA 5IQHA 2FVDA 4XLIA 5K0KA 4FI1A 3UDZA 4HGEA 2XM8A 2VO7A 3PTGA 2O0UA 4ZIMA 1WCCA 1XJDA 4G34A 3GB2A 5FP5A 2J0JA 4WG5A 1U5QA 3OTVA 4E5WA 4NKAA 4KSQA 2GNFA 1ZWSA 4U43A 1PXPA 3OCBA 5L3AA 2O5KA 3LFDA 3PA3A 4U44A 5ANJA 5LMKC 3WBLA 2ETRA 3PLSA 4TWPA 3VS5A 4RT7A 4EYJA 5JT2A 3DXQA 1XH4A 3FY0A 3FDNA 4ZJIA 1MRUA 3FMDA 3ML1A 3KN5A 3CTHA 1XBCA 1Y6BA 1JKLA 2Z2WA 5H3QA 2X7FA 2R3QA 2C5VA 3OY1A 3W2QA 1BLXA 4B8LA 2VTMA 4FK6A 1R39A 4I20A 4K33A 4DGGA 4G17A 4CV8A 1KWPA 4RJ7A 3HZTA 3C50A 3NUAA 2QR8A 1ND4A 4DA5A 2PZRA 4HJOA 4NW6A 3QRJA 5E91A 5AUZA 3GC9A 3F61A 4HPTE 4JG8A 2CHLA 5FBOA 4IVDA 3ZYAA 3RWPA 3RK5A 2G1TA 4QMVA 3UYTA 4LL5A 4RIWA 1YXUA 4EOKA 5LVPA 5GINE