4RRVA

Crystal structure of pdk1 in complex with atp and piftide
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
284
structure length
283
Chain Sequence
KKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title A small-molecule mimic of a peptide docking motif inhibits the protein kinase PDK1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 283
sequence length 284
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4rrvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4rrvA01
3BLHA 3DJ6A 1ATPE 4JIKA 5DG5A 3ZRLA 5CF6A 4IM3A 5CEIA 4D5HA 5JQ5A 4HPUE 3UOKA 3ODZX 1GZOA 5GJGA 3WYYA 4DTAA 1FPUA 4CVAA 4LL0A 4QTDA 2O64A 2CLXA 4K6ZA 1U46A 4KSPA 2UZBA 3AOXA 1H07A 3DFCB 3HRCA 1JWHA 2GFSA 3OY1A 3I79A 2UZVA 1H08A 3M42A 3QWKA 5HVKA 1MRVA 3MIYA 3BLRA 5H9BA 4O7YA 3FUPA 2PMOX 2VTNA 4HGLA 5DA3A 1KUTA 4R78A 2UZLA 2WZJA 5AADA 1Y57A 3TZ7A 1B6CB 5CENA 3TEIA 4DEIA 4G9RA 3FLSA 4K11A 4XOYA 3B2WA 3C50A 4EH4A 5A6NA 5LQFA 1P4FA 3R8ZA 3ZO1A 5IDNA 1H0VA 3Q52A 3F7WA 4BTKA 4F70A 3TJCA 3VJNA 2C6IA 3GT8A 3E5AA 3DTWA 4ZTMA 2WMUA 5AA8A 3PIXA 3AD6A 2R5TA 5HOAA 5TF9A 3NPCA 4OGRA 4WG3A 5CZHA 4ZEGA 4BKJA 4C4JA 3R9NA 4BHZA 3OBJA 4TNBA 4EONA 3E64A 3VULA 5CSHA 2VTMA 5EYCA 5FEDA 2CKOA 4BI1A 2GNJA 3EZVA 3L9MA 4U7ZA 3RPRA 5IQAA 3LXNA 4XG3A 2DS1A 3LFDA 5HBEA 1PKDA 4E7WA 1UU3A 4CYJA 3I7BA 3FC2A 5C8MA 3OOGA 5HKMA 2R0IA 4ZTRA 1KSWA 4LRKA 3HEGA 1A48A 3IK3A 2XP2A 3A7HA 2GQGA 2HWPA 4FTIA 5GHVA 4C61A 4F1TA 3MV5A 3JUHA 4D58A 4FTLA 2C6KA 1UWJA 2GDOA 3HV3A 5DE2A 4F0IA 4RIWA 4BC6A 4MAOA 1CKPA 4O96A 5EKOA 3V51A 5L2TA 4RC2A 2F49A 4XLIA 4EORA 3GI3A 4IAFA 2ZB1A 4C0TA 5ICPA 5IEXA 2VZ6A 4QP6A 3UJGA 2OFVA 4MYGA 1YW2A 1L3RE 2XK6A 3KGAA 4IB3A 2HWOA 5M08A 3FPMA 1Q24A 3QTQA 3KREA 5IA3A 4L46A 3WARA 1ZWSA 1BI8A 5BPYA 4FL2A 4AF3A 1OPKA 2E9PA 4JBVA 5HICA 5EHLA 5KMKA 3AC3A 4DCEA 1S9IA 4M97A 1YVJA 4X0MA 5HX8A 1UNLA 5ANEA 2VX0A 4P5ZA 5AV1A 4CKRA 1ZY4A 4DT9A 3E63A 2DWBA 1OIRA 3I60A 1GZNA 5DGZA 5M4IA 3NNWA 3I0QA 3NNVA 3W2PA 2XM9A 2YJRA 3ERKA 4M7IA 3OCBA 5IH5A 4IXPA 1H1WA 5HNGA 5AM6A 4TY1A 2VU3A 4KRDA 4RFYA 4HNIA 3CLYA 1OL6A 2H9VA 3HMPA 5TO8A 1J7LA 1IR3A 4BCPA 4DLJA 4QMSA 3HAVA 4ZSJA 4OBPA 3RGFA 2BDWA 1OI9A 3PY3A 4TWPA 3HP5A 1I44A 4PMTA 5M09A 3QTIA 4N6ZA 3A4PA 3BZ3A 3G0EA 1JKKA 4HCUA 2GTNA 4G6NA 3ZUVA 3DNEA 3EN9A 2JEDA 4JJRA 5DH3A 1FVVA 4TYJA 4EH7A 4C33A 4ANQA 4CXAA 1CKJA 2YN8A 3CQUA 1BI7A 5FDXA 3QQKA 5IQGA 3RPOA 2R7BA 3W2QA 2BAKA 1ZOHA 2A19B 5AV3A 5IUIA 3VBVA 3ZTXA 4AOIA 4D1ZA 3NNXA 4UZHA 3R83A 3TNHA 4AT5A 1NA7A 2XVDA 4DH3A 4TL0A 3RM7A 4AQCA 4FTUA 3W18A 1R78A 5M07A 2VTHA 3QU0A 3R02A 5IDPA 4ACDA 3LKMA 4ZAUA 4EOOA 4ASXA 1Q61A 2QVSE 2OIBA 3DZOA 5BUEA 3ZFYA 3GP0A 5JFVA 2GNGA 4FYNA 2J2IB 2WPAA 2E9VA 2JKMA 4UXQA 4ZSEA 4JI9A 3MFTA 4O2ZA 2OFUA 2YACA 3R01A 4D4SA 3DT1A 2PVMA 4EH3A 3BGQA 4IZAA 3L8VA 3PZHA 3QYZA 4Z9LA 5DYJA 4YTIA 2ESMA 5F4NA 3E3BX 4FV8A 2OXYA 2RFNA 2Z02A 2YABA 2X7OA 4FSWA 3O7LD 5EYDA 3QTUA 3Q53A 3SX9A 2XCHA 1QMZA 3S95A 4B8MA 3CY2A 3U9NA 1ZAOA 2PVHA 2C0TA 4HYHA 3PSBA 4AUAA 4FK6A 5BNJA 4D2PA 1Q8ZA 3NAXA 4I4EA 4AGUA 3VUGA 5AP7A 4OT5A 3WF8A 3G9NA 1OITA 5CVHA 3NS9A 4M0YA 5EW3A 5BYZA 5CI7A 3NWWA 4RIYA 2XF0A 2UZEA 1GJOA 3V5LA 2AYPA 2PVNA 4WA9A 3UQCA 4I94A 4O7SA 1ZLTA 3DKOA 3EQIA 1O6LA 4BY9E 2ITZA 4C7TA 2YA9A 2VWXA 3PSDA 4FV9A 5D10A 3KRLA 5E8VA 3K5UA 4E6DA 2OF4A 5EYMA 3AGMA 3F3ZA 2C5YA 1TKIA 3TV4A 2ZMCA 4PPBA 3NYNA 2IPXA 3SDJA 4LV5A 4AT3A 5CNOA 4QP2A 2UW9A 4FV0A 1UWHA 1V0BA 4PX6A 3DDPA 3R9RA 2F2CB 4JIAA 2W7XA 4GT3A 4RFMA 1BUHA 3KRJA 2BKZA 2G2HA 2W99B 3L9LA 3QHRA 3OT3A 4FT5A 4P90A 4J98A 3WBLA 1Q99A 5AUUA 4EEVA 4JQ8A 4GYIA 2ZB0A 3DK7A 4HGSA 2XJ1A 5KHXA 1IEPA 2HZIA 2OO8X 4JG8A 1G8AA 3QKMA 3L8SA 4AZVA 3L9NA 4Q5EA 2X1NA 3EYHA 3HRBA 5HIDA 3LFNA 4EBVA 4YC3A 2PZYA 3VS5A 4E20A 4FG7A 5HD4A 3GXLA 3OC1A 5I9VA 5EI6A 3HZTA 5CI6A 4XCUA 2ITUA 2YISA 3CGFA 4NCTC 4QYGA 5IEVA 2YIRA 4E4NA 4W4VA 3TNQB 3Q4UA 4AA4A 3L1SA 4YO4A 3BHVA 3BI6A 2YIQA 3SXSA 4FG9A 4X6RA 3FMLA 3RCJA 3UMWA 3H9OA 2XIXA 3R8MA 5GZAA 4N0SA 3AT3A 4XOZA 3PVBA 1MRYA 2PU8A 4UZDA 2YM6A 3OTUA 3QA0A 5CEPA 5KHWA 4QMUA 4AW5A 2QD9A 4PF4A 3G9LX 5EDRA 2HIWA 3WE4A 5IA0A 1DAYA 3LJ2A 2CKEA 4LUEA 4RG0A 3GOPA 5BVDA 5CAOA 3FMHA 4UXLA 3QCXA 4C4IA 3RVGA 1MRUA 2NPQA 3UO4A 4ACGA 5KBRA 4B8LA 4FSMA 3UOHA 4KSQA 1YI4A 2HY81 3OHTA 5I9ZA 3CS9A 1B39A 1OIQA 3GENA 5AV2A 4BGHA 2C30A 4E4XA 3VBYA 2PUUA 5AP5A 4RC3A 4C38A 1M2QA 4FNXA 2ZV8A 4FOCA 3NZ0A 3K3IA 3RALA 3MB7A 2QOLA 4N6YA 5G1XA 4H05A 5FM2A 5AAGA 5L2SA 3PPZA 4HZRA 2UUEA 5AUTA 4F9AA 3WF9A 3FY0A 4FUXA 3GCQA 2HW6A 3KL8A 3MH1A 3VS0A 1PXNA 2WELA 3R28A 5M53A 3BHYA 2OG8A 5ANDA 3NRMA 4QMPA 4WRGA 4I20A 4R77A 2BAQA 4AOTA 4IMYA 4BFMA 2OLCA 2XK4A 3BYSA 4BICA 1JKSA 5FDPA 4JAJA 4QP9A 3EQCA 3QZIA 3QCSA 1PXKA 2ITYA 3FAAA 1YXUA 4F7JA 2QC6A 3ORTA 1I09A 5AJQA 2Z7QA 5B2MA 3DBEA 2GQSA 4E26A 4YLKA 4DEGA 1O6KA 3P23A 4ITJA 4X3FA 1ND4A 3GQIA 4BB4A 1YOMA 5I9UA 4ID7A 3F5PA 3RMFA 4HGEA 3JVRA 3F5XA 5HCXA 3P7BA 4FSRA 4PPCA 3UVRA 4A4XA 4E5WA 1JSTA 3C4FA 4E6AA 3B8RA 4OTFA 4DGLC 3OFMA 3R7EA 4AZSA 2Y9QA 4WD5A 4NIFA 5FXSA 3EN7A 5M57A 2BRHA 3FI3A 4MCVA 3FWQA 5B0XA 3LIJA 5CY3A 3REPA 2BVAA 3QFVA 3QRIA 5CNNA 3U8WA 4EKLA 5JFWA 5IQCA 3TKUA 2EXCX 3EQPA 4H36A 3C0HA 2XNGA 3BE9A 3FQSA 4QTEA 3CR0A 4YHFA 4C02A 3SG8A 3QLGA 2OZOA 5EQPA 3F66A 2IVUA 3E88A 4O86A 2W1EA 4NCTA 5E9EA 4JBOA 5JRSA 5TE0A 5EI8A 2C6DA 4X2JA 4Z16A 4XV1A 5D9HA 4YJUA 5EYKA 4BTFA 4F1MA 4KBAA 5CS6A 3UP2A 3ORKA 5C27A 2GHMA 3IG7A 5CWZA 4F0FA 3E8CA 4EHVA 1L8TA 2BZHB 4G3FA 4A07A 2OK1A 2RFSA 4GMYA 3G90X 4FTOA 4GJ3A 4OBOA 4L00A 2YHVA 2YAKA 3BYMA 4O0TA 2XJ2A 2IZUA 4FF8A 3DOGA 4I21A 4RIXB 3VQHA 3GU4A 5DI1A 4FICA 3V8SA 4UBAA 5HCZA 1UV5A 4P4CA 4PDYA 1ZYSA 3FYJX 5HG5A 1YXXA 4FL1A 3CJFA 4K0YA 3TNIA 3UVQA 4Y8DA 1ZYCA 3PJ3A 3FJQE 2WAJA 4R1VA 5E92A 3Q5ZA 5EHOA 1A06A 4RIWB 3U6JA 4Z7HA 5HBJA 2OZAB 3F82A 1YDSE 2WIHA 4LRMA 2HK5A 4Y5QA 4DEBA 2GQRA 2QG5A 5DWRA 4BIBA 2XK7A 5KMLA 3FMNA 2VTJA 2HXLA 3DS6A 3C4WA 3FZTA 4XV2A 2V7OA 3QAME 3BGZA 4BL1A 4JS8A 3NYXA 3R7VA 3W2SA 4OUCA 4WUNA 3CP9A 3SRVA 3ZONA 1K2PA 4C3RA 4J52A 3SC1A 1WVXA 2I40A 2WD1A 3EQHA 4LUDA 2OW3A 3UC4A 3QWJA 3ZSGA 2QOQA 1YRPA 4G17A 4P2KA 4R8QA 3TUDA 5J1WA 2WXVA 5JN2A 4WG4A 1YXSA 3FL4A 1NVSA 2G2FA 1ZARA 4IQ6A 4FGBA 1CM8A 3R6XA 3D7ZA 1BL6A 4XH6A 5H8BA 5HD7A 5ITAA 4U3YA 1O9UA 5GIPE 3HLLA 5IA4A 4D2SA 3CKXA 4FZFB 2W0JA 3TACA 1OPJA 3PFQA 3S1HA 5IH6A 5KO1A 3IOPA 4H1JA 2ACXA 3FLWA 3IPHA 3V5TA 3EJ1A 3D94A 4ONAA 3CD3A 4GEOA 1E9HA 4I5MA 4OTPA 2FSMX 3QA8A 2J0KA 3CE3A 3R04A 4PL4A 4ACCA 1YDRE 4F6SA 1NT2A 3R2BA 4Q9SA 2FYSA 4QMXA 4IWPA 3LMHA 5JGAA 2J5FA 4YPSA 5BUJA 5KMMA 4FE2A 2ZM1A 4G1WA 2Z7LA 2R3JA 3ZHPC 5I9WA 2PE1A 3RAKA 3COKA 4BDHA 3HV5A 5IISA 2Z8CA 4XRLA 2CJMA 2YIWA 3OXIA 3C1XA 3HECA 3MESA 4L43A 3TM0A 2IVTA 3KK9A 4G3DA 4JQ7A 4F7SA 3OVVA 2PUNA 4CD0A 3R8LA 2XK8A 2PK9A 2YFXA 4R7HA 5A3XA 4N4SA 3OTVA 5C4LA 3FXZA 2PZIA 3EFJA 3OWLA 3PZEA 2YZLA 3O8PA 4E93A 4NWMA 4OTRA 4ZP5A 4AXAA 2PY3A 4RSSA 4RJ4A 4OTIA 1FGKA 2Y7JA 2WTIA 3EKKA 4D4YA 4HGTA 3EN4A 2P55A 3FEGA 1P2AA 5CEOA 4K18A 3E3PA 2C3LA 4BIEA 2XS0A 3LE6A 4I0SA 3LM0A 4J71A 3B2TA 1GZKA 4W4XA 2XIKA 4QYEA 1YQJA 2IW6A 4M3QA 2VTAA 3MH0A 4X21A 5CEMA 3ZZEA 1J7IA 1KV2A 2UZUE 3NAYA 3D9VA 2P4IA 4WBOA 2GMXA 3R63A 4PMMA 2WOUA 4S34A 5FXRA 4EUTA 2VWZA 4QMTA 2YCRA 2HZ4A 4D9TA 4FEXA 3C13A 3H3CA 1JBPE 3IO7A 5CEQA 5IMXA 5LVOA 2R3KA 1OM1A 5GINE 2CGVA 3IW6A 4H39A 4NSTA 3UG2A 5IQBA 3DAKA 3R71A 4IM0A 5DLSA 4MF0A 2PMNX 3HMNA 3IKAA 4U44A 3QD0A 4FT0A 4YHTA 5F9EA 4W9WA 4JRVA 3RPSA 3WOWA 2J0MB 4M14A 4II5A 1WZYA 1P14A 4MXCA 5HO6A 2IG7A 3HKOA 3V01A 3ZDIA 3ZLSA 2QLUA 3VBWA 4CCUA 4FEUA 4WNPA 4GCJA 4XP3A 5IKWA 2WEIA 2X9EA 3KVWA 4V01A 1KE8A 4JL9A 3TKIA 3IQ7A 3HV6A 4ZLOA 3UQFA 1ZOEA 3OP5A 3CC6A 3QTRA 4X2NA 5AUZA 5KMOA 1VYZA 2DQ7X 4M15A 4FT7A 4OTQA 4GRBA 3UP7A 2G15A 3FQEA 3UIXA 3C51A 4AN2A 4BN1A 4UWBA 4B0GA 4KS8A 4DEAA 4KKHA 4OAVB 2C1BA 5J9ZA 3BE2A 2WTVA 2Y4IB 2FO0A 4UALA 4NT4A 1YHSA 3DY7A 4RZWA 1PXJA 2B54A 3PWDA 4FNZA 2X8IA 3GNIB 4F0GA 3RHXA 4L01A 4BYIA 2B1PA 2WFYA 4A7CA 4EC8A 2EB3A 5CXZA 4NKSA 5BYLA 5AAFA 3EYGA 2FA2A 2V0DA 2VRXA 3ORPA 3RNYA 4YURA 3P1AA 1ZXEA 4CTCA 3E92A 4GJ2A 3SAYA 4HZSA 4ITIA 4BZOA 3DAEA 3AC2A 3TNPC 4HVSA 2VWYA 4GU9A 4IJPA 2IVVA 5JT2A 4BBMA 3UE4A 5CAUA 4KB8A 3QXPA 3D15A 3MH2A 2W1GA 2QOCA 5LMKC 2PSQA 3V5WA 3WZDA 5HE0A 2GNIA 4IZ7A 4I0TA 4LG4A 3ZXZA 2PVKA 4FI1A 4JBPA 3JY0A 2ZOQA 4QT1A 3BELA 3COMA 5EI2A 3JY9A 3NUSA 4FKWA 4WHZA 5KZIA 4IZYA 3UO5A 3OZ6A 5L4QA 2JDOA 4FKSA 4OBQA 4AZWA 2XH5A 3N4UA 1U5QA 3ZOSA 3PXZA 4A9UA 2CNQA 3ORZA 4NM0A 3K54A 4G5PA 3TG1A 5ANOA 4I6FA 4GV1A 4D1XA 3NUUA 1J1CA 1PMEA 1UA2A 2CLQA 3PA4A 4OTDA 1YHVA 1MP8A 4U43A 2CNUA 3O0GA 1UKIA 4QTCA 3KVXA 5JRQA 3MA6A 4FSUA 4MBIA 4WSQA 5E8TA 3GC0A 5AA9A 1YI3A 3PE1A 3SXFA 3KXXA 3ZLWA 5CAPA 5IF1A 2IZTA 1WBSA 4QQTA 4O82A 4GUEA 5AP1A 3MPMA 5FP5A 3E7OA 4IAAA 2E9UA 5HG7A 2C69A 5AFVA 3RM6A 2C4GA 2YM4A 1U4DA 2WMAA 5D7VA 5ACBC 4JLCA 4AX8A 3C7QA 3ZS5A 2Y0AA 2F7ZE 4WO5A 2UW4A 2WMBA 4LYNA 4DCAA 1AQ1A 4I23A 5AUWA 4CFNA 3A8XA 1J7UA 3FSKA 4D28A 5A4LA 2EVAA 1H8FA 1G8SA 3PIZA 5E8UA 3O96A 1ZRZA 1W98A 2PZPA 2RIOA 3BX5A 4AE6A 2OKRA 2YCFA 5ETCA 4ERWA 3O71A 3PJ2A 5IZFA 5LVNA 3PRIA 3VS6A 3KRRA 4NYEA 4O0VA 2E9NA 5GIOE 4K77A 1WBTA 1WBNA 3LJ0A 4PQNA 3A2CA 4U42A 3T9IA 4FYOA 4QPAA 4AZFA 2XCKA 4YBJA 1CSNA 2BZIB 4MD9E 2RG6A 4AOJA 3RWPA 4RIOA 1KE5A 4DFZE 2Y8OA 3AGLA 4X3FB 3IW5A 2R3IA 1CKIA 2VTSA 3W8LA 3C5IA 1H27A 2WMXA 4AW2A 1IRKA 3F3VA 3WF7A 4LGGA 4EOMA 4F64A 1Z9XA 1ZMWA 3NGAA 5HU3A 3BRBA 2WTCA 2JBOA 3N9XA 4C58A 4NH1A 4D2RA 3ZSIA 3MGYA 3ORIA 2QQ7A 5FGKA 1XR1A 3UC3A 3VIDA 4QQCA 1IG1A 3GC7A 2PMIA 5LCKA 3GU8A 4NJDA 4EBWA 3RPYA 4B4LA 4L44A 3V8WA 2VTPA 3AC4A 3VF8A 3FQHA 4KKEA 2A0CX 3VHEA 5HEZA 2GU8A 4CMOA 5H3QA 2OJIA 4M67A 3S2PA 4QP7A 4U6RA 4YUQA 2XK9A 3QTXA 1QPJA 4O38A 2OI4X 4CMUA 5LMKA 3Q96A 5E8WA 3Q6UA 3V8TA 3HA6A 3OWKA 3FSFA 5L6PA 4OAUC 4K1BA 4MXXA 2WTWA 4QTAA 5CU3A 3R8PA 4CKIA 4KUJA 1DAWA 2BZJA 3L8PA 4EWQA 2EXEA 2FSLX 3FZPA 4L6QA 4NIFB 5CQWA 5TR6A 4F6WA 5AAEA 2B53A 4NW6A 3ANQA 4X2KA 1DM2A 2W4OA 4FTTA 5CAQA 5LWMA 3O8TA 4D0XA 2C6MA 4FNWA 2F7EE 2BRGA 4YZMA 2JLDA 5IUGA 4A4OA 4RC4A 4GUBA 4FKRA 1FVTA 2R3FA 5I9XA 4RX7A 4WOVA 2BILB 5ETAA 5GNKA 4RIXA 4O0XA 1WFCA 3NCZA 2UZDA 5DIAA 3H0ZA 4BBFA 4F9YA 4UYNA 2ZV7A 1JVPP 2JFMA 3CTHA 2H8HA 4C35A 5B2KA 4DGOA 3F3TA 4GU6A 3AC8A 2Q0NA 3F61A 3ORLA 4O81A 2VTOA 2YCSA 5A54A 2OZAA 4U8ZA 2F7XE 4QYYA 3UO6A 4BR3A 2Y6MA 3VC4A 3BLQA 4JG7A 1YOJA 3POZA 2OH0E 3D14A 3SRVB 2NRYA 3S4QA 2F2UA 2VN9A 4M68A 1UU9A 2ITWA 4MNEB 3EFLA 4BF2A 4L7FA 3IW7A 4J95A 2UW0A 4IZ5A 3C4XA 5CXHA 2HW7A 3BKBA 2C1AA 1OBDA 2GNFA 4FNYA 3SGCA 4I24A 5FEQA 5AP2A 1K3AA 2ERKA 2QOIA 3FLQA 3V5QA 1WBPA 4APPA 3TUBA 3MFUA 2FSTX 2O0UA 3QRUA 1DI9A 2CPKE 1V0PA 3UYTA 4BWKA 4F9CA 1VEBA 4BDIA 5BQ0A 2IVSA 3T3VA 3VHKA 3S00A 3DLZA 5IUHA 2Z2WA 3D0EA 2ETKA 4ARKA 4O27B 5HQ0A 4EC9A 3Q3BA 4GL9A 1P4OA 2Y4IC 4HYIA 4L7SA 4FTCA 2WQBA 5J9LA 4AACA 5KNJA 4UV0A 5BVFA 5E90A 1OIYA 4KBCA 1JQHA 3LCOA 5T6KA 4CZUA 5JH6A 4YU2A 3MY0A 4CV9A 2CKPA 3N4TA 5IQHA 3O51A 3UNZA 4FTKA 2UVYA 5CSXA 4FL3A 3QQJA 4TN6A 5HTCA 2GHGA 4QYHA 3AG9A 5D11A 2Z7RA 2Z60A 4L42A 3QYWA 1WMKA 1LR4A 4X2FA 4IEBA 2GFCA 2JGZA 4IVDA 5FTGA 3BCEA 4S2ZA 3V6SA 3I7CA 4RFZA 4G6OA 4XHKB 4PUZA 2QO2A 3PPJA 5L8LA 4UEUA 4HVIA 3KFAA 1ZZLA 2WMSA 2KULA 1FMKA 3LVPA 4I5CA 3BBWA 3TWJA 3ZC5A 4QMQA 3UQGA 3R1YA 4M66A 4R6VA 2EB2A 3D5XA 1DI8A 4IH8A 5J5SA 5AR7A 2R7IA 3ANRA 4O22A 4IACA 4S32A 1CMKE 2JAMA 3HX4A 3P5KA 3TZ9A 5CANA 4BZNA 2ITXA 4JDKA 3A7FA 2X7FA 3GU5A 1H01A 3VAPA 1KOBA 2VWIA 3IONA 4IW0A 3R22A 2LAVA 2OIQA 3SA0A 3DXNA 4JX7A 3OF0A 3ELJA 2QOKA 3UPXA 5C26A 1Z57A 1FMOE 3LFEA 3OY3A 4PDPA 5DT0A 1CTPE 3RAWA 3FY2A 5IU2A 4BKZA 4X7QA 4DFUA 2ZMDA 1R0EA 3GBZA 2XBJA 3QKKA 1WBOA 4XYFA 4NFMA 4FIHA 3C0GA 5HZNA 3LZBA 3M11A 4I0RA 1OGUA 3DA6A 4C57A 4EZ5A 2VTIA 4IB1A 4K8AA 4BDJA 5HGIA 1BL7A 5BVNA 4RVTA 1RW8A 3K3JA 4L67A 5A9UA 2BHHA 3EIDA 3DV3A 5CSPA 4USDA 3FXXA 4KINA 1MUOA 3G33A 4QMWA 5HE2A 4BTJA 2QU6A 5AX3A 2XYUA 4O6LA 2V7AA 5AR4A 4DH7A 5M44A 1PYEA 4IC7A 3FV8A 2WTKB 4YR8A 5AR3A 2JKKA 2J6MA 3KMWA 1G5SA 3B8QA 4FKGA 3R7UA 5G6VA 3O50A 4FG8A 3CQEA 4O21A 2PL0A 3NW6A 2R3LA 5AR8A 3LFBA 1GZ8A 2ONLA 4QOXA 3Q04A 1ZYDA 4U45A 4XX9A 5HVJA 4BRXA 3PXQA 4O0YA 4QPMA 3F3WA 1G3NA 4IX6A 4UMRA 4RVMA 5CF8A 4LFIA 4G2FA 3R00A 3E7VA 3Q5IA 4FIIA 4X3FC 2VTLA 4IAIA 2EU9A 3V04A 1OKZA 4C4HA 4YP8A 2HCKA 1XH9A 3H9RA 4RZVA 3U4UA 4DC2A 4DH8A 4EWHA 3IOKA 2W4KA 3HMIA 3V5JA 3FLZA 3R30A 2BUJA 3FKLA 4XEYA 1JSVA 2EUFB 3D5WA 3W8QA 2B0QA 3DBFA 5JGDA 4ZJIA 3QD2B 4I6QA 4AN9A 2W5HA 2GNLA 5C8NA 3POOA 4Z3VA 1LP4A 4E5AX 3JR1A 2OGVA 4RWKA 2BZKB 3QLFA 1Q41A 4FVQA 4UMUA 2XK3A 1TQIA 3IGOA 1OKYA 5JGBA 3NIZA 2YEXA 4FZ7A 1Q4LA 4XLVA 3UDBA 1WBVA 4MTAA 1YWVA 3O8UA 2XNEA 3GFEA 2J0LA 4FIJA 3BBTB 1ZY5A 4ANOA 4YO6A 4CG8A 3ET7A 4JDJA 2YM5A 3SVVA 3VUTA 2NO3A 5AV4A 1SVEA 5FQDC 2GS7A 2YDIA 4ZMEA 4M12A 3II5A 1SZMA 3CTJA 2G01A 4FKPA 4PP9A 2W05A 2VAGA 4Q2AA 4V04A 3WIKA 3ZM4A 5LXMA 1UKHA 4EL9A 4RQVA 3MVLA 2O3PA 4RX8A 3NUXA 2X2MA 3PP1A 4BDBA 5HTBA 3HYHA 3A62A 4G3CA 5JK3A 2ZDUA 4ZTQA 3ULZA 5ETFA 2WGJA 4L68A 5BUIA 1PXOA 2WO6A 4TPTA 1VZOA 1JNKA 3LXLA 4OT6A 4RQKA 4ANMA 3ACJA 3DK3A 5DR9A 5AP0A 3KXZA 3OWJA 4ACMA 5CF5A 3HMOA 1RJBA 3TV6A 3VBTA 5L2IA 3HA8A 4EK5A 4AAAA 3EQGA 4EK3A 3VW6A 2CGUA 5IEYA 3FMKA 1YI6A 4TZRA 3IDBA 4B99A 4O2PA 3HP2A 1Q3WA 1YHWA 2X39A 2XZSA 5KUPA 4TKSA 4TRLA 1PXIA 4MEDA 3U87A 3SG9A 4CZTA 4LI5A 4ASZA 1U59A 3MTLA 4QP1A 3MY1A 3KXHA 4C4FA 3OXTA 4EJ7A 4A9YA 4ZJVA 1F0QA 1E1VA 4DT8A 5DFPA 4JR3A 5FUTA 3KKVA 3DJ5A 3MBLA 4RLKA 4ZS0A 2PHKA 1UU8A 2WMTA 2ZYBA 3GVUA 4MHAA 4PL5A 1XJDA 3M1SA 4AN3A 4ZY4A 2R2PA 4FSTA 3OS3A 4GH2A 3TUCA 4NM3A 4HCVA 1LPUA 3ENHA 4ZZNA 3P9JA 3W2OA 3LCSA 3OCSA 2OJJA 4GG5A 1WVYA 3TTIA 2CGXA 4M84A 3BQRA 3FC1X 4LGDA 4KIPA 2BDJA 4DFLA 4CZYB 4P5QA 2NRUA 3VUMA 2W1CA 2QURA 3QL8A 3QUPA 3CGOA 2FUMA 3ZRMA 1PXLA 4XG9A 5K0XA 3D7TB 3RI1A 4BI2A 2F9GA 3F6XA 3U54A 1Q8UA 3LFQA 3W33A 1VR2A 4EZ3A 2C47A 4MWIA 3ALOA 4RWIA 4K9YA 3ITZA 3EKNA 2HZ0A 4EUUA 1PHKA 4AWIA 3NNUA 4G5JA 4NFNA 4EHGA 3KF4A 4E6CA 3R9OA 3DZQA 5DRBA 2QKWB 4UY9A 3RHKA 3Q4CA 1R0PA 5AEPA 2UW6A 1T45A 3NMUF 4BWPA 5FTOA 4EOJA 4BHNA 3F9NA 3OCGA 1PMNA 4FSNA 3OEZA 2F4JA 4BCNA 4Q9ZA 2SRCA 3JPVA 2Y6OA 4JNWA 3UTOA 1WBWA 3COHA 2VO0A 2YERA 3Q9WA 2W17A 5F95A 1EH4A 1FQ1B 4EQCA 2OF2A 4O0RA 3ZSHA 4FK3A 1RQQA 1ZMUA 3MWUA 2Z7SA 3Q9YA 4DTBA 3RKBA 3WZKA 3DQXA 3GCVA 2G9XA 4ZY5A 4N70A 2WQEA 2OXDA 1ERKA 4D2TA 3MTFA 4D2WA 2J0JA 4FKVA 1H1QA 4NL0A 4HOKA 4WSYA 5LOHA 5CF4A 5HHWA 5EDQA 3LOKA 4OTWA 3E93A 4ORKA 3AC1A 3COIA 4C36A 3GCPA 3FPQA 4BDAA 5HCYA 2J7TA 1FVRA 3KB7A 4CEGA 3QZHA 3Q6WA 4FKJA 4HNFA 2GSFA 3GFWA 4G6LA 4ASDA 5K3YA 4NEUA 3P7CA 3AD5A 5LVLA 4IANA 5E1EA 5IQFA 1FINA 2QODA 5FEEA 3VO3A 4PDSA 3BHUA 4O7VA 5GZ9A 1MQBA 3QRTA 2W9FB 3C0IA 4ZTSA 4ZTHA 5CTPA 3NUYA 3GEQA 4PL3A 5A4QA 4GYGA 3PRFA 5C8KA 3DXQA 5CZIA 2X9FA 3BU5A 2WTKC 3F7ZA 3R7YA 4J97A 4MNEA 1BYGA 1M52A 4J7BA 2VWWA 1KWPA 4L8MA 3OBGA 5KMIA 1OKVA 4I22A 2VWVA 3ATTA 3MA3A 4QMVA 5FWKK 2BPMA 5AX9A 3F88A 2ITQA 5DBXA 2R3OA 2XNNA 5AUXA 4F7LA 4EOQA 5CU0A 5AUVA 3A7JA 3ETAA 3NX8A 3I6UA 3UZRA 2XKCA 3DBQA 3RAIA 2R0UA 3LLAA 4O7ZA 4Y95A 4JRNA 4PTEA 5D12A 3UOLA 3D5VA 4LL5A 3UIMA 2PTKA 2VV9A 4OTHA 1U54B 3EFKA 3QC9A 5IG1A 4YMJA 3TKHA 3VQUA 3U9CA 3T8OA 2VWBA 3WYXA 2RSVA 5E8ZA 4CT2A 3HL7A 4Q5HA 3VVHA 4CMTA 5J8IA 4XUFA 5CYIA 3C5UA 3BWFA 3OW4A 4DN5A 5KE0A 4ERKA 1W84A 4NKAA 2XNMA 3BV2A 2WMRA 1JPAA 5C9CA 2XKFA 4A9RA 4BVUA 3DAJA 3I6WA 1ZYJA 4I4FA 3CD8A 3NUNA 4Y72A 3KXMA 1JLUE 5L6WL 3RPVA 3V6RA 1BLXA 5HLNA 4DBNA 4J8MA 3VBXA 3PSCA 3MPAA 4XBRA 4PDOA 2W96B 3ZYAA 5HIEA 5M4CA 1H0WA 5E8XA 2PPQA 2BROA 4HYSA 5BYYA 4XRJA 3NLBA 3Q9XA 4K2RA 3SOAA 4BCFA 1H1PA 2IW9A 4PP7A 4MX9A 4YJRA 4MXAA 3DKFA 1T46A 3VJOA 3VUIA 4J53A 5IQDA 2H96A 3DBCA 4MQ2A 4MXOA 4R7IA 4U81A 4L52A 4IDVA 2W1ZA 3R1QA 4JVGA 4UYAA 4D0WA 4O7RA 1SVHA 1XBBA 2UW8A 4AFJA 1Y8YA 2XKEA 1GIHA 3FE3A 3LQ5A 1PMUA 2XIYA 1BMKA 3FI4A 2UZWE 3ZBXA 5J7HA 1PKGA 2J0IA 1SVGA 2XEZA 4O1PA 2ZVAA 2KTYA 3CXWA 3NYOA 2O5KA 4BGQA 3ZMMA 2XB7A 3CIKA 5TOZA 4AGDA 3ZO3A 2QOFA 4JX3A 5FTQA 3MVMA 3UVPA 4D55A 4F08A 5I9YA 2OSCA 3DQWA 1R3CA 2QU5A 4U3ZA 1J3HA 3LM5A 3HDMA 3FHRA 3QZFA 4F7NA 5EKNA 3G2FA 4QP3A 3SHEA 4BCOA 5JFSA 4O83A 2YAAA 2ZAZA 3PXKA 4B7TA 4Z55A 4C34A 3ZUUA 4IWOA 4YTCA 2ZV9A 3TIZA 4NK9A 3GCUA 4O0UA 4DBXA 4AZTA 2X6DA 5M55A 3KU2A 2YM3A 4GIHA 4GK3A 3DK6A 5KMJA 3CTQA 2C5XA 4C62A 2XIRA 2XYNA 2X7GA 4FEQA 5EOLA 4O84A 3W2CA 4FSZA 4LGHA 3LCTA 2CDZA 4E5BA 3P08A 4XBUA 4KABA 5EK7A 1W0XC 5K5NA 4HPTE 3CQWA 1GAGA 1ZYLA 3QTWA 2WQOA 4IBMA 5AIRA 3SKCA 4HVGA 4I1ZA 4FV3A 5L3AA 4MBLA 1XWSA 3A99A 3DB8A 1GY3A 4Y73A 3W16A 3ZFMA 4BBEA 3ORXA 3ZEWA 4GG7A 3M2WA 3ZO4A 4AGWA 2NP8A 4QP8A 4DGNA 1TQPA 3DLSA 1GNGA 3AT4A 3GGFA 5CT7A 4YPDA 2VGPA 5CVGA 1YWRA 1YOLA 1IAJA 3DCVA 2ZJWA 4R5SA 4IX3A 3AMBA 2BCJA 5CX9A 3SV0A 5C1QB 4MXYA 2X4ZA 4PWNA 3AMAA 3PJ8A 1R39A 4YSMA 3VS2A 4LM5A 3HUBA 4YJNA 3FZRA 4DFNA 3MB6A 3Q32A 4B6LA 2VTRA 3EB0A 4MK0A 4Y46A 3ID6C 3DFAA 4IHPA 4O91A 4U41A 4YTHA 2PUIA 3MIAA 1TVOA 2B9JA 1WAKA 1B38A 1YWNA 3R1SA 1V1KA 2CKQA 4RVLA 4QNYA 2ITOA 4GS6A 3FBVA 4IB0A 2VO7A 4H58A 5J1VA 2XIZA 2XNPA 2YM8A 4E8AA 3LHJA 4FT3A 2PVYA 4WKQA 4IFGA 3E87A 3P79A 2OJGA 4ENYA 5LMBA 2ZM3A 1OMWA 4TWOA 2WQMA 4IAYA 4USEA 1Q8YA 3C4EA 4YJSA 4HVHA 2W5AA 4BCHA 4DINA 5JFXA 3UNKA 4LV8A 4KIKB 2OXXA 4KIQA 2UVZA 4WT6A 4BYJA 2JDVA 5J7BA 2OH4A 3G51A 3EWHA 3BU3A 4JG6A 3KMMA 4HW7A 4CYIA 4FKOA 5DR6A 3VS1A 2P3GX 5M56A 4O7WA 3K2LA 5AUYA 3NUAA 2W9ZB 3EMGA 4FKLA 3H9FA 4GW8A 4RWJA 4RJ8A 4FTNA 3QRKA 4FZAB 2VTQA 4KIOA 5K5XA 3WF6A 4XV3A 2QOBA 4OR5A 5H2UA 1NXKA 4FV4A 2X2KA 3P78A 3A4OX 3DBDA 4YBKA 4AW1A 2YIYA 1GIIA 3I0OA 4YTFA 4FZ6A 3D83A 5CEKA 3QF9A 3R8VA 3NR9A 4L53A 1H1SA 1Q5KA 3NEWA 5IA5A 3PVGA 3ZCLA 2YIXA 1XQZA 2I0YA 4EYJA 3NYVA 4RJ6A 4D1SA 4YZDA 2RG5A 4CV8A 4R7BA 3IDPA 3TJDA 3TZMA 3BEAA 2QO7A 4LOOA 2BALA 3H30A 4EH6A 2QONA 2WU7A 3RK7A 2Q83A 4CRLA 3LFSA 3WF5A 5IH4A 3FKNA 4FA2A 3VS3A 4A4LA 1QPCA 3VUKA 2YCQA 2BFXA 2WEVA 1KOAA 4QO9A 4AP7A 4EH2A 5D1JA 4M69B 4EI4A 1VYWA 4AG8A 4GFMA 3Q9ZA 2VD5A 1BX6A 4X2GA 5HE1A 2G1TA 3V3VA 3QUDA 4QMZA 2AC5A 2PE0A 3QQFA 2X81A 4X3JA 5FRIA 4EHEA 2CCHA 1JSUA 2UW3A 3F5GA 4CLJA 1O6YA 4CQEA 3D7TA 4GK2A 3IDCA 4ZXTA 3TDWA 3MS9A 1SNXA 3G6GA 4FVRA 4WRSA 5H8GA 5CASA 2IJMA 4RJ5A 2C3IB 3VNTA 3R7GA 3VUDA 2ETRA 5IA1A 3FMMA 3ZBFA 4JDIA 1XBAA 4XP0A 5C4KA 2BRNA 3F2AA 1H25A 3PY0A 3MI9A 5D7AA 4EQUA 4A9TA 4WBBB 4D4RA 3FXWA 5EM6A 2GPHA 1YDTE 4G9CA 3RBWA 4D5KA 3PDTA 5HE3A 1OL1A 3C9WA 4V0GA 3L8XA 5KZ0A 2R3RA 4FIEA 2C6LA 2QKRA 3T3UA 4BCMA 5E8YA 1M2PA 4E6QA 2QOOA 3NSZA 2B7AA 2HENA 5HG8A 2VO6A 2J4ZA 2PMLX 3HV7A 3OUNB 3KCFA 4U40A 5DRDA 5M4FA 4D4VA 4C3FA 3LFFA 4XP2A 3ZFXA 4FMQA 5JSMA 1J91A 2BFYA 4BDFA 2JDRA 5FM3A 3ZDUA 2DUVA 3VS7A 2X4FA 1NW1A 3EZRA 2R3GA 2HYYA 3BEGA 4RA4A 2VWUA 2LGCA 3DGKA 4R3RA 3QQLA 2C3JA 4JAIA 2O2UA 3QZGA 3SLSA 3VS4A 2AUHA 5DVRA 1SM2A 3PG3A 4APCA 4MNFA 2IW8A 4M0ZA 4YZBA 2C5NA 4FV6A 1Q62A 4UMPA 3ALNA 4UN0C 4GFOA 3QQUA 1OIUA 4BTMA 3EQDA 3GOKA 2XMYA 2YDJA 1F5QA 3E62A 4NM7A 4ZOGA 4GVAA 5LMAA 4XS2A 2QG7A 2A1AB 4ANSA 5KMNA 2WOTA 4CT1A 3A7GA 3DDQA 4V05A 3PJCA 3KXNA 2RFDA 4RT7A 5BX0A 1PY5A 4EOIA 4FZDB 4ZTLA 2GS2A 2ITTA 1KV1A 1PF8A 2HZNA 3BYUA 2F57A 4IWQA 3LCDA 3OCTA 3A7IA 2JIVA 3G5DA 2E2BA 3R7IA 5HLPA 4MD7E 3BHHA 2WU6A 4BDEA 4MXZA 2HAKA 3D2KA 4NZWB 1ZOGA 4J96A 4L9IA 5A46A 1XO2B 2ONLC 4PPAA 3F2NA 2PVJA 2P0CA 3NVMB 4RBLA 3THBA 2A4LA 5ANJA 5CQUA 3EH9A 4B9DA 2IO6A 5AP6A 4LRJA 4FEVA 2V55A 4C4EA 4CG9A 4QYFA 5EW8A 3FI8A 3PY1A 3R7OA 4DAWA 5M51A 4AFEA 3HAMA 2PYWA 4YHJA 3GQLA 3A61A 4PY1A 4ZSAA 3KULB 4KS7A 4DG3E 2P33A 4ALUA 4TWNA 3O7LB 2XRWA 1U54A 4YC8A 4ZMFA 2BTSA 2WKMA 3EFWA 4DA5A 3LXPA 4ZZMA 4MVFA 5BMSA 1OUYA 1X8BA 4CGAA 2BTRA 4BCKA 2B9IA 3CY3A 5LVMA 4IC8A 1REKA 2IWIA 2QOHA 3UYSA 3ZH8A 1QPDA 4FTMA 3ZLXA 3QC4A 4XV9A 1W82A 3E8EA 3O23A 2X8EA 3MW1A 3RINA 3SW4A 1RDQE 3QTZA 3H4JA 3RNIA 4BCQA 4DITA 4O7LA 3R73A 4ITHA 4D9UA 4FX3A 3I81A 3Q60A 2XM8A 5F94A 4ASEA 2WMWA 4QMMA 2FH9A 5L8JA 4KAOA 5FXQA 3PA5A 3DPKA 1BKXA 3EQRA 1XH4A 4L3JA 5DN3A 4AA5A 4C2VA 5EH0A 1U5RA 2WTDA 3CPCA 5CAVA 4E3CA 3TIYA 5JZNA 2BIKB 4WNKA 4AT4A 4RPVA 4FV7A 3ZRKA 4CFUA 3NIEA 4AW0A 2ITNA 4FV2A 1KE7A 2ZDTA 1YXVA 5DMZA 4C3PA 3EN6A 2R3NA 1FBNA 2QNJA 3I5ZA 5AR5A 3WZUA 3LFAA 5K4IA 1P5EA 1OKWA 3ATSA 3LPBA 3FLYA 2WIPA 4TYHB 4YNEA 2I0EA 1URCA 3VWAA 3SXRA 4FTAA 3TT0A 2C6EA 2C3KA 3OXZA 3MPTA 4EOSA 1NY3A 5HNBA 1KE6A 5I4NA 1A9UA 4NU1A 2IN6A 4XMOA 4FC0A 5J95A 3FLNC 4RX9A 4ZSLA 1FOTA 5CSWA 3VRZA 3PXRA 2VGOA 3RK9A 1UNHA 3E8NA 5EQEA 3TN8A 3UBDA 3WIGA 5LWNA 2C6OA 2JIUA 3BYVA 2PWLA 4W8EA 3FZOA 3DB6A 4JBQA 4LMUA 3DNDA 5CU2A 3OEFX 3BIZA 3GUBA 4LQMA 4TYIA 4ZTNA 1OPLA 2FB8A 3QCQA 5FG8A 1GOLA 2H34A 5EDPA 3LW0A 4ZS4A 3QRJA 4AS0A 4FGRA 4MBJA 4WG5A 2B55A 3QXOA 2BIYA 4FV1A 1PXMA 4YJOA 2YWPA 4I92A 3ZZWA 3R9HA 3KQ7A 5JQ8A 4O1OA 3H10A 4QQ5A 3KRXA 4LMNA 3BQCA 4E4LA 4AU8A 5IA2A 3DKCA 4FIFA 5AIKA 4DFYA 4RLLA 4F4PA 3D5UA 4JDHA 5HNIX 3PVWA 4DFBA 2J50A 5AMNA 4DFXE 3GU7A 3ODYX 3EN5A 1PRYA 3O2MA 3TCPA 4ANBA 3LAUA 3H0YA 4J8NA 5KKRB 1Q97A 3HVCA 2ETMA 2QO9A 3G6HA 2ZM4A 4G31A 3OW3A 1TQMA 3N51A 4I5HA 4OTGA 2WHBA 4PTGA 4U9AA 2CN5A 4U97A 5I5ZA 2YITA 5DNRA 3NW7A 1DS5A 5D41A 3NVKI 1IASA 3TL8A 3OD6X 3ROYA 3LQ8A 4M13A 5A14A 1H24A 2YWVA 2VO3A 2GTMA 2XRUA 3PWYA 4PNKA 5AV0A 1XKKA 1OL2A 4RVKA 1Q8TA 2H6DA 3QGYA 5J5TA 4UMTA 4I6BA 2B9FA 2XA4A 3A8WA 3CCNA 3MVJA 4ANLA 5HORA 2OICA 4G3EA 4MD8E 4I41A 2UVXA 4HCTA 4G34A 4Y83A 4CSVA 2CHLA 2CCIA 3QHWA 4EH5A 4NTTA 4CNHA 3OG7A 4U79A 3N4VA 3U51A 4C4GA 4QMLA 5EQYA 1AGWA 2OJ9A 3PYYA 5A4CA 4YLJA 4KD1A 2XJ0A 1E1XA 2R3MA 4NUSA 3TTJA 5HX6A 3IS5A 3QX4A 4W4YA 5BVWA 4FSQA 3DXPA 2JAVA 4BCJA 3LXKA 4BDGA 1OUKA 2O65A 3QUEA 4GKHA 3L9PA 4EK8A 2UZNA 4KIKA 3WILA 3ORMA 4TNDA 4UB7A 1APME 5B7VA 2RF9A 4QQJA 3IW8A 2GS6A 4G3GA 5A6OA 3HUCA 3CEKA 4EH9A 4F1OA 2ZV2A 3UGCA 4HYUA 2G2IA 3UOJA 2O63A 2HXQA 4DYMA 3BGPA 5L2QA 3GCSA 4FEWA 2ITPA 3U6IA 3TI1A 3CSVA 4WNOA 3AD4A 2JITA 4IWDA 2HOGA 5CU4A 3UZPA 1KE9A 4QPSA 2YLEA 3KN5A 5L8KA 2PUPA 4RJ3A 1F3MC 5AM7A 3RCDA 5C01A 4CLIA 2C5OA 2WB8A 3MVHA 4BDDA 3FDNA 1UVRA 4GT4A 5DT3A 3OUKA 3TXOA 4EYMA 2AC3A 3QX2A 5ANKA 4H3BA 2JKOA 2JKQA 2VUWA 4YZCA 4R3PA 4RGJA 5CVFA 2RGPA 4H1MA 1PMVA 3SD0A 4ZJJA 4DEDA 4EQMA 1JKTA 4YJQA 2PVFA 4M69A 3WZEA 4W4WA 3PG1A 2RL5A 3PJ1A 3FI2A 5EM7A 4M8TA 1M2RA 2YDKA 4NTSA 4BGGA 5FBNC 2QCSA 1SNUA 4HVDA 2WMQA 3U4WA 3EQBA 3ENMA 4CCBA 1PJKA 1YXTA 4UWYA 4O0SA 2R64A 4IVAA 2JC6A 2EXMA 4QD6A 3FMJA 2XUUA 4NW5A 4FKIA 4ZLZA 3EQFA 3HV4A 4YNOA 4YJPA 4BIDA 4QP4A 5T68A 3Q2JA 4I6HA 4ZSGA 2JD5A 3RZFA 3BU6A 3K5VA 5I3RA 2QR8A 3Q2MA 4GK4A 4FTQA 4IX5A 4V0GB 3PE2A 3PXFA 5LJJA 3AMYA 2NNWB 1XHAA 2R3PA 5CT0A 5IQEA 4EOLA 2W5BA 4BWXA 5A4TA 3ZXTA 2OBJA 2VX3A 2YJSA 2YM7A 3NUPA 4KA3A 4E1ZA 1IA9A 3KCKA 3EHAA 5ETIA 2CMWA 4YSJA 1OZ1A 3RJCA 4NJ3A 2VNYA 2R3HA 3D4QA 4MQ1A 3BV3A 4X6QC 2WQNA 3QCYA 3QD4A 2B9HA 4F6UA 4O0WA 3TZ8A 4JR7A 5AWMA 2C5VA 3JS2A 3MFRA 5HBHA 1XH5A 3LFCA 4RRVA 1M7QA 4IIRA 5CU6A 2C0OA 5E7RA 5H8EA 3VN9A 5IQIA 1Y91A 2PVLA 3PP0A 4I5PA 3WZJA 3NDMA 3V5PA 3GC8A 4FR4A 4HJOA 4TYEA 4IX4A 1LUFA 2QI8A 3ZO2A 5HTIA 4ALVA 4CFFA 3OROA 3I4BA 1W8CA 4PRJA 4RJ7A 5K9IA 4R3CA 4EOKA 2OIDA 4MF1A 4BCGA 3FZ1A 4EH8A 1IAHA 4AE9A 4TWCA 4IADA 3ZUTA 3IGGA 1OVEA 3MSSA 2V62A 4FKTA 3RTPA 1W83A 1H00A 3E8DA 4RWLA 3ZEPA 2B52A 3VRYA 4F9WA 4EOPA 5HVYA 1FGIA 4RX5A 5GJDA 4ANNA 5B2LA 5K4JA 4YGAA 3BHTA 1XH7A 1OL5A 3ACKA 3F69A 5HG9A 4DTKA 3ULIA 1S9JA 2FVDA 2QR7A 3C4CA 4XG4A 3FYKX 3PA3A 5BVEA 4LOQA 3JYAA 3ZM9A 5A4EA 3LQ3A 3MDYA 4AZEA 2W4JA 4Y5HA 1OB3A 5HLWA 2C6TA 2DYLA 2XBAA 3UZTA 5T3QA 5CSVA 2VX1A 4IE9A 3FKOA 1J1BA 1AD5A 4GSBA 3HGKA 4CFWA 4L3LA 2PULA 4ZY6A 1H4LA 2UZOA 4FSYA 2Y4PA 2X8DA 3NW5A 4FBXA 4EHZA 5IPJA 2IZSA 5EW9A 1YKRA 3GC9A 3MJ1A 4CFXA 5E1SA 2PZRA 2W1IA 3KULA 3AQVA 2PE2A 5C03A 1QPEA 1M7NA 5KKRC 3W1FA 4O7NA 2J9MA 4F9BA 3QBNA 5K0KA 5HIBA 2XNOA 2BHEA 4Z7GA 3BWJA 3W2RA 2W06A 4A06A 4JQEA 1XH8A 3EOCA 2W1FA 3QKLA 5AR2A 1H28A 5EOBA 2RFEA 5DR2A 3OT8A 3PIYA 4GT5A 4ALWA 4IAZA 4QMNA 2HY0A 3CBLA 5HI2A 4C59A 2QLQA 2QHMA 4ACHA 3S0OA 2A2AA 2C68A 4R5YA 1QL6A 2V5QA 2V22A 1JOWB 1M14A 4IFCA 4F99A 1Y8GA 5HO7A 3PLSA 5J79A 5BMMA 2YLFA 4H3PA 3ZC6A 4ZLYA 4FT9A 3PXYA 4EKKA 2GNHA 3G0FA 4J99A 2E9OA 2UW5A 1Y6AA 2CGWA 2JDTA 3QTSA 4C8BA 4E4MA 4EJNA 1RE8A 5GJFA 4IAKA 4I93A 4N57A 3FMEA 3QALE 3OMVA 2J5EA 4P7EA 4W8DA 1R1WA 3GU6A 1LEWA 2WNTA 3KC3A 3I1AA 4IDTA 4PNIA 2X6EA 4CFVA 3TNWA 4YLLA 4PV0A 3EL7A 4U0IA 3PVUA 3IECA 3D2IA 4FKQA 4KKGA 4F63A 4ZZOA 1OL7A 1Q3DA 3PTGA 4FV5A 4XG2A 4KWPA 5EM8A 4QTBA 4TYHA 1HCKA 2CNVA 4W9XA 4DE4A 2VTTA 4JT3A 4ZK5A 1WVWA 5DOSA 1IA8A 3UMXA 3UODA 4CKJA 3Q4TA 3KY2A 5I0BA 2B4SB 3RP9A 4BZDA 4DEEA 3C4ZA 5F20A 3VF9A 3FHIA 2EWAA 5BVKA 2HELA 3U6HA 2W1DA 4MKCA 4XG6A 2XNBA 1STCE 3T9TA 3ZU7A 2IZRA 2X2LA 4FVPA 4IVCA 4BI0A 4CTBA 4USFA 3F2RA 1H26A 3UIBA 4RA5A 3S3IA 5DEYA 4D2VA 2REIA 4FOBA 4NM5A 1M17A 4O6EA 3P0MA 2QHNA 2R4BA 4JOAA 4S31A 2OJFE 5DHJA 4EK4A 1OBGA 3PLAE 5IMEA 3LCKA 2WMVA 3CPBA 3DJ7A 3P4KA 3R8UA 5CALA 2XKDA 3F5UA 1ZMVA 4WUAA 2I7QA 4FIGA 1K9AA 3LJ1A 3R21A 3VW8A 5F1ZA 1W7HA 2JFLA 4R1YA 4TXCA 4DG2E 1PYXA 2UW7A 2I1MA 3CJGA 5KCVA 5HO8A 5ANGA 5FP6A 1NVQA 4YZ9A 3BPRA 4JXFA 4QNAA 2P2IA 4F09A 1MQ4A 3R1NA 2JBPA 4UMQA 4GVJA 5M4UA 2BKKA 4DG0E 4OW8A 4RIYB 2J51A 5KBQA 3UG1A 5LARA 4L45A 3QGWA 4UWCA 3TV7A 3MFSA 4ENXA 2W1HA 3JXWA 4L3PA 2OU7A 5TT7A 4YJVA 3FZSA 3KA0A 5EG3A 5E4HA 2R3QA 2YZAA 4OLIA 3P7AA 1JKLA 2PVRA 5L6OA 3TDVA 4KRCA 5ANIA 3VBQA 3GB2A 4BKYA 3ORNA 4XG7A 2ERZE 3MN3A 3VUHA 5J87A 3DKGA 5EHYA 4BDCA 5JZJA 3HNGA 4E73A 4DH5A 2GHLA 4MH7A 4KBKA 1Q8WA 1LEZA 3R0TA 3KN6A 3OWPA 3SQQA 4CRSA 4UX9A 5I3OA 4FTJA 4K33A 3MY5A 4FUYA 2I0VA 1UNGA 2C0IA 2GCDA 2VNWA 5M06A 1HOWA 1NVRA 3JVSA 4J1RA 4FTRA 4MWHA 4YJTA 4GFGA 3MJ2A 4U5JA 3KK8A 4PMSA 1SYKA 2O8YA 4IJ9A 1UU7A 3W55A 1PW2A 4XJ0A 4TYGA 1WCCA 1PXPA 1Z5MA 3KRWA 1GIJA 1URWA 4CQGA 2PZ5A 3ZLYA 1OECA 3WE8A 4BCIA 5LCJA 3MH3A 2OWBA 3LLTA 1XBCA 3AC5A 3FL5A 3QD3A 3CKWA 3AXWA 3KXGA 1H1RA 4QMOA 3RZBA 1HCLA 5L2WA 4DLIA 4S33A 4S30A 1XH6A 4WIHA 2I6LA 4DHFA 4AA0A 2R9SA 3KEXA 4AGCA 2BR1A 3LMGA 2JIIA 3NCGA 3QQHA 5TKDA 4DEHA 3RK5A 5ACKA 4FKUA 3FMDA 1ZZ2A 2BRBA 3DU8A 4DF3A 3IW4A 3W10A 5FBOA 3KF7A 4U80A 5DT4A 3OOMA 4C2WA 4TTHB 4F65A 4DGMA 5DEWA 5J9YA 3R9DA 1REJA 5JKGA 2CSNA 5JEBA 2BDFA 3I5NA 2X0GA 3P86A 5GZ8A 3UNJA 4CFMA 4EZ7A 4GIIA 2Q0BA 2RKUA 5CLPA 3BYOA 3QQGA 3R2YA 5AP4A 3W32A 4EK6A 2BRMA 4H3QA 2P2HA 4IB5A 3RWQA 4PMPA 5KX8A 1VJYA 5LVPA 3SW7A 2XEYA 1Y6BA 4I3ZA 5FD2A 4GKIA 5HESA 3KMUA 3UIUA 2A27A 2I0HA 3RAHA 2FSOX 5HU9A 3Q4ZA 4DH1A 4DGGA 3HDNA 4IVBA 3ROCA 2BAJA 5JMSA 5FLFA 4C37A 4YZNA 4TW9A 5AP3A 3LMIA 4Y85A 3SOCA 3EL8A 3PPKA 2WTJA 3HRFA 3F3UA 5E91A 2CN8A 4G16A 4LOPA 1SMHA 5DPVA 3UPZA 3PUPA 2BMCA 2ITVA 4FODA 4IM2A 4YC6A 2JDSA 1CDKA 4WNMA 1JAMA 2J90A 4QRCA 3DTCA 4XG8A 4RMZA 5EFQA 3WI6A 2FGIA 3U55A 2UV2A 3MYGA 3O17A 4TT7A 5BVOA 4O7TA 3AT2A 3HMMA 4KNBA 4XNEA 5EM5A 1V0OA 4A9SA 4BDKA 5E8SA 3A60A 3G15A 4QMYA 1QCFA 4ZIMA 4PTCA 2UZTA
chains in the Genus database with same CATH superfamily
3BLHA 3DJ6A 1ATPE 4JIKA 5DG5A 3ZRLA 5CF6A 4IM3A 5CEIA 4D5HA 5JQ5A 4HPUE 3UOKA 3ODZX 1GZOA 5GJGA 3WYYA 4DTAA 1FPUA 4CVAA 4LL0A 4QTDA 2O64A 2CLXA 4K6ZA 1U46A 4KSPA 2UZBA 3AOXA 1H07A 3DFCB 3HRCA 1JWHA 2GFSA 3OY1A 3I79A 2UZVA 1H08A 3M42A 3QWKA 5HVKA 1MRVA 3MIYA 3W0SA 3BLRA 5H9BA 4O7YA 3FUPA 2PMOX 2VTNA 4HGLA 5DA3A 1KUTA 4R78A 2UZLA 2WZJA 5AADA 1Y57A 3TZ7A 1B6CB 5CENA 1ST4A 3TEIA 4DEIA 4G9RA 3FLSA 4K11A 4XOYA 3B2WA 3C50A 4EH4A 5A6NA 5LQFA 1P4FA 3R8ZA 3ZO1A 5IDNA 1H0VA 3Q52A 3F7WA 4BTKA 4F70A 3TJCA 3VJNA 2C6IA 3GT8A 3E5AA 3DTWA 4ZTMA 2WMUA 5AA8A 3PIXA 3AD6A 2R5TA 5HOAA 5TF9A 3NPCA 4OGRA 4WG3A 5CZHA 4ZEGA 4BKJA 4C4JA 3R9NA 4BHZA 3OBJA 4TNBA 4EONA 3E64A 3VULA 5CSHA 2VTMA 5EYCA 5FEDA 2CKOA 4BI1A 2GNJA 3EZVA 3L9MA 4U7ZA 3RPRA 5IQAA 3LXNA 4XG3A 2DS1A 3LFDA 5HBEA 1PKDA 4E7WA 1UU3A 4CYJA 3I7BA 3FC2A 5C8MA 3OOGA 5HKMA 2R0IA 4ZTRA 1KSWA 4LRKA 3HEGA 1A48A 3IK3A 2XP2A 3A7HA 2GQGA 2HWPA 4FTIA 5GHVA 4C61A 4F1TA 3MV5A 3JUHA 4D58A 4FTLA 2C6KA 1UWJA 2GDOA 3HV3A 5DE2A 4F0IA 4RIWA 4BC6A 4MAOA 1CKPA 4O96A 5EKOA 3V51A 5L2TA 4RC2A 2F49A 4XLIA 4EORA 3GI3A 4IAFA 2ZB1A 4C0TA 5ICPA 5IEXA 2VZ6A 4QP6A 3UJGA 2OFVA 4MYGA 1YW2A 1L3RE 2XK6A 3KGAA 4IB3A 2HWOA 5M08A 3FPMA 1Q24A 3QTQA 3KREA 5IA3A 4L46A 3WARA 1ZWSA 1BI8A 5BPYA 4FL2A 4AF3A 1OPKA 2E9PA 4JBVA 5HICA 5EHLA 5KMKA 3AC3A 4DCEA 1S9IA 4M97A 1YVJA 4X0MA 5HX8A 1UNLA 5ANEA 2VX0A 4P5ZA 5AV1A 4CKRA 1ZY4A 4DT9A 3E63A 2DWBA 1OIRA 3I60A 1GZNA 5DGZA 5M4IA 3NNWA 3I0QA 3NNVA 3W2PA 2XM9A 2YJRA 3ERKA 4M7IA 3OCBA 5IH5A 4IXPA 1H1WA 5HNGA 5AM6A 4TY1A 2VU3A 4KRDA 4RFYA 4HNIA 3CLYA 4F78A 1OL6A 2H9VA 3HMPA 5TO8A 1J7LA 4O4EA 1IR3A 4BCPA 4DLJA 4QMSA 3HAVA 4ZSJA 4OBPA 3RGFA 2BDWA 1OI9A 3PY3A 4TWPA 3HP5A 1I44A 4PMTA 2NYAA 5M09A 3QTIA 4N6ZA 3A4PA 3BZ3A 3G0EA 1JKKA 4HCUA 2GTNA 4G6NA 3ZUVA 3DNEA 3EN9A 2JEDA 4JJRA 5DH3A 1FVVA 4TYJA 4EH7A 4C33A 4ANQA 4CXAA 1CKJA 2YN8A 3CQUA 1BI7A 5FDXA 3QQKA 5IQGA 3RPOA 2R7BA 3W2QA 2BAKA 1ZOHA 2A19B 5AV3A 5IUIA 3VBVA 3ZTXA 4AOIA 4D1ZA 3NNXA 4UZHA 3R83A 3TNHA 4AT5A 1NA7A 2XVDA 4DH3A 4TL0A 3RM7A 4AQCA 4FTUA 3W18A 1R78A 5M07A 2VTHA 3QU0A 3R02A 5IDPA 4ACDA 3LKMA 4ZAUA 4EOOA 4ASXA 1Q61A 2QVSE 2OIBA 3DZOA 5BUEA 3ZFYA 3GP0A 5JFVA 2GNGA 4FYNA 2J2IB 2WPAA 2E9VA 2JKMA 4UXQA 4ZSEA 4JI9A 3MFTA 4O2ZA 2OFUA 2YACA 3R01A 4D4SA 3DT1A 2PVMA 4EH3A 3BGQA 4IZAA 3L8VA 3PZHA 3QYZA 4Z9LA 5DYJA 4YTIA 2ESMA 5F4NA 3E3BX 4FV8A 2OXYA 2RFNA 2Z02A 2YABA 2X7OA 4FSWA 3O7LD 5EYDA 3QTUA 3Q53A 3SX9A 2XCHA 1QMZA 3S95A 4B8MA 3CY2A 3U9NA 1ZAOA 2PVHA 2C0TA 4HYHA 3PSBA 4AUAA 4FK6A 5BNJA 4D2PA 1Q8ZA 3NAXA 4I4EA 4AGUA 3VUGA 5AP7A 4OT5A 3WF8A 3G9NA 1OITA 5CVHA 3NS9A 4M0YA 5EW3A 5BYZA 5CI7A 3NWWA 4RIYA 2XF0A 2UZEA 1GJOA 3V5LA 2AYPA 2PVNA 4WA9A 3UQCA 4I94A 4O7SA 1ZLTA 3DKOA 3EQIA 1O6LA 4BY9E 2ITZA 4C7TA 2YA9A 2VWXA 3PSDA 4FV9A 5D10A 3KRLA 5E8VA 3K5UA 4E6DA 2OF4A 5EYMA 3AGMA 3F3ZA 2C5YA 1TKIA 3TV4A 2ZMCA 4PPBA 3NYNA 2IPXA 3SDJA 4LV5A 4AT3A 5CNOA 4QP2A 2UW9A 4FV0A 1UWHA 1V0BA 4PX6A 3DDPA 3R9RA 2F2CB 4JIAA 2W7XA 4GT3A 4RFMA 1BUHA 3KRJA 2BKZA 2G2HA 2W99B 3L9LA 3QHRA 3OT3A 4FT5A 4P90A 4J98A 3WBLA 1Q99A 5AUUA 4EEVA 4JQ8A 4GYIA 2ZB0A 3DK7A 4HGSA 2XJ1A 5KHXA 1IEPA 2HZIA 2OO8X 4JG8A 1G8AA 3QKMA 3L8SA 4AZVA 3L9NA 4Q5EA 2X1NA 3EYHA 3HRBA 5HIDA 3LFNA 4EBVA 4YC3A 2PZYA 3VS5A 4E20A 4FG7A 5HD4A 3GXLA 3OC1A 5I9VA 5EI6A 3HZTA 5CI6A 4XCUA 2ITUA 2YISA 3CGFA 4NCTC 4QYGA 5IEVA 2YIRA 4E4NA 4W4VA 3TNQB 3Q4UA 4AA4A 3L1SA 4YO4A 3BHVA 3BI6A 2YIQA 3SXSA 4FG9A 4X6RA 2X0QA 3FMLA 3RCJA 3UMWA 3H9OA 2XIXA 3R8MA 5GZAA 1G8KA 4N0SA 3AT3A 4XOZA 3PVBA 1MRYA 2PU8A 4UZDA 2YM6A 3OTUA 3QA0A 5CEPA 5KHWA 4AXEA 4QMUA 4AW5A 2QD9A 4PF4A 3G9LX 5EDRA 2HIWA 3WE4A 5IA0A 1DAYA 3LJ2A 2CKEA 4LUEA 4RG0A 3GOPA 5BVDA 5CAOA 3FMHA 4UXLA 3QCXA 4C4IA 3RVGA 1MRUA 2NPQA 3UO4A 4ACGA 5KBRA 4B8LA 4FSMA 3UOHA 4KSQA 1YI4A 2HY81 3OHTA 5I9ZA 3CS9A 1B39A 1OIQA 3GENA 5AV2A 4BGHA 2C30A 4E4XA 3VBYA 2PUUA 5AP5A 4RC3A 4C38A 1M2QA 4FNXA 2ZV8A 4FOCA 3NZ0A 3K3IA 3RALA 3MB7A 2QOLA 4N6YA 5G1XA 4H05A 5FM2A 5AAGA 5L2SA 3PPZA 4HZRA 2UUEA 5AUTA 4F9AA 3WF9A 3FY0A 4FUXA 3GCQA 2HW6A 3KL8A 3MH1A 3VS0A 1PXNA 2WELA 3R28A 5M53A 3BHYA 2OG8A 5ANDA 3NRMA 4QMPA 4WRGA 4I20A 4R77A 2BAQA 4AOTA 4IMYA 4BFMA 2OLCA 2XK4A 3BYSA 4BICA 1JKSA 5FDPA 4JAJA 4QP9A 3EQCA 3QZIA 3QCSA 1PXKA 2ITYA 3FAAA 1YXUA 4F7JA 2QC6A 3ORTA 1I09A 5AJQA 2Z7QA 5B2MA 4QDVA 3DBEA 2GQSA 4E26A 4YLKA 4DEGA 1O6KA 3P23A 4ITJA 4X3FA 1ND4A 3GQIA 4BB4A 1YOMA 5I9UA 4ID7A 3F5PA 3RMFA 4HGEA 3JVRA 3F5XA 5HCXA 3P7BA 4FSRA 4PPCA 3UVRA 4A4XA 4E5WA 1JSTA 3C4FA 2X0PA 4E6AA 3B8RA 4OTFA 4DGLC 3OFMA 3R7EA 4AZSA 2Y9QA 4WD5A 4NIFA 5FXSA 3BLAA 3EN7A 5M57A 2BRHA 3FI3A 4MCVA 3FWQA 5B0XA 3LIJA 5CY3A 3REPA 2BVAA 3QFVA 3QRIA 5CNNA 3U8WA 4EKLA 5JFWA 5IQCA 3TKUA 2EXCX 3EQPA 4H36A 3C0HA 2XNGA 3BE9A 3FQSA 4QTEA 3CR0A 4YHFA 4C02A 3SG8A 3QLGA 2OZOA 5EQPA 3F66A 2IVUA 3UDZA 3E88A 4O86A 2W1EA 4NCTA 5E9EA 4JBOA 5JRSA 5TE0A 5EI8A 2C6DA 4X2JA 4Z16A 4XV1A 5D9HA 4YJUA 5EYKA 4BTFA 4F1MA 4KBAA 5CS6A 3UP2A 3ORKA 5C27A 2GHMA 3IG7A 5CWZA 4F0FA 3E8CA 4EHVA 1L8TA 2BZHB 4G3FA 4A07A 2OK1A 2RFSA 4GMYA 3G90X 4FTOA 4GJ3A 4OBOA 4L00A 2YHVA 2YAKA 3BYMA 4O0TA 2XJ2A 2IZUA 4FF8A 3DOGA 4I21A 4RIXB 3VQHA 3GU4A 5DI1A 4FICA 3V8SA 4UBAA 5HCZA 1UV5A 4P4CA 4PDYA 1ZYSA 3FYJX 5HG5A 1YXXA 4FL1A 3CJFA 4K0YA 3TNIA 3UVQA 4Y8DA 1ZYCA 3PJ3A 3FJQE 2WAJA 4R1VA 5E92A 3Q5ZA 5EHOA 1A06A 4RIWB 3U6JA 4Z7HA 5HBJA 2OZAB 3F82A 1YDSE 2WIHA 4LRMA 2HK5A 4Y5QA 4DEBA 2GQRA 2QG5A 5DWRA 4BIBA 2XK7A 5KMLA 3FMNA 2VTJA 2HXLA 3DS6A 3C4WA 3FZTA 4XV2A 2V7OA 3QAME 3BGZA 4BL1A 4JS8A 3NYXA 3R7VA 3W2SA 4OUCA 4WUNA 3CP9A 3SRVA 3ZONA 4BJJA 1K2PA 4C3RA 4J52A 3SC1A 1WVXA 2I40A 2WD1A 3EQHA 4LUDA 2OW3A 3UC4A 3QWJA 3ZSGA 2QOQA 1YRPA 4G17A 4P2KA 4R8QA 3TUDA 5J1WA 2WXVA 5JN2A 4WG4A 1YXSA 3FL4A 1NVSA 2G2FA 1ZARA 4IQ6A 4FGBA 1CM8A 3R6XA 3D7ZA 1BL6A 4XH6A 5H8BA 5HD7A 5ITAA 4U3YA 1O9UA 5GIPE 3HLLA 5IA4A 4D2SA 3CKXA 4FZFB 2W0JA 3TACA 1OPJA 3PFQA 3S1HA 5IH6A 5KO1A 3IOPA 4H1JA 2ACXA 3FLWA 3IPHA 3V5TA 3EJ1A 3D94A 4ONAA 3CD3A 4GEOA 1E9HA 4I5MA 4OTPA 2FSMX 3QA8A 2J0KA 3CE3A 3R04A 4PL4A 4ACCA 1YDRE 4F6SA 1NT2A 3R2BA 4Q9SA 2FYSA 4QMXA 4IWPA 3LMHA 5JGAA 2J5FA 4YPSA 5BUJA 5KMMA 4FE2A 2ZM1A 4G1WA 2Z7LA 2R3JA 3ZHPC 5I9WA 2PE1A 3RAKA 3COKA 4BDHA 3HV5A 5IISA 3W0QA 2Z8CA 4XRLA 2CJMA 2YIWA 3OXIA 3C1XA 3HECA 3MESA 4L43A 3TM0A 2IVTA 3KK9A 4G3DA 4JQ7A 4F7SA 3OVVA 2PUNA 4CD0A 3R8LA 2XK8A 2PK9A 2YFXA 4R7HA 5A3XA 4N4SA 3OTVA 5C4LA 3FXZA 2PZIA 3EFJA 3OWLA 3PZEA 2YZLA 3O8PA 4E93A 4NWMA 4OTRA 4ZP5A 4AXAA 2PY3A 4RSSA 4RJ4A 4OTIA 1FGKA 2Y7JA 2WTIA 3EKKA 4D4YA 4HGTA 3EN4A 2P55A 3FEGA 1P2AA 3O5AA 5CEOA 4K18A 1TZDA 2C3LA 3E3PA 4BIEA 2XS0A 3LE6A 4I0SA 3LM0A 4J71A 3B2TA 1GZKA 4W4XA 2XIKA 4QYEA 1YQJA 2IW6A 4M3QA 2VTAA 3MH0A 4X21A 5CEMA 3ZZEA 2A98A 1J7IA 1KV2A 2UZUE 3NAYA 1G8JA 3D9VA 2P4IA 4WBOA 2GMXA 3R63A 4PMMA 2WOUA 4S34A 5FXRA 4EUTA 2VWZA 4QMTA 2YCRA 2HZ4A 4D9TA 4FEXA 3C13A 3H3CA 1JBPE 3IO7A 5CEQA 5IMXA 5LVOA 2R3KA 1OM1A 5GINE 2CGVA 3IW6A 4H39A 4NSTA 3UG2A 5IQBA 3DAKA 3R71A 4IM0A 5DLSA 4MF0A 2PMNX 3HMNA 3IKAA 4U44A 3QD0A 4FT0A 4YHTA 5F9EA 4W9WA 4JRVA 3RPSA 3WOWA 2J0MB 4M14A 4II5A 1WZYA 1P14A 4MXCA 5HO6A 2IG7A 3HKOA 3V01A 3ZDIA 3ZLSA 2QLUA 3VBWA 4CCUA 4FEUA 4WNPA 4GCJA 4XP3A 5IKWA 2WEIA 2X9EA 3KVWA 4V01A 1KE8A 4JL9A 3TKIA 3IQ7A 3HV6A 4ZLOA 3UQFA 1ZOEA 3OP5A 3CC6A 3QTRA 4X2NA 5AUZA 5KMOA 1VYZA 2DQ7X 4M15A 4FT7A 4OTQA 4GRBA 3UP7A 2G15A 3FQEA 3UIXA 3C51A 4AN2A 4BN1A 4UWBA 4B0GA 4KS8A 4DEAA 3AKJA 4KKHA 4JMQA 4OAVB 2C1BA 3VONA 5J9ZA 3BE2A 2WTVA 2Y4IB 2FO0A 4UALA 3W0NA 4NT4A 1YHSA 3DY7A 4RZWA 1PXJA 2B54A 3PWDA 4FNZA 2X8IA 3GNIB 4F0GA 3RHXA 4L01A 4BYIA 2B1PA 2WFYA 4A7CA 4EC8A 2EB3A 5CXZA 4NKSA 5BYLA 5AAFA 3EYGA 2FA2A 2V0DA 2VRXA 3ORPA 3RNYA 4YURA 3P1AA 1ZXEA 4CTCA 3E92A 4GJ2A 3SAYA 4HZSA 4ITIA 4BZOA 3DAEA 3AC2A 3TNPC 4HVSA 2VWYA 4GU9A 4IJPA 2IVVA 5JT2A 4BBMA 3UE4A 3PFYA 5CAUA 4KB8A 3QXPA 3D15A 3MH2A 2W1GA 2QOCA 3TMOA 5LMKC 2PSQA 3V5WA 3WZDA 5HE0A 2GNIA 4IZ7A 4I0TA 4LG4A 3BL9A 3ZXZA 2PVKA 4FI1A 4JBPA 3JY0A 2ZOQA 4QT1A 3PUFC 3BELA 3COMA 5EI2A 3JY9A 3NUSA 4FKWA 4WHZA 5KZIA 4IZYA 3UO5A 3OZ6A 5L4QA 2JDOA 4FKSA 4OBQA 4AZWA 2XH5A 3N4UA 1U5QA 3ZOSA 3PXZA 4A9UA 2CNQA 3ORZA 4NM0A 3K54A 4G5PA 3TG1A 4I6LA 5ANOA 4I6FA 4GV1A 4D1XA 3NUUA 1J1CA 1PMEA 1UA2A 2CLQA 3PA4A 4OTDA 1YHVA 1MP8A 4U43A 2CNUA 3O0GA 1UKIA 4QTCA 3KVXA 5JRQA 3MA6A 4FSUA 4MBIA 4WSQA 5E8TA 3GC0A 5AA9A 1YI3A 3PE1A 3SXFA 3KXXA 3ZLWA 5CAPA 5IF1A 2IZTA 1WBSA 4QQTA 4O82A 4GUEA 5AP1A 3MPMA 5FP5A 3E7OA 4IAAA 2E9UA 5HG7A 2C69A 5AFVA 3RM6A 2C4GA 2YM4A 1U4DA 2WMAA 5D7VA 5ACBC 4JLCA 4AX8A 3C7QA 3ZS5A 2Y0AA 2F7ZE 4WO5A 2UW4A 2WMBA 4LYNA 4DCAA 1AQ1A 4I23A 5AUWA 4CFNA 3A8XA 1J7UA 3FSKA 4D28A 5A4LA 2EVAA 1H8FA 1G8SA 3PIZA 5E8UA 3O96A 1ZRZA 1W98A 4DDGA 2PZPA 2RIOA 3BX5A 4AE6A 2OKRA 2YCFA 5ETCA 4ERWA 3O71A 3PJ2A 5IZFA 5LVNA 3PRIA 3VS6A 3KRRA 4NYEA 4O0VA 2E9NA 5GIOE 4K77A 1WBTA 1WBNA 3LJ0A 4PQNA 3A2CA 4U42A 3T9IA 4FYOA 4QPAA 4AZFA 2XCKA 1TFFA 4YBJA 1CSNA 2BZIB 4MD9E 2RG6A 4AOJA 3RWPA 4RIOA 1KE5A 4DFZE 2Y8OA 3AGLA 4X3FB 3IW5A 2R3IA 1CKIA 2VTSA 3W8LA 3C5IA 1H27A 2WMXA 4AW2A 1IRKA 3F3VA 3WF7A 4LGGA 4EOMA 4F64A 1Z9XA 1ZMWA 3NGAA 5HU3A 3BRBA 2WTCA 2JBOA 3N9XA 4C58A 4NH1A 4D2RA 3ZSIA 3MGYA 3ORIA 2QQ7A 5FGKA 1XR1A 3UC3A 3VIDA 4QQCA 1IG1A 3GC7A 2PMIA 5LCKA 3GU8A 4NJDA 4EBWA 3RPYA 4B4LA 4L44A 3V8WA 2VTPA 3AC4A 3VF8A 3FQHA 4KKEA 2A0CX 3VHEA 5HEZA 2GU8A 4CMOA 5H3QA 2OJIA 4M67A 3S2PA 4QP7A 4U6RA 4YUQA 2XK9A 3QTXA 1QPJA 4O38A 2OI4X 4CMUA 5LMKA 3Q96A 5E8WA 3Q6UA 3V8TA 3HA6A 3OWKA 3FSFA 5L6PA 4OAUC 4K1BA 3UDSA 4MXXA 2WTWA 4QTAA 5CU3A 3R8PA 4CKIA 4KUJA 1DAWA 2BZJA 3L8PA 4EWQA 4AAYA 2EXEA 2FSLX 3FZPA 4L6QA 4NIFB 5CQWA 5TR6A 4F6WA 5AAEA 2B53A 4NW6A 3ANQA 4X2KA 1DM2A 2W4OA 4FTTA 5CAQA 5LWMA 3O8TA 4D0XA 2C6MA 4FNWA 2F7EE 2BRGA 4YZMA 2JLDA 5IUGA 4A4OA 4RC4A 4GUBA 4FKRA 1FVTA 2R3FA 5I9XA 4RX7A 4WOVA 2BILB 5ETAA 5GNKA 4RIXA 4O0XA 1WFCA 3NCZA 2UZDA 5DIAA 3H0ZA 4BBFA 4F9YA 4UYNA 2ZV7A 1JVPP 2JFMA 3CTHA 2H8HA 4C35A 5B2KA 4DGOA 3F3TA 4GU6A 3AC8A 2Q0NA 3F61A 3ORLA 4O81A 2VTOA 2YCSA 5A54A 2OZAA 4U8ZA 2F7XE 4QYYA 3UO6A 4BR3A 2Y6MA 3VC4A 3BLQA 4JG7A 1YOJA 3POZA 2OH0E 3D14A 3SRVB 2NRYA 3S4QA 4BJJB 2F2UA 2VN9A 4M68A 1UU9A 2ITWA 4MNEB 3EFLA 4BF2A 4L7FA 3IW7A 4J95A 2UW0A 4IZ5A 3C4XA 5CXHA 2HW7A 3BKBA 2C1AA 1OBDA 2GNFA 4FNYA 3SGCA 4I24A 5FEQA 5AP2A 1K3AA 2ERKA 4FRFA 2QOIA 3FLQA 3V5QA 1WBPA 4APPA 3TUBA 3MFUA 2FSTX 2O0UA 3QRUA 1DI9A 2CPKE 1V0PA 3UYTA 4BWKA 4F9CA 1VEBA 4BDIA 5BQ0A 2IVSA 3T3VA 3VHKA 3S00A 3DLZA 5IUHA 2Z2WA 3D0EA 2ETKA 4ARKA 4O27B 5HQ0A 4EC9A 3Q3BA 4GL9A 1P4OA 2Y4IC 4HYIA 4L7SA 4FTCA 2WQBA 5J9LA 4AACA 5KNJA 4UV0A 5BVFA 5E90A 1OIYA 4KBCA 1JQHA 3LCOA 5T6KA 4CZUA 5JH6A 4YU2A 3MY0A 4CV9A 2CKPA 3N4TA 5IQHA 3O51A 3UNZA 3AKLA 4FTKA 2UVYA 5CSXA 4FL3A 3QQJA 4TN6A 5HTCA 2GHGA 4QYHA 3AG9A 5D11A 2Z7RA 2Z60A 4L42A 3QYWA 1WMKA 1LR4A 2IF8A 4IEBA 4X2FA 2GFCA 2JGZA 4IVDA 5FTGA 3BCEA 4S2ZA 3V6SA 3I7CA 4RFZA 4G6OA 4XHKB 4PUZA 2QO2A 3PPJA 5L8LA 4UEUA 4MUQA 4HVIA 3KFAA 1ZZLA 2WMSA 2KULA 1FMKA 3LVPA 4I5CA 3BBWA 3TWJA 3ZC5A 4QMQA 3UQGA 3R1YA 4M66A 4R6VA 2EB2A 3D5XA 1DI8A 4IH8A 5J5SA 5AR7A 2R7IA 3ANRA 4O22A 4IACA 4S32A 1CMKE 2JAMA 3HX4A 3P5KA 3TZ9A 5CANA 4BZNA 2ITXA 4JDKA 3A7FA 2X7FA 3GU5A 1H01A 3VAPA 1KOBA 2VWIA 3IONA 4IW0A 3R22A 2LAVA 2OIQA 3SA0A 3DXNA 4JX7A 3OF0A 3ELJA 2QOKA 3UPXA 5C26A 1Z57A 1FMOE 3LFEA 3OY3A 4PDPA 5DT0A 1CTPE 3RAWA 3FY2A 5IU2A 4BKZA 4X7QA 4DFUA 2ZMDA 1R0EA 3GBZA 2XBJA 3QKKA 1WBOA 4XYFA 4NFMA 4FIHA 3C0GA 5HZNA 3LZBA 3M11A 4I0RA 1OGUA 4DHZA 3DA6A 4C57A 4EZ5A 2VTIA 4IB1A 4K8AA 4BDJA 5HGIA 1BL7A 5BVNA 4RVTA 1RW8A 3K3JA 4L67A 5A9UA 2BHHA 3EIDA 3DV3A 5CSPA 4USDA 3FXXA 4KINA 1MUOA 3G33A 4QMWA 5HE2A 3AKKA 4BTJA 2QU6A 5AX3A 2XYUA 4O6LA 2V7AA 5AR4A 4DH7A 5M44A 1PYEA 4IC7A 3FV8A 2WTKB 4YR8A 4DHIB 5AR3A 2JKKA 2J6MA 3KMWA 1G5SA 3B8QA 4FKGA 3R7UA 5G6VA 3O50A 4FG8A 3CQEA 4O21A 2PL0A 3NW6A 2R3LA 5AR8A 3LFBA 1GZ8A 2ONLA 4QOXA 3Q04A 1ZYDA 4U45A 4XX9A 5HVJA 4BRXA 3PXQA 4O0YA 4QPMA 3F3WA 1G3NA 4IX6A 4UMRA 2XALA 4RVMA 5CF8A 4LFIA 4G2FA 3R00A 3E7VA 3Q5IA 4FIIA 4X3FC 2VTLA 4IAIA 2EU9A 3V04A 1OKZA 4C4HA 4YP8A 2HCKA 1XH9A 3H9RA 4RZVA 3U4UA 4DC2A 4DH8A 4EWHA 3IOKA 2W4KA 3HMIA 3V5JA 3FLZA 3R30A 2BUJA 3FKLA 4XEYA 1JSVA 2EUFB 3D5WA 3W8QA 2B0QA 3DBFA 5JGDA 4ZJIA 3QD2B 4I6QA 4AN9A 2W5HA 2GNLA 5C8NA 3POOA 4Z3VA 1LP4A 4E5AX 1VLRA 2OGVA 4RWKA 3JR1A 2BZKB 3QLFA 1Q41A 4FVQA 4UMUA 2XK3A 1TQIA 3IGOA 1OKYA 5JGBA 3NIZA 2YEXA 4FZ7A 1Q4LA 4XLVA 3UDBA 1WBVA 4MTAA 1YWVA 3O8UA 2XNEA 3GFEA 2J0LA 4FIJA 3BBTB 1ZY5A 4ANOA 4YO6A 4CG8A 3ET7A 4JDJA 2YM5A 3SVVA 3VUTA 2NO3A 5AV4A 1SVEA 5FQDC 2GS7A 2YDIA 4ZMEA 4M12A 3II5A 1SZMA 3CTJA 2G01A 4FKPA 4PP9A 2W05A 2VAGA 4Q2AA 4V04A 3WIKA 3ZM4A 5LXMA 1UKHA 4EL9A 4RQVA 3MVLA 2O3PA 4RX8A 3NUXA 2X2MA 3PP1A 4BDBA 5HTBA 3W0RA 3HYHA 3A62A 4G3CA 5JK3A 2XANA 2ZDUA 4ZTQA 3ULZA 5ETFA 2WGJA 4L68A 5BUIA 3W0PA 1PXOA 2WO6A 4TPTA 1VZOA 1JNKA 3LXLA 4OT6A 4RQKA 4ANMA 3ACJA 3DK3A 5DR9A 5AP0A 3KXZA 3OWJA 4ACMA 5CF5A 3HMOA 1RJBA 3TV6A 3VBTA 5L2IA 3HA8A 4EK5A 4AAAA 3EQGA 4EK3A 3VW6A 2CGUA 5IEYA 3FMKA 1YI6A 4TZRA 3IDBA 4B99A 4O2PA 4DHJA 3HP2A 1Q3WA 1YHWA 2X39A 2XZSA 5KUPA 4TKSA 4TRLA 1PXIA 4MEDA 3U87A 3SG9A 4CZTA 4LI5A 4ASZA 1U59A 3MTLA 4QP1A 3MY1A 3KXHA 4C4FA 3OXTA 4EJ7A 4A9YA 4ZJVA 1F0QA 1E1VA 4DT8A 5DFPA 4JR3A 5FUTA 3KKVA 3DJ5A 3MBLA 4RLKA 4ZS0A 2PHKA 1UU8A 2WMTA 2ZYBA 3GVUA 4MHAA 4PL5A 1XJDA 3M1SA 4AN3A 4ZY4A 2R2PA 4FSTA 3OS3A 4GH2A 3TUCA 4NM3A 4HCVA 1LPUA 3ENHA 4ZZNA 3P9JA 3W2OA 3LCSA 3OCSA 2OJJA 4GG5A 1WVYA 3TTIA 2CGXA 4M84A 3BQRA 3FC1X 4LGDA 4KIPA 2BDJA 4DFLA 4CZYB 4P5QA 2NRUA 3VUMA 2W1CA 2QURA 3QL8A 3QUPA 3CGOA 2FUMA 3ZRMA 4QEBA 1PXLA 4XG9A 5K0XA 3D7TB 3RI1A 4BI2A 2F9GA 3F6XA 3U54A 1Q8UA 3LFQA 3W33A 1VR2A 4EZ3A 2C47A 4MWIA 3ALOA