3NW6A

Crystal structure of insulin-like growth factor 1 receptor (igf-1r-wt) complex with a carbon-linked proline isostere inhibitor (11a)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
301
structure length
301
Chain Sequence
VYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Insulin-like growth factor 1 receptor
publication title Proline isosteres in a series of 2,4-disubstituted pyrrolo[1,2-f][1,2,4]triazine inhibitors of IGF-1R kinase and IR kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 301
sequence length 301
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nw6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nw6A01
4FIHA 3U54A 5DGZA 4WG5A 3CXWA 3E8CA 4G3EA 4W4XA 1PXLA 1V0OA 3BWJA 4FV1A 5DEYA 1F0QA 4BHNA 4N57A 4E7WA 1OI9A 1ZYDA 4Z7GA 1WBOA 2C47A 3ANRA 5BQ0A 4PP7A 3QUPA 3FPQA 2NP8A 2YDKA 1CKIA 2GNLA 3AMYA 5J7HA 2FH9A 3R7IA 4F0GA 3EZRA 4Q5HA 4HCUA 5DPVA 3CTQA 2X2MA 4I5HA 3VF9A 4EWHA 5IA3A 4ZS4A 3MVJA 3GFEA 3MA6A 3NUPA 4HPUE 4LGDA 4C33A 4Z3VA 5A14A 5IA2A 3UMXA 3TKUA 4PUZA 5DVRA 3GQIA 5CT7A 3RPYA 4I1ZA 4X3FB 3G0FA 3HV7A 4FSWA 2WD1A 4OLIA 5G1XA 4D1XA 3QGYA 2H34A 4O0YA 3ZFXA 4FSUA 2GCDA 2GHLA 4YJQA 5CWZA 5J8IA 4C3RA 4F65A 5JFVA 2QOHA 3ZXTA 5TO8A 3F7WA 4EHGA 1OKZA 2WTIA 3R7EA 3K3JA 3FLSA 4NKSA 4EH3A 3R7GA 5EI8A 3T8OA 3JY9A 4BDFA 5EKNA 5M07A 1SNUA 1VYZA 1WVWA 4AT4A 3IKAA 1P2AA 1AD5A 1ZY5A 2W17A 5CVFA 3QALE 5AP5A 3IDBA 5M44A 3N4UA 5AIKA 1WBNA 1BL6A 5JEBA 1E9HA 4RJ6A 4L00A 5BYLA 3DBDA 2P55A 4FKQA 5LCJA 4M69B 5IEVA 1Q24A 4IJ9A 4N70A 4GK4A 4C58A 3GCVA 2AC3A 5CENA 3FWQA 2I6LA 3F5XA 4XS2A 4EC9A 4BCGA 4F1MA 4ZLYA 3R02A 3VUIA 1XJDA 1ND4A 3R00A 5C4LA 3C5IA 2GDOA 5DH3A 4QYHA 2HW6A 3L9MA 3OBJA 5IUIA 4RIWB 3F82A 4I6HA 5J5TA 4L01A 3R2YA 4CEGA 1YWVA 2P33A 5M08A 1BKXA 1O6KA 3TKHA 3VHKA 2C5YA 3Q4UA 5BX0A 1J7IA 1FPUA 3ENMA 3ITZA 2OF2A 4CSVA 4DTAA 3SKCA 4JNWA 4FGRA 3ZFYA 4ZLZA 4N6ZA 4DH8A 1SYKA 5CTPA 4HCVA 1WAKA 4YC3A 2YISA 4O0RA 4IW0A 3KCKA 3PIZA 3QTSA 4IDTA 1H1RA 4FOCA 1Q99A 3P4KA 4RQKA 4DG2E 1U59A 3R9NA 4KIPA 2BKZA 4MBJA 1OIYA 3WF6A 3II5A 5HLPA 5FXQA 1PRYA 2WMTA 2XEZA 2VTMA 3OY1A 5E1SA 4DG3E 2OO8X 4U0IA 2W96B 4S31A 4FZDB 4TN6A 4AN3A 3TDWA 2CLXA 2R3RA 3VN9A 4PTCA 5EYKA 1UKHA 4W9WA 2YERA 5E8VA 5EHLA 3ORTA 3K5VA 4I94A 1UWJA 2YAKA 3ZLSA 3NW7A 3CKWA 3LFEA 4LGGA 5HTCA 4Y72A 2BAKA 2FO0A 3EMGA 3QKKA 4JG7A 3TNWA 4FIJA 5JT2A 4OTHA 3A7HA 3P5KA 2J0JA 4G3FA 4JBVA 4BN1A 2Z8CA 3ZO2A 4NFNA 3DLSA 5CT0A 5JKGA 5CI6A 2YM7A 4DFNA 4YUQA 1YVJA 2GS7A 4IVBA 3NS9A 5JGDA 4FTTA 4ZY5A 5LMBA 4DA5A 4C2VA 1ZWSA 3F6XA 5KHWA 4CQEA 4EK6A 3QKMA 2C3JA 1W0XC 4U6RA 3OEFX 5EOLA 5GZ8A 4BTMA 1CDKA 4XG2A 4E4LA 3MVLA 2GPHA 1OMWA 5AV3A 3VBXA 3P7AA 4KKHA 2BRGA 5AR2A 3GU6A 3CJGA 2P3GX 2XCHA 2UW8A 1MP8A 4CFVA 3DKCA 2PE1A 4XP2A 2DUVA 3A7GA 5I9VA 4KRCA 4RIXA 4GMYA 2R3KA 3ZM4A 2RGPA 3FHRA 4O96A 1YI3A 2ETRA 1UU3A 3RWQA 3R7YA 2OH0E 2WTDA 1HCLA 1U54B 4JJRA 4M67A 3DNDA 3V6SA 1NT2A 1MQBA 2E9UA 4XJ0A 1U4DA 3FKLA 4RJ8A 4X6QC 2F2CB 4IM0A 2BROA 4GRBA 4AW0A 3QBNA 4C8BA 2GNFA 4X3JA 3FMJA 5M55A 2ZV7A 4ZSEA 3QLFA 4J95A 4AOTA 4RA5A 4JDKA 3OWLA 5FXSA 3UPXA 3V5LA 4HZRA 3GGFA 4ITHA 2ZDUA 2UZWE 4TKSA 3QTIA 5H8EA 3LAUA 4H1JA 4RVMA 3DXQA 3BELA 5BVWA 2C5OA 2UW4A 5KNJA 2YEXA 3MWUA 2C0OA 5CSVA 5DMZA 3SAYA 1JKTA 3TV4A 5IUHA 2UZVA 1W84A 4WRGA 4G5PA 4XP0A 5F95A 3V6RA 3EQDA 1LEZA 3EH9A 3MFSA 3D5XA 3QXPA 4FV8A 3W2PA 1L8TA 4J52A 3WE8A 2OLCA 3UMWA 1GZKA 2ZMDA 2ZMCA 3DJ7A 4RC3A 5FTQA 4PNKA 4LOOA 4CKJA 2OK1A 3VS0A 4S34A 4DFZE 1G8SA 2R3MA 2WMQA 4DFXE 5FXRA 3KY2A 5AR3A 1H1QA 2H6DA 2E9NA 4EK3A 2XNMA 3OFMA 3Q6UA 5K5NA 4RBLA 2ACXA 3C4ZA 3EFLA 3BYSA 3JXWA 2R3HA 4BCPA 3UC3A 3LFQA 4GK3A 3OF0A 4GYIA 4OTDA 5IQHA 3ZC5A 1YXSA 3L8XA 5JQ8A 2CJMA 3NEWA 3TI1A 3EFJA 1AQ1A 2VWVA 2EXCX 2LGCA 1GIIA 4KSQA 3R8VA 5LMKC 1GJOA 4D2RA 5AR8A 4QQCA 3PVWA 4FI1A 2UZDA 2OIQA 5L8LA 3ZM9A 5IQEA 4R5SA 4LGHA 2XYUA 4QP9A 4WG3A 2Q0BA 2ETMA 5ANJA 3ZH8A 2YDJA 1VR2A 3KA0A 4XCUA 3Q5IA 5JSMA 3ENHA 4XLIA 5BVDA 4IZ5A 2R3OA 3VBTA 2W0JA 4HYHA 4O38A 5CZIA 3PIXA 4I41A 5J95A 4ANSA 5KMOA 3PPZA 2R3GA 5IKWA 4GT3A 3LCOA 2QOBA 3WZDA 3CSVA 5EM8A 4AZSA 2C5NA 2R7BA 4EJNA 3ZU7A 3ZSHA 1IA9A 2ITUA 3F3UA 4NM7A 4CQGA 4G16A 2X9FA 2FYSA 2BFYA 3GU5A 3BYVA 4IB0A 3ZFMA 3I81A 4BL1A 4C2WA 4KIKA 2OJ9A 1OL6A 2CGUA 4ORKA 4LG4A 3MDYA 5HU3A 1OKWA 2BIKB 3DKFA 3NYVA 4ZZOA 4NUSA 3FI4A 4QYFA 5CYIA 3RPOA 3DFAA 3WF5A 2X4ZA 4DBNA 4EZ5A 5DR2A 4GKHA 2JIVA 4V0GB 5I3OA 3RK5A 1Q3DA 4G1WA 4B99A 3FZSA 1JAMA 5DR9A 2CLQA 1KV2A 3VO3A 3UIXA 4O27B 2BIYA 4WSYA 4DEDA 4ANQA 4NW5A 2WEVA 3WF9A 3FQHA 3GT8A 1GIHA 4PMTA 3P1AA 2YABA 5AP1A 3NUUA 4RWJA 2J9MA 2YCFA 4O6EA 3ZBXA 4BKYA 4K18A 2PUPA 4F7LA 4U42A 4DBXA 2V0DA 4GEOA 2JIIA 4IDVA 3KXGA 3C7QA 5T68A 3UC4A 5J9ZA 4KKEA 3LMIA 3R1SA 3CJFA 4RIYA 1HCKA 4EHEA 2VO0A 1DM2A 3PXYA 3ZO4A 3S2PA 4C59A 1FVVA 2IZRA 3Q04A 5IA4A 2BCJA 2IVVA 3NAYA 3TIZA 4E3CA 2UZUE 4YMJA 3ZS5A 2G1TA 4KB8A 3Q6WA 4OUCA 4WG4A 5HGIA 5E8TA 5CEKA 5TT7A 3FL5A 3VW6A 1JPAA 5HESA 3HAVA 1H1WA 3LFCA 5AIRA 3R1YA 3PDTA 3N9XA 2UVZA 3KULA 2QOQA 4YZDA 4GS6A 3QF9A 1OPKA 1SVHA 2WTJA 5HZNA 4AGCA 2QO7A 2PMOX 4LRMA 5EH0A 4I21A 2Y6OA 3IQ7A 3NCZA 2W5AA 2G15A 3PYYA 4O0WA 2I7QA 3ZOSA 4C4FA 4GKIA 2XKFA 3KN6A 3B8QA 5TR6A 4NK9A 3P23A 1YXVA 2PE0A 1ZY4A 4H36A 2XRWA 1IAJA 4KABA 3QL8A 3GFWA 4JRVA 4RWIA 3DXNA 4BZNA 3U9CA 1F3MC 2I40A 4C7TA 4L42A 4ZLOA 3O7LD 5B7VA 2UW5A 5AP6A 3BEGA 4DAWA 5DA3A 1TQIA 2W9ZB 2V7AA 3FBVA 1OIUA 3L9PA 2W05A 3QQJA 3R2BA 3EKKA 4O0VA 5AM7A 4BI1A 3QRIA 2WKMA 4YHTA 3P9JA 3E7OA 4RVLA 4AE6A 5BMMA 4F7NA 1PHKA 4YNOA 2VNYA 3SLSA 3OCTA 2QVSE 4RJ5A 4GL9A 3RK7A 1Q3WA 5D12A 5T3QA 1OBGA 5D10A 3O50A 3VUDA 4BKZA 3UNJA 3C9WA 5LVMA 2PSQA 3FMLA 3D94A 2VD5A 4QMYA 3D4QA 1JKSA 4RX9A 1K3AA 2XNNA 2X6EA 1JOWB 2YM5A 4WUNA 1NA7A 3DBCA 2HY81 1BX6A 3AMBA 2VWBA 4M13A 5CNNA 4EYMA 3M11A 4F70A 4ANMA 4JVGA 4UMRA 2BHHA 2QO2A 2C6LA 4FICA 4IVDA 1H0VA 5DI1A 1GNGA 4C4JA 4ZSAA 5L2IA 1OUKA 2YFXA 2IVTA 5KBRA 2YWVA 3FPMA 5CSPA 4QRCA 4HZSA 3LE6A 4FOBA 5AUTA 4RFMA 3W8QA 4JR7A 2XEYA 2WIHA 3ORIA 4YJRA 3U4UA 3K2LA 1Q8TA 2YA9A 3DDQA 2WO6A 3E8EA 3NVMB 3SG8A 4YBJA 4AFEA 2IWIA 4I4FA 4YJNA 4XH6A 4DGNA 2VNWA 3A8XA 2J6MA 4CFXA 3S1HA 2WMXA 1YHWA 4R1VA 1WBPA 5AADA 3VIDA 4CCUA 1R1WA 2OG8A 3ET7A 5EYMA 4EOOA 3D14A 3BV2A 4OBPA 3BBWA 2GNJA 4NM0A 3A62A 5AUWA 4CKIA 4CYIA 5A6OA 5CSWA 2OXXA 3VUKA 3UNKA 4ZSLA 1H27A 2C6IA 2F4JA 2XIKA 3HL7A 4PPAA 3GP0A 3Q60A 4XBRA 4FZAB 5CX9A 1Y8YA 2WMSA 3RPSA 3C50A 3HECA 2J5EA 2OZAB 4C3PA 5LWMA 2I1MA 2PVFA 4QTDA 1XR1A 3PXFA 4BBEA 4EH9A 1XH8A 3V5JA 4XX9A 2O0UA 3AT2A 3HRBA 2X39A 5A4CA 5E8YA 4UXLA 4FL3A 4IFCA 3MGYA 2NRYA 4L3PA 4TZRA 3T9TA 4TYHA 4APCA 5KMIA 3NUAA 2GMXA 2UW0A 4I22A 2ITNA 5FTOA 2PPQA 4G2FA 3ORXA 3HRCA 3GBZA 4KINA 1H28A 2XK8A 5HI2A 3R83A 4Y85A 3M2WA 4GSBA 3WF7A 3H9RA 2XF0A 3PP0A 3LVPA 4FL2A 1V0PA 5K5XA 4YTIA 5M4FA 1OECA 4ZZMA 2C3KA 5HTIA 2ITPA 2WNTA 3WIGA 5L2TA 4EOKA 2X7FA 3HKOA 3EQIA 3LJ2A 4GT5A 4WNMA 2O3PA 4YZCA 4AXAA 3B2WA 2GHMA 5D7VA 2V22A 4UMTA 3NW6A 3AC3A 3EN4A 4LOPA 3VRZA 5ANKA 4YJOA 2RKUA 3LMHA 2QLQA 1PMEA 4FNZA 4I0SA 3V5PA 3IECA 5HG7A 3OTVA 5AMNA 2WHBA 4JRNA 2BFXA 5H8BA 4YC6A 3O96A 1WZYA 4LRJA 4O21A 4WNPA 2XJ0A 4L9IA 4AGDA 1U46A 1U5QA 3BYOA 5HU9A 3RNYA 3R22A 4ALWA 3OD6X 4EOJA 4M0YA 2OBJA 2VU3A 3D0EA 4BCFA 2FUMA 1R78A 3E64A 5JN2A 5HCYA 3NZ0A 1V0BA 4YU2A 4D2SA 4CKRA 2J4ZA 5HIDA 4BCMA 4BDEA 3TCPA 2QLUA 3BU5A 1R0EA 3UP7A 4D9TA 3NVKI 1CKPA 1K2PA 2JAMA 3UVQA 3RNIA 3COMA 5LARA 4UXQA 3MY1A 4DEEA 3NUYA 3VUHA 3C5UA 3FC2A 3PA3A 2JITA 3AD5A 3KKVA 2CHLA 4TT7A 5A4LA 4HGTA 2OH4A 3KB7A 2WFYA 2VX1A 5EQYA 3DTWA 3BV3A 5CAVA 4MVFA 1TQMA 3F5PA 2GQSA 4F9BA 3CTHA 4OAVB 4D5HA 4IXPA 4LL5A 1REJA 2F57A 3JR1A 4C4HA 3QYZA 5AR4A 3ID6C 4M8TA 2EWAA 3MFRA 2W1CA 4NTTA 2JKOA 4NIFA 2QCSA 2OJIA 5HG9A 2XMYA 4PRJA 3RM6A 3PSBA 3VBQA 4AT5A 3FZOA 4FL1A 4QNAA 2OI4X 1H01A 4FKTA 4NM5A 4HVHA 4HPTE 4FVQA 2W1DA 2GS2A 3PLSA 2VV9A 4D9UA 2B52A 5LMKA 4B7TA 5LQFA 4FEVA 4OTFA 3JS2A 4D0WA 5CZHA 4BDAA 3CY3A 5E1EA 4GIHA 4DEAA 4BKJA 2ZVAA 2IW8A 1PKGA 2QI8A 5FDXA 3K3IA 4F1OA 3UQFA 3AD6A 4L67A 2PVRA 3R9DA 4M7IA 4QYEA 4YSMA 2V5QA 1I09A 3DAKA 3LJ0A 3QX4A 4EJ7A 1WVYA 3QQKA 3RPVA 5FBOA 2PE2A 4AW1A 1PYXA 3QUEA 2BRBA 5GINE 2QHMA 2R4BA 4MH7A 2WGJA 4O0SA 2XP2A 3TZMA 2YIRA 4QP1A 1OUYA 3LZBA 4BI0A 4BGQA 1PMUA 3REPA 3LQ3A 3TACA 2Z7LA 4MXZA 3PLAE 4E5WA 3PA5A 3E88A 3IOPA 3V01A 4I6BA 2RIOA 2IVUA 1OITA 1PXKA 5A6NA 3THBA 4AN9A 1TQPA 4I5CA 5IQAA 2WMRA 3JYAA 4GVAA 3OY3A 4BF2A 3PY3A 3UTOA 4HYIA 3IW6A 1H1SA 4FV4A 4W4YA 2ITYA 4CMOA 2YCQA 4NSTA 3C4FA 4XMOA 4DCAA 1H08A 5EFQA 4RWLA 3LLAA 1H4LA 4XG3A 1SZMA 3MJ1A 3NSZA 1WBTA 4FTRA 5GNKA 2R3NA 3MB6A 4OTRA 4J99A 3G5DA 4PL3A 5AP0A 5K3YA 4NYEA 2WMVA 2HWPA 3MYGA 2DWBA 4NU1A 4MX9A 4TWNA 2I0HA 4C36A 3HP2A 3RAKA 4D4VA 1MQ4A 5BNJA 3CD8A 3BWFA 3ZO3A 5L2SA 1XBBA 5CF8A 2HOGA 2HIWA 3CIKA 4U44A 4MQ2A 4FTAA 4FKRA 5I9ZA 4E5BA 2W1IA 3LCTA 3PJ1A 3SV0A 3QHRA 4NKAA 3A7IA 2P2HA 5HTBA 4YTHA 3LHJA 4R3CA 4ARKA 1B39A 4FG9A 4O2ZA 2WB8A 3PVUA 2HZNA 3O8TA 5CU2A 5AUVA 3ATTA 4Z7HA 2FB8A 4Q2AA 2OGVA 4DYMA 4IX5A 3F2RA 4F7SA 3NYNA 4M15A 5GJFA 3QAME 3RAHA 5CVHA 1OL7A 4P5ZA 2Z60A 3FLWA 4M68A 4EBVA 2GNGA 3LLTA 4DFYA 3GOKA 5AFVA 4HGEA 4M12A 4F0FA 2VO3A 2XH5A 4FV2A 4KRDA 2PUUA 2X0GA 3GENA 5L6OA 3DLZA 1ZOEA 3QWJA 4AA0A 5FM3A 4O7LA 5B2KA 4IM3A 5C26A 2RFEA 3FMHA 4IWOA 5HLWA 4UALA 3EQGA 2C69A 3OMVA 4XP3A 5TKDA 4CV8A 3IGGA 4GU6A 1NVQA 4Y46A 4U97A 2B9IA 5CANA 3D15A 3E3PA 5EHYA 4J8NA 2H96A 3QX2A 3MN3A 4G5JA 2CGXA 2VTQA 4J53A 1BUHA 3DB8A 4X2JA 4D4YA 3ERKA 3LQ8A 5IA1A 1YHVA 3FSFA 4HNIA 4MHAA 4EONA 2ZM4A 2NO3A 2G01A 1SVGA 3QA0A 4OT6A 4UY9A 2YAAA 2Z2WA 3VJNA 4EWQA 4EZ3A 1XH7A 5FLFA 4IADA 4NH1A 4WBBB 3POOA 3D5VA 4TYGA 2OJJA 3HA6A 4ANNA 3BIZA 3HV4A 4BFMA 1T45A 5EG3A 3UZRA 5BUJA 3M42A 2OJFE 3FMKA 3NAXA 5HBEA 2F9GA 5M4CA 1YDTE 3R0TA 2XYNA 2YCSA 3VWAA 5DE2A 1BL7A 1IASA 2A0CX 2C5XA 5HEZA 2QNJA 2FVDA 4FNXA 3HAMA 4QP8A 3GC8A 3BI6A 3OC1A 4GH2A 3WZUA 4MNEA 4LFIA 5CAUA 3MY0A 4J96A 1BLXA 1FOTA 2C6DA 4BDGA 1OVEA 2XIZA 3IS5A 4C0TA 4F6SA 4ZJIA 1DAWA 2VWUA 4FVPA 4FIGA 4L46A 3GCPA 3PE2A 1YOLA 1UNLA 3BX5A 2WMUA 5I0BA 4JDHA 5ETCA 5FUTA 1YDSE 4APPA 2CNQA 3Q9ZA 4Q5EA 2HXQA 3VULA 3PRIA 4OTIA 3UYSA 3TUDA 3D5UA 3FMNA 3MJ2A 5LJJA 2GU8A 3VVHA 4YC8A 1GZNA 2YIWA 3UPZA 3UOKA 3QWKA 1PMVA 2YN8A 1KV1A 3FSKA 3OCBA 1PKDA 3PJ3A 5E7RA 5G6VA 5BVEA 2VO6A 3CR0A 2XK6A 3DAEA 4YO4A 2Q0NA 3FXZA 4HJOA 2R7IA 4S33A 1ZMWA 4EOMA 3PJCA 4UMQA 2C0TA 4R8QA 3BQCA 2XBJA 2Y0AA 4J8MA 3DTCA 3VUMA 1H8FA 3FQSA 3L8VA 3TNQB 4E6AA 1P4OA 3T3VA 3FMEA 5ACKA 4D0XA 3TJDA 3V8TA 1BYGA 3BEAA 3P7CA 4MWIA 5K4IA 5BYZA 4CT2A 3R73A 2WAJA 1CSNA 3SDJA 4BYJA 4E4NA 5AA9A 3QCXA 3FAAA 5IQBA 4KAOA 2WZJA 4XG8A 3NNXA 3PZHA 3VW8A 4DE4A 4FT7A 1O6LA 1ZARA 3OUNB 5LVOA 1TKIA 4DEGA 3ACJA 5B0XA 2UZTA 1RJBA 3NNUA 4I5PA 2XM8A 1YOMA 4X7QA 4EKKA 3DKOA 4ZTSA 3NUSA 2XZSA 4FSMA 4E6DA 5FG8A 4LUDA 1UA2A 2VWZA 4L3JA 4FTOA 5DHJA 3OXZA 1H00A 3FL4A 5HIBA 3HRFA 4IVCA 2YWPA 2WU6A 5JH6A 1QPCA 5CU3A 5C01A 2VWWA 2YJRA 4W8EA 5IUGA 3R71A 5AP2A 1FBNA 5GZ9A 3QCYA 4I5MA 5IPJA 4ZZNA 2PMNX 1MUOA 1ZLTA 1DI9A 1WMKA 5TF9A 4I92A 2PU8A 4YHFA 3PRFA 4EH4A 2RF9A 4F4PA 4JI9A 3OWJA 4CMUA 3KXHA 5ANEA 3C4WA 4M0ZA 3FZPA 4DG0E 5E8SA 3HMOA 2QO9A 3ZO1A 3IW7A 4FKPA 5C27A 4R7BA 3VRYA 4G34A 4ZMFA 3OOGA 3RHKA 4HOKA 3I0OA 3QZHA 3IG7A 4QMNA 2FSMX 1XBAA 4IQ6A 3VQUA 1KOAA 1WBVA 1PYEA 3TT0A 2GNHA 3JY0A 2VTNA 4FTUA 3ZUTA 4ANBA 3E5AA 4O7VA 3MH2A 3CQUA 3Q4CA 4TWPA 4EKLA 4JAJA 5FD2A 2XNPA 3VBWA 4CZYB 1JNKA 3QLGA 4UWBA 4DC2A 4EEVA 5CSHA 3Q2JA 4N0SA 3GXLA 3BYMA 3RI1A 3VAPA 2YDIA 3EL7A 5ANDA 3CEKA 2BRNA 3MBLA 5L8KA 4WNKA 3F2AA 4AZTA 4JS8A 4F9WA 4PX6A 3D2IA 4HYSA 4O91A 4X0MA 4R3PA 3FKNA 3UG2A 3O8PA 3RTPA 4NIFB 3PA4A 3HV6A 1NY3A 4IVAA 2R64A 4XV1A 1M2PA 5EM6A 3RAIA 1W7HA 3GQLA 3H4JA 3KK9A 1A06A 3OW4A 4RQVA 4FSZA 5H2UA 4A4XA 3COKA 4RVTA 3SOCA 3QD4A 3ALNA 4RG0A 4AA5A 4IAAA 3JPVA 3ZLYA 3NUNA 3KXNA 3MH3A 4J1RA 1FVRA 2UZNA 4MXCA 2JFLA 3NNWA 3W18A 2ONLC 2I0YA 2YHVA 3GNIB 3MVMA 4QPAA 2RFSA 2HELA 3PJ8A 3F3VA 4FR4A 4BCQA 5HX8A 1O9UA 3KFAA 5C03A 4ZJVA 3UOJA 5DRDA 5IQDA 3LFNA 2FSLX 3G6HA 4TW9A 4Y8DA 4WT6A 4N6YA 3QQLA 3GB2A 4KD1A 1JSUA 2ZV9A 2OU7A 4RX5A 4L45A 3W32A 2R3FA 3KRRA 3E62A 5IDNA 5C8KA 2G2FA 3IW5A 5M4UA 3IGOA 2PL0A 4PL4A 3FKOA 5JZNA 3CPCA 3HMIA 2XNEA 3VS2A 3L9LA 2E9OA 3VHEA 3FXWA 3Q3BA 3FI2A 3KVWA 2WTWA 4FE2A 3WZKA 5D41A 2IPXA 1Z57A 3NGAA 3QRKA 3MA3A 5LCKA 5HE0A 2VRXA 3DK6A 3E7VA 4FZ6A 4FYOA 4PMMA 3CE3A 4R6VA 1YQJA 3I79A 3DBQA 5DYJA 3UDBA 4DEIA 3DJ5A 3R63A 3IPHA 4K2RA 5ICPA 3SXRA 4O2PA 3SVVA 4FV3A 3A99A 5JMSA 1M7QA 2BAQA 5DRBA 5IF1A 4XRLA 3RM7A 4XOYA 4MWHA 3NDMA 5EHOA 4L44A 2B0QA 4C35A 2EUFB 3N51A 5KKRC 2W4KA 2GNIA 5AV1A 4YPSA 2VTIA 4BR3A 4A9UA 1XH6A 1UWHA 1CKJA 3R04A 3BHHA 3A61A 2AUHA 2VX3A 5L4QA 4B4LA 3BLHA 4EOPA 4IAIA 4PNIA 2OW3A 1P14A 2O63A 4LUEA 4ACCA 4O6LA 3C4CA 3ZCLA 2R3JA 5C4KA 3MTLA 4F9AA 3EYHA 5I4NA 5AUUA 5HNGA 4DF3A 4H58A 4D4RA 1ATPE 5C8NA 1OL5A 2REIA 1FVTA 4P7EA 5HORA 3DOGA 4B0GA 2IG7A 4XV3A 5BMSA 4MQ1A 4XG7A 4ACGA 4O0TA 5F94A 1Y57A 4JR3A 4IB3A 5AEPA 4RFYA 2YM3A 4BZOA 2YITA 1MRUA 2BZIB 3HMNA 4ZTLA 2XRUA 2CN8A 2RFNA 4KS7A 4CZTA 3ELJA 4U45A 4YTCA 4FVRA 3Q9WA 4PPBA 4PDOA 4QNYA 4MXOA 4U43A 3DS6A 4EOLA 2CDZA 2X8IA 2QODA 5HO6A 1Y6BA 3D5WA 4H39A 2HENA 5GZAA 4UEUA 4MD9E 2Y4IC 4BVUA 1A48A 3BYUA 2YLFA 4OBQA 5EQEA 3GI3A 3R1QA 4ZP5A 4CTBA 4K77A 3BKBA 3VS7A 2IZSA 4OAUC 4IAKA 5EI6A 5HKMA 2BILB 4D1ZA 2XNBA 4RX7A 3DGKA 5L2WA 3S4QA 4TPTA 3F69A 3ROCA 1J7UA 3JUHA 2IN6A 4RPVA 2YACA 3IW4A 4EZ7A 3CS9A 5E92A 2XJ2A 3H10A 3LXKA 3F88A 5J1VA 2GFSA 3A4PA 3TM0A 2GTNA 4O1PA 4UBAA 2QOCA 5GHVA 2C3IB 5M57A 3DY7A 2XVDA 3G51A 2C1BA 4U3YA 3QTQA 5J9LA 3NLBA 3D7TA 3IK3A 1RQQA 4FIIA 1WFCA 2UZBA 4Z16A 3OT3A 4W8DA 2PVNA 3C4EA 5D9HA 5GJDA 3QCQA 4J7BA 3LM0A 4S32A 1SM2A 1F5QA 5AAFA 3U4WA 3O0GA 5KX8A 2A27A 2JGZA 3KXZA 2UW7A 3IO7A 1UU7A 4AG8A 5AV4A 5IEYA 2WQMA 5BVKA 1XH4A 3EZVA 5GIOE 3FZ1A 4Q9ZA 4QTCA 3ETAA 4UX9A 5EQPA 4IAZA 3TV7A 2GS6A 3FQEA 1OPJA 4BDDA 3N4TA 3ZSGA 3E93A 1URWA 4LRKA 4JT3A 3EN5A 2I0EA 2XNOA 2ZOQA 3L1SA 3RZBA 5AAGA 3AC4A 3LXPA 1PMNA 2R9SA 3RK9A 1Q41A 4LMNA 3RWPA 2WPAA 5J1WA 4O7RA 3UOHA 3MS9A 2XK9A 5BVFA 5CNOA 1Z5MA 1IEPA 2A1AB 4IAFA 4IB1A 2VTPA 4JIKA 4LL0A 3KGAA 4F7JA 4G6LA 3MB7A 4B8MA 4Z9LA 4D2TA 3U6JA 4BIBA 4NZWB 5IQIA 4XUFA 4HCTA 3GCQA 3DBFA 2C6TA 3PWDA 3ORMA 5K4JA 3MESA 2PUIA 2JDTA 4QMOA 3ORPA 3TUCA 1FINA 3N4VA 2PTKA 3SOAA 1VJYA 4I23A 3NIZA 3RCDA 3V5TA 1OIRA 2ERKA 2WEIA 4BCJA 4NCTC 4DT9A 3OCSA 1FMOE 4G9RA 1LR4A 4RWKA 4MF1A 4ZTRA 1IR3A 4AOIA 4YR8A 3R28A 5A4QA 5IH5A 1IA8A 2BTSA 3Q4TA 3O23A 3TZ7A 4KSPA 3SW4A 4MTAA 4NJ3A 4QTAA 4XG9A 2B55A 4P5QA 2W4OA 4TL0A 2OSCA 3IOKA 3KU2A 2W5HA 3DFCB 3MVHA 4FTMA 2BKKA 2G2HA 4OT5A 3P79A 2WQEA 5AR5A 4IH8A 3VUTA 4O7YA 4WSQA 3MV5A 4GU9A 3I0QA 4V05A 2YM6A 3OCGA 3OEZA 4QMXA 4B9DA 5IH6A 3LMGA 3HUCA 4W4WA 4DFLA 5AM6A 4YURA 2PZRA 4L6QA 5A46A 3HDNA 2PVJA 2VUWA 5KMLA 2QOIA 1G5SA 2H8HA 3WBLA 1JVPP 4ZY4A 3KF7A 1UU9A 3EOCA 4FG7A 2W4JA 4U41A 5CXHA 3UO5A 1KE9A 2OXDA 3HA8A 4O7TA 2HWOA 2BZJA 4XBUA 4FZFB 3DJ6A 4ASXA 4K33A 1M17A 4BIEA 1KWPA 4EOQA 5ANGA 5FWKK 2GQRA 5EYDA 3HMPA 4AGUA 2F7XE 5I9XA 3SQQA 1R0PA 4M69A 3BRBA 4USEA 2VTJA 4HVDA 5IH4A 4CT1A 3F3WA 4F1TA 3OOMA 1G3NA 3Q2MA 3W10A 2GSFA 3A8WA 4DTBA 1YXUA 4IM2A 4RIXB 3UZTA 1M2RA 2IJMA 4PP9A 4LM5A 5E90A 2AC5A 3R8LA 4E5AX 4FTCA 4FT9A 3DK7A 4FK3A 4RIWA 4O83A 3TWJA 1UNGA 3QTXA 1FGKA 2YIXA 4P90A 3RGFA 3RP9A 2WTKB 4AW2A 4GFGA 4JBOA 4GYGA 3S0OA 1J1CA 3ORNA 3DB6A 4TWCA 5IQFA 2HW7A 2UW9A 2ITZA 4ERKA 3ORZA 4D2VA 4ASDA 3DA6A 3PWYA 2J5FA 5TOZA 2KTYA 2ZV2A 3EQHA 3VBYA 2JIUA 3KRLA 3NUXA 4AZEA 4H3QA 4FUYA 3HV5A 2XA4A 1A9UA 3I4BA 3EJ1A 4EH6A 1P4FA 3Q32A 4ZSGA 4ZTNA 2CKPA 4II5A 4QYGA 4FZ7A 3AC5A 3R9HA 4QMWA 1WBWA 2IZTA 3PVBA 3RJCA 5KCVA 4ZSJA 3BHYA 2QKRA 2QC6A 4WBOA 3DKGA 1WBSA 3EQCA 5DR6A 3T3UA 4JBPA 4J71A 2G2IA 2VTRA 5TE0A 3FE3A 4EC8A 4QMPA 4WKQA 1NVRA 3DZOA 3U6IA 3NYXA 3A2CA 3CQWA 4IANA 2CKOA 3G33A 5EK7A 1O6YA 5E8WA 4BTKA 5CI7A 3W2SA 3FY0A 2CCHA 2C4GA 2JLDA 3LQ5A 4G3GA 4UB7A 5F4NA 4CV9A 2UUEA 4OTWA 4GUBA 3GU4A 3MIYA 3E8NA 4ACHA 5CF6A 1H1PA 2WQOA 1JKKA 2F49A 1SMHA 3SRVA 5HQ0A 1K9AA 4ZEGA 3MY5A 3PE1A 3QC9A 3HX4A 3SHEA 1JKLA 1ZRZA 4MXXA 2F2UA 4R7IA 4BGHA 2VTTA 2JBPA 2ONLA 5EYCA 3HVCA 5HG5A 1P5EA 1OL2A 2Y8OA 4M66A 4FTIA 1GY3A 4GFOA 2W1HA 3FI3A 2PZ5A 4M84A 3TXOA 4EUUA 2XKDA 4AUAA 3C4XA 3QA8A 4RJ7A 2HY0A 4DH7A 3K54A 1S9JA 1STCE 2EB2A 4RC4A 2VZ6A 4KBCA 3G9NA 5ANOA 4G6NA 3WOWA 3CQEA 2CGWA 3ZZEA 4FEXA 3LIJA 3TN8A 3QXOA 1JWHA 3FLNC 4XLVA 2VWXA 3LFFA 4AZVA 2E9VA 4BICA 3QQHA 5DLSA 1Q8WA 3ZEWA 4QP2A 1H26A 3L8PA 3PP1A 4CCBA 2UV2A 3VF8A 3PXKA 4JLCA 1FGIA 1XKKA 4BCNA 4A07A 3TIYA 3EN6A 3ZTXA 2OFVA 4F9CA 4KIKB 4QP6A 4TNDA 3PG1A 3PIYA 3UQCA 4GIIA 3QCSA 3WZJA 3K5UA 5A3XA 2F7ZE 5CXZA 3P78A 4JBQA 3ZEPA 5JGAA 4BBFA 5M06A 2VX0A 4FSTA 3PJ2A 4L52A 3LPBA 1XWSA 4DGOA 4F9YA 1GIJA 2R0IA 4NW6A 4W9XA 4G17A 4TRLA 4WA9A 2QOOA 5KZIA 4FSRA 5FP5A 4E4XA 3DQXA 1PW2A 4OTQA 3F3TA 4IE9A 4CVAA 3MW1A 3BHUA 3FHIA 3Q9YA 3SC1A 2QR8A 4O0XA 3W2OA 4UZDA 1OGUA 3CCNA 1V1KA 2XUUA 1YDRE 4PQNA 2C6EA 3TL8A 3D83A 2YJSA 3QD2B 4CFFA 4YLJA 4IHPA 3ZXZA 5IMXA 3R7OA 4FMQA 3UP2A 4BBMA 2X1NA 1TVOA 3LFBA 4D1SA 3L8SA 4RGJA 4RIYB 5HBHA 4ZS0A 3UJGA 2XNGA 1DI8A 3HNGA 5HE3A 1XBCA 4FG8A 5HE1A 4IZYA 1PXIA 3NX8A 1H07A 3SX9A 3BGPA 5C8MA 5FP6A 5HVYA 2OXYA 4YSJA 3AGMA 3PPJA 4C02A 3QZGA 1M52A 3EN7A 3WZEA 5K0KA 3DDPA 4CTCA 2ZYBA 5FEQA 3FJQE 2ITVA 4E73A 3KULB 5EOBA 3V8SA 4HNFA 4I0TA 5HNBA 3OXTA 3E3BX 2J51A 3CP9A 5A9UA 1Q61A 3OWKA 3QKLA 4RZVA 4DH1A 4EK5A 5BPYA 5BYYA 4WIHA 4CLJA 5CF5A 4IC8A 3PY1A 3KEXA 4FV5A 4IEBA 4FC0A 3VS6A 1GAGA 4CLIA 4YJPA 4TNBA 4X2NA 5EW3A 4HW7A 2YM4A 3G6GA 2BUJA 4IX4A 5DBXA 5L6WL 3ZRKA 1HOWA 2YIQA 4RVKA 2ERZE 2WXVA 3G9LX 2E9PA 3I7BA 4BWXA 3VNTA 4QPMA 2X81A 3BU6A 3QZIA 4E4MA 4J97A 3M1SA 4AW5A 4FIFA 4AWIA 2BMCA 3QHWA 2BDJA 4EUTA 5AA8A 4BCIA 3MFTA 2WELA 5IDPA 1J3HA 5AUZA 4UN0C 4O7SA 2X2LA 4ERWA 1Y8GA 3KMUA 3LW0A 4QTBA 3DNEA 2C68A 4L3LA 3GC7A 2FSOX 4LV8A 5I5ZA 1QL6A 4NEUA 5J87A 1AGWA 4QD6A 3PPKA 1Q8YA 3W33A 4ALVA 4FKLA 4BC6A 4WO5A 2PVYA 4V0GA 3GCSA 4O7NA 4YBKA 1OM1A 1PY5A 2IZUA 4S2ZA 4E8AA 2DQ7X 4FV6A 1UNHA 4X2KA 5KUPA 2Q83A 3KRJA 4BY9E 3FMDA 3KF4A 3LCSA 1UVRA 3R30A 1W82A 3ZYAA 4NT4A 4BCHA 5EI2A 5L2QA 3A4OX 2B53A 4TY1A 3VUGA 4BGGA 1MRYA 3COIA 4OGRA 4WUAA 2UZEA 4F6WA 4MEDA 2Z02A 4HGLA 2QKWB 3C51A 4JQ7A 3RCJA 3TNPC 3ZUVA 2BZKB 3E87A 3SGCA 2BPMA 2ZDTA 1ZOGA 4AX8A 2JDOA 4FTQA 4YZMA 3HDMA 2WQBA 2IW6A 4CXAA 4UYNA 3UZPA 3LFDA 4USFA 5B2LA 2CKEA 1OPLA 2UW3A 3EL8A 4RFZA 3LFSA 1YOJA 4BDBA 4CG8A 3O7LB 4H1MA 5E4HA 3OXIA 3TG1A 2BZHB 1S9IA 4G31A 2VN9A 2IVSA 4OW8A 2C6KA 2W1FA 3DPKA 2PK9A 4RIOA 5CEOA 2HZ0A 4EK4A 4Z55A 3OZ6A 2HK5A 5CS6A 3LCDA 4EBWA 4JG8A 4EQUA 4IWQA 3TJCA 2BRMA 4NM3A 5DFPA 4QMQA 3BE2A 4BYIA 5HNIX 4MXYA 3AG9A 4V04A 3UIBA 5CASA 1DAYA 4FKSA 3W55A 4O81A 5LVNA 2UZLA 4U5JA 3AT3A 1Q62A 2ITOA 3B2TA 4C34A 3DXPA 2X9EA 5DG5A 3DBEA 4JL9A 3R6XA 5ANIA 2V62A 3I7CA 4NCTA 2J2IB 3EKNA 5I3RA 4DH3A 4MD8E 4QMTA 2BDWA 4MAOA 3H9OA 4TYHB 2BAJA 4PDPA 4QT1A 3KCFA 4MNFA 1QPEA 5D11A 4OR5A 4FYNA 3H0YA 5EM7A 4DTKA 4E20A 3HEGA 2XCKA 4X3FC 4F0IA 5GIPE 3BBTB 4IIRA 4XV9A 3R1NA 4JG6A 4YLLA 2X7GA 4P4CA 1JSVA 4LQMA 3KC3A 4L53A 5H9BA 3CC6A 3VBVA 4GJ2A 1H25A 2XIRA 3L9NA 4Y5QA 3W8LA 5BVNA 5IMEA 4MF0A 2J90A 2PVLA 1PXOA 5DNRA 2QU5A 3KRWA 4U8ZA 2QU6A 4FF8A 2CMWA 4Y95A 5ETAA 4BZDA 4D58A 2R3LA 4A9TA 1ZYSA 1M14A 4YNEA 4WNOA 5IEXA 2JKQA 5FGKA 2JD5A 3KN5A 3LXNA 5EDPA 2HZIA 4CFWA 2AYPA 4ZMEA 4FSQA 1PJKA 2OJGA 3QZFA 5AR7A 2HAKA 4K8AA 2J0KA 4RMZA 1PXJA 3UO6A 3R21A 1YI6A 4CFNA 5J9YA 5AV0A 3AQVA 3C0GA 1Q97A 4FKGA 4FUXA 4QQJA 2GQGA 4XG4A 2PVHA 3UGCA 5C1QB 2ZV8A 1U5RA 3KXMA 3ORKA 2PZIA 3D2KA 3VJOA 2JAVA 4QQ5A 1L3RE 3EQPA 3OG7A 4GW8A 5C9CA 1YWNA 4ACDA 3I6UA 3BU3A 2OIDA 4FTNA 2B1PA 2JBOA 2XM9A 3AT4A 5BVOA 4PTEA 2BRHA 1DS5A 3QD3A 3PFQA 3MI9A 4J98A 1QPJA 2VGPA 4ANOA 3QC4A 2B9JA 4OTPA 2WOUA 4NL0A 3MPAA 3FV8A 1H0WA 3NYOA 3TEIA 4GJ3A 4CD0A 4KS8A 5DN3A 4C4IA 2LAVA 5CEPA 5JQ5A 3ULIA 5KE0A 2OZAA 3JVSA 4JX7A 2XJ1A 4JXFA 4Q9SA 3F61A 1QPDA 3Q4ZA 1GOLA 4RRVA 2E2BA 5E8ZA 4BDHA 1IG1A 3ZLXA 1OBDA 5AUXA 5KHXA 3PG3A 4F08A 1YKRA 4QQTA 1BMKA 3SRVB 4ZOGA 3GUBA 4FTJA 4A9YA 3PXQA 3COHA 4D28A 3PSDA 4D55A 5KZ0A 5LVPA 3CLYA 4M3QA 2YCRA 5DIAA 3WIKA 4O22A 1XQZA 2G9XA 1Q8ZA 3AC1A 4D2PA 2X8EA 4IAYA 5F20A 5LVLA 4BI2A 4O86A 4R77A 4A7CA 4L7FA 1R3CA 3S3IA 2P0CA 3FC1X 3MIAA 3P08A 4M14A 5JGBA 3PXZA 4X6RA 4RX8A 3G2FA 2GTMA 2W1EA 4K6ZA 3TV6A 5IQGA 2HCKA 1NW1A 4GT4A 3WI6A 3EHAA 3QRJA 2ZJWA 3DT1A 1T46A 3R8MA 4KBKA 1B6CB 2BDFA 3H0ZA 3I5ZA 2F7EE 4AZFA 4FEWA 3LOKA 4QO9A 4C4EA 2V7OA 3WYXA 3UIUA 3UODA 5A4TA 2PZYA 3LJ1A 4O7WA 5E91A 4C57A 5JFWA 3PZEA 3OTUA 3BPRA 5CU6A 4EH5A 1WCCA 4O82A 2OZOA 2PULA 4ITIA 3ZSIA 3EQRA 4EQCA 4C3FA 1CMKE 2UZOA 3EN9A 3D9VA 3RHXA 4JQ8A 1Q8UA 5CQWA 5ITAA 3QTWA 1YXXA 2ZM3A 5DT4A 3HYHA 2VTOA 5CALA 5L8JA 4G6OA 4ZTMA 3O8UA 5CEMA 5KKRB 2A2AA 4I6QA 3KQ7A 2CKQA 3SG9A 4L8MA 3F5GA 5JFXA 4FT3A 3QGWA 4DLIA 3VS3A 1NVSA 3I1AA 3RZFA 4QMZA 5H8GA 4ONAA 4D4SA 4CFMA 2EVAA 4FNYA 4QMMA 2V55A 5GJGA 2PUNA 3QTUA 1KE5A 3BHTA 1YXTA 3QQUA 4QMSA 4B6LA 4DLJA 2RFDA 3DU8A 4RC2A 3UNZA 2C1AA 4AAAA 4EYJA 2HXLA 4YHJA 4A9SA 3LM5A 5HO7A 4RLKA 3UO4A 2ITXA 3V5QA 4IX3A 3FDNA 2ETKA 5IISA 4R78A 2FA2A 3PSCA 4BRXA 3SA0A 4GCJA 2QOLA 2OIBA 3NRMA 4EQMA 4BDCA 3H9FA 4JDJA 2C6OA 2QG5A 4U40A 3CBLA 5AP4A 4DEBA 2ZB0A 4QP4A 3ZBFA 2HYYA 5M56A 4UV0A 4BDJA 5JZJA 3U55A 3CPBA 3GC9A 3IDCA 4AN2A 4JIAA 5T6KA 2O8YA 2BHEA 2BVAA 4K9YA 4E6QA 4DFBA 5AX3A 2JC6A 2Y4IB 2WOTA 3TDVA 1YW2A 4FV9A 4YPDA 3OUKA 1URCA 1UKIA 3AXWA 3UG1A 5FEDA 1W83A 3C0IA 4BB4A 4HVSA 3MFUA 3W2CA 3BCEA 3ZLWA 3D7ZA 4H05A 3HV3A 1ZMVA 3KVXA 5AJQA 4H3BA 2XIYA 3FLZA 4I4EA 3BQRA 2XBAA 3ZDUA 4FKUA 2W1GA 5DWRA 2XKCA 4ZAUA 4BHZA 5IQCA 3GU7A 3LCKA 3BHVA 3CTJA 4DINA 4JAIA 4CG9A 5LOHA 3FY2A 4PMSA 5HCZA 1WVXA 3ZMMA 3F3ZA 4AA4A 4KNBA 5A4EA 3ANQA 4O84A 4CGAA 3OHTA 4ITJA 3A7JA 4ASZA 5CAPA 2PVMA 4WHZA 2JDSA 1LUFA 3FI8A 1ZZ2A 3OS3A 5CLPA 4UZHA 4U81A 3W2QA 5HIEA 5EW8A 3R9RA 2QOKA 3H30A 2CNVA 4FA2A 2UVYA 3HMMA 4FSNA 3QTRA 4IB5A 4PMPA 4YLKA 3NPCA 2O5KA 4QOXA 5CEQA 4E93A 4MXAA 4CNHA 4GFMA 2NPQA 3EFWA 3NWWA 4NWMA 4RT7A 4XRJA 4DN5A 2H9VA 4U79A 3U8WA 4FEQA 4QYYA 1QCFA 3FLYA 4CRLA 4DCEA 4DH5A 2PY3A 4OTGA 3TNHA 3ZONA 4YTFA 3SD0A 2ITQA 3F7ZA 2PZPA 3I6WA 3VS5A 2BR1A 2OWBA 3U6HA 5HCXA 3QTZA 2XK3A 4PWNA 4ENYA 2W9FB 4YJUA 4ACMA 4Y83A 1Y6AA 4A4LA 4KUJA 3Q96A 2R2PA 3KRXA 1VYWA 4AQCA 4LV5A 3CGFA 1ERKA 3A60A 4MNEB 4X2GA 2XK7A 1KE8A 2CN5A 4MCVA 3G15A 3H3CA 4AU8A 3DZQA 4KIOA 5CAOA 1J91A 3AGLA 5E8UA 4MBIA 2RSVA 2VWYA 2QURA 3OBGA 4MKCA 4R1YA 4G9CA 2WQNA 1XO2B 5E8XA 3U9NA 4CZUA 1LEWA 2FSTX 3O71A 4RLLA 4AZWA 2GFCA 5LMAA 5BUIA 4YJVA 1YWRA 4XYFA 2DS1A 4ZY6A 2QHNA 4OBOA 5HG8A 4AT3A 3QD0A 1JBPE 4TTHB 4DGGA 5KMKA 4BDIA 3UVRA 3HP5A 3TUBA 1APME 1UV5A 1KOBA 4QPSA 4AE9A 4FK6A 2C5VA 3DAJA 4I6FA 5A54A 2CSNA 3R9OA 4HGSA 1CM8A 3MH0A 3OROA 4FTLA 4BWPA 5KMNA 4UMPA 2B54A 4C62A 3R8UA 1J7LA 4YJTA 1JQHA 1ZZLA 3FYKX 3Q53A 2JFMA 4FGBA 4IZAA 4I24A 4XOZA 3RMFA 3TZ8A 4R7HA 4WD5A 4IX6A 2VTHA 2W06A 3IW8A 2SRCA 4EH2A 4JQEA 2KULA 2NNWB 3ROYA 3NW5A 1YHSA 3V5WA 4C37A 1CTPE 3ZRLA 4D2WA 3TTIA 4LMUA 3HLLA 5AWMA 3EWHA 4M97A 4FIEA 5FM2A 5F9EA 5KMJA 2CPKE 4ALUA 4Y73A 2NRUA 2OFUA 3F9NA 4IWPA 3DK3A 2EB3A 4PV0A 4C38A 4LI5A 2QD9A 4UMUA 1OL1A 1LP4A 4NTSA 4EH8A 2OKRA 3WYYA 4EK8A 4FSYA 2Z7RA 2RL5A 4AOJA 5HD7A 3JVRA 5KO1A 5FTGA 4O0UA 1R39A 3Q9XA 5M51A 4X3FA 3ALOA 2XB7A 2JEDA 4YZ9A 5D7AA 3S00A 5LWNA 3PY0A 5JFSA 4I93A 2O65A 3RKBA 4AGWA 3EYGA 4IFGA 4FV7A 4TYEA 5JRQA 4HVGA 2ESMA 3CD3A 3MPMA 5ACBC 1RE8A 2R5TA 4IJPA 4PF4A 4FKVA 3ODYX 4GG5A 2W99B 3EIDA 4XNEA 5HOAA 4DT8A 2WMWA 3V04A 1OZ1A 1FQ1B 4RZWA 5JRSA 1M2QA 5EDRA 2P2IA 4ID7A 4TWOA 3F2NA 3ZUUA 1JLUE 5EDQA 1XHAA 3KXXA 3RAWA 4MK0A 1VZOA 2RG6A 4PDSA 4DGMA 3CGOA 3MH1A 2W7XA 3NR9A 3ZZWA 3RINA 5LXMA 3MSSA 5J79A 4JDIA 4KA3A 1GZOA 3W1FA 2X7OA 3EFKA 3KK8A 4FTKA 4P2KA 5EM5A 3ODZX 3TNIA 5BUEA 4CYJA 1KUTA 1ZAOA 3OT8A 4R3RA 3FYJX 3UQGA 4GK2A 4Y5HA 2YLEA 3S95A 2O64A 3A7FA 4ZIMA 3DCVA 2GHGA 2XK4A 3GC0A 3DV3A 4HYUA 4UWCA 2QG7A 3TZ9A 4XV2A 4CMTA 2EXEA 2JKMA 2PMLX 4EORA 2O2UA 4F6UA 2JDRA 3AC2A 3POZA 3R7UA 4NJDA 4E26A 4GUEA 4FKJA 1REKA 4L43A 3V51A 3W16A 4QTEA 3PVGA 2FGIA 3WF8A 2CNUA 4TYIA 3NMUF 1NXKA 4C4GA 5DT0A 4IC7A 3FEGA 3PXRA 3U51A 4CFUA 2C3LA 5FBNC 2ZB1A 4N4SA 4FKWA 2WTVA 3FXXA 5M53A 4YGAA 1OKYA 1RDQE 2VO7A 3EQFA 3LFAA 4U9AA 4DGLC 5HD4A 3MTFA 4QP3A 3IONA 3F5UA 2J0MB 1PXMA 4F64A 4U80A 3BLRA 4O7ZA 3QRTA 2J50A 5DT3A 5JK3A 1GZ8A 5CQUA 2R0UA 5HX6A 3UOLA 4XEYA 2VTLA 3C13A 1IAHA 1JSTA 3E8DA 3P7BA 3QU0A 4RJ4A 5CY3A 5HVJA 5IA5A 2A4LA 2QR7A 4I0RA 4K0YA 4YJSA 5DEWA 5J7BA 1W98A 3QUDA 3UIMA 4TXCA 5F1ZA 4ZK5A 4MD7E 3T9IA 2B4SB 3TTJA 3G0EA 4ENXA 5IA0A 2WMBA 4A06A 2PVKA 2PMIA 4GV1A 4UYAA 1E1XA 5CAQA 2PYWA 3F66A 2B9HA 4FV0A 4PDYA 4YP8A 3SXSA 3EB0A 4RSSA 3BLQA 3GEQA 3IDPA 4PPCA 4ZXTA 3ZDIA 3C1XA 2JDVA 3B8RA 2J0LA 5HHWA 5FDPA 4IMYA 4H3PA 2B7AA 4QP7A 3UYTA 3DQWA 3C0HA 4EH7A 5IG1A 1Q4LA 1BI7A 2ZAZA 4UWYA 4AFJA 5ETIA 4DHFA 4E1ZA 1ZYCA 4W4VA 3FMMA 5CU4A 2WTKC 3AD4A 4BIDA 3RBWA 2OF4A 4XHKB 4ZJJA 3ULZA 1UU8A 3ZHPC 3RPRA 2Y6MA 2X2KA 3BGQA 2VGOA 3O17A 2QQ7A 2R3IA 4KWPA 4QMVA 2WTCA 3ACKA 1B38A 2PHKA 3P0MA 5D1JA 5IU2A 2RG5A 2X6DA 1Z9XA 3LKMA 3HGKA 3GVUA 3WILA 1IRKA 2X4FA 2R3PA 4GVJA 4BDKA 4G3DA 1G8AA 3SXFA 4FX3A 3ZC6A 4L7SA 3Q52A 5AUYA 5AX9A 5HE2A 3QQGA 2IW9A 5AAEA 1VEBA 4HVIA 1EH4A 2Z7SA 4BWKA 2WIPA 2Y4PA 3R8ZA 2IO6A 4K11A 1ZOHA 5I9YA 2JKKA 3FZRA 2X8DA 4FKOA 3HUBA 4PL5A 2VWIA 2WU7A 4A4OA 1U54A 2BALA 4QMLA 5L3AA 4GG7A 3BGZA 2R3QA 4ZTHA 3U87A 3P86A 4BTJA 2B9FA 4XG6A 5H3QA 4B8LA 2Z7QA 3KL8A 4FBXA 2C0IA 1SNXA 4FKIA 4I3ZA 4EOSA 2UW6A 4KBAA 5FEEA 3OP5A 5B2MA 2ZM1A 3E63A 3UVPA 1RW8A 1PXPA 3UE4A 4IBMA 2C30A 4AS0A 3UBDA 4RJ3A 3OW3A 3WARA 4QMUA 5HICA 5I9WA 4TYJA 4U3ZA 5I9UA 3AC8A 2ITWA 3KREA 3Q5ZA 3RALA 4LOQA 5CVGA 5CSXA 1KSWA 2P4IA 2UVXA 3LXLA 4USDA 4YZNA 5AV2A 3VQHA 1KE7A 3R01A 4FODA 5EKOA 4K1BA 3VS1A 1X8BA 4KIQA 1XH9A 2EU9A 2WMAA 3WE4A 2YZAA 3NNVA 4F99A 1OB3A 2VTSA 4BTFA 2CGVA 5M09A 2QONA 1PXNA 1J1BA 2Y7JA 4DEHA 4F63A 4X21A 5HBJA 5AP3A 1Q5KA 3CKXA 3W2RA 2CCIA 3O2MA 1BI8A 1H24A 2W1ZA 2Y9QA 2A19B 4I20A 3QFVA 4LYNA 5HVKA 5J5SA 3GOPA 4X2FA 3HZTA 4EHZA 5FRIA 4EOIA 4E6CA 3ORLA 5L6PA 4FNWA 4IWDA 1ZXEA 3MPTA 3VC4A 4U7ZA 2ITTA 5CF4A 1QMZA 5HO8A 3PTGA 4FT5A 4S30A 1XH5A 1SVEA 3VS4A 3TKIA 4V01A 3OWPA 5ETFA 4KKGA 1FMKA 3V8WA 4MYGA 3GU8A 2VTAA 3V3VA 4AP7A 4F09A 3QQFA 1PF8A 2I0VA 3QRUA 1M7NA 2VAGA 4IACA 4JOAA 4ASEA 5K0XA 1LPUA 4C61A 4DITA 1Y91A 3NCGA 3FZTA 4EI4A 1ZYJA 5IZFA 1YI4A 3D7TB 3ATSA 4ANLA 2DYLA 1OIQA 3KMWA 4EL9A 5E9EA 3AMAA 1W8CA 3R8PA 3QYWA 3R7VA 2OICA 1ZMUA 4WOVA 1YRPA 3O51A 4MBLA 3BZ3A 1ZYLA 4CRSA 2XIXA 3EQBA 3FUPA 3RVGA 5K9IA 5M4IA 4O1OA 4FT0A 3I5NA 4RA4A 2QOFA 4R5YA 2J7TA 5CU0A 5FQDC 1I44A 4D5KA 4L68A 3OVVA 2YIYA 2J0IA 4YZBA 4AACA 1KE6A 4JX3A 1OKVA 2EXMA 2HZ4A 4PTGA 1E1VA 4PY1A 3G90X 3NIEA 3BE9A 5CEIA 4BCKA 3PUPA 3CY2A 5HLNA 2BTRA 3E92A 4IZ7A 4NFMA 5AP7A 2YZLA 3KMMA 2XS0A 2PWLA 3GCUA 4BCOA 3SW7A 4YO6A 2C6MA 4AF3A 4DFUA 3ZRMA 4A9RA 5EW9A 4ZTQA 5KMMA 2XKEA 4EHVA 3I60A 4G3CA 4WRSA 4FEUA 1MRVA 2W5BA 5DOSA 2YM8A 3FLQA 5KBQA 3AOXA
chains in the Genus database with same CATH superfamily
4FIHA 3U54A 5DGZA 4WG5A 3CXWA 3E8CA 4G3EA 4W4XA 1PXLA 1V0OA 3BWJA 4FV1A 5DEYA 1F0QA 4BHNA 4N57A 4E7WA 1OI9A 1ZYDA 4Z7GA 1WBOA 2C47A 3ANRA 5BQ0A 4PP7A 3QUPA 3FPQA 2NP8A 2YDKA 3TMOA 1CKIA 2GNLA 3AMYA 5J7HA 2FH9A 3R7IA 4F0GA 3EZRA 4Q5HA 4HCUA 5DPVA 3CTQA 2X2MA 4I5HA 3VF9A 4EWHA 5IA3A 4ZS4A 3MVJA 3GFEA 3MA6A 3NUPA 4HPUE 4LGDA 4C33A 4Z3VA 5A14A 5IA2A 3UMXA 3TKUA 4PUZA 5DVRA 3GQIA 5CT7A 3RPYA 4I1ZA 4X3FB 3G0FA 3HV7A 4FSWA 2WD1A 4OLIA 5G1XA 4D1XA 3QGYA 2H34A 4O0YA 3ZFXA 4FSUA 2GCDA 2GHLA 4YJQA 5CWZA 5J8IA 4C3RA 4F65A 5JFVA 2QOHA 3ZXTA 5TO8A 3F7WA 4EHGA 1OKZA 2WTIA 3R7EA 3K3JA 3FLSA 4NKSA 4EH3A 3R7GA 5EI8A 3T8OA 3JY9A 4BDFA 5EKNA 5M07A 1SNUA 1VYZA 1WVWA 4AT4A 3IKAA 1P2AA 1AD5A 1ZY5A 2W17A 5CVFA 3QALE 5AP5A 3IDBA 5M44A 3N4UA 5AIKA 1WBNA 1BL6A 5JEBA 1E9HA 4RJ6A 4L00A 5BYLA 3DBDA 2P55A 3W0RA 4FKQA 5LCJA 4M69B 5IEVA 4QEBA 1Q24A 4IJ9A 4N70A 4GK4A 4C58A 3GCVA 2AC3A 5CENA 3FWQA 2I6LA 3F5XA 4XS2A 4EC9A 4BCGA 4F1MA 4ZLYA 3R02A 3VUIA 1XJDA 1ND4A 3R00A 5C4LA 3C5IA 4QDVA 2GDOA 5DH3A 4QYHA 2HW6A 3L9MA 3OBJA 5IUIA 4RIWB 3F82A 4I6HA 5J5TA 4L01A 3R2YA 4CEGA 1YWVA 2P33A 5M08A 1BKXA 1O6KA 3TKHA 3VHKA 2C5YA 3Q4UA 5BX0A 1J7IA 1FPUA 3ENMA 2XAMA 3PUFC 3ITZA 2OF2A 4CSVA 4BJJA 4DTAA 3SKCA 4JNWA 4FGRA 3ZFYA 4ZLZA 4N6ZA 4DH8A 1SYKA 5CTPA 4HCVA 1WAKA 4YC3A 2YISA 4O0RA 4IW0A 3KCKA 3PIZA 3QTSA 4IDTA 1H1RA 4FOCA 1Q99A 3P4KA 4RQKA 4DG2E 1U59A 3R9NA 4KIPA 2BKZA 4MBJA 1OIYA 3WF6A 3II5A 5HLPA 5FXQA 1PRYA 2WMTA 2XEZA 2VTMA 3OY1A 5E1SA 4DG3E 2OO8X 4U0IA 2W96B 4S31A 4FZDB 4TN6A 4AN3A 3TDWA 2CLXA 2R3RA 3VN9A 4PTCA 5EYKA 1UKHA 4W9WA 2YERA 5E8VA 5EHLA 3ORTA 3K5VA 4I94A 1UWJA 2YAKA 3ZLSA 3NW7A 3CKWA 3LFEA 4LGGA 5HTCA 4Y72A 2BAKA 2FO0A 3EMGA 3QKKA 4JG7A 3TNWA 4FIJA 5JT2A 4OTHA 3BL9A 3A7HA 3P5KA 2J0JA 4G3FA 4JBVA 4BN1A 2Z8CA 4DHJA 3ZO2A 4NFNA 3DLSA 5CT0A 5JKGA 5CI6A 2YM7A 4DFNA 4YUQA 1YVJA 2GS7A 4IVBA 3NS9A 5JGDA 4FTTA 1W2CA 4ZY5A 5LMBA 4C2VA 4AXCA 1ZWSA 3F6XA 5KHWA 4CQEA 4EK6A 3QKMA 2C3JA 1W0XC 4U6RA 3OEFX 5EOLA 5GZ8A 4BTMA 1CDKA 4XG2A 4E4LA 3MVLA 2GPHA 1OMWA 5AV3A 3VBXA 3P7AA 4KKHA 2BRGA 5AR2A 3GU6A 3CJGA 2P3GX 2XCHA 2UW8A 1MP8A 4CFVA 3DKCA 2PE1A 4XP2A 2DUVA 3A7GA 5I9VA 4KRCA 4RIXA 4GMYA 2R3KA 3ZM4A 2RGPA 3FHRA 4O96A 1YI3A 2ETRA 1UU3A 3RWQA 3R7YA 2OH0E 2WTDA 1HCLA 1U54B 4JJRA 4M67A 3DNDA 3V6SA 1NT2A 1MQBA 2E9UA 4XJ0A 1U4DA 3FKLA 4RJ8A 4X6QC 2F2CB 4IM0A 2BROA 4GRBA 4AW0A 3QBNA 4C8BA 2GNFA 4X3JA 3FMJA 5M55A 2ZV7A 4ZSEA 3QLFA 4J95A 1W2DA 4AOTA 4RA5A 4JDKA 3OWLA 5FXSA 3UPXA 3V5LA 4HZRA 3GGFA 4ITHA 2ZDUA 3W0PA 2UZWE 4TKSA 3QTIA 5H8EA 3LAUA 4H1JA 4RVMA 3DXQA 3BELA 5BVWA 2C5OA 2UW4A 5KNJA 2YEXA 3MWUA 2C0OA 5CSVA 5DMZA 3SAYA 1JKTA 3TV4A 5IUHA 2UZVA 1W84A 4WRGA 4G5PA 4XP0A 5F95A 3V6RA 3EQDA 1LEZA 3EH9A 3MFSA 3D5XA 3QXPA 4FV8A 3W2PA 1L8TA 1ST0A 4J52A 3WE8A 1G8KA 2OLCA 3UMWA 1GZKA 2ZMDA 2ZMCA 3DJ7A 4RC3A 5FTQA 4PNKA 4LOOA 4CKJA 1VLRA 2OK1A 3VS0A 4S34A 4DFZE 1G8SA 2R3MA 2WMQA 4DFXE 5FXRA 3KY2A 5AR3A 1H1QA 2H6DA 2E9NA 4EK3A 2XNMA 3OFMA 3Q6UA 5K5NA 4RBLA 2ACXA 3C4ZA 3EFLA 4DDGA 3BYSA 3NFGB 3JXWA 2R3HA 4BCPA 3UC3A 3LFQA 4GK3A 3OF0A 4GYIA 4OTDA 5IQHA 3ZC5A 1YXSA 3L8XA 5JQ8A 2CJMA 3NEWA 3TI1A 3EFJA 1AQ1A 2VWVA 2EXCX 2LGCA 1GIIA 4KSQA 3R8VA 5LMKC 1GJOA 4D2RA 5AR8A 4QQCA 3PVWA 4FI1A 2UZDA 2OIQA 5L8LA 3ZM9A 5IQEA 4R5SA 4LGHA 2XYUA 4QP9A 4WG3A 2Q0BA 2ETMA 5ANJA 3ZH8A 2YDJA 1VR2A 3KA0A 4XCUA 3Q5IA 5JSMA 3ENHA 4XLIA 5BVDA 4IZ5A 2R3OA 3VBTA 2W0JA 4HYHA 4O38A 5CZIA 3PIXA 4I41A 5J95A 4ANSA 5KMOA 3PPZA 2R3GA 5IKWA 4GT3A 3LCOA 2QOBA 3WZDA 3W0NA 3CSVA 5EM8A 4AZSA 2C5NA 2R7BA 4EJNA 3ZU7A 3ZSHA 1IA9A 2ITUA 3F3UA 4NM7A 4CQGA 4G16A 2X9FA 2FYSA 2BFYA 3GU5A 3BYVA 4IB0A 3ZFMA 3I81A 4BL1A 4C2WA 4KIKA 2OJ9A 1OL6A 2CGUA 4ORKA 4LG4A 3MDYA 5HU3A 1OKWA 2BIKB 3DKFA 3NYVA 4ZZOA 4NUSA 3FI4A 4QYFA 5CYIA 3RPOA 3DFAA 3WF5A 2X4ZA 4DBNA 4EZ5A 5DR2A 4GKHA 2JIVA 4V0GB 5I3OA 3RK5A 1Q3DA 4G1WA 4B99A 3FZSA 1JAMA 5DR9A 2CLQA 1KV2A 3VO3A 3UIXA 4O27B 2BIYA 4WSYA 4DEDA 4ANQA 4NW5A 2WEVA 3WF9A 3FQHA 3GT8A 1GIHA 4PMTA 3P1AA 2YABA 5AP1A 3NUUA 4RWJA 2J9MA 2YCFA 4O6EA 3ZBXA 4BKYA 4K18A 2PUPA 4F7LA 4U42A 4DBXA 2V0DA 4GEOA 2JIIA 4IDVA 3KXGA 3C7QA 5T68A 3UC4A 5J9ZA 4KKEA 3LMIA 3R1SA 3CJFA 4RIYA 1HCKA 4EHEA 2VO0A 3UDTA 1DM2A 3PXYA 3ZO4A 3S2PA 4C59A 1FVVA 2IZRA 3Q04A 5IA4A 2BCJA 2IVVA 3NAYA 3TIZA 4E3CA 2UZUE 4YMJA 3ZS5A 2G1TA 4KB8A 3Q6WA 4OUCA 4WG4A 5HGIA 5E8TA 5CEKA 5TT7A 3FL5A 3VW6A 1JPAA 5HESA 3HAVA 1H1WA 3LFCA 5AIRA 3R1YA 3PDTA 3N9XA 2UVZA 3KULA 2QOQA 4YZDA 4GS6A 3QF9A 1OPKA 1SVHA 2WTJA 5HZNA 4AGCA 2QO7A 2PMOX 4LRMA 5EH0A 4I21A 2Y6OA 3IQ7A 3NCZA 2W5AA 2G15A 3PYYA 4O0WA 2I7QA 3ZOSA 4C4FA 4GKIA 2XKFA 3KN6A 3B8QA 5TR6A 4NK9A 4FJVA 3P23A 1YXVA 2PE0A 1ZY4A 4H36A 2XRWA 1IAJA 4KABA 3QL8A 3GFWA 4JRVA 4RWIA 3DXNA 4BZNA 3U9CA 1F3MC 2I40A 4C7TA 4L42A 4ZLOA 3O7LD 5B7VA 2UW5A 5AP6A 3BEGA 4DAWA 5DA3A 1TQIA 2W9ZB 2V7AA 3FBVA 1OIUA 3L9PA 2W05A 3QQJA 3R2BA 3EKKA 4O0VA 5AM7A 4BI1A 3QRIA 2WKMA 4YHTA 3P9JA 3E7OA 4RVLA 4AE6A 5BMMA 4F7NA 1PHKA 4YNOA 2VNYA 3SLSA 3OCTA 2QVSE 4RJ5A 4GL9A 3RK7A 1Q3WA 5D12A 5T3QA 1OBGA 5D10A 3O50A 3VUDA 4BKZA 3UNJA 3C9WA 5LVMA 2PSQA 3FMLA 3D94A 2VD5A 4QMYA 3D4QA 1JKSA 4RX9A 1K3AA 2XNNA 2X6EA 1JOWB 2YM5A 4WUNA 1NA7A 3DBCA 2HY81 1BX6A 3AMBA 2VWBA 4M13A 5CNNA 4EYMA 3M11A 4F70A 4ANMA 4JVGA 4UMRA 2BHHA 2QO2A 2C6LA 4FICA 4IVDA 1H0VA 5DI1A 1GNGA 4C4JA 4ZSAA 5L2IA 1OUKA 2YFXA 2IVTA 5KBRA 2YWVA 3FPMA 5CSPA 4QRCA 4HZSA 3LE6A 4FOBA 5AUTA 4RFMA 3W8QA 4JR7A 2XEYA 2WIHA 3ORIA 4YJRA 3U4UA 3K2LA 1Q8TA 2YA9A 3DDQA 2WO6A 3E8EA 3NVMB 3SG8A 4YBJA 4AFEA 2IWIA 4I4FA 4YJNA 4XH6A 4DGNA 2VNWA 3A8XA 2J6MA 4CFXA 3S1HA 2WMXA 1YHWA 4R1VA 1WBPA 5AADA 3VIDA 4CCUA 1R1WA 2OG8A 3ET7A 5EYMA 2X0QA 3D14A 3BV2A 4EOOA 4OBPA 3BBWA 2GNJA 4NM0A 3A62A 5AUWA 4CKIA 4CYIA 5A6OA 5CSWA 2OXXA 3VUKA 3UNKA 4ZSLA 1H27A 2C6IA 2F4JA 2XIKA 3HL7A 4PPAA 3GP0A 3Q60A 4XBRA 4FZAB 2XAOA 5CX9A 1Y8YA 2WMSA 3RPSA 3C50A 3HECA 2J5EA 2OZAB 4C3PA 5LWMA 2I1MA 2PVFA 4QTDA 3AKKA 1XR1A 3PXFA 4BBEA 4EH9A 1XH8A 3V5JA 4XX9A 2O0UA 3AT2A 3HRBA 2X39A 5A4CA 5E8YA 1XMLA 4UXLA 4QDEA 4FL3A 4IFCA 3MGYA 2NRYA 4L3PA 4TZRA 3T9TA 4TYHA 4APCA 5KMIA 3NUAA 2GMXA 2UW0A 4I22A 2ITNA 5FTOA 2PPQA 4G2FA 3ORXA 3HRCA 3GBZA 4KINA 1H28A 2XK8A 5HI2A 3R83A 4Y85A 3M2WA 4GSBA 3WF7A 3H9RA 2XF0A 3PP0A 3LVPA 4FL2A 1V0PA 5K5XA 4YTIA 5M4FA 1OECA 4ZZMA 2C3KA 5HTIA 2ITPA 2WNTA 3WIGA 5L2TA 4EOKA 2X7FA 3HKOA 3EQIA 1W2FA 3LJ2A 4GT5A 2O3PA 4WNMA 4YZCA 4AXAA 3B2WA 2GHMA 5D7VA 2V22A 4UMTA 3NW6A 3AC3A 3EN4A 4LOPA 3VRZA 5ANKA 4YJOA 2RKUA 3LMHA 2QLQA 1PMEA 4FNZA 4I0SA 3V5PA 3IECA 5HG7A 3OTVA 5AMNA 2WHBA 4JRNA 2BFXA 5H8BA 4YC6A 3O96A 1WZYA 4LRJA 4O21A 4WNPA 2XJ0A 4L9IA 4AGDA 1U46A 1U5QA 3BYOA 5HU9A 3RNYA 3R22A 4ALWA 3OD6X 4EOJA 4M0YA 2OBJA 2VU3A 3D0EA 4BCFA 2FUMA 1R78A 3E64A 5JN2A 5HCYA 3NZ0A 1V0BA 4YU2A 4D2SA 4CKRA 2J4ZA 5HIDA 4BCMA 4BDEA 3TCPA 2QLUA 3BU5A 1R0EA 3UP7A 4D9TA 3NVKI 1CKPA 1K2PA 2JAMA 3UVQA 3RNIA 3COMA 5LARA 4UXQA 3MY1A 4DEEA 3NUYA 3VUHA 3C5UA 3FC2A 3PA3A 2JITA 3AD5A 3KKVA 2CHLA 4TT7A 5A4LA 4HGTA 2OH4A 3KB7A 2WFYA 2VX1A 5EQYA 2XARA 3DTWA 3BV3A 5CAVA 4MVFA 1TQMA 3F5PA 2GQSA 4F9BA 3CTHA 4OAVB 4D5HA 4IXPA 4LL5A 2XANA 1REJA 2F57A 3JR1A 4C4HA 3QYZA 5AR4A 3ID6C 4M8TA 2EWAA 3MFRA 2W1CA 4NTTA 2JKOA 4NIFA 2QCSA 2OJIA 5HG9A 2XMYA 4PRJA 3RM6A 3PSBA 3VBQA 4AT5A 3FZOA 4FL1A 4QNAA 2OI4X 1H01A 4FKTA 4NM5A 4HVHA 4HPTE 4FVQA 2W1DA 4O4DA 2GS2A 3PLSA 2VV9A 4D9UA 2B52A 5LMKA 4B7TA 5LQFA 4FEVA 4OTFA 4AQKA 3JS2A 4D0WA 5CZHA 4BDAA 3CY3A 5E1EA 4GIHA 4DEAA 4BKJA 2ZVAA 2IW8A 1PKGA 2QI8A 5FDXA 3K3IA 4F1OA 3UQFA 3AD6A 4L67A 2PVRA 3R9DA 4M7IA 4QYEA 4YSMA 2V5QA 1I09A 3DAKA 3LJ0A 3QX4A 4EJ7A 1WVYA 3QQKA 3RPVA 5FBOA 2PE2A 4AW1A 1PYXA 3QUEA 2BRBA 5GINE 2QHMA 2R4BA 4MH7A 2WGJA 4O0SA 2XP2A 3TZMA 2YIRA 4QP1A 1OUYA 3LZBA 4BI0A 4BGQA 3UDSA 1PMUA 3REPA 3LQ3A 3TACA 2Z7LA 4MXZA 4AXEA 4E5WA 3PLAE 3PA5A 3E88A 3IOPA 3V01A 4I6BA 2RIOA 2IVUA 1OITA 1PXKA 5A6NA 3THBA 4AN9A 1TQPA 4I5CA 5IQAA 2WMRA 3JYAA 4GVAA 3OY3A 4BF2A 3PY3A 3UTOA 4HYIA 3IW6A 1H1SA 4FV4A 4W4YA 2ITYA 4CMOA 2YCQA 4NSTA 3C4FA 4XMOA 4DCAA 1H08A 5EFQA 4RWLA 3LLAA 1H4LA 4XG3A 1SZMA 3MJ1A 3NSZA 1WBTA 4FTRA 5GNKA 2R3NA 3MB6A 4OTRA 4J99A 3G5DA 4PL3A 5AP0A 5K3YA 4NYEA 2WMVA 2HWPA 3MYGA 2DWBA 4NU1A 4MX9A 4TWNA 2I0HA 4C36A 3HP2A 3RAKA 4D4VA 1MQ4A 5BNJA 3CD8A 3BWFA 3ZO3A 5L2SA 1XBBA 5CF8A 2HOGA 2HIWA 3CIKA 4U44A 4MQ2A 4FTAA 4FKRA 5I9ZA 4E5BA 2W1IA 3LCTA 3PJ1A 3SV0A 3QHRA 4NKAA 3A7IA 2P2HA 5HTBA 4YTHA 3LHJA 4R3CA 4ARKA 1B39A 4FG9A 4O2ZA 2WB8A 3PVUA 2HZNA 3O8TA 5CU2A 5AUVA 3ATTA 4Z7HA 2FB8A 4Q2AA 2OGVA 4DYMA 4IX5A 3F2RA 4F7SA 3NYNA 4M15A 5GJFA 3QAME 3RAHA 5CVHA 1OL7A 4P5ZA 2Z60A 3FLWA 4M68A 4EBVA 2GNGA 3LLTA 4DFYA 3GOKA 5AFVA 4HGEA 4M12A 4F0FA 2VO3A 2XH5A 4FV2A 4KRDA 2PUUA 2X0GA 3GENA 5L6OA 3DLZA 1ZOEA 3QWJA 4AA0A 5FM3A 4O7LA 5B2KA 4IM3A 5C26A 2RFEA 3FMHA 4IWOA 5HLWA 4UALA 3EQGA 2C69A 3OMVA 4XP3A 5TKDA 4CV8A 3IGGA 4GU6A 1NVQA 4Y46A 4U97A 2B9IA 5CANA 3D15A 3E3PA 5EHYA 4J8NA 2H96A 3QX2A 3MN3A 4G5JA 2CGXA 2VTQA 4J53A 1BUHA 4DHZA 3DB8A 4X2JA 4D4YA 3ERKA 3LQ8A 5IA1A 1YHVA 3FSFA 4HNIA 4MHAA 4EONA 2ZM4A 2NO3A 2G01A 1SVGA 3QA0A 4OT6A 4UY9A 2YAAA 2Z2WA 3VJNA 4EWQA 4EZ3A 1XH7A 5FLFA 4IADA 4NH1A 4WBBB 3POOA 3D5VA 4TYGA 2OJJA 3HA6A 4ANNA 3BIZA 3HV4A 4BFMA 1T45A 5EG3A 3UZRA 5BUJA 3M42A 2OJFE 3FMKA 3NAXA 5HBEA 1ST4A 2F9GA 5M4CA 1YDTE 3R0TA 2XYNA 2YCSA 3VWAA 5DE2A 1BL7A 1IASA 2A0CX 2C5XA 5HEZA 2QNJA 2FVDA 4FNXA 3HAMA 4QP8A 3GC8A 3BI6A 3OC1A 4GH2A 3WZUA 4MNEA 4LFIA 5CAUA 3MY0A 4J96A 1BLXA 1FOTA 2C6DA 4BDGA 1OVEA 2XIZA 3IS5A 4C0TA 4F6SA 4ZJIA 1DAWA 2VWUA 4FVPA 4FIGA 4L46A 3GCPA 3PE2A 1YOLA 1UNLA 3BX5A 2WMUA 5I0BA 4JDHA 5ETCA 5FUTA 1YDSE 4APPA 2CNQA 3Q9ZA 4Q5EA 2HXQA 3VULA 3PRIA 4OTIA 3UYSA 3TUDA 3D5UA 3FMNA 3MJ2A 5LJJA 2GU8A 3VVHA 4YC8A 1GZNA 2YIWA 3UPZA 3UOKA 3QWKA 1PMVA 2YN8A 1KV1A 3FSKA 3OCBA 1PKDA 3PJ3A 5E7RA 5G6VA 5BVEA 2VO6A 3CR0A 2XK6A 3DAEA 4YO4A 2Q0NA 3FXZA 4HJOA 2R7IA 4S33A 1ZMWA 4EOMA 3PJCA 4UMQA 2C0TA 4R8QA 3BQCA 2XBJA 2Y0AA 4J8MA 3DTCA 3VUMA 1H8FA 3FQSA 3L8VA 3TNQB 4E6AA 1P4OA 3T3VA 3FMEA 5ACKA 4MUQA 4D0XA 3TJDA 3V8TA 1BYGA 3BEAA 3P7CA 4MWIA 5K4IA 5BYZA 4CT2A 3R73A 2WAJA 1CSNA 3SDJA 4BYJA 4E4NA 5AA9A 3QCXA 3FAAA 5IQBA 4KAOA 2WZJA 4XG8A 3NNXA 3PZHA 3VW8A 4DE4A 4FT7A 1O6LA 1ZARA 3OUNB 5LVOA 1TKIA 4DEGA 3ACJA 5B0XA 2UZTA 1RJBA 3NNUA 4I5PA 2XM8A 1YOMA 4X7QA 4EKKA 3DKOA 4ZTSA 3NUSA 2XZSA 4FSMA 4E6DA 5FG8A 4LUDA 1UA2A 2VWZA 4L3JA 4FTOA 5DHJA 3OXZA 1H00A 3FL4A 5HIBA 3HRFA 4IVCA 2YWPA 2WU6A 5JH6A 1QPCA 5CU3A 5C01A 2VWWA 2YJRA 4W8EA 5IUGA 3R71A 5AP2A 1FBNA 5GZ9A 3QCYA 4I5MA 5IPJA 4ZZNA 2PMNX 1MUOA 1ZLTA 1DI9A 1WMKA 5TF9A 4I92A 2PU8A 4YHFA 3PRFA 4EH4A 2RF9A 4F4PA 4JMQA 4JI9A 3OWJA 4CMUA 3KXHA 5ANEA 3C4WA 4M0ZA 3FZPA 4DG0E 5E8SA 3HMOA 2QO9A 3ZO1A 3IW7A 4FKPA 5C27A 4R7BA 3VRYA 4G34A 4ZMFA 3OOGA 3RHKA 4HOKA 3I0OA 3QZHA 3IG7A 4QMNA 2FSMX 1XBAA 4IQ6A 3VQUA 1KOAA 1WBVA 1PYEA 3TT0A 2GNHA 3JY0A 2VTNA 4FTUA 3ZUTA 4ANBA 3E5AA 4O7VA 3MH2A 3CQUA 3Q4CA 4TWPA 4EKLA 4JAJA 5FD2A 2XNPA 3VBWA 4CZYB 1JNKA 3QLGA 4UWBA 4DC2A 4EEVA 5CSHA 3Q2JA 4N0SA 3GXLA 3BYMA 3RI1A 3VAPA 3UDZA 2YDIA 3EL7A 5ANDA 3CEKA 2BRNA 3MBLA 5L8KA 4WNKA 3F2AA 4AZTA 4JS8A 4F9WA 4PX6A 3D2IA 4HYSA 4O91A 4X0MA 4R3PA 3FKNA 3UG2A 3O8PA 3RTPA 4NIFB 3PA4A 3HV6A 1NY3A 4IVAA 2R64A 4XV1A 1M2PA 5EM6A 3RAIA 1W7HA 3GQLA 3H4JA 3KK9A 1A06A 3OW4A 4RQVA 4FSZA 5H2UA 4A4XA 3COKA 4RVTA 3SOCA 3QD4A 3ALNA 4RG0A 4AA5A 4IAAA 3JPVA 3ZLYA 3NUNA 3KXNA 3MH3A 4J1RA 1FVRA 2UZNA 4MXCA 2JFLA 3NNWA 3W18A 2ONLC 2I0YA 2YHVA 3GNIB 3MVMA 4QPAA 2RFSA 2HELA 3PJ8A 3F3VA 4FR4A 4BCQA 5HX8A 1O9UA 3KFAA 5C03A 4ZJVA 3UOJA 5DRDA 5IQDA 3LFNA 2FSLX 3G6HA 4TW9A 4Y8DA 4WT6A 4N6YA 3QQLA 3GB2A 4KD1A 1JSUA 2ZV9A 2OU7A 4RX5A 4L45A 3W32A 2R3FA 3KRRA 3E62A 5IDNA 5C8KA 2G2FA 3IW5A 5M4UA 3IGOA 2PL0A 4PL4A 3FKOA 5JZNA 3CPCA 3HMIA 2XNEA 3VS2A 3L9LA 2E9OA 3VHEA 3FXWA 3Q3BA 3FI2A 3KVWA 2WTWA 4FE2A 3WZKA 5D41A 2IPXA 1Z57A 3NGAA 3QRKA 3MA3A 5LCKA 5HE0A 2VRXA 3DK6A 3E7VA 4FZ6A 4FYOA 4PMMA 3CE3A 4R6VA 1YQJA 3I79A 3DBQA 5DYJA 3UDBA 4DEIA 3DJ5A 3R63A 3IPHA 4K2RA 5ICPA 3SXRA 4O2PA 3SVVA 4FV3A 3A99A 5JMSA 1M7QA 2BAQA 5DRBA 5IF1A 4XRLA 3RM7A 4XOYA 4MWHA 3NDMA 5EHOA 4L44A 2B0QA 4C35A 2EUFB 3N51A 5KKRC 2W4KA 2GNIA 5AV1A 4YPSA 2VTIA 4BR3A 4A9UA 1XH6A 1UWHA 1CKJA 3R04A 3BHHA 3A61A 2AUHA 2VX3A 5L4QA 4B4LA 3BLHA 4EOPA 4IAIA 4PNIA 2OW3A 1P14A 2O63A 4LUEA 4ACCA 4O6LA 3C4CA 3ZCLA 2R3JA 5C4KA 3MTLA 4F9AA 3EYHA 5I4NA 5AUUA 5HNGA 4DF3A 4H58A 4D4RA 1ATPE 5C8NA 1OL5A 2REIA 1FVTA 4P7EA 5HORA 3DOGA 4B0GA 2IG7A 4XV3A 5BMSA 4MQ1A 4XG7A 4ACGA 4O0TA 5F94A 1Y57A 4JR3A 4IB3A 5AEPA 4RFYA 2YM3A 4BZOA 2YITA 1MRUA 2BZIB 3HMNA 4ZTLA 2XRUA 2CN8A 2RFNA 4KS7A 4CZTA 3ELJA 4U45A 4YTCA 4FVRA 3Q9WA 4PPBA 4PDOA 4QNYA 4MXOA 4U43A 3DS6A 4EOLA 2CDZA 2X8IA 2QODA 5HO6A 1Y6BA 3D5WA 4H39A 2HENA 5GZAA 4UEUA 4MD9E 2Y4IC 4BVUA 1A48A 3BYUA 2YLFA 4OBQA 5EQEA 3GI3A 3R1QA 4ZP5A 2X0PA 4CTBA 4K77A 3BKBA 3VS7A 2IZSA 4OAUC 4IAKA 5EI6A 5HKMA 2BILB 4D1ZA 2XNBA 4RX7A 3DGKA 5L2WA 3S4QA 4TPTA 3F69A 3ROCA 1J7UA 3JUHA 2IN6A 4RPVA 2YACA 3IW4A 4EZ7A 3CS9A 5E92A 2XJ2A 3H10A 3LXKA 3F88A 5J1VA 2GFSA 3A4PA 3TM0A 2GTNA 4O1PA 4UBAA 2QOCA 5GHVA 2C3IB 5M57A 3DY7A 2XVDA 3G51A 2C1BA 4U3YA 3QTQA 5J9LA 3NLBA 3D7TA 3IK3A 1RQQA 4FIIA 1WFCA 2UZBA 4Z16A 3OT3A 4W8DA 2PVNA 3C4EA 5D9HA 5GJDA 3QCQA 4J7BA 3LM0A 4S32A 1SM2A 1F5QA 5AAFA 3U4WA 3O0GA 5KX8A 2A27A 2JGZA 3KXZA 2UW7A 3IO7A 1UU7A 4AG8A 5AV4A 5IEYA 2WQMA 5BVKA 1XH4A 3EZVA 5GIOE 3FZ1A 4Q9ZA 4QTCA 3ETAA 4UX9A 5EQPA 4IAZA 3TV7A 2GS6A 3FQEA 1OPJA 4BDDA 3N4TA 3ZSGA 3E93A 1URWA 4LRKA 4JT3A 3EN5A 2I0EA 2XNOA 2ZOQA 3L1SA 3RZBA 5AAGA 3AC4A 3LXPA 1PMNA 2R9SA 3RK9A 1Q41A 4LMNA 3RWPA 2WPAA 5J1WA 4O7RA 3UOHA 3MS9A 2XK9A 5BVFA 4LDTA 5CNOA 1Z5MA 1IEPA 2A1AB 4IAFA 4IB1A 2VTPA 4JIKA 4LL0A 3KGAA 4F7JA 4G6LA 3MB7A 4B8MA 4Z9LA 4D2TA 3U6JA 4BIBA 4NZWB 5IQIA 4XUFA <