3NW6A

Crystal structure of insulin-like growth factor 1 receptor (igf-1r-wt) complex with a carbon-linked proline isostere inhibitor (11a)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
301
structure length
301
Chain Sequence
b'VYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Insulin-like growth factor 1 receptor
publication title Proline isosteres in a series of 2,4-disubstituted pyrrolo[1,2-f][1,2,4]triazine inhibitors of IGF-1R kinase and IR kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 301
sequence length 301
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nw6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nw6A01
4V0GA 4O96A 1QPJA 5BYLA 2WU7A 5IQFA 1ZYLA 5E8YA 3ITZA 4IC8A 3H10A 4WO5A 4QP1A 4GJ2A 4JDJA 2C5NA 3LXNA 5AIKA 2P3GX 4FKSA 4RG0A 2PVLA 5M4FA 1PXOA 3RGFA 4I5MA 1NVQA 4UV0A 2R7BA 5D1JA 1LR4A 2R7IA 1AQ1A 3KMUA 3O71A 4FV5A 4CFVA 3FHRA 4TWNA 3QTQA 1JKTA 5IMEA 3QD0A 5LWMA 4J97A 2YM7A 4F0GA 2OJFE 3R1YA 5AUYA 3I5NA 3GQIA 3QC4A 5FXRA 5JFXA 2XJ0A 5AR7A 4PMMA 1FMOE 4Q5HA 3SG8A 2VWUA 2J7TA 1IAHA 2G1TA 4K33A 3RNIA 2ZV2A 2ZV8A 5H8EA 3VBXA 1VJYA 3OXIA 4IX5A 4PL4A 4RIYB 4EOKA 4KB8A 5HESA 5LCJA 3EIDA 3LQ8A 3Q96A 2BMCA 2ZDTA 3IOKA 2OGVA 4GEOA 5KHXA 3KULA 2QR7A 1X8BA 3UMXA 2CSNA 3UBDA 1VR2A 2V7OA 2XBAA 4G3FA 4IX6A 4M15A 4X2FA 4M67A 1IA8A 1OIQA 3QQKA 4ITIA 4MQ1A 3TZ8A 3NS9A 4OTPA 1ZOGA 4QQJA 2W1FA 4ARKA 4P4CA 5IISA 5DR9A 3DLSA 3OT8A 2G2FA 5HOAA 5I4NA 2XCHA 1J7UA 3H30A 3OS3A 4O0RA 3E92A 5FUTA 1AD5A 2QKRA 4IXPA 4JLCA 5IG1A 2YZAA 3MY1A 1HCKA 4F9CA 5CXZA 5ITAA 5J7HA 2YM6A 1ZMWA 4JX3A 5C03A 2EXEA 3FKOA 4DEAA 4YLKA 5DI1A 3UQFA 1R0EA 2V62A 2VTOA 3U55A 4DH1A 5HVYA 5FQDC 2XNGA 4IFGA 3QZIA 4FNXA 4XP3A 4BICA 4C02A 3R7EA 1V0BA 3VUKA 2RKUA 5A4QA 3DTCA 4XNEA 2IO6A 2BHEA 2ERZE 3NUPA 3PJ3A 5DMZA 3POZA 4AZVA 3OY3A 3AD6A 3K3JA 4ACDA 2VWVA 1FGIA 3C50A 2BR1A 5HBJA 3F2NA 5DT0A 2HW6A 1JSVA 1Z57A 1XH9A 1YXSA 3R2BA 5DRDA 4W4WA 1JPAA 3VHKA 3PY0A 1JLUE 3AMBA 5IEVA 2BROA 3DDQA 5IUGA 2SRCA 4QNAA 1FBNA 4M7IA 2WMTA 5C8KA 2ITNA 3GU4A 3CY2A 4MQ2A 4IWPA 4OTDA 2YACA 3W2SA 4CMOA 2QG7A 4HYHA 3CSVA 4OTQA 3QZHA 3OWKA 4C58A 2YAKA 3QTIA 3K2LA 5T6KA 4ENYA 2E9VA 3CPCA 4QMPA 4X6RA 4D4SA 4F7LA 3PG1A 2YN8A 5TKDA 4YNOA 2A1AB 1S9IA 4UXQA 3AT4A 3PXYA 3AC1A 4WRGA 4YSMA 4AA0A 4AW2A 3EB0A 5AM6A 3GI3A 3QWKA 4QOXA 5CI7A 4BR3A 5FWKK 1NVSA 4DTAA 2R3RA 3F5GA 1KE9A 4O7LA 4NTSA 2CCIA 3F5UA 3IGOA 2IJMA 4CYJA 3PPZA 1S9JA 4BCKA 2BRBA 3FQHA 3HZTA 3L8SA 5HBEA 3FKNA 3TN8A 3U87A 1KE7A 1JSUA 1GZ8A 1Y6BA 3ZBXA 5HTCA 2O3PA 2ETRA 4X7QA 3GT8A 2OFVA 4FV2A 3TEIA 3PPKA 2VTSA 3HEGA 4FZFB 3UJGA 4CMTA 4AW5A 3PXRA 1Q8UA 1ND4A 3PIXA 2QO7A 2J0IA 3KU2A 4X21A 3V5PA 3UO4A 3ZLYA 4EWHA 1Q24A 3AC2A 3FMHA 2R2PA 5CU4A 5J1WA 2PTKA 2X39A 2YLEA 3DZQA 3K5VA 4DFXE 3Q4UA 4F0FA 3DKGA 2B52A 3MYGA 4KKGA 5T68A 2RFDA 4FIHA 4CCBA 1OBDA 2WMQA 2UW9A 2VWZA 3R7IA 1WBNA 5HBHA 3QCSA 4F9AA 2ZVAA 4QYFA 3UOHA 5FDPA 4UBAA 4XG7A 3IS5A 3SRVA 3UO5A 5IH4A 3GUBA 2JD5A 2WMWA 3CTJA 1OB3A 2WTKC 3TNQB 2ITTA 4XS2A 4AZFA 4ZJVA 1DAYA 3QRJA 2WIPA 4RC4A 2UZNA 5CSPA 2OJGA 2BDWA 2RL5A 3MBLA 4G5JA 1CSNA 4RIWA 5IQBA 3ORNA 5FTQA 3WE8A 1P5EA 3C0IA 3HNGA 4G34A 3EJ1A 5AEPA 4OTGA 3UVQA 4J98A 5GZAA 4FA2A 3JR1A 4RZWA 4I0SA 1YQJA 4X3FA 2XEYA 5DIAA 2BAQA 4JDKA 4BZOA 3AXWA 3QTUA 4IAYA 2JLDA 3OY1A 1GAGA 1ZZ2A 2OXYA 3D2KA 3KCKA 3R7GA 4F09A 3PLSA 3ZBFA 4IB0A 4HNIA 4BTFA 3QX4A 4FOCA 4FTQA 5EHOA 4PTCA 2GCDA 4JIAA 3ZONA 4ASEA 2OSCA 4WG3A 2J50A 3BHTA 2PVHA 1SMHA 4FZ6A 5CU0A 4B8LA 4ZSEA 4YBJA 1PXIA 2WGJA 4I1ZA 4WSQA 3QX2A 1K9AA 4O7SA 4A4OA 4L01A 2CKQA 4L3JA 2Y0AA 4TNDA 5H8BA 3U6IA 3A60A 1L8TA 4YHFA 2UW7A 2R4BA 3WOWA 3W2PA 3NUXA 1CKJA 3ATTA 4RX8A 4FSTA 2QONA 3BE9A 4I6BA 1VZOA 2C30A 2XVDA 4AT3A 5M06A 3DQWA 1J7LA 4RT7A 3MJ2A 4BBMA 4BTJA 3RPOA 4IAZA 5EYMA 1F0QA 4ANSA 5J9YA 3FLQA 3VIDA 4CKJA 4H05A 2UZWE 2WMVA 2NRYA 4AW1A 2OBJA 5M4IA 3E64A 4M69B 4D2WA 4HYIA 1XR1A 3BYSA 1W82A 4NT4A 4R6VA 4U44A 4EQUA 2JAVA 3KXHA 3L9PA 5DA3A 2R3IA 4IZYA 4DEDA 3TJDA 5EH0A 4UYAA 2CGVA 2WD1A 3DOGA 3Q9YA 4R7BA 4QMMA 4OUCA 4EH7A 3BLQA 3QZFA 4IZ5A 3QZGA 4GT3A 3ULZA 5E9EA 1F3MC 1OITA 2OU7A 2BVAA 3S3IA 1OPJA 3HUCA 5E8VA 3TZ9A 4R5YA 2I0EA 2J5EA 3QCQA 3QU0A 4ITHA 4ID7A 3D4QA 5KKRC 4O0UA 4PNIA 2HZ0A 4ZY6A 1XH7A 3CTQA 5HNBA 3ZOSA 3QQHA 2NRUA 3NUAA 3E87A 2RGPA 3NUUA 4JOAA 3TUDA 5CAPA 3NNWA 3RAWA 3EN5A 4O7TA 4FV7A 5IMXA 3KRLA 2C6TA 4YUQA 4DCAA 4DTBA 4RWKA 1YHWA 3GU7A 3HRFA 5KHWA 1W7HA 2F57A 3TNWA 4M97A 2QOFA 5M08A 2VUWA 4C4IA 3E8DA 5L8JA 4U5JA 3GU8A 4M66A 1UU8A 4GU6A 3E7OA 1E1XA 2PE1A 3NR9A 2C5XA 2C6MA 4F99A 3PJ1A 5G1XA 5M57A 1GZNA 3ZUVA 3RTPA 2WQMA 3QHRA 4NW5A 3F3ZA 2VX3A 3QCXA 4NEUA 4F7SA 5JK3A 5KMLA 1PXKA 4HZRA 3NAXA 3RJCA 3D5WA 2W1GA 2VD5A 2KULA 2W4OA 2H9VA 4ZZNA 2J4ZA 4QYHA 4LM5A 2VTQA 4TY1A 3FDNA 5H8GA 3UO6A 3E8CA 2YEXA 3G6HA 3E8EA 5BMMA 5EW3A 2OW3A 3ORPA 4RIYA 3CEKA 2JDVA 3NCZA 3F5XA 4E6CA 1WVYA 3ODYX 2VWYA 5AUUA 5DR6A 1WVWA 5GJGA 5EW8A 1W98A 2HXLA 2IPXA 4U9AA 3FUPA 3MB6A 1PKGA 2XF0A 5H9BA 4YNEA 1CMKE 1UA2A 3LHJA 2XYUA 2O65A 5LMKC 5D7AA 5AJQA 4AN3A 4EZ3A 4ZTMA 2VTAA 3DDPA 3EQGA 2VX0A 3PSBA 3G9LX 3BQCA 4J53A 1WCCA 1APME 3HYHA 2PL0A 3MFSA 4WOVA 4CFUA 2OZAB 1FVVA 4FBXA 4J8MA 2BIYA 3E63A 2UZUE 5IDNA 4FKOA 5E90A 3LFFA 3FZPA 4L53A 2DWBA 4FKQA 3BV3A 4YP8A 5JH6A 1BLXA 4E6AA 4PNKA 5E8SA 3S95A 2VGOA 3UGCA 4FNYA 4NKAA 2F7XE 1A9UA 3O7LD 2ZAZA 3QFVA 2PVFA 4G3CA 1M2RA 2HK5A 2QURA 4QMLA 4DEIA 5FTOA 2WXVA 3DA6A 5JSMA 1Z5MA 3D7ZA 3DS6A 3KY2A 4G31A 2W0JA 3JY0A 4EL9A 5IA3A 4C4GA 3QTRA 2ERKA 2ZV9A 4YJQA 4UXLA 3FV8A 2R3FA 3DBFA 3E3PA 4O0TA 4QMXA 3ZS5A 3DBEA 3R02A 4ZP5A 2C5VA 5AR2A 2OWBA 3F9NA 3NGAA 3OWLA 4FTJA 1A48A 1SVHA 5IUIA 3P7CA 1WBWA 2CLXA 4ZJJA 2BRMA 2WMSA 3C4FA 5B2KA 4BTMA 4QT1A 2IW6A 3HV5A 4I5HA 3VRYA 2OO8X 4ZLOA 2R3GA 4FYOA 4C8BA 5L2TA 5DWRA 2RF9A 1WBTA 2IVSA 1LPUA 5AWMA 5CVFA 3WIKA 5DVRA 4MWHA 4QMTA 4EYMA 4IM2A 2X6EA 1UKIA 4IE9A 4QTDA 2XK3A 3ERKA 2A19B 4DC2A 5BVFA 4FGRA 1T46A 2LGCA 3AC4A 4FIEA 4E4MA 2A2AA 3IW6A 3I4BA 2CPKE 4PTGA 4DFZE 4MYGA 2GNJA 3RWPA 4ZTHA 4O0YA 5FEQA 1M7QA 5DGZA 5H2UA 3PXKA 4PWNA 4ANMA 3R1SA 3U6HA 2BZHB 2J0MB 4EOLA 4BI0A 4D1XA 5LXMA 4D4VA 4FYNA 4YC3A 3RAIA 4YO4A 3PJCA 1MUOA 3R2YA 3C1XA 1J7IA 3D94A 4IDTA 4FKTA 2FSTX 2GTNA 2VNWA 3RMFA 3UNJA 4FTAA 1OL5A 3F2AA 3Q3BA 3RPSA 4NWMA 5J95A 3QXPA 2XKEA 3RCJA 4KIQA 1PMUA 4LMNA 4C3RA 4EK5A 5L4QA 1O9UA 2BAJA 3L8XA 2PY3A 4FTCA 3BU6A 5IA5A 3OOGA 5C26A 1JVPP 5IQIA 4GK2A 3LFEA 5ANGA 1H08A 2BAKA 3S00A 3OUKA 5E8XA 3PZHA 4O83A 5CF4A 1PXLA 4NJ3A 1IR3A 4M14A 1XJDA 2YCQA 4FZAB 1FQ1B 5AP6A 4O0VA 3QD4A 2X81A 4ZTQA 5BMSA 2V7AA 3HV7A 2NPQA 3HVCA 4FT7A 5CSWA 5HI2A 3LW0A 4X2NA 1JAMA 1RQQA 2FSOX 2W1HA 4IWDA 3PDTA 2PMNX 4AZSA 5B2MA 4TRLA 3Q6WA 5BPYA 3QTSA 3ZM4A 4ALVA 4TPTA 3OWJA 2VWBA 3BHYA 5AP4A 4LFIA 3WIGA 2ITWA 3P7AA 3PZEA 3C5UA 4MAOA 3LFSA 2B9JA 3BGPA 3HV6A 4ZZMA 3H4JA 1P2AA 4UMRA 4GG5A 4D0XA 5JEBA 3QQGA 4I24A 2WFYA 2QOBA 4MNEB 3KN5A 3GB2A 3UG2A 4WNOA 3R8PA 3V5LA 3UYSA 2XRUA 3AC5A 4Y85A 1R39A 5HHWA 4AN9A 4EYJA 4NZWB 1P14A 1H1QA 2FA2A 3VHEA 3M1SA 3WF6A 3ZO3A 3LQ5A 1U5QA 4MXOA 3RPVA 3JVRA 5IEXA 1YI3A 1U59A 3PPJA 4AS0A 1H1PA 4D2TA 2XJ2A 2BDJA 4O1OA 5KUPA 4DTKA 1CTPE 4MBLA 1ATPE 4DYMA 3CQEA 1PMNA 4X2GA 2XIKA 4JG8A 1JKSA 1J3HA 5F9EA 3IW7A 3ZSHA 3PP0A 3PFQA 3NUYA 5AP7A 4XG3A 4C4FA 3CGFA 2QOIA 4I3ZA 3LXKA 4IHPA 1E1VA 2BPMA 4L8MA 2ITQA 3O17A 2VTNA 4P90A 4XG9A 5JFWA 3KMWA 3OFMA 3NIZA 4EHGA 1OIRA 2E9OA 3II5A 4L52A 4HVDA 3QTXA 4BB4A 2YM3A 4B9DA 1K3AA 3R30A 2WKMA 5KO1A 3NVMB 4RVMA 4A06A 4A07A 3EYGA 2XIXA 4E5WA 5D12A 4AE9A 3C5IA 3R73A 4C2WA 2QOCA 3MH2A 2XIYA 4C38A 2EVAA 3AD5A 3OW3A 4MEDA 3UIXA 4R77A 4L9IA 4BCQA 4AGCA 3LOKA 4U41A 5HVJA 2FGIA 4N57A 1U5RA 5CF5A 3ZUUA 2GNFA 3FMMA 3QQJA 2CHLA 3SXRA 3HECA 1H25A 4QRCA 5CF8A 4FVRA 3C4WA 3SC1A 4FEUA 4GIIA 4QQTA 1YKRA 2QVSE 3MSSA 3L9MA 5D7VA 3EQHA 3OXTA 4KBCA 2NP8A 3UNKA 4C33A 4GS6A 4HGTA 2WTIA 3E93A 4HOKA 4BDAA 3IDBA 4D5HA 4RIXB 2PPQA 5HX6A 5A4LA 3QCYA 2HOGA 4BCNA 4X2KA 4G6NA 5AAGA 2PMLX 4AW0A 3MJ1A 4HYSA 4IWOA 3EN7A 3OOMA 3CBLA 4ALWA 4OTIA 4D58A 1F5QA 4GW8A 3FLSA 4MX9A 2C5OA 2UZEA 4EH8A 4EHEA 3LXPA 5TO8A 2XRWA 2O64A 3TXOA 4EWQA 4XYFA 5AP3A 4NIFB 4NL0A 2W96B 2CGXA 3GC8A 5M07A 4YJSA 2VTIA 3E3BX 3F3WA 3PTGA 3EFJA 3QRUA 1QPCA 3DT1A 4Y73A 3TNPC 1YI6A 4C3FA 1NW1A 1BUHA 4ZXTA 3F3TA 2UZVA 1PMEA 2QODA 5FM2A 4O86A 1IEPA 2IWIA 5KMKA 4J1RA 3G0FA 3SD0A 3TJCA 3THBA 3Q9ZA 1M14A 3M11A 5J5SA 4C62A 4PX6A 5BX0A 3LFNA 3SLSA 1FPUA 5ETAA 1WBPA 5DN3A 3HV3A 1J1CA 2ACXA 4B0GA 5J79A 2PUUA 4YJTA 5JGAA 3DPKA 4FTNA 4N6ZA 3UIBA 3ZUTA 1QCFA 5FEDA 4DEHA 5EQEA 4I92A 1REJA 2WMAA 3OEFX 5E8UA 3C7QA 4HW7A 4QYEA 3F69A 3ZDIA 4RGJA 5GJDA 4ZJIA 4TYEA 2X7OA 3RBWA 2X6DA 1V0OA 2PU8A 1HCLA 5DLSA 2PZPA 5I3OA 2XYNA 4UMPA 1B6CB 2X7FA 5EK7A 1YVJA 2EB2A 3FLWA 2PZYA 2Z60A 3OHTA 4F4PA 5ACBC 2ZM3A 5AR4A 2EB3A 4EOOA 5K4IA 4S2ZA 4I6HA 1DAWA 3QXOA 3IO7A 5GJFA 3FLNC 5CENA 3EQCA 3VAPA 1Q61A 2OFUA 4I23A 4ANQA 3D5XA 4BIEA 2VTPA 2E9NA 2ZM4A 3LFCA 3P9JA 5CNNA 2QKWB 2Q83A 2O8YA 1H8FA 4PPCA 3BYVA 5K5NA 3UVRA 4Z9LA 4II5A 4Z7HA 2P2HA 3LPBA 5CXHA 5DEYA 4NM5A 4AFEA 3VS2A 4ERKA 4G3EA 1O6LA 1SZMA 2JGZA 2GS2A 5AADA 2QC6A 1H28A 3IKAA 3BBWA 4C0TA 5KE0A 3TT0A 4D2SA 5IPJA 1UNHA 3VUHA 2KTYA 3K5UA 3O23A 5LMKA 1UV5A 3ZZWA 2JDRA 3IONA 3A7IA 5BVNA 4M0ZA 2JKMA 3BQRA 3MA3A 3MH0A 4TYHB 4CG8A 5GIPE 2R9SA 2PE0A 3KVWA 2F9GA 3BKBA 3CE3A 3OG7A 5IA2A 4QPMA 4DLJA 4C4JA 4MHAA 5CLPA 4PMPA 4FGBA 5CT0A 3R1NA 4HVHA 3W18A 2B54A 4FIGA 4MXCA 4FTUA 3LQ3A 3RPYA 4ASDA 3MWUA 3CKWA 4USEA 4ZIMA 1Q8WA 2VTLA 1XKKA 3VWAA 5ICPA 3MTLA 5I9XA 3ET7A 1WMKA 4TT7A 3W2CA 4FI1A 4FKUA 3O51A 2R0IA 3Q53A 2VV9A 4CG9A 2ZJWA 2JDSA 2W17A 5K0KA 5LVLA 3LCDA 2C3LA 3ZO2A 3WF7A 5KNJA 3Q5IA 4FC0A 3ATSA 2X2LA 2XIZA 5JFSA 2C6EA 3CCNA 3BX5A 3C4CA 4DFLA 4PP7A 3VBQA 3FSKA 4NH1A 3PRFA 2VWWA 3I7BA 3GC9A 3NNXA 2B0QA 3OP5A 3KCFA 2CKOA 4EEVA 3ORTA 3IECA 5DEWA 4WT6A 5FD2A 2ETMA 4XHKB 3JPVA 4DFBA 2C6DA 1IRKA 2C3KA 1H27A 4BKJA 3FC1X 5JGDA 4KRDA 5JFVA 2R3KA 3QD3A 5AP2A 4O0WA 3NUNA 4L45A 2XS0A 3PY1A 5A4CA 4H3QA 2X9EA 4KS7A 2R3JA 3MPTA 2FVDA 4FL1A 4G2FA 2VTMA 4RC2A 4DGGA 3OROA 2R3MA 1ZYCA 4CRLA 4N0SA 3VVHA 4BKYA 4Z55A 1GIHA 2XK4A 5KMJA 4LRJA 2J2IB 3DJ6A 1MRUA 1VYZA 2BKZA 4UMQA 3EFLA 4I6FA 4GT4A 4KD1A 4BDJA 4FEWA 5I3RA 4U3ZA 4QO9A 2B9IA 3MVMA 4AOJA 4QQCA 4IANA 2PHKA 5ETFA 1W84A 4X2JA 3FHIA 3VBTA 3W33A 3ZXZA 2PULA 3VJNA 2WTVA 4K6ZA 4R7IA 5CX9A 5GIOE 3FL4A 1OIUA 3QKMA 2B53A 1KWPA 4BWXA 5EHLA 4BL1A 5A6OA 4FSWA 4M84A 3ACKA 1MP8A 2ZB1A 3LE6A 2VTHA 4KKEA 4FK3A 1OKVA 2WQNA 2JC6A 5AUTA 4OTRA 2H34A 2F4JA 3DU8A 5CSHA 1H24A 4ZEGA 4YZMA 2ITXA 4D28A 4YLJA 3BIZA 4JS8A 2C6LA 1YWRA 3DLZA 3ZLXA 4M0YA 4DAWA 2GHLA 5DHJA 4D9TA 2QO9A 1JKKA 4KIKB 2UW6A 4CTBA 5HO8A 3BYOA 1JOWB 2XA4A 1SVGA 4FF8A 4JJRA 4NYEA 4BY9E 2YIRA 3W32A 5GZ9A 3R7VA 3CD3A 4ZZOA 2JFMA 4LGHA 3F5PA 5ANIA 3A7GA 2R64A 3O2MA 2OIDA 4YPDA 1E9HA 4FT5A 3MY5A 3QLFA 4F9BA 3VF9A 4YMJA 1XWSA 2BIKB 1GNGA 3L8PA 2UVXA 4EOQA 3EL7A 3I0QA 3FPQA 3BBTB 3L9NA 3D7TB 1GY3A 4DG2E 2XNMA 2JKOA 4QD6A 4XEYA 2Z8CA 4PUZA 1U54B 3I60A 4W4YA 3ZCLA 4TYGA 4AN2A 2PSQA 1PJKA 3BHUA 2WHBA 5CASA 4BFMA 3FMJA 2E9UA 3BLHA 5G6VA 3SQQA 3TV6A 3PA4A 2RFNA 1GZKA 3LXLA 2Q0BA 3FC2A 4O82A 1OZ1A 4IAFA 4IBMA 4AZWA 4EOIA 5HG8A 4GUEA 5DT4A 2XMYA 3MGYA 3OVVA 4RIXA 3RNYA 2XK7A 4PDOA 5HNIX 4A9TA 3QKLA 5CAOA 3P23A 3G5DA 3F3VA 4DINA 4JR3A 3F6XA 3SXSA 5CZIA 2J6MA 3FY2A 4BGGA 3FZRA 3ZLWA 2XEZA 3A99A 4KIPA 4EH2A 1UVRA 5BVKA 4B4LA 4RZVA 4DA5A 4DGOA 3EWHA 3VS5A 4GL9A 4IAAA 1ERKA 3LM5A 3MV5A 2VAGA 3KVXA 4IVBA 3UODA 2CGUA 5ANOA 5HZNA 1R0PA 2YIQA 3FI3A 5KMOA 1Q8YA 3LLTA 4NIFA 5TF9A 2PVNA 1DM2A 3QWJA 4MXYA 4PL3A 4OAVB 3LMIA 2C0OA 3KB7A 5A3XA 3HRBA 3HMOA 4FEXA 3ZRMA 3RZBA 1ZZLA 2G2HA 2W4JA 5IQGA 1BMKA 3CD8A 3L1SA 2DS1A 1R78A 5AR3A 1QMZA 3I7CA 3KMMA 1Y8GA 4HGSA 3SGCA 5AR5A 3CC6A 5EDPA 3E7VA 3P0MA 3G0EA 3CQWA 2XH5A 4LOPA 3ZC5A 3DJ5A 5EOBA 3C51A 4B7TA 4C4HA 4EH9A 3LFQA 3NDMA 3ORIA 4MF0A 4RLKA 5AP1A 5DYJA 5IH5A 3W1FA 2RSVA 3UG1A 1RDQE 3ZM9A 4FV0A 4ALUA 5BUJA 1UWJA 2IW8A 2FSLX 3I6WA 2ZMDA 4D2VA 3HKOA 3KRWA 3E8NA 1UU9A 3PY3A 4IAIA 2BTRA 3NPCA 4WBBB 3T8OA 2Y4IB 4DCEA 1O6YA 4RWLA 2H96A 4R1YA 4BDIA 5EFQA 3FLYA 2XKFA 5FEEA 3O8TA 4O7WA 1YWVA 1CKPA 2P0CA 2OICA 3KF4A 4FTLA 4HCVA 3S2PA 2QR8A 4USDA 4FZDB 3CR0A 3W16A 2QOLA 1Q62A 2ZMCA 5CU6A 2UVYA 2YDJA 4BYIA 1WFCA 2C68A 3G2FA 3NYVA 4YU2A 5AV3A 4CEGA 4FT0A 3ANRA 4UWBA 4GT5A 2XKCA 4C35A 4TWCA 4XP2A 2XM9A 2GQGA 4QYYA 2WQBA 1FMKA 3QBNA 4U80A 5ACKA 1H0WA 3HX4A 4BDGA 4C61A 1ZLTA 5CAQA 4FTKA 3O7LB 5CAVA 4QTCA 3VS7A 4AQCA 5EW9A 4IVCA 5K5XA 1RW8A 2J0LA 1BL6A 2J90A 2JDTA 4FUYA 3VC4A 2VO3A 4U0IA 5E91A 5BQ0A 2Y8OA 4F0IA 2W06A 4E4XA 3TI1A 5GHVA 5AIRA 1RE8A 3U8WA 4FV4A 2WB8A 4FNZA 2EU9A 3H0ZA 3A7FA 3FI4A 4U42A 1XBAA 4I21A 3GNIB 5DFPA 4O7YA 1AGWA 4O1PA 3TV4A 3UOJA 4JBOA 2XBJA 3C9WA 1OM1A 4PL5A 4ACGA 3OCGA 4K8AA 3ZH8A 3G15A 3QL8A 5EKNA 2W1EA 4XLIA 5M44A 3GCSA 1YDTE 2YAAA 3MTFA 4TYHA 2F49A 3KQ7A 1OL7A 5L2SA 3B2WA 3VW6A 5A4EA 4FG8A 4ACCA 4KBAA 4YZDA 4CLIA 3ENMA 3R7YA 4XBUA 4BIDA 2WOUA 2I40A 4FKRA 4H36A 1U46A 3PXZA 4XG8A 3TIYA 3UDBA 5L6WL 4GYGA 4DBNA 2VU3A 1KUTA 2BZIB 4OGRA 4ASZA 1PYXA 3KL8A 4MWIA 3W55A 4D4RA 5LVMA 2X8IA 5I9VA 4DG3E 4S34A 5LVOA 4P7EA 2R0UA 2EWAA 4KIOA 4EOSA 3H3CA 4PMTA 1MQ4A 4KBKA 2C0IA 5AX9A 3A7JA 2JKKA 2ONLC 2PVKA 5JKGA 4ZY4A 4GKHA 5J7BA 3RK5A 3ANQA 3Q6UA 4CTCA 4JQ7A 4W4VA 4LRMA 4D2RA 4HVSA 2O5KA 3RI1A 1Q4LA 5FTGA 2XK8A 5CSVA 1H0VA 4XUFA 1OECA 3DXNA 3TZ7A 3WZDA 2Z7QA 3Q32A 4OTFA 3QRIA 4O84A 3DBDA 3ZRLA 1OUKA 4QP4A 3WZEA 2XM8A 4RJ7A 3A62A 3UIUA 2ZOQA 3AGMA 1TQIA 3GC7A 4LUDA 3FYJX 4L3PA 4BGQA 2VN9A 5IDPA 4LV8A 4QP7A 2BKKA 4NSTA 4QPSA 3V04A 5IQHA 3NAYA 2ZM1A 4GU9A 2VO7A 3CP9A 4OW8A 5EDQA 5CEPA 2YLFA 4XX9A 3UYTA 4FT3A 4CFFA 5IQCA 5M56A 4TN6A 2OJIA 4HPTE 2YCSA 4D5KA 4LRKA 3TG1A 3MI9A 4Y95A 5KZIA 4E7WA 4NFNA 3ACJA 3OUNB 3P08A 4GFGA 1R3CA 3R0TA 5K3YA 2XB7A 3U6JA 4NW6A 3IOPA 3ZZEA 4TKSA 3PSDA 4FTTA 2W7XA 4UYNA 3U51A 4G3GA 3UE4A 5D10A 3UIMA 4PDPA 1OL6A 5EOLA 3R8VA 3LZBA 3SDJA 5LVNA 1OGUA 4WD5A 1GOLA 4D55A 5DE2A 2YWVA 4O7ZA 1KV2A 3OXZA 3MDYA 4XV2A 3ZFXA 4AXAA 2YZLA 3JS2A 2CNVA 2I0VA 2J0KA 3PP1A 2A0CX 5KMNA 1B39A 3A4OX 3EH9A 4EQMA 2W9FB 5KCVA 3NW5A 3BLRA 1G5SA 4J96A 3FBVA 2BCJA 4BCIA 3Q2MA 5IF1A 4I5CA 2DQ7X 4BDKA 4IJPA 5IU2A 4CMUA 2BZKB 3DFAA 3FZSA 4W4XA 4YGAA 3NYNA 3FQEA 4IAKA 4LYNA 5ANJA 4EOJA 1K2PA 3N4TA 3SG9A 2J5FA 4W9XA 4JG6A 2XNEA 3B2TA 5F94A 4BZNA 3FYKX 2A4LA 3VUMA 4KIKA 2UZBA 2WOTA 4GIHA 2X4FA 3OTUA 4R3PA 3BCEA 4KKHA 4ASXA 3OCTA 2XK9A 1Y91A 3OT3A 3CXWA 3R01A 3BU3A 4GKIA 2VGPA 4UY9A 4WIHA 2WNTA 1KSWA 4KABA 4RX5A 5IA0A 3U4UA 3PA3A 3BZ3A 4RX9A 2C3IB 4RWJA 5C01A 4M68A 3F66A 3VBVA 2GNIA 5AX3A 3BE2A 4JBQA 4ONAA 3TKHA 4JBPA 5CQUA 3ZU7A 1SYKA 4WNPA 1L3RE 4EZ5A 4QTEA 3O0GA 4DGMA 1U54A 2PE2A 3GFEA 3NNUA 3A8WA 3VBYA 5DG5A 5J1VA 2PMOX 1P4FA 2HELA 5HORA 3PG3A 4F6WA 2WMRA 4F63A 2O2UA 1PMVA 3MIYA 2GTMA 3FL5A 4NM0A 5EM8A 3PE2A 3UC4A 2RG6A 4AE6A 5EQPA 3EMGA 3OZ6A 4TWOA 5E92A 4C3PA 4EK8A 3EQPA 3C4EA 2ITYA 3GGFA 5EM7A 4NU1A 2OI4X 5FP5A 3IW5A 4YLLA 4E1ZA 1Y6AA 4E6DA 3N4VA 2WAJA 1JBPE 4AFJA 1Y57A 1Q8TA 3ZC6A 5AV2A 1YHVA 5AAEA 4GMYA 4QMZA 2RFEA 3G33A 3EYHA 2IW9A 1ZYDA 3LJ0A 4KWPA 4ZAUA 1H1WA 5AUZA 4JXFA 5JQ5A 3C0HA 5E1SA 3E88A 3EQIA 4NM3A 2J0JA 2WEIA 3EQDA 4GVJA 4D1SA 4CKIA 2EXCX 3KK8A 3HLLA 5AV0A 3D0EA 3DNEA 4JQ8A 4HVIA 4O81A 4J52A 4IIRA 3VULA 4YBKA 5B2LA 2VTJA 1IG1A 4JDHA 3EN4A 5CYIA 4BHZA 5CNOA 4IM0A 4IMYA 2XKDA 3AT3A 3GCQA 4FKVA 2X8EA 2JFLA 4RA4A 3QC9A 4E73A 3R28A 4BI1A 3HUBA 3W8LA 4PY1A 3LCKA 4AACA 1LEWA 1VYWA 2PVYA 3ALOA 2C4GA 1URCA 1P4OA 2R3PA 4LL0A 5EG3A 4BCFA 3HV4A 5JRQA 4FL3A 4QPAA 2QCSA 5CEOA 2C1AA 3W2RA 3V8SA 2B55A 4FKPA 3D9VA 5CU3A 2VTTA 4FIJA 5C8NA 5AR8A 4BTKA 4X6QC 3JUHA 3VQUA 1IA9A 1ZARA 3KF7A 3HA8A 3QD2B 4A9YA 2QG5A 4HGLA 4BC6A 4U7ZA 4A7CA 5EM5A 5E1EA 1KE6A 3DGKA 4JG7A 3DBQA 5KBQA 2B1PA 2YERA 4ZMFA 4YJPA 3I6UA 4O22A 4M69A 2JAMA 4EBWA 1XH4A 2XNBA 4CRSA 4DEGA 1ZY5A 2UV2A 1PXPA 4BKZA 5HD7A 3LJ1A 4IQ6A 3LFBA 3I1AA 2UW8A 4FV8A 2HZ4A 4MF1A 2EUFB 3ENHA 4TYJA 1SNUA 3V5TA 2X4ZA 4U79A 1XHAA 4P2KA 5CAUA 2OF4A 4GSBA 4BZDA 2Z02A 5HU3A 2UZLA 1H26A 3IDCA 3ZXTA 3ZMMA 3PXQA 4M13A 4K77A 5J5TA 3WF5A 4UMTA 2XIRA 4Y83A 5DOSA 3KK9A 4AZTA 5HG5A 4I5PA 3ZSIA 2I6LA 2OKRA 3R00A 5DH3A 4V04A 4XG2A 4Y46A 3N4UA 1WAKA 5H3QA 3F3UA 4CYIA 3MVHA 4QNYA 3RCDA 4WNMA 5I5ZA 3MVLA 3UQGA 4DG0E 4ORKA 3LKMA 4J71A 1GJOA 5AUVA 3PIZA 4IW0A 4OT6A 4DH7A 2WEVA 3PJ2A 4XH6A 3BI6A 2B4SB 3Q4TA 4JDIA 3SW7A 2P33A 3R7UA 4XV9A 3TIZA 3ID6C 3OW4A 1FVTA 1NXKA 4JR7A 4FICA 2CCHA 3QRKA 3QUEA 3LAUA 4QTAA 4Y5HA 5E8WA 2YJRA 3FXZA 4E4LA 3ZO1A 3WBLA 3EQFA 4QMSA 3FXXA 2AUHA 2W99B 3I0OA 4IFCA 4PDSA 4P5ZA 3E62A 2C3JA 2OJJA 4O2ZA 4R5SA 4APPA 5I9YA 4JAIA 1KOBA 4CFNA 3IG7A 5CEKA 3NCGA 4OLIA 4QMQA 4U97A 4FK6A 5J87A 3NEWA 3SRVB 1KV1A 5IUHA 1EH4A 1KE8A 1OKZA 3PVUA 2OXDA 1PYEA 3D5VA 4HVGA 5IQEA 4UMUA 2RG5A 5GNKA 1OMWA 4G9CA 3DY7A 4ANBA 4KSPA 3R8ZA 3ZDUA 5L3AA 4PRJA 3OWPA 5M09A 4K2RA 2R3LA 4ZSLA 5CZHA 4RIWB 3OD6X 3PWYA 4RBLA 3V5QA 3D5UA 4F08A 3NZ0A 4FSNA 4IB5A 2JEDA 3RK9A 4FIIA 2WMXA 4LV5A 3PSCA 3HMPA 3QGYA 3TDWA 3ORMA 3F61A 4BWPA 5I9WA 4QTBA 4CQGA 4XOZA 5A46A 2ZV7A 3HRCA 4G1WA 4X3FB 2W1IA 2OZAA 3DAKA 4R8QA 4KUJA 3JYAA 4LI5A 4FKWA 1XO2B 3AC8A 3MPMA 4FSQA 5CALA 5CQWA 4M3QA 5HLPA 3RALA 3QYZA 3SVVA 4KRCA 4U3YA 2YM4A 2WIHA 4RX7A 1YOMA 4EHZA 2R5TA 3VS1A 1BI8A 3GU6A 3LM0A 3ZEWA 2XNOA 4IZ7A 4F7JA 4H3PA 2JBPA 2XZSA 4I94A 5DRBA 4R1VA 5KMMA 5EYDA 2HZNA 1GIIA 3KREA 2ZDUA 4AX8A 3GXLA 3GU5A 4N6YA 4BDHA 3Q2JA 4QP6A 4E8AA 3T3UA 2IVUA 3CY3A 1FOTA 4MH7A 4CFWA 4Z16A 2V22A 1M7NA 4L68A 5CVGA 5FM3A 3L8VA 5HVKA 3VS4A 2VRXA 3KKVA 3PUPA 3MW1A 2QLQA 4G6LA 3LIJA 5AA8A 5CU2A 1YXXA 4U81A 3AMAA 1REKA 4IWQA 4TZRA 3ULIA 3L9LA 4F64A 3FY0A 3SAYA 4GV1A 5HQ0A 4M8TA 4AAAA 4ENXA 2PZIA 3OCBA 4G17A 3RWQA 4W8EA 2CDZA 4JNWA 2YDIA 4XG4A 1GZOA 4MBIA 4ZOGA 4ANOA 4BDFA 5J9LA 2ONLA 2VO0A 4PTEA 2REIA 3BYMA 5HG7A 4AGWA 2B9FA 3FPMA 4YTHA 2OLCA 1U4DA 4ITJA 3S1HA 3RHXA 4IZAA 4WUNA 3LMHA 2F2CB 3HA6A 4IH8A 3PRIA 3FZOA 2P4IA 4I0RA 3VF8A 2JDOA 2V55A 2J9MA 1YDRE 2F7EE 3UC3A 4XOYA 2C0TA 3COMA 5IA4A 5K4JA 4G16A 5BVOA 2AC3A 4IB3A 4QMWA 3PLAE 4XJ0A 3ZO4A 3R1QA 5BYYA 1W83A 4WSYA 3V5JA 4EUTA 3V5WA 4EKKA 4YSJA 2UUEA 3DKCA 3DCVA 4GRBA 2HAKA 4XMOA 3KC3A 5CI6A 2YISA 4EC9A 1YOLA 2VNYA 4EORA 2JBOA 2BZJA 5A9UA 2I0HA 1Q5KA 2IVVA 4NCTA 1YXTA 3B8RA 4NTTA 4L7FA 3PVWA 3D2IA 4S30A 3FJQE 3AT2A 3QKKA 2CN8A 2UVZA 2UW3A 3BPRA 3FE3A 1I44A 1SM2A 4D4YA 3LMGA 2PZ5A 3DTWA 3FMEA 4IDVA 4U43A 3T3VA 4E26A 4ZLYA 2Z7LA 3QUPA 4KINA 5LARA 3P4KA 1JSTA 2Z7SA 3BWJA 4RFYA 3RM7A 3VUDA 2YWPA 3QALE 4JBVA 4GVAA 4MXXA 4QP9A 4AWIA 3SXFA 4CFXA 3ZEPA 4EK3A 3EKNA 3R9OA 3RK7A 5M53A 3HMNA 3DKOA 5L2WA 3CJFA 4XCUA 3Q04A 3PXFA 4XV3A 3DJ7A 2Y9QA 3P86A 2W1CA 5JT2A 2Z7RA 3F7ZA 1G8SA 3KXMA 1Q3DA 1RJBA 2QNJA 3AC3A 2WMUA 2OZOA 4QP3A 4NK9A 1XH8A 1UNGA 4AUAA 5CSXA 4I6QA 5HKMA 3GCUA 3IGGA 5BUEA 3BGQA 2OH0E 1H00A 5HLNA 4V01A 2XJ1A 4UWYA 2RFSA 3FSFA 4ACMA 3RAKA 4HPUE 2W5BA 4U8ZA 1WBOA 4X0MA 5IEYA 1QL6A 3BU5A 4FSRA 3TUCA 4FZ7A 4MNEA 1BKXA 3G9NA 3KN6A 1ZYSA 3FLZA 5KZ0A 4L7SA 2WZJA 3Q9XA 4ZS4A 4DLIA 5A4TA 2BFYA 4RMZA 3R63A 4AA5A 1XH6A 4FVPA 5A6NA 5IH6A 4FKGA 4F1TA 4UZDA 4XP0A 2NNWB 5CEMA 5AAFA 3T9IA 5HG9A 1NY3A 4J7BA 2CN5A 2YM5A 1Y8YA 4FV9A 4IEBA 4DFNA 3UTOA 4OBPA 3Q5ZA 2C1BA 3ELJA 4MCVA 2ZB0A 4R3RA 3RKBA 3EFWA 4OAUC 4FE2A 3GP0A 4I41A 3AGLA 4ZSJA 4CCUA 3NMUF 1LP4A 2YCRA 3DZOA 4H1JA 2PUPA 2YIYA 5JQ8A 4NFMA 2OK1A 1OBGA 4LQMA 3KRJA 1OUYA 2C6OA 4BDCA 2VTRA 5EHYA 4PPBA 2PVMA 1ZMUA 2GFCA 2HW7A 2VZ6A 3QQUA 5CS6A 5TOZA 3EFKA 4C7TA 2GHMA 4ZY5A 3CIKA 4HGEA 3DK6A 1UU3A 2J51A 4EHVA 4F1MA 4U40A 5LJJA 4QP8A 3EZRA 5M4UA 4ZSAA 1YXVA 3QUDA 3TUBA 2G15A 3F7WA 4G5PA 3S4QA 3UZPA 5EQYA 4S33A 2PUNA 5GZ8A 5JZNA 1G3NA 4IX4A 4IACA 4F9WA 5I9UA 5EM6A 4EJ7A 4A9SA 1T45A 1H4LA 4FTIA 5K9IA 2Y4IC 4EK6A 5LQFA 4R7HA 2BHHA 3NIEA 4O91A 3FAAA 2GS6A 4MKCA 2GU8A 4YZCA 4PQNA 2JITA 3PYYA 3ALNA 3FZ1A 4DE4A 2UW5A 3NSZA 2QOKA 3CJGA 3SHEA 4RJ4A 5CWZA 4CGAA 4DITA 4FL2A 4RSSA 5HTBA 4OBQA 4D9UA 4NJDA 2IN6A 4TNBA 4DH8A 4L43A 2VX1A 4UEUA 3QTWA 4D1ZA 5AP5A 5DR2A 4K11A 3DKFA 3UOLA 3BEGA 2F2UA 1IASA 2P55A 3EOCA 1BX6A 2Q0NA 4RVKA 5LMAA 4BCPA 4YZBA 3F2RA 1DS5A 3GVUA 3DFCB 3GQLA 2FH9A 4MD9E 5AUWA 1YHSA 3ZFYA 3DQXA 4BGHA 4EOPA 2UZDA 4UB7A 3U9CA 4CZUA 1PXJA 1KOAA 2QOOA 3ETAA 4Q2AA 5EKOA 5AV4A 3I5ZA 4RVLA 3MH1A 2IZTA 5F95A 2HIWA 1OKWA 4J95A 5FLFA 3V01A 4AF3A 3HP5A 5KBRA 3SOCA 1LUFA 4O6EA 4D2PA 3D83A 1CDKA 1WBSA 3PJ8A 3LJ2A 3MFUA 3H9FA 4FNWA 4NKSA 1M17A 4IVDA 5HGIA 2XP2A 5AA9A 4BWKA 3RINA 3SW4A 2BILB 4KNBA 4EI4A 4FV1A 4MXAA 1WBVA 4HJOA 3EN6A 3VUIA 4BN1A 5LOHA 3AD4A 5FBNC 1OKYA 2WPAA 3NW7A 1ZY4A 3R9HA 4XG6A 3TM0A 5HIEA 3VUGA 3FWQA 1UU7A 3ORZA 1Q99A 3H9OA 4LGGA 3LCTA 4A4LA 5HD4A 2I1MA 4NM7A 3QAME 3P1AA 2GNHA 3KXGA 1YWNA 4IX3A 4W9WA 4I4FA 3KEXA 4RLLA 1M2PA 5JRSA 4CZTA 4MVFA 2I7QA 3OF0A 3LCSA 2DYLA 3TNHA 5GINE 4PDYA 4I20A 1DI9A 1V1KA 3SV0A 4HYUA 4L3LA 3VS6A 3TDVA 3UVPA 1ZXEA 3P78A 4GG7A 4F6SA 2VO6A 3WE4A 3R9NA 1G8AA 3I81A 4CZYB 3KGAA 5FP6A 1XQZA 4TTHB 2X9FA 3O8PA 4HZSA 4FTOA 4J8NA 1JQHA 4JVGA 4PP9A 3AG9A 4YO6A 5CEIA 4IC7A 1J91A 2Y6OA 4B99A 5C4LA 4ZMEA 2EXMA 3ZSGA 5L2QA 4WBOA 3QGWA 2WU6A 3Q52A 4XLVA 3UZTA 3ROCA 2GNLA 2GFSA 5EYCA 4BHNA 4J99A 3RP9A 4H1MA 4YZNA 3OBJA 3ZTXA 3FMLA 3DXQA 3SKCA 2OG8A 3A2CA 4FSYA 5TT7A 1V0PA 4EH4A 3KRRA 3WZKA 4JX7A 2HY81 4EQCA 2XK6A 4CXAA 3ZLSA 5HE2A 2GPHA 2JKQA 4YC8A 2XNPA 5HE0A 4UN0C 5HEZA 4R78A 3ODZX 4RWIA 1JKLA 1YDSE 4E3CA 2QHMA 5ANKA 3TZMA 1W0XC 4BBFA 5ETIA 2PMIA 3NNVA 4IB1A 4E4NA 4DGNA 4CSVA 3GOPA 3SX9A 3SA0A 2FO0A 2WTKB 2PWLA 4FG7A 4WA9A 4YTCA 4JL9A 2WO6A 1ZYJA 2YIWA 1I09A 5CTPA 3WZUA 2IVTA 3MFTA 1JNKA 4WNKA 4FODA 3TV7A 3NX8A 4GUBA 4EC8A 3R9RA 4QMUA 3O50A 5AMNA 2PVRA 4F65A 2YHVA 4AGUA 3BRBA 4FR4A 4RRVA 4X3JA 3BYUA 4QQ5A 5JN2A 4DF3A 1CKIA 1Q97A 5L8KA 4FX3A 4IADA 4Z3VA 3EZVA 3POOA 4FOBA 4ACHA 2P2IA 3E5AA 3VO3A 2GNGA 4AOTA 4FKLA 3REPA 3R9DA 3WILA 4BCOA 5L6OA 5LVPA 1DI8A 3EKKA 1URWA 4ZLZA 4ANNA 4RIOA 2C6IA 3AQVA 3Q4ZA 4E5AX 5CY3A 2QI8A 3UNZA 1ZOHA 4FMQA 4H3BA 4FSUA 4H58A 2G2IA 4LGDA 5JGBA 3DXPA 3ZYAA 1MRVA 3C4XA 3FKLA 3IW8A 3R22A 4YTIA 3TNIA 5LWNA 1PY5A 1Z9XA 2HYYA 4H39A 4RJ8A 2OIBA 4IVAA 3W2OA 2QOHA 3U54A 2QHNA 2DUVA 2X2KA 3NYXA 4Z7GA 3QF9A 3DK3A 4O0SA 4BBEA 4W8DA 4F7NA 1PRYA 3GENA 4AZEA 5HIDA 3EN9A 4NUSA 4Y5QA 3FXWA 5HIBA 2VWXA 5I0BA 4O21A 4BVUA 5M55A 3NYOA 3IDPA 4C34A 4LL5A 3QYWA 4OR5A 5HLWA 1SNXA 2IZSA 5E4HA 4FIFA 5K0XA 4GYIA 1MRYA 2X8DA 4Q5EA 3LFDA 4APCA 4FTMA 3KFAA 4F9YA 4O7RA 3TTIA 5ANEA 4E5BA 5HO6A 4PMSA 2V0DA 2YDKA 1FGKA 3O8UA 4UZHA 3KA0A 2CJMA 3U4WA 1LEZA 2OF2A 5HTIA 3UZRA 4NCTC 1HOWA 4XV1A 5EI6A 1H01A 3AOXA 1OVEA 2UW0A 2XNNA 4BCMA 4V05A 5KKRB 4JIKA 4QMYA 2AC5A 4EK4A 2FB8A 2HENA 2WELA 4LMUA 4BCGA 4AT4A 3N51A 3VRZA 3WYYA 2GS7A 4L46A 2R3OA 1ZWSA 1H07A 3TKIA 2YCFA 2XUUA 5EYKA 2UZOA 5DBXA 4C4EA 4DT8A 1BL7A 3CS9A 5EI2A 3VNTA 3NVKI 1OI9A 3GC0A 2ZYBA 3O96A 1SVEA 4JI9A 3R8LA 3QQLA 3RAHA 4BCHA 3FEGA 3Q4CA 3V6SA 4FSZA 4GK4A 4MNFA 4DH5A 4IM3A 5F1ZA 5ETCA 4HNFA 2HCKA 3D14A 3IPHA 2G9XA 3VS3A 5HU9A 3NW6A 1Q3WA 3ROYA 2CKPA 5L6PA 4FEQA 4C2VA 3V8TA 1VEBA 5L2IA 5IKWA 3WI6A 3CTHA 2B9HA 2YIXA 2W05A 5F4NA 2X7GA 3BHHA 3JXWA 4LOOA 2QOQA 4G3DA 5TE0A 3C0GA 4YZ9A 3UMWA 2C47A 1ZAOA 4C37A 2BFXA 4EH6A 3BHVA 2WTCA 3MFRA 5AFVA 3U9NA 3M2WA 3UP2A 1H1RA 1OL1A 4Y72A 3DBCA 5CT7A 1Q8ZA 2W1DA 5LCKA 3CGOA 5BVWA 5C27A 4YURA 2PVJA 4KS8A 4ZTSA 4C57A 3QRTA 3VN9A 4OBOA 3LFAA 4BYJA 5D9HA 1Q41A 3WF9A 1UNLA 4LG4A 4YJVA 4EOMA 4YPSA 2WTDA 1QPDA 3R21A 4MTAA 4GH2A 3G90X 3D7TA 4QYGA 5CEQA 5KMIA 4O7NA 5M4CA 3GFWA 5AUXA 4V0GB 2AYPA 4MXZA 4RJ3A 2WTJA 2R3NA 3QQFA 2UW4A 3GOKA 3RVGA 2C5YA 3H9RA 3DV3A 4GFMA 4HCUA 4CV9A 3K3IA 3FMDA 3PE1A 3FI2A 4K1BA 3T9TA 2CKEA 4EKLA 4BCJA 3MB7A 5C1QB 1FVRA 3RM6A 5HCZA 4DH3A 3IW4A 3MN3A 4F1OA 1A06A 4BF2A 3DB8A 4MBJA 4L67A 3HMMA 4RFMA 5ANDA 1BYGA 3FI8A 3WF8A 4BRXA 3GEQA 2F7ZE 4PF4A 3A4PA 4O2PA 5B7VA 4RFZA 4I22A 4B8MA 4EBVA 3H0YA 1XBCA 3OMVA 4Q9ZA 4QMOA 3F82A 4N4SA 3TL8A 2W1ZA 4M12A 3IK3A 2ESMA 3UP7A 3CKXA 3Q60A 1NT2A 4C36A 3PVGA 4DEEA 1BI7A 4ZSGA 4AU8A 3EHAA 4EUUA 2HY0A 3KULB 3GCVA 3TWJA 4EONA 4FKIA 1YXUA 3MY0A 4QMVA 2GHGA 2UZTA 3EL8A 1CM8A 3P7BA 4CLJA 2PYWA 2QU6A 5IQAA 5HCYA 2WMBA 3V51A 2WQEA 5AV1A 2X2MA 2I0YA 2OXXA 3N9XA 4BIBA 1YRPA 3ORKA 1STCE 5HNGA 2BRNA 2H6DA 2JIUA 1NA7A 2W5AA 2ITVA 3CLYA 3NUSA 4N70A 3HAMA 3QHWA 3CQUA 1TQPA 2A27A 3MA6A 4JQEA 4KAOA 4S32A 3COKA 4AA4A 4FG9A 3VW8A 4EH3A 1JWHA 1WVXA 4Y8DA 4ZS0A 4MD8E 4WKQA 4YHTA 1B38A 4FSMA 4IJ9A 3DK7A 3OC1A 4FT9A 2ITZA 3B8QA 3ZHPC 5HE1A 2ITPA 3KRXA 4L6QA 4XBRA 4CT2A 5C8MA 1M2QA 4EZ7A 4GK3A 3OTVA 2YM8A 3KXXA 2GDOA 4K9YA 2BRHA 3DAJA 3NLBA 3QLGA 4O0XA 3BEAA 4C59A 2R3HA 3HAVA 2OH4A 3RHKA 3NRMA 3RPRA 1GIJA 3NWWA 1QPEA 2C6KA 4Q9SA 3LVPA 4L44A 4CT1A 3EQBA 4AOIA 4GCJA 4TYIA 4RVTA 4QP2A 3WYXA 2O0UA 4A4XA 5TR6A 3COHA 5KX8A 3R83A 2YITA 2Y6MA 2GQSA 3ZRKA 2ITUA 3PA5A 1R1WA 2CNQA 3P5KA 2W4KA 4FEVA 3HDNA 3MIAA 3VJOA 2NO3A 3MPAA 5CANA 5JZJA 4U45A 3FMKA 2FUMA 2WQOA 3C4ZA 2GMXA 4FVQA 4UWCA 5HO7A 3DNDA 4BDBA 3W8QA 3C13A 2QD9A 3UQCA 4EJNA 3PWDA 2YFXA 4X3FC 5BVDA 3R04A 1J1BA 2E2BA 4K18A 2X1NA 1PF8A 3BGZA 3QTZA 3OCSA 4F6UA 5C4KA 3KXZA 4F70A 5HICA 4WG4A 3V6RA 2HZIA 1UKHA 3A7HA 2BTSA 4RQVA 4CQEA 4ZTNA 5E8TA 1W8CA 3ZFMA 4P5QA 3EQRA 3R7OA 3G51A 2BALA 2HXQA 2X0GA 4KA3A 5FRIA 4G9RA 5LMBA 1PKDA 1YI4A 3PVBA 2Z2WA 4LUEA 4O27B 4WUAA 4RPVA 3TCPA 5T3QA 4ERWA 4BDEA 4JRNA 4BDDA 3UPZA 1NVRA 2IZUA 4FV3A 1PW2A 3ORLA 3PIYA 4TWPA 4CKRA 4TXCA 4DHFA 4YJOA 1PXMA 4YTFA 1KE5A 2CMWA 2JIIA 5BUIA 3UPXA 1PXNA 5E8ZA 4ANLA 2PZRA 5CF6A 1O6KA 4UX9A 2QQ7A 2W5HA 4ZK5A 4XRLA 5D41A 4UALA 3P79A 5HE3A 2Y7JA 4E93A 5DNRA 5EI8A 4AGDA 4CV8A 3CPBA 1H1SA 3FMNA 4FKJA 4AT5A 4YJNA 3V8WA 2GQRA 3OBGA 3K54A 4QMNA 1ZRZA 2Y4PA 4L00A 4RC3A 2W9ZB 5AP0A 4GJ3A 4TW9A 3WZJA 2OJ9A 4ZTLA 1OPLA 1MQBA 3HP2A 1IAJA 3SOAA 4D0WA 4JRVA 4R3CA 2FYSA 3OEZA 2GSFA 4G6OA 4WRSA 1TQMA 3A8XA 4OTWA 5F20A 5BYZA 5IZFA 4MD7E 4JT3A 4YJRA 4RJ5A 3R6XA 5DT3A 3MH3A 4O7VA 4FV6A 2G01A 3MESA 1OL2A 3R71A 3LLAA 5J8IA 5BVEA 4E6QA 3DB6A 4WG5A 2PK9A 4GFOA 4O6LA 3V3VA 4A9UA 4YJUA 2LAVA 1OIYA 2QU5A 5I9ZA 4OTHA 5L8LA 3BV2A 4CVAA 2CGWA 3VBWA 1YW2A 2IZRA 3HGKA 3IQ7A 4A9RA 2PUIA 4DT9A 1YOJA 5EDRA 4BI2A 5DPVA 4DFUA 3LCOA 1XH5A 4PPAA 5C9CA 1PHKA 4OT5A 3BELA 3MVJA 3W10A 5FG8A 4AG8A 2O63A 4YC6A 4E20A 2HWPA 3GCPA 3MS9A 5BNJA 4FUXA 5IA1A 3JY9A 3WARA 2YA9A 3M42A 4FTRA 2CLQA 3I79A 2FSMX 2WTWA 2BUJA 1ZMVA 4K0YA 2YABA 5CVHA 1FINA 3R8MA 3VQHA 3VS0A 3VUTA 4DEBA 3DAEA 5D11A 4PV0A 3BWFA 1TKIA 5E7RA 5IQDA 1UWHA 2JIVA 2XCKA 3ORXA 2VWIA 4CNHA 4YHJA 5FGKA 2H8HA 2ETKA 1XBBA 3QA0A 3F88A 4O38A 5FXSA 4DGLC 4B6LA 3FQSA 5FDXA 3W2QA 3JVSA 4LOQA 4L42A 3S0OA 4RA5A 5HX8A 4HCTA 4MK0A 4XRJA 4JAJA 5FXQA 4DN5A 4DBXA 3A61A 4ZTRA 4AP7A 5B0XA 4WHZA 4TL0A 2IG7A 4EH5A 3G6GA 4CFMA 3HDMA 3TTJA 5A14A 2B7AA 3COIA 4KSQA 5A54A 3TACA 4DFYA 2BDFA 3R8UA 3HMIA 4CD0A 2R3QA 4RJ6A 4YR8A 1WZYA 5J9ZA 3HL7A 2QLUA 3AMYA 3D15A 4USFA 2OIQA 3UOKA 2E9PA 5JMSA 2YJSA 1TVOA 3FZTA 3KXNA 2QO2A 4RQKA 5HCXA 1M52A 1OPKA 2ITOA 2CNUA 3QA8A 2BRGA 5FBOA 4I4EA 4S31A 2V5QA 4U6RA 5M51A 4I0TA 2RIOA 2C69A 3Q9WA 3GBZA 3TKUA 2HWOA 1ZOEA 5AM7A 3RZFA 4I93A
chains in the Genus database with same CATH superfamily
4V0GA 4O96A 1QPJA 5BYLA 2WU7A 5IQFA 1ZYLA 5E8YA 3ITZA 4IC8A 3H10A 4WO5A 4QP1A 4GJ2A 4JDJA 2C5NA 3LXNA 5AIKA 2P3GX 4FKSA 4RG0A 2PVLA 5M4FA 1PXOA 3RGFA 4I5MA 1NVQA 4UV0A 2R7BA 5D1JA 1LR4A 2R7IA 1AQ1A 3KMUA 3O71A 4FV5A 4CFVA 3FHRA 4TWNA 3QTQA 1JKTA 5IMEA 3QD0A 5LWMA 4J97A 2YM7A 4F0GA 2OJFE 3R1YA 5AUYA 3I5NA 3GQIA 3QC4A 5FXRA 5JFXA 2XJ0A 5AR7A 4PMMA 1FMOE 4Q5HA 3SG8A 2VWUA 2J7TA 1IAHA 2G1TA 4K33A 3RNIA 2ZV2A 2ZV8A 5H8EA 3VBXA 1VJYA 3OXIA 4IX5A 4PL4A 4RIYB 4EOKA 4KB8A 5HESA 5LCJA 3EIDA 3LQ8A 3Q96A 2BMCA 2ZDTA 3IOKA 2OGVA 4GEOA 5KHXA 3KULA 2QR7A 1X8BA 3UMXA 2CSNA 3UBDA 1VR2A 2V7OA 2XBAA 4G3FA 4IX6A 4M15A 4X2FA 4M67A 1IA8A 1OIQA 3QQKA 4ITIA 4MQ1A 3TZ8A 3NS9A 4O4EA 4OTPA 1ZOGA 4QQJA 2W1FA 4FRFA 4ARKA 4P4CA 5IISA 5DR9A 3DLSA 3OT8A 2G2FA 5HOAA 5I4NA 2XCHA 1J7UA 3H30A 3OS3A 4O0RA 3E92A 5FUTA 1AD5A 2QKRA 4IXPA 4JLCA 5IG1A 2YZAA 3MY1A 1HCKA 4F9CA 5CXZA 5ITAA 5J7HA 2YM6A 1ZMWA 4JX3A 5C03A 2EXEA 3FKOA 4DEAA 4O4DA 4YLKA 5DI1A 3UQFA 1R0EA 2V62A 2VTOA 3U55A 4DH1A 5HVYA 5FQDC 2XNGA 4IFGA 3QZIA 4FNXA 4XP3A 4BICA 4C02A 3R7EA 1V0BA 3VUKA 2RKUA 5A4QA 3NFGB 3DTCA 4XNEA 2IO6A 2BHEA 2ERZE 3NUPA 3PJ3A 5DMZA 3POZA 4AZVA 3OY3A 3AD6A 3K3JA 4ACDA 2VWVA 1FGIA 3C50A 2BR1A 5HBJA 3F2NA 5DT0A 2HW6A 1JSVA 1Z57A 1XH9A 1YXSA 3R2BA 5DRDA 4W4WA 1JPAA 3VHKA 3PY0A 1JLUE 3AMBA 5IEVA 2BROA 3DDQA 5IUGA 2SRCA 4QNAA 1FBNA 4M7IA 2WMTA 5C8KA 2ITNA 3GU4A 3CY2A 4MQ2A 4IWPA 4OTDA 2YACA 3W2SA 4CMOA 2QG7A 4HYHA 3CSVA 4OTQA 3QZHA 3OWKA 4C58A 2YAKA 3QTIA 3K2LA 5T6KA 4ENYA 2E9VA 3CPCA 4QMPA 4AXDA 4X6RA 4D4SA 4F7LA 3PG1A 2YN8A 5TKDA 4YNOA 2A1AB 1S9IA 4UXQA 3AT4A 3PXYA 3AC1A 4WRGA 4YSMA 4AA0A 4AW2A 3EB0A 5AM6A 3GI3A 3QWKA 4QOXA 5CI7A 4BR3A 5FWKK 1NVSA 4DTAA 2R3RA 3F5GA 1KE9A 4O7LA 4NTSA 2CCIA 3F5UA 3IGOA 2IJMA 4CYJA 3PPZA 1S9JA 4BCKA 2BRBA 3FQHA 3HZTA 3L8SA 5HBEA 3FKNA 3TN8A 3U87A 1KE7A 1JSUA 1GZ8A 1Y6BA 4O4BB 3ZBXA 2O3PA 2ETRA 4X7QA 5HTCA 3GT8A 2OFVA 4FV2A 3TEIA 3PPKA 2VTSA 3HEGA 4FZFB 3UJGA 4CMTA 4AW5A 3PXRA 1Q8UA 1ND4A 3PIXA 2QO7A 2J0IA 3KU2A 4X21A 3V5PA 3UO4A 3ZLYA 4EWHA 1Q24A 3AC2A 3FMHA 2R2PA 5CU4A 5J1WA 2PTKA 2X39A 2YLEA 3DZQA 3K5VA 4DFXE 3Q4UA 4F0FA 3DKGA 2B52A 3MYGA 4KKGA 5T68A 2RFDA 4FIHA 4CCBA 1OBDA 2WMQA 2UW9A 1W2FA 2VWZA 3R7IA 1WBNA 5HBHA 3QCSA 4F9AA 2ZVAA 4QYFA 3UOHA 5FDPA 4UBAA 4XG7A 3IS5A 3SRVA 3UO5A 5IH4A 3GUBA 2JD5A 2WMWA 3CTJA 1OB3A 2WTKC 3TNQB 2ITTA 4XS2A 4AZFA 4ZJVA 1DAYA 3QRJA 2WIPA 4RC4A 2UZNA 5CSPA 2OJGA 2BDWA 2RL5A 3MBLA 4G5JA 1CSNA 4RIWA 5IQBA 3ORNA 5FTQA 3WE8A 1P5EA 3C0IA 3HNGA 4G34A 3EJ1A 5AEPA 4OTGA 3UVQA 4J98A 5GZAA 4FA2A 3JR1A 4RZWA 4I0SA 1YQJA 4X3FA 2XEYA 5DIAA 2BAQA 4JDKA 4BZOA 3AXWA 3QTUA 4IAYA 2JLDA 3OY1A 1GAGA 1ZZ2A 2OXYA 3D2KA 3KCKA 3R7GA 4F09A 3PLSA 3ZBFA 4IB0A 4HNIA 4BTFA 3QX4A 4FOCA 4FTQA 5EHOA 4PTCA 2GCDA 4JIAA 3ZONA 4ASEA 2OSCA 4WG3A 2J50A 3BHTA 2PVHA 1SMHA 4FZ6A 5CU0A 4B8LA 4ZSEA 4YBJA 1PXIA 2WGJA 4I1ZA 4WSQA 3QX2A 1K9AA 4O7SA 4A4OA 4L01A 2CKQA 4L3JA 2Y0AA 4TNDA 5H8BA 3U6IA 3A60A 1L8TA 4YHFA 2UW7A 2R4BA 3WOWA 3W2PA 3NUXA 1CKJA 3ATTA 4RX8A 4FSTA 2QONA 3BE9A 4I6BA 1VZOA 2C30A 2XVDA 4AT3A 4QDVA 4AQKA 5M06A 3DQWA 1J7LA 4RT7A 3MJ2A 4BBMA 4BTJA 3W0RA 3RPOA 4IAZA 5EYMA 1F0QA 4ANSA 5J9YA 3FLQA 3VIDA 4CKJA 4H05A 2UZWE 2WMVA 2NRYA 4AW1A 2OBJA 5M4IA 3E64A 4M69B 4D2WA 4HYIA 1XR1A 3BYSA 1W82A 4NT4A 4R6VA 4U44A 4EQUA 2JAVA 3KXHA 3L9PA 5DA3A 2R3IA 4IZYA 4DEDA 3TJDA 5EH0A 4LDTA 4UYAA 2CGVA 2WD1A 3DOGA 3Q9YA 4R7BA 4QMMA 4OUCA 4EH7A 3BLQA 3QZFA 4IZ5A 3QZGA 4GT3A 3ULZA 5E9EA 1F3MC 1OITA 2OU7A 2BVAA 3S3IA 1OPJA 3HUCA 5E8VA 3TZ9A 4R5YA 2I0EA 2J5EA 3QCQA 3QU0A 4ITHA 4ID7A 3D4QA 5KKRC 4O0UA 4PNIA 2HZ0A 4ZY6A 1XH7A 3CTQA 5HNBA 3ZOSA 3QQHA 2NRUA 3NUAA 3E87A 2RGPA 3NUUA 4JOAA 3TUDA 5CAPA 3NNWA 3RAWA 3EN5A 4O7TA 4FV7A 5IMXA 3KRLA 2C6TA 4YUQA 4DCAA 4DTBA 4RWKA 1YHWA 3GU7A 3HRFA 5KHWA 1W7HA 2F57A 3TNWA 4M97A 2QOFA 4BJJB 5M08A 2VUWA 4C4IA 3E8DA 5L8JA 4U5JA 3GU8A 4M66A 1UU8A 4GU6A 3E7OA 1E1XA 2PE1A 3NR9A 2C5XA 2C6MA 4F99A 3PJ1A 5G1XA 5M57A 1GZNA 3ZUVA 3RTPA 2WQMA 3QHRA 4NW5A 3F3ZA 2VX3A 3QCXA 4NEUA 4F7SA 5JK3A 5KMLA 3BLAA 1PXKA 4HZRA 3NAXA 3RJCA 3D5WA 2W1GA 2VD5A 2KULA 2W4OA 2H9VA 4ZZNA 2J4ZA 4QYHA 4LM5A 2VTQA 4TY1A 3FDNA 5H8GA 4FJVA 3UO6A 3E8CA 2YEXA 3G6HA 3E8EA 5BMMA 5EW3A 2OW3A 3ORPA 4RIYA 3CEKA 2JDVA 3NCZA 3F5XA 4E6CA 1WVYA 3ODYX 2VWYA 5AUUA 5DR6A 1WVWA 5GJGA 5EW8A 1W98A 2HXLA 2IPXA 4U9AA 3FUPA 3MB6A 1PKGA 2XF0A 5H9BA 4YNEA 1CMKE 1UA2A 3LHJA 2XYUA 2O65A 5LMKC 5D7AA 5AJQA 4AN3A 4EZ3A 4ZTMA 2VTAA 3DDPA 3EQGA 2VX0A 3PSBA 1ST4A 3G9LX 3BQCA 4J53A 1WCCA 1APME 3HYHA 2PL0A 3MFSA 4WOVA 4CFUA 2OZAB 1FVVA 4FBXA 4J8MA 2BIYA 3E63A 2UZUE 5IDNA 4FKOA 3W0PA 5E90A 3LFFA 3FZPA 4L53A 2DWBA 4FKQA 3BV3A 4YP8A 5JH6A 1BLXA 4E6AA 4PNKA 5E8SA 3S95A 2VGOA 3UGCA 4FNYA 4NKAA 2F7XE 1A9UA 3O7LD 2ZAZA 3QFVA 2PVFA 4G3CA 1M2RA 2HK5A 2QURA 4QMLA 4DEIA 5FTOA 2WXVA 3DA6A 5JSMA 1Z5MA 3D7ZA 3DS6A 3KY2A 4G31A 2W0JA 3JY0A 4EL9A 5IA3A 4C4GA 3QTRA 2ERKA 2ZV9A 4YJQA 4UXLA 3FV8A 2R3FA 3DBFA 3E3PA 4O0TA 4QMXA 3ZS5A 3DBEA 3R02A 4ZP5A 2C5VA 5AR2A 2OWBA 3BL7A 3F9NA 3NGAA 3OWLA 4FTJA 1A48A 1SVHA 5IUIA 3P7CA 1WBWA 2CLXA 4ZJJA 2BRMA 2WMSA 3C4FA 5B2KA 4BTMA 4QT1A 2IW6A 3HV5A 4I5HA 3VRYA 1ST0A 2OO8X 4ZLOA 2R3GA 4FYOA 4C8BA 5L2TA 5DWRA 2RF9A 1WBTA 2IVSA 1LPUA 5AWMA 5CVFA 3WIKA 5DVRA 4MWHA 4QMTA 4EYMA 4IM2A 2X6EA 1UKIA 4IE9A 4DHIB 4QTDA 2XK3A 3ERKA 2A19B 4DC2A 5BVFA 4FGRA 1T46A 2LGCA 3AC4A 4FIEA 4E4MA 2A2AA 3IW6A 3I4BA 2CPKE 4PTGA 4DFZE 4MYGA 2GNJA 2IEWA 3RWPA 4ZTHA 4O0YA 5FEQA 1M7QA 5DGZA 5H2UA 3PXKA 4PWNA 4ANMA 3R1SA 3U6HA 2BZHB 2J0MB 4EOLA 4BI0A 4D1XA 5LXMA 4D4VA 4FYNA 4YC3A 3RAIA 4YO4A 3PJCA 1MUOA 3R2YA 3C1XA 1J7IA 3D94A 4IDTA 4FKTA 2FSTX 2GTNA 2VNWA 3RMFA 3UNJA 4FTAA 1OL5A 3F2AA 3Q3BA 3RPSA 4NWMA 5J95A 3QXPA 2XKEA 3RCJA 4KIQA 1PMUA 4LMNA 4C3RA 4EK5A 5L4QA 1O9UA 2BAJA 3L8XA 2PY3A 4FTCA 3BU6A 5IA5A 3OOGA 5C26A 1JVPP 5IQIA 4GK2A 3LFEA 5ANGA 1H08A 2BAKA 3S00A 3OUKA 5E8XA 3PZHA 4O83A 5CF4A 1PXLA 4NJ3A 1IR3A 4M14A 1XJDA 2YCQA 4FZAB 1FQ1B 5AP6A 4O0VA 4AAYA 3QD4A 2X81A 4ZTQA 5BMSA 2V7AA 3HV7A 2NPQA 3HVCA 4FT7A 5CSWA 5HI2A 3LW0A 4X2NA 1JAMA 1RQQA 2FSOX 2W1HA 4IWDA 1TZDA 3PDTA 2PMNX 4AZSA 5B2MA 4TRLA 3Q6WA 5BPYA 3QTSA 3ZM4A 4ALVA 4TPTA 3OWJA 2VWBA 3BHYA 5AP4A 4LFIA 3WIGA 2ITWA 3P7AA 3PZEA 3C5UA 4MAOA 3LFSA 2B9JA 3BGPA 3HV6A 4ZZMA 3H4JA 1P2AA 4UMRA 4GG5A 4D0XA 5JEBA 3QQGA 4I24A 2WFYA 2QOBA 4MNEB 3KN5A 3GB2A 3UG2A 4WNOA 3R8PA 3V5LA 3UYSA 2XRUA 3AC5A 4Y85A 1R39A 5HHWA 4AN9A 4EYJA 4NZWB 1P14A 1H1QA 2FA2A 3VHEA 3M1SA 3WF6A 3ZO3A 3LQ5A 1U5QA 4MXOA 3RPVA 3JVRA 5IEXA 1YI3A 1U59A 3PPJA 4AS0A 1H1PA 4D2TA 2XJ2A 2BDJA 4O1OA 5KUPA 4DTKA 1CTPE 4MBLA 1ATPE 4DYMA 3CQEA 1PMNA 4X2GA 2XIKA 4JG8A 1JKSA 1J3HA 5F9EA 3IW7A 3ZSHA 3PP0A 3PFQA 3NUYA 5AP7A 4XG3A 4C4FA 3CGFA 2QOIA 4I3ZA 3LXKA 4IHPA 1E1VA 2BPMA 4L8MA 2ITQA 3O17A 2VTNA 4P90A 4XG9A 5JFWA 3KMWA 3OFMA 3NIZA 4EHGA 3AKJA 1OIRA 2E9OA 3II5A 4L52A 4HVDA 3QTXA 4BB4A 2YM3A 4B9DA 1K3AA 3R30A 2WKMA 5KO1A 3NVMB 4RVMA 4A06A 4A07A 3EYGA 2XIXA 4E5WA 5D12A 4AE9A 3C5IA 2XAMA 3R73A 4C2WA 2QOCA 3MH2A 2XIYA 4C38A 2EVAA 3AD5A 3OW3A 4MEDA 3UIXA 4R77A 4L9IA 4BCQA 4AGCA 3LOKA 4U41A 5HVJA 2FGIA 4N57A 1U5RA 5CF5A 3ZUUA 2GNFA 3FMMA 3QQJA 2CHLA 3SXRA 3HECA 1H25A 4QRCA 5CF8A 4FVRA 3C4WA 3SC1A 4FEUA 4GIIA 4QQTA 1YKRA 2QVSE 3MSSA 3L9MA 5D7VA 3EQHA 3OXTA 4KBCA 2NP8A 3UNKA 4C33A 4GS6A 4HGTA 2WTIA 3E93A 4HOKA 4BDAA 3IDBA 4D5HA 4RIXB 2PPQA 5HX6A 5A4LA 3QCYA 2HOGA 4BCNA 4X2KA 4G6NA 5AAGA 2PMLX 4AW0A 3MJ1A 4HYSA 4IWOA 3EN7A 3OOMA 3CBLA 4ALWA 4OTIA 4D58A 1F5QA 4GW8A 3FLSA 4MX9A 2C5OA 2UZEA 4EH8A 4EHEA 3LXPA 5TO8A 2XRWA 2O64A 3TXOA 4EWQA 4XYFA 5AP3A 4NIFB 4NL0A 2W96B 2CGXA 3GC8A 5M07A 4YJSA 2VTIA 3E3BX 3F3WA 3PTGA 3EFJA 3QRUA 1QPCA 3DT1A 4Y73A 3TNPC 1YI6A 4C3FA 1NW1A 1BUHA 4ZXTA 3F3TA 2UZVA 1PMEA 2QODA 5FM2A 2AEGA 4O86A 1IEPA 2IWIA 5KMKA 4J1RA 3G0FA 3SD0A 3TJCA 3THBA 3Q9ZA 1M14A 3M11A 5J5SA 4C62A 4PX6A 5BX0A 3LFNA 3SLSA 1FPUA 5ETAA 1WBPA 5DN3A 3HV3A 1J1CA 2ACXA 4B0GA 5J79A 2PUUA 4YJTA 5JGAA 3DPKA 4FTNA 4N6ZA 3UIBA 3ZUTA 1QCFA 5FEDA 4DEHA 5EQEA 4I92A 1REJA 2WMAA 3OEFX 2IF8A 5E8UA 3C7QA 4HW7A 4QYEA 3F69A 3ZDIA 4RGJA 5GJDA 4ZJIA 4TYEA 2X7OA 3RBWA 2X6DA 1V0OA 2PU8A 1HCLA 5DLSA 2PZPA 4JMQA 5I3OA 2XYNA 4UMPA 1B6CB 2X7FA 5EK7A 1YVJA 2EB2A 3FLWA 2PZYA 2Z60A 3OHTA 4F4PA 5ACBC 2ZM3A 5AR4A 2EB3A 4EOOA 5K4IA 4S2ZA 4I6HA 1DAWA 3QXOA 3IO7A 5GJFA 3FLNC 5CENA 3EQCA 3VAPA 1Q61A 2OFUA 4I23A 4ANQA 3D5XA 4BIEA 2VTPA 2E9NA 2ZM4A 3LFCA 3P9JA 5CNNA 2QKWB 2Q83A 2O8YA 1H8FA 4PPCA 3BYVA 5K5NA 3UVRA 4Z9LA 4II5A 4Z7HA 2P2HA 3LPBA 5CXHA 5DEYA 4NM5A 4AFEA 3VS2A 4ERKA 4G3EA 1O6LA 1SZMA 2JGZA 2GS2A 5AADA 2QC6A 1H28A 3IKAA 3BBWA 4C0TA 5KE0A 3TT0A 4D2SA 5IPJA 3W0NA 1UNHA 3VUHA 2KTYA 3K5UA 3O23A 4AXFA 5LMKA 1UV5A 3ZZWA 2JDRA 3IONA 3A7IA 5BVNA 4M0ZA 2JKMA 3BQRA 3MA3A 3MH0A 4TYHB 4CG8A 5GIPE 2R9SA 2PE0A 3KVWA 2F9GA 3BKBA 3CE3A 3OG7A 5IA2A 4QPMA 4DLJA 4C4JA 4MHAA 5CLPA 2X0OA 4PMPA 4FGBA 5CT0A 3R1NA 4HVHA 3W18A 2B54A 4FIGA 4MXCA 4FTUA 3LQ3A 3RPYA 4ASDA 3MWUA 3CKWA 4USEA 4ZIMA 3VONA 1Q8WA 2VTLA 1XKKA 3VWAA 5ICPA 3MTLA 5I9XA 3ET7A 1WMKA 4TT7A 3W2CA 4FI1A 4FKUA 3O51A 2R0IA 3Q53A 2VV9A 4CG9A 2ZJWA 2JDSA 2W17A 5K0KA 5LVLA 3LCDA 2C3LA 3ZO2A 3WF7A 5KNJA 3Q5IA 4FC0A 3ATSA 2X2LA 2XIZA 5JFSA 2C6EA 3CCNA 3BX5A 3C4CA 4DFLA 4PP7A 3VBQA 3FSKA 4NH1A 3PRFA 2VWWA 3I7BA 3GC9A 3NNXA 2B0QA 3OP5A 3KCFA 2CKOA 4EEVA 3ORTA 3IECA 5DEWA 4WT6A 5FD2A 2ETMA 4XHKB 3JPVA 4DFBA 2C6DA 1IRKA 4MUQA 2C3KA 1H27A 4BKJA 3FC1X 5JGDA 4KRDA 5JFVA 2R3KA 3QD3A 5AP2A 4O0WA 3NUNA 4L45A 2XS0A 3PY1A 5A4CA 4H3QA 2X9EA 4KS7A 2R3JA 3MPTA 2FVDA 4FL1A 4G2FA 2VTMA 4RC2A 4DGGA 3OROA 2R3MA 1ZYCA 4CRLA 4N0SA 3VVHA 4BKYA 4Z55A 1GIHA 2XK4A 5KMJA 4LRJA 2J2IB 3DJ6A 1MRUA 1VYZA 2BKZA 4UMQA 3EFLA 4I6FA 4GT4A 4KD1A 4BDJA 4FEWA 5I3RA 4U3ZA 4QO9A 2B9IA 3MVMA 4AOJA 4QQCA 4IANA 2PHKA 5ETFA 1W84A 4X2JA 3FHIA 3VBTA 3W33A 3ZXZA 2PULA 3VJNA 2WTVA 4K6ZA 4R7IA 5CX9A 5GIOE 3FL4A 1OIUA 3QKMA 2B53A 1KWPA 4BWXA 5EHLA 4BL1A 5A6OA 4FSWA 4M84A 3ACKA 1MP8A 2ZB1A 3LE6A 2VTHA 4KKEA 4FK3A 1OKVA 2WQNA 2JC6A 5AUTA 4OTRA 2H34A 2F4JA 3DU8A 5CSHA 1H24A 4ZEGA 4YZMA 2ITXA 4D28A 4YLJA 3BIZA 4JS8A 2C6LA 4F78A 1YWRA 3DLZA 3ZLXA 4M0YA 4DAWA 2GHLA 1G8KA 5DHJA 4D9TA 2QO9A 1JKKA 4KIKB 2UW6A 4CTBA 5HO8A 3BYOA 1JOWB 2XA4A 1SVGA 4FF8A 4JJRA 4NYEA 4BY9E 2YIRA 3W32A 5GZ9A 3R7VA 3CD3A 4ZZOA 2JFMA 4LGHA 3F5PA 5ANIA 3A7GA 2R64A 3O2MA 2OIDA 4YPDA 1E9HA 4FT5A 3MY5A 3QLFA 4F9BA 3VF9A 4YMJA 1XWSA 2BIKB 1GNGA 3L8PA 2UVXA 4EOQA 3EL7A 3I0QA 3FPQA 3BBTB 3L9NA 3D7TB 1GY3A 4DG2E 2XNMA 2JKOA 4QD6A 4XEYA 2Z8CA 4PUZA 1U54B 3I60A 4W4YA 3ZCLA 4TYGA 4AN2A 2PSQA 1PJKA 3BHUA 2WHBA 5CASA 4BFMA 3FMJA 2E9UA 3BLHA 5G6VA 3SQQA 3TV6A 3PA4A 2RFNA 1GZKA 3LXLA 2Q0BA 3FC2A 4O82A 1OZ1A 4IAFA 4IBMA 4AZWA 4EOIA 5HG8A 4GUEA 5DT4A 2XMYA 3MGYA 3OVVA 4RIXA 3RNYA 2XK7A 4PDOA 5HNIX 4A9TA 3QKLA 5CAOA 3P23A 2X0PA 3G5DA 3F3VA 4DINA 4JR3A 3F6XA 3SXSA 5CZIA 2J6MA 3FY2A 4BGGA 3FZRA 3ZLWA 2XEZA 3A99A 4KIPA 4EH2A 1UVRA 5BVKA 4B4LA 4RZVA 4DA5A 4DGOA 3EWHA 3VS5A 4GL9A 4IAAA 1ERKA 3LM5A 3MV5A 2VAGA 3KVXA 4IVBA 3UODA 2CGUA 5ANOA 5HZNA 1R0PA 2YIQA 3FI3A 5KMOA 1Q8YA 3LLTA 4NIFA 5TF9A 2PVNA 1DM2A 3QWJA 4MXYA 4PL3A 4OAVB 3LMIA 2C0OA 3KB7A 5A3XA 3HRBA 3HMOA 4FEXA 3ZRMA 3RZBA 1ZZLA 2G2HA 2W4JA 5IQGA 1BMKA 3CD8A 3L1SA 2DS1A 1R78A 5AR3A 1QMZA 3I7CA 3KMMA 1Y8GA 4HGSA 3SGCA 5AR5A 3CC6A 5EDPA 3E7VA 3P0MA 3G0EA 3CQWA 2XH5A 4LOPA 3ZC5A 3DJ5A 5EOBA 3C51A 4B7TA 4C4HA 4EH9A 3LFQA 3NDMA 3ORIA 4MF0A 4RLKA 5AP1A 5DYJA 5IH5A 4DHJA 3W1FA 2RSVA 3UG1A 1RDQE 3ZM9A 4FV0A 4ALUA 5BUJA 1UWJA 2IW8A 2FSLX 3I6WA 2ZMDA 4D2VA 3HKOA 3KRWA 3E8NA 1UU9A 3PY3A 4IAIA 2BTRA 3NPCA 4WBBB 3T8OA 2Y4IB 4DCEA 1O6YA 4RWLA 2H96A 4R1YA 4BDIA 5EFQA 3FLYA 2XKFA 5FEEA 3O8TA 4O7WA 1YWVA 1CKPA 2P0CA 2OICA 3KF4A 4FTLA 4HCVA 3S2PA 2QR8A 4USDA 4FZDB 3CR0A 3W16A 2QOLA 1Q62A 2ZMCA 5CU6A 2UVYA 2YDJA 4BYIA 1WFCA 2C68A 3G2FA 3NYVA 4YU2A 5AV3A 4CEGA 4FT0A 3ANRA 4UWBA 4GT5A 2XKCA 4C35A 4TWCA 1OGYA 4XP2A 2XM9A 2GQGA 4QYYA 2WQBA 1FMKA 3QBNA 4U80A 5ACKA 1H0WA 3HX4A 4BDGA 4C61A 1ZLTA 5CAQA 4FTKA 3O7LB 5CAVA 4QTCA 3VS7A 4AQCA 5EW9A 4IVCA 5K5XA 1RW8A 2J0LA 1BL6A 2J90A 2JDTA 4FUYA 3VC4A 2VO3A 4U0IA 5E91A 5BQ0A 2Y8OA 4F0IA 2W06A 4E4XA 3TI1A 5GHVA 5AIRA 1RE8A 3U8WA 4FV4A 2WB8A 4FNZA 2EU9A 3H0ZA 4DHZA 3A7FA 3FI4A 4U42A 1XBAA 4I21A 3GNIB 5DFPA 4O7YA 1AGWA 4O1PA 3TV4A 3UOJA 4JBOA 2XBJA 3C9WA 1OM1A 4PL5A 4ACGA 3OCGA 4K8AA 3ZH8A 3G15A 3QL8A 5EKNA 2W1EA 4XLIA 5M44A 3GCSA 1YDTE 2YAAA 3MTFA 4TYHA 2F49A 3KQ7A 1OL7A 5L2SA 3B2WA 3VW6A 5A4EA 4FG8A 4ACCA 4KBAA 4YZDA 4CLIA 3ENMA 3R7YA 4XBUA 4BIDA 2WOUA 2I40A 4FKRA 4H36A 1U46A 3PXZA 4XG8A 3TIYA 3UDBA 5L6WL 4GYGA 4DBNA 2VU3A 1KUTA 2BZIB 4OGRA 4ASZA 1PYXA 3KL8A 4MWIA 3W55A 4D4RA 5LVMA 2X8IA 5I9VA 4DG3E 4S34A 5LVOA 4QDEA 4P7EA 2R0UA 2EWAA 4KIOA 4EOSA 3H3CA 4PMTA 1MQ4A 4KBKA 2C0IA 5AX9A 3A7JA 2JKKA 2ONLC 2PVKA 5JKGA 4ZY4A 4GKHA 5J7BA 3RK5A 3ANQA 3Q6UA 4CTCA 4JQ7A 4W4VA 4LRMA 4D2RA 4HVSA 2O5KA 3RI1A 1Q4LA 2XANA 5FTGA 2XK8A 5CSVA 1H0VA 4XUFA 1OECA 1TFFA 3DXNA 3TZ7A 3WZDA 2Z7QA 3Q32A 4OTFA 3QRIA 4O84A 3DBDA 3ZRLA 1OUKA 4QP4A 3WZEA 2XM8A 4RJ7A 3A62A 3UIUA 2ZOQA 3AGMA 1TQIA 3GC7A 4LUDA 3FYJX 4L3PA 4BGQA 2VN9A 5IDPA 4LV8A 4QP7A 2BKKA 4NSTA 4QPSA 3V04A 5IQHA 3NAYA 2ZM1A 4GU9A 2VO7A 3CP9A 4OW8A 5EDQA 5CEPA 2YLFA 4XX9A 3UYTA 4FT3A 4CFFA 5IQCA 5M56A 4TN6A 2OJIA 4HPTE 2YCSA 4D5KA 4LRKA 3TG1A 3MI9A 4Y95A 3UDSA 5KZIA 4E7WA 4NFNA 3ACJA 3OUNB 3P08A 4GFGA 1R3CA 3R0TA 5K3YA 2XB7A 3U6JA 4NW6A 3IOPA 3ZZEA 4TKSA 3PSDA 2A98A 4FTTA 2W7XA 4UYNA 3U51A 4G3GA 3UE4A 5D10A 3UIMA 4PDPA 1OL6A 5EOLA 3R8VA 3LZBA 3SDJA 5LVNA 1OGUA 4WD5A 1GOLA 4D55A 5DE2A 2YWVA 4O7ZA 1KV2A 3OXZA 3MDYA 4XV2A 3ZFXA 4AXAA 2YZLA 3JS2A 1XMMA 2CNVA 2I0VA 2J0KA 3PP1A 2A0CX 5KMNA 1B39A 3A4OX 3EH9A 4EQMA 2W9FB 5KCVA 3NW5A 3BLRA 1G5SA 4J96A 3FBVA 2BCJA 4BCIA 3Q2MA 5IF1A 4I5CA