1BX6A

Crystal structure of the potent natural product inhibitor balanol in complex with the catalytic subunit of camp-dependent protein kinase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
339
structure length
337
Chain Sequence
QESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine/threonine-protein kinase
molecule keywords CAMP-DEPENDENT PROTEIN KINASE
publication title Crystal structure of the potent natural product inhibitor balanol in complex with the catalytic subunit of cAMP-dependent protein kinase.
pubmed doi rcsb
source organism Mus musculus
total genus 94
structure length 337
sequence length 339
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 1998-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1bx6A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1bx6A02
4G9RA 2QR7A 5M09A 2A2AA 4BTFA 5JFXA 4RPVA 1PXOA 1NVSA 4X2NA 2UZDA 1WBTA 4QP8A 5T68A 4I5CA 3TDWA 4DFXE 4FTJA 4AN3A 3D7TB 4Y85A 4O7VA 1OBDA 2WOTA 5HBEA 2BKZA 4I0RA 1RJBA 3NIZA 3EQFA 4OBQA 1PXPA 3UZRA 2X8EA 3MPTA 2CNUA 4LL0A 2JDVA 4BVUA 4UWYA 3VRZA 1K2PA 3M2WA 4IXPA 2GHLA 5EQEA 2VD5A 3DXQA 2PE2A 4FT5A 4LGHA 2Z7LA 4KSQA 4XOZA 5EHOA 3UOKA 5CSPA 3T9IA 4O0WA 3ZTXA 1HOWA 3ZEPA 3EQGA 2BRNA 3IOPA 2YM3A 1JOWB 4PNIA 4XG7A 5ACKA 3TKUA 2R3JA 4HVGA 5G6VA 3IW8A 3G5DA 2PVJA 2X4FA 4QMNA 2ONLA 2Z8CA 3GOKA 3JVSA 1DAWA 5HEZA 4JG6A 2LAVA 4AGDA 3R9DA 4RIYB 2ZOQA 2C30A 3PIXA 5AUVA 5C01A 1XO2B 3AG9A 2HZNA 3DK3A 3LQ5A 4FVQA 2GHGA 3RKBA 4RWIA 4EJNA 2CPKE 3G6GA 4H1MA 3QHRA 1ZRZA 4GL9A 5J87A 4C36A 3M1SA 3MVJA 2O0UA 4MBLA 3H4JA 4FV0A 2YIWA 5K3YA 4AU8A 4C4FA 5A46A 2XKDA 5JQ5A 3QC4A 1XKKA 4EWQA 3KREA 2EWAA 3IKAA 3LFCA 4QTAA 2XA4A 3D94A 4U0IA 5GIPE 2R3KA 2DWBA 3W33A 1QCFA 4QMYA 5CU3A 1RQQA 1BKXA 2XKEA 4GUEA 3F66A 3P5KA 3R1SA 2BRGA 5CNNA 5CZIA 4WUNA 4APCA 4XBRA 2WTVA 3CPCA 2X2KA 3LFNA 4N57A 3O51A 1QPJA 5IMXA 1YWRA 4Z9LA 3F9NA 3EWHA 4UALA 4AFJA 2V5QA 3O2MA 3R83A 2XBJA 3DNDA 4MX9A 1SZMA 2ZMDA 4JG7A 4P7EA 3ZRLA 3OWKA 4D1XA 2J2IB 4JXFA 2XJ1A 1JKTA 2W1ZA 4FT7A 3LCKA 5E8ZA 3UMXA 2UW4A 3WF9A 3E62A 4UWBA 4X6QC 4QMUA 3Q9WA 2W99B 5BUJA 5AP1A 4YLJA 4MXCA 1OGUA 5AAFA 5BNJA 4YLLA 1OUKA 3FUPA 3HV5A 4I0TA 3DQWA 1U5QA 4A06A 2HZ4A 4ACMA 4RVLA 3R1NA 3AT3A 4U43A 4UWCA 3BKBA 3UC3A 2XP2A 3EOCA 1BL6A 5C8NA 4KUJA 5J7HA 4NFNA 5IQDA 3ZXZA 4J7BA 3FV8A 4GYIA 4QP9A 1Z5MA 4RVTA 5ANEA 5DT0A 4ZXTA 1XH7A 5CSWA 2JDSA 4MEDA 5I3OA 3CY3A 4JIAA 3QRTA 4G6NA 5A6OA 1QPDA 5CS6A 4FNWA 3RNIA 1YOMA 1RW8A 4FEUA 2FYSA 4XNEA 4FBXA 1YWNA 4EHVA 1OL6A 2X7GA 4FL3A 1GIIA 3D2KA 4TWNA 5J9ZA 3OVVA 1OIYA 3KMMA 1K3AA 3FMLA 2W1HA 3E8CA 3VS6A 5K5NA 1Q8YA 4YTHA 5KCVA 4JBVA 4L67A 4PTEA 4FSMA 2FSMX 3NVMB 5E8XA 4FKQA 5LOHA 2REIA 3R7VA 1U54B 4UY9A 4MK0A 4ZMEA 4GJ2A 5IQGA 3TIZA 3AC1A 3L1SA 4BCFA 4GCJA 1M14A 2VWYA 3N9XA 3EQBA 2WMBA 5CT0A 3VW6A 4DTAA 3FDNA 5FBNC 4QTCA 5A4CA 2IZRA 5IEYA 3PVWA 4PPBA 5TF9A 4YJPA 3UQGA 2CDZA 3ZUTA 4CXAA 3VULA 4FVPA 3FLZA 5AP4A 1CDKA 4EOOA 5M44A 3DNEA 4FTTA 1KOAA 1GJOA 4ITHA 1OM1A 4B7TA 3I0OA 4IM2A 1CKJA 4WUAA 5HE0A 4IADA 3FMKA 1YHSA 2X1NA 4KBKA 1H1PA 1SM2A 3DCVA 1JPAA 4KD1A 2PUNA 5M57A 2X0GA 2WZJA 3HA8A 3PPJA 5FEDA 1TQPA 5AP7A 3E93A 3FYJX 2OO8X 5ANIA 3ZSIA 4ITJA 3PA3A 4FL1A 5ETIA 4QO9A 1BL7A 3SRVA 4XH6A 5CU0A 5B0XA 3AD4A 2C3IB 3KK9A 4JI9A 4C33A 3G15A 3UPZA 4HYSA 5E8YA 4Z7HA 5C8MA 1WBSA 2J0JA 2BAQA 3E5AA 1BUHA 3QZHA 3UIBA 3IS5A 2Y6OA 2R3RA 5BVWA 5CEMA 4K1BA 5HBJA 1H00A 5IA0A 2YM6A 3UIUA 3NPCA 4DF3A 4KA3A 5JEBA 3S0OA 4XV1A 1U4DA 5TO8A 2YIXA 2XK6A 3W2SA 5HNGA 1YW2A 4NYEA 2R3QA 5KUPA 1ZOHA 4I22A 4XHKB 5IKWA 4BDCA 5DN3A 4D0WA 1VYWA 2EB2A 3OEFX 4EKKA 3ANQA 1FMKA 3FLYA 2V22A 4ZEGA 3OUKA 4KBCA 2J50A 3GB2A 3QD4A 4KIOA 4NZWB 4XCUA 4GKHA 3NVKI 4OTGA 1JKSA 2WTIA 4QTDA 3QXOA 5CSXA 1WFCA 4EYMA 2VTAA 4L3JA 5HIBA 3P0MA 2X81A 5EKOA 1S9IA 4FV3A 2GNJA 5DYJA 1SNUA 2C6KA 3O71A 3UBDA 4TZRA 2AYPA 3PA4A 3R73A 1OL1A 4I94A 4RFMA 1FQ1B 1F0QA 5T3QA 4BDAA 4MF0A 3ALNA 5CEQA 1OB3A 3MN3A 4D55A 4CG9A 3OXZA 4AUAA 2WNTA 4ANOA 5HBHA 4WNOA 3VS3A 3PWYA 4DEHA 5I9YA 5HU3A 2Z7QA 2YJSA 3UQCA 1NA7A 2VNWA 3RTPA 4QP4A 1E1XA 2RL5A 2CHLA 4DBNA 3FY0A 5A14A 5JRQA 4PDYA 4YJTA 1J7LA 4TT7A 3QWKA 2GS6A 4YNEA 2W17A 3EKNA 1U59A 3NLBA 3OXIA 4O22A 4RX7A 5H8GA 3ZDIA 5JGAA 2PULA 5IQFA 2YZAA 3TUDA 4C8BA 2QONA 4WBOA 3A8WA 3R9NA 4DFZE 3HV4A 2OGVA 4YURA 3DS6A 5H3QA 1OKYA 4G3CA 2FUMA 3C50A 1XHAA 4IFGA 5CSVA 4F09A 5A3XA 4MNFA 2W5BA 3R8MA 5HO8A 5IISA 4ALWA 3MY1A 1GIHA 2B1PA 4M0ZA 4YHFA 4IVBA 2PWLA 3GC9A 3PSBA 4D1ZA 3C13A 2H34A 4FUXA 4JNWA 4FTIA 5DT3A 4WT6A 4GS6A 3F2RA 3NWWA 4LRJA 3RCJA 4M12A 3ACKA 3ZRKA 1FVVA 2W7XA 3W1FA 1AGWA 5J9LA 3JS2A 3QCSA 4DG3E 3TM0A 4FR4A 1Y91A 2O3PA 3DV3A 3O23A 2RIOA 3EFLA 3KRRA 4FK6A 4O7NA 1XH5A 3WF7A 1JKKA 2ITXA 2V7OA 4X2FA 5FG8A 4X2KA 2Y4IB 5E90A 5AV0A 1IRKA 1B6CB 4GFOA 4ASZA 2IVTA 3FKLA 2HIWA 3VUIA 4ANBA 3Q9XA 2Y8OA 3ZH8A 1YOLA 5CASA 3RI1A 3F5GA 3MH3A 4FNXA 4G1WA 5HCZA 1ZY4A 2W9ZB 2O65A 1ND4A 2R7IA 1XH9A 3D5VA 4FTKA 2PE1A 4UMRA 2W4JA 4IAFA 2OJ9A 3DB8A 2WQOA 2XRWA 3MS9A 2XIYA 5DI1A 3CKXA 3E8NA 4Q5EA 2ITQA 4IQ6A 4CLIA 3QWJA 1TKIA 2ONLC 4IMYA 3HRBA 3LZBA 3BPRA 3II5A 3R2BA 1IAJA 3TDVA 3EFJA 4L6QA 4O7RA 3NMUF 2BUJA 4UN0C 2J0LA 1BMKA 2FSTX 2OF4A 3LE6A 4GFMA 4FA2A 2JITA 3CQWA 3O8PA 3NUXA 4NIFB 4XG3A 2PVLA 4U5JA 5EYMA 3IW4A 4DA5A 4AOTA 3RHXA 5AP0A 3NUUA 3ZUUA 3P78A 1Z9XA 4AA0A 2HZ0A 5AIKA 2ETKA 4U3YA 4A07A 5TE0A 2YM5A 2B54A 5HO7A 3A99A 3LFEA 4HGSA 3QYWA 2OW3A 3ZFMA 5FQDC 3FHIA 5AA9A 4E8AA 5KMIA 3NYVA 2RGPA 3O50A 4O91A 3R30A 3PLSA 4IX3A 4RWKA 4YZNA 1A48A 4BBMA 3NUSA 3R7EA 5IUGA 3GCUA 3OD6X 3MH0A 4M0YA 4B6LA 4CZUA 2BR1A 4WNPA 1DAYA 3MFSA 4FG9A 5F20A 5L8JA 3ZO3A 5JZJA 3L8SA 3F7WA 3BZ3A 3DLZA 5IF1A 4AGWA 1ATPE 4D4VA 5L2WA 3COKA 3ZEWA 3LMGA 3VBTA 3LFAA 3NUNA 4JR3A 4W4VA 5JFSA 4R3RA 5BVOA 4YSJA 2OIBA 3BQCA 3O8TA 3CBLA 3TG1A 4AT4A 5E8VA 5BYYA 1Q62A 2W05A 2X8IA 2OKRA 2YLEA 4X7QA 3A2CA 3C7QA 3H0YA 3DKFA 3FMMA 2OXYA 4WO5A 3AC5A 4U79A 1WVYA 2HY81 5EI8A 2VTIA 1M17A 2BZHB 2F49A 5KNJA 3ROYA 4E5BA 1SVEA 5DG5A 2A27A 1SYKA 5HNIX 2CGVA 4QOXA 4AN2A 4FX3A 4QTBA 4G3EA 4X3FB 4BCGA 3MA3A 3R22A 3MTLA 3QRUA 3NCGA 3DGKA 3ODZX 1JNKA 3FI2A 3V3VA 4MD8E 2B9IA 4NKSA 2IW9A 2XK9A 2IPXA 4KAOA 1ZYJA 3HYHA 4E73A 4BDDA 4DBXA 2YEXA 4F6SA 1EH4A 3PTGA 2F4JA 4HYIA 3RK7A 4CCUA 2HYYA 4A7CA 4F0IA 1Q24A 4O1OA 2XS0A 3OHTA 2UZNA 5CZHA 4FT9A 2BZKB 3QA0A 4AA4A 4GH2A 4ZLZA 2XKCA 3KRJA 3MVLA 3NX8A 1WAKA 4FZ7A 1I44A 4I5MA 3V5PA 3HL7A 4CFFA 3AD5A 3KXHA 3LXKA 3KY2A 4CT1A 2OXXA 1YXSA 4M15A 3SOCA 5GINE 5E1SA 3DY7A 4EORA 3POZA 5HGIA 3WZDA 3R63A 3HAVA 4BICA 3CY2A 2ITPA 4Q2AA 3DJ6A 4UZHA 4DHFA 4RWLA 4IIRA 3LXLA 3B2TA 3KKVA 4TYHA 3OP5A 4FL2A 4RIXA 2QOCA 3KXZA 4C3FA 4N0SA 3ORTA 2GSFA 4FTAA 4U8ZA 3DFCB 3F3TA 3U54A 5BUIA 4F7LA 1B38A 2IZTA 3FJQE 2WMRA 3PIYA 3QQKA 3VO3A 2QC6A 3FC1X 3QHWA 5HLPA 5BMSA 1H0WA 4UZDA 3IPHA 4JAIA 5JMSA 3R02A 2OLCA 2QOFA 4S34A 3MB7A 4BCJA 3K5UA 4BDGA 2QOLA 2RG5A 2J5FA 3FXXA 3T8OA 3V5LA 4B4LA 1NT2A 3WZJA 2FVDA 5J95A 2Q0BA 3U4WA 2HWPA 2WIPA 4RVMA 2C5NA 2OXDA 3R71A 3DOGA 4PMMA 3RPYA 3QUEA 2UV2A 2VO7A 4QP3A 4RQVA 4YLKA 5FRIA 1BX6A 3ZOSA 5J7BA 2O5KA 2GQRA 2QCSA 4PP7A 4ACDA 2WU7A 3BEAA 3PPKA 2JDOA 4TN6A 4GU6A 4JG8A 4XBUA 4O7SA 4EH4A 2ETRA 4EONA 2DUVA 3QD0A 3OBGA 3MI9A 3GU5A 5DMZA 3TXOA 4E20A 3U6JA 1Q3WA 3R1QA 4YBJA 5HD7A 3K3JA 3QRKA 3UMWA 4AOJA 3VUGA 3P23A 4BHNA 3PVBA 4FMQA 1UWJA 2XJ0A 3LXPA 3OMVA 1ERKA 3H0ZA 4W8EA 3BHVA 3EFWA 3M11A 4G5JA 5L6PA 5ETCA 4EOPA 5FP5A 3A7IA 5HVJA 1YI3A 5CXHA 4PUZA 3QZFA 5C26A 2C0TA 3DAKA 4P90A 3NW7A 4RJ8A 3DK7A 1WMKA 4MAOA 2JAVA 2F2CB 2IVUA 3PXZA 4DGLC 4F6UA 2WMWA 3VS7A 1OKWA 3QZGA 3R01A 4KNBA 4XG9A 4J71A 4QYHA 5HHWA 4BC6A 4FTOA 4XUFA 1E9HA 3SKCA 3D7TA 3SA0A 2DQ7X 2C3KA 4F70A 5KBRA 4FZDB 5HI2A 2QR8A 3FZPA 4OGRA 3N4UA 4IEBA 3VJOA 4CFXA 4FIFA 4EOJA 3NW6A 4KRCA 3ZO2A 5HG5A 3QYZA 2YABA 3CJGA 1M7QA 3RAIA 4APPA 4BCMA 1BI7A 2FGIA 3F5PA 5AR7A 4YO4A 4CGAA 1L3RE 3AC2A 4HCVA 3TNPC 2VWWA 3C0IA 1PXLA 4BZDA 4PDPA 3PVGA 3VHKA 2WEIA 3FC2A 3AT4A 2NNWB 3ZM9A 3BE2A 3QCXA 4E6DA 1H28A 4IANA 4C58A 1S9JA 2HK5A 3MV5A 5EW9A 1H26A 2YCSA 3UTOA 2PUIA 1TQMA 5CVGA 4MXAA 5HG7A 4HW7A 3FQHA 3QRJA 4PMSA 4BTMA 4DEBA 4BI0A 4MQ2A 4RIYA 3QLFA 1Q97A 5HLNA 4ZTQA 3QD2B 3WF6A 5AUUA 1PKDA 3V8SA 1YDSE 3F6XA 5GNKA 5LXMA 4HGEA 2PMLX 2ERKA 3SC1A 3V8TA 4BIBA 2XEZA 2WEVA 4K0YA 3PSCA 2ITUA 3NRMA 5ANGA 5I4NA 3HZTA 3G90X 1VR2A 5CENA 5HE3A 2H96A 3FLSA 3R2YA 4L42A 4RG0A 4K2RA 3EN6A 3S00A 2IVSA 3PJ3A 3T3VA 5CAQA 5AR2A 4BFMA 4TYHB 1OECA 3R1YA 1IEPA 5IQBA 5CU2A 5CALA 3IW7A 4YP8A 3FYKX 3G51A 4UXLA 2PMIA 4DH3A 3ZM4A 1YDRE 5I5ZA 4JX3A 4GT4A 4KBAA 4O1PA 3QKLA 4FSNA 4MQ1A 4A4XA 2P3GX 3Q5IA 3QUPA 3ZLSA 1KE5A 4FKGA 2LGCA 5AP5A 4CFMA 4R77A 2ZB1A 5FXRA 5CF8A 4C4IA 4L46A 4QNAA 3T9TA 5BVNA 2Y9QA 4YZCA 4JLCA 5CI7A 4DCAA 2VWVA 4O21A 3ZYAA 2HZIA 3GC8A 4IB1A 3KF4A 4XG8A 5AP3A 3UOHA 5FTQA 4AOIA 3Q9ZA 4IB5A 3RAHA 4DN5A 5M4IA 4EOQA 4JDIA 3D83A 4G31A 2WXVA 4ERKA 2ITYA 3GNIB 3B2WA 3M42A 3DZOA 4CTBA 4R78A 3G2FA 2WMXA 4WNKA 2UZVA 3HV7A 5EDRA 2X2LA 5LARA 3EQIA 4ALUA 4KS7A 4BCHA 2CLXA 1GIJA 5CAUA 2WB8A 1O6LA 5IQHA 5AMNA 2V7AA 2NRUA 3DBEA 1XJDA 4GW8A 2BAKA 1ZMWA 2J0MB 2B4SB 3FSKA 4ZSJA 3RWPA 3W32A 5GZ9A 2BRHA 4I3ZA 4EHEA 5M51A 1VEBA 3PY1A 5AR4A 4RWJA 1JLUE 4XRJA 3O17A 3L8XA 2Z02A 4D2PA 3VQHA 5BUEA 2BILB 4YJNA 5LWMA 3E3PA 2PY3A 5DPVA 4ANMA 4J99A 1GZKA 4CKJA 3H9OA 4YJSA 5L2TA 1U54A 3HA6A 3P7BA 5CNOA 4O0RA 2VO3A 1YXUA 5C27A 3VVHA 4C4HA 5DBXA 2KTYA 4U42A 2P2HA 2VUWA 4D4RA 4YHJA 4JAJA 1OIRA 1JQHA 3FZ1A 4CSVA 4D9UA 2X9FA 5HU9A 4E6CA 1ZYDA 3ZLYA 4QP7A 4G9CA 1YXTA 4HYUA 4R5SA 3KXXA 4DLIA 5G1XA 1ZOGA 4JT3A 2VTLA 3OS3A 4IB3A 3U9NA 5A4TA 5EDPA 1ZYCA 4MHAA 4MD7E 4XLVA 4PDSA 5EM5A 5HG8A 3VHEA 4DT8A 3ORPA 3PE2A 3IGGA 4UMQA 4UYAA 4RC4A 5HKMA 2Y4PA 4YSMA 2E9NA 4FKUA 1OPJA 3ZFYA 5D12A 3UE4A 3FXWA 5KO1A 3JVRA 3MDYA 3BELA 2ITZA 3F3UA 4FIHA 1WVWA 4NT4A 3E63A 4XP3A 3FY2A 4YC3A 5FD2A 1OVEA 3EL8A 2FH9A 2I6LA 3IDCA 4GFGA 3FXZA 3ZLWA 3FL5A 3CTJA 1UVRA 5F1ZA 2IZSA 4K33A 4EBVA 3NUAA 4FKSA 4K18A 3PDTA 2VX1A 3WZUA 4I6BA 1OBGA 2HW6A 4FC0A 3IQ7A 4PPAA 5T6KA 2OJIA 2C6DA 3KXGA 2BDFA 3P1AA 3WILA 4NSTA 5KMLA 4ENYA 5KMKA 1KUTA 3S1HA 4WSQA 4AZFA 3TZMA 4E7WA 3LFBA 5AFVA 3PPZA 4KWPA 3TTJA 3LLAA 2PZ5A 3PP1A 3GQLA 2JIUA 2R3HA 4F7NA 5LVNA 5DH3A 3MPMA 4DE4A 2AUHA 4IDTA 5JT2A 5BYLA 4K9YA 4V0GB 5M55A 4KIPA 2PSQA 1J91A 4FYNA 4QYEA 5IMEA 4BRXA 1M2RA 3D5UA 4L53A 4DEIA 5LMKA 2JIVA 3COHA 1MQ4A 3HMOA 4KKEA 2JBPA 3QCYA 4ERWA 4C37A 5K0XA 5KMJA 3Q60A 4FKIA 5L3AA 3ID6C 3SXRA 2JDTA 3D5XA 3MESA 4AAAA 4EYJA 4V04A 1W84A 3GENA 4FZ6A 4FE2A 2VO0A 4NW6A 2IN6A 5J1WA 2J0KA 3QX4A 4CZYB 4CFNA 3ZS5A 2RFDA 2VTHA 4DAWA 1Q8WA 2WIHA 2YJRA 3MJ2A 3ELJA 3MY5A 3IW5A 2YACA 3ET7A 5AM6A 3TJCA 5EW8A 4DH1A 1WBVA 4MYGA 4O7WA 2Q83A 2W5HA 4LG4A 4C62A 5LVOA 3SW7A 4CEGA 1A06A 2EXEA 4X0MA 4ANLA 3HLLA 3KVWA 4L43A 3MA6A 1P14A 5M08A 5M4FA 4AW2A 4JDHA 2YWPA 4IB0A 4KIKA 3FMNA 3VS1A 4TPTA 3P9JA 5BYZA 4OAVB 1SNXA 2YERA 3NYXA 1Q5KA 1FMOE 2WTDA 3QGWA 4O2PA 3BYOA 3ZMMA 2CKQA 3WE4A 1DM2A 4U80A 4O0TA 1J3HA 1PMUA 4HVSA 5TR6A 5A54A 3QTZA 4IH8A 3G6HA 5GJGA 2WKMA 3NNVA 4DINA 2OWBA 3E64A 4ARKA 3AC8A 3QAME 4O7LA 3HDNA 4IE9A 5IQEA 3AC3A 3P08A 4TKSA 2PVKA 1H1QA 5AV2A 4OTHA 4XV9A 3O96A 2BHEA 1HCLA 4Y73A 5J9YA 4U3ZA 5LVLA 3V51A 2XK7A 2GNFA 4EK6A 4E93A 2ZJWA 2C69A 5E8UA 4BCPA 2A0CX 5AV3A 3ZUVA 3KRWA 4CNHA 3IDPA 4RQKA 2XIXA 2W5AA 3U6HA 1GZNA 4MTAA 4HZRA 3NSZA 3NYOA 3BHHA 4OTRA 3K54A 4F0FA 4PTGA 1XBAA 4C2VA 4EK4A 2ZM4A 4B9DA 4HVDA 2CKPA 4I21A 4GT3A 3R7YA 3IO7A 5CEKA 3PZHA 5KHWA 2W1GA 3RGFA 2PU8A 4Q9SA 3L9MA 2XUUA 2UW7A 3F2AA 3Q4ZA 4MWHA 4XG4A 3QXPA 3NAYA 3FAAA 3KULB 3AOXA 4NM7A 2R3PA 2JKOA 3HP2A 3U51A 1J7IA 3UYSA 3EMGA 4IM3A 2NRYA 5HIEA 3R8PA 4TL0A 3CJFA 2VTRA 3NW5A 4C02A 1JSUA 5GJFA 2R64A 3ZBFA 4BGQA 3PXRA 4PY1A 2G2FA 3Q32A 5A9UA 5KZ0A 3ENHA 2BRBA 3OT3A 2BHHA 4H1JA 4WIHA 4X2JA 2XIZA 4LRMA 3RNYA 2UZWE 4YC6A 3MFUA 4BZNA 4BY9E 3BHUA 3L9LA 4M13A 4QMLA 3BV3A 3BQRA 2UW6A 4FGRA 3LMHA 3GU4A 4BDKA 2JFLA 1PYXA 4XRLA 3ZXTA 4EC9A 3OEZA 4IX5A 4EZ3A 4J53A 4AFEA 3HV6A 4NIFA 4C34A 3PLAE 3FLWA 4CMUA 3TUCA 4PL5A 2G15A 3V5WA 4EQCA 4F6WA 4JOAA 5GIOE 5FP6A 2R3NA 2ZMCA 4AT3A 3PJ2A 4UEUA 1W83A 3GU7A 4I24A 5EYCA 5IDPA 4WRGA 2R3LA 3SHEA 4U41A 5CEOA 1Y6BA 3D14A 4UBAA 5KE0A 1LR4A 4B99A 4ZTLA 3TV6A 4EH7A 1IASA 2RKUA 3UNZA 4FTLA 4EC8A 1H27A 3Q52A 4IJ9A 2X9EA 3GU8A 4O6LA 4W9WA 4RA4A 2PZRA 5L4QA 5JKGA 3CPBA 3R8VA 2ERZE 3RVGA 1H8FA 2WTJA 3QQGA 4C4GA 4RZVA 1R3CA 2CGUA 4N70A 2WAJA 1DS5A 5DT4A 3FMEA 1MQBA 2WQEA 4IDVA 3UC4A 2ZDTA 2OSCA 2JC6A 1Q8TA 4K6ZA 3UYTA 4EH6A 5LCKA 2OF2A 5IPJA 2GFSA 4PNKA 1JSVA 4TYEA 4YJUA 4YHTA 5AUWA 4FK3A 2BDWA 4FNZA 1BLXA 3HUCA 3OCSA 5DEWA 4BTKA 4HOKA 5D41A 2VU3A 1M7NA 3EZVA 3LLTA 4FTRA 2ESMA 4R3PA 4D2VA 3KXNA 3D7ZA 3LCSA 4USEA 4KIKB 4X3FA 2E2BA 3WIGA 1R0EA 3QTSA 4GK3A 4A9TA 5M4UA 2JAMA 3ACJA 4IAYA 4AACA 4E3CA 3ZU7A 4E4XA 5IA2A 4GUBA 5K4JA 3QC9A 3H9RA 3BEGA 2QOHA 3HX4A 4R7HA 4ACCA 2J5EA 2QNJA 3BYVA 3R7IA 3VS4A 3CKWA 1YWVA 2I7QA 5CF6A 5CANA 3BRBA 4ZZOA 2Q0NA 3AMAA 2ITWA 5L2IA 2VTOA 3RPOA 3BGZA 3NYNA 3QL8A 3V6SA 4EEVA 4CRLA 3BGQA 3R7OA 3KFAA 4JS8A 2CGXA 2YM8A 1LEWA 4PTCA 1PYEA 3CS9A 4LGGA 4BDIA 5DHJA 3FKOA 2BDJA 2QOBA 3HV3A 3KL8A 2PZIA 3HMMA 3OTVA 4FSWA 4I6FA 4JRNA 4QMPA 4BKZA 2YITA 2HELA 4AXAA 3WARA 5ICPA 2X39A 3DXNA 3F5UA 4S33A 5AUYA 3PYYA 2BFYA 3V5JA 5M06A 4XLIA 2XF0A 3BGPA 1URWA 2OH4A 4PL4A 5EOLA 1UU7A 1GAGA 4EL9A 3BLQA 3KC3A 4FSUA 3TKHA 3GOPA 4QD6A 3ODYX 4ZS4A 2XRUA 3LFFA 4FZFB 1SMHA 2VTJA 4NH1A 2H8HA 3VF9A 5IEXA 2Y6MA 4E6AA 2E9UA 3V6RA 4XYFA 4F1MA 1FVTA 3LFDA 4L44A 5AP6A 3TCPA 5HLWA 5LMAA 3TACA 2VWBA 4OTDA 4FTUA 2WD1A 4G16A 3RCDA 2UVXA 1GOLA 4IX4A 4QMWA 3MH1A 3E7OA 4MXOA 1K9AA 4OT5A 4TY1A 4XG2A 3VIDA 5LCJA 2CNQA 2WOUA 3BIZA 1U5RA 4GKIA 4G34A 4F08A 3TL8A 4AE9A 5IU2A 3VJNA 3F2NA 4JDJA 3W2RA 5CEPA 4R7IA 4FV9A 2HOGA 2C3LA 1YDTE 4LL5A 3C0GA 4KIQA 4YNOA 4I23A 2PVRA 1PHKA 3U87A 3DKOA 2GQGA 3DB6A 4V05A 5CYIA 3VW8A 1Y6AA 3UO4A 3LJ0A 3OCTA 4RFYA 3QFVA 3NCZA 3U8WA 4L3LA 4FOCA 1YQJA 5I0BA 2VWUA 1UNHA 3EQRA 3GU6A 3JYAA 2G1TA 4DEGA 1O6KA 4TWPA 4AX8A 2R0IA 2VAGA 4FKOA 3A7HA 3RZFA 4DTKA 4OTPA 4FT0A 4MCVA 4C3RA 5BQ0A 3HAMA 4M69B 4QMZA 1Y8YA 2OZOA 3NAXA 3Q3BA 4D5KA 1P4OA 4LUDA 3GXLA 3ORMA 4ZSGA 2CNVA 3CXWA 4OUCA 4OLIA 3FQSA 4G6OA 5IQCA 1OL2A 3I5NA 2OI4X 5HICA 1WBWA 2UVYA 2V0DA 2I0EA 3VS0A 3ZC5A 3B8RA 5ACBC 2R5TA 2A4LA 3G33A 1HCKA 4EOKA 3SXFA 5HTCA 2NP8A 4YUQA 4GVAA 2C5XA 5KBQA 3CTQA 4NJDA 4YJVA 3KB7A 4PRJA 2UW8A 5B2MA 2W1EA 3R8LA 4BYIA 2FSOX 3DTCA 4FTQA 2WPAA 3CQEA 4RJ5A 4L7FA 3CC6A 5L2SA 5IUIA 2W4KA 2VX3A 5DLSA 3QGYA 5LMKC 5AAGA 3F82A 2WMAA 2XK3A 2QQ7A 4RX8A 3R8UA 3FZSA 1PMVA 5A4QA 3UIXA 2W1DA 2F57A 3ZRMA 3VAPA 3BWJA 4HZSA 4K11A 4A4OA 2WMQA 3C5IA 1U46A 4TNDA 4ZY5A 4E4NA 4R6VA 2AC5A 2ZDUA 3C0HA 3MPAA 5TKDA 3REPA 3L9PA 1F3MC 5CVHA 4CQGA 3COMA 5CXZA 4UXQA 4L45A 3AMBA 4EOMA 5C8KA 4AZWA 1PXKA 3TUBA 2E9VA 3TN8A 4DFYA 4E26A 1VJYA 4FV4A 4ZTHA 4BDFA 4PMPA 3NNXA 5JZNA 2OIDA 3FI4A 3OG7A 3RK9A 5FLFA 3RPRA 4M8TA 3SVVA 1WBNA 4TW9A 3PY0A 5AJQA 4TTHB 3FHRA 4BKJA 4CT2A 5FM3A 3FMJA 3A4OX 2VTTA 2BIKB 3BV2A 3CQUA 2WTKB 4TYIA 5FWKK 5AV4A 1KE7A 4EJ7A 4FEXA 4EK5A 1OIUA 4ZJVA 4AS0A 4MWIA 3DBCA 1UNGA 3ORLA 4RJ4A 3BCEA 2J4ZA 1J1CA 4FKJA 4FKWA 4H3BA 4AGUA 3DFAA 3D5WA 3P7AA 4FI1A 4OT6A 4KSPA 5FXQA 3PFQA 4G3DA 5BMMA 3DDPA 3SOAA 3TI1A 5CSHA 2JEDA 3POOA 3C5UA 4FTCA 4IACA 3PRFA 4NKAA 5CVFA 2W1IA 3RHKA 4DT9A 1UA2A 1J1BA 1XBBA 2QO2A 2W0JA 2W96B 3WF5A 4YZBA 3ZLXA 1YXVA 1WZYA 5H2UA 5KKRB 2ITOA 5F94A 1IA8A 5HE1A 2PVHA 4F1TA 4FICA 4YC8A 2GQSA 3VQUA 4NFMA 4O7TA 3KGAA 2UW0A 5IEVA 2X2MA 4HJOA 4BDBA 2CJMA 5IQAA 1CKIA 4AP7A 2B9FA 2B0QA 2Y4IC 3KMWA 5HD4A 1QL6A 3F3ZA 2CN8A 3EKKA 2B55A 1ZMUA 2JKMA 3NNWA 4W8DA 3I7BA 3TNWA 2UW5A 2G2IA 5JFWA 3UQFA 4L3PA 4WSYA 2OG8A 2YHVA 3OOGA 4HNFA 3IOKA 3KU2A 4BBEA 3SG8A 3HRCA 3E87A 4CG8A 5CU6A 4ASDA 1ZMVA 4O0YA 4Y95A 2GPHA 4P4CA 4IWOA 4NK9A 1YVJA 5IA4A 2RG6A 3KF7A 3PG1A 3SQQA 3KEXA 4J97A 3OTUA 2J51A 5KMNA 3RJCA 5IH6A 1YI4A 3AGLA 4W4YA 3OWPA 4CV8A 2JIIA 4ZTNA 3Q6UA 5GHVA 5B2KA 3NGAA 5FBOA 5AUTA 5J5TA 3GP0A 5ANJA 4IAAA 4ANSA 5AP2A 3F7ZA 2C68A 4IZ5A 4DLJA 3NZ0A 4IM0A 3KXMA 3EQCA 4NW5A 4EUUA 2JLDA 2J9MA 4Y72A 4ZS0A 2R7BA 4A9RA 3LQ8A 4EQUA 4PWNA 2UZBA 4ID7A 1W8CA 2JKKA 2EB3A 4GJ3A 2YIQA 1REKA 4LQMA 5HVYA 3VWAA 4XG6A 3TJDA 1JWHA 3MIAA 4MNEA 2C5OA 5CQWA 5DWRA 4E1ZA 4F99A 4CKRA 5KMMA 3UOLA 5M53A 2ETMA 2A19B 2WMUA 3Q53A 3LKMA 1H4LA 1W82A 2GNGA 2C5VA 3OWJA 4DEEA 2ZM1A 2YZLA 3LVPA 4BWKA 2OK1A 3BU3A 3TWJA 2GNHA 5DNRA 1YHWA 4DC2A 2BFXA 2EUFB 4Q5HA 2DYLA 4MD9E 1GY3A 2NO3A 4JBPA 2WGJA 4OTIA 1H08A 5CAOA 5JK3A 2GDOA 4RC2A 3JXWA 4NEUA 1KE8A 1JBPE 2BIYA 3KCFA 3LCDA 1LUFA 3SDJA 3R28A 1BI8A 4CYJA 4GK4A 3C1XA 4L68A 4NM5A 2GTNA 2YIRA 4H3QA 4JVGA 5HCYA 2QO7A 2XM9A 4LRKA 4MH7A 5AA8A 3F61A 5LVMA 5M4CA 1PXJA 2XJ2A 4YPDA 4XEYA 3PE1A 3C4EA 4A9UA 4CZTA 4ORKA 2E9OA 4QQJA 2Z7RA 4X3FC 4DGMA 4F1OA 2CCHA 2WQMA 2F2UA 5E7RA 3A7FA 3SW4A 4EWHA 5JGDA 1DI9A 1ZY5A 5C4LA 3BX5A 5J79A 2QU5A 3DU8A 4DGGA 4IWDA 2BCJA 5I9XA 4YPSA 2R4BA 3LW0A 4LOPA 4F63A 3ORIA 1WVXA 3QF9A 3ZO4A 2IJMA 2V62A 5HTBA 3R7UA 5LJJA 4U9AA 3W2QA 2W4OA 1FVRA 3C9WA 1ZOEA 3IDBA 3P4KA 3C4WA 2O64A 4OTQA 3TZ7A 3ZCLA 4CCBA 2XK4A 2OICA 3NIEA 2QLQA 3BI6A 3DT1A 4FZAB 5TT7A 4CKIA 3OW3A 1XR1A 4LOOA 3JY9A 2C6MA 3Q4CA 3ZC6A 3PSDA 2HXQA 3A61A 4EH5A 3F3VA 5AM7A 4FT3A 3FLQA 3KMUA 2QKRA 4M68A 3R9OA 5KKRC 3RAWA 3QRIA 1JVPP 4AT5A 2OU7A 4IFCA 1LPUA 4Z16A 4ITIA 5DR9A 4C35A 2C3JA 4WKQA 3GUBA 4U40A 4U97A 2XMYA 4V0GA 2BALA 4RT7A 5EG3A 3QQLA 2WHBA 2QHMA 1XH8A 2CSNA 4ZSLA 3WBLA 3I5ZA 2YFXA 2BMCA 4QMQA 4GRBA 5KZIA 4EHZA 3D4QA 1WCCA 1WBOA 4AZSA 3R9RA 2XKFA 3PRIA 1KV2A 1GZOA 3LIJA 4F0GA 3UOJA 5E91A 4USFA 2OH0E 4ASXA 4Z7GA 3PG3A 3UNJA 3PY3A 3R8ZA 4YO6A 5EM7A 2R3OA 3N51A 2XYUA 3EB0A 4E5WA 4D0XA 2XBAA 4QQCA 3O7LB 2ZVAA 3VBYA 2IWIA 3C4XA 4HGTA 4O0VA 5JGBA 3VUMA 3QZIA 4L9IA 4C7TA 5CY3A 2PZPA 1Q61A 4ALVA 2CGWA 3VS5A 3O7LD 4R3CA 3U9CA 3K2LA 4FG7A 4TXCA 4DTBA 1X8BA 4CFVA 4BDEA 4JIKA 4U44A 4DFLA 1LEZA 4AN9A 3QD3A 4W4WA 5DFPA 3GCVA 3W16A 4TYGA 4TYJA 4FUYA 1XH4A 2Z2WA 4RJ6A 4C3PA 3DAJA 2VO6A 4FSTA 1G8AA 3Q2JA 5CTPA 4BIEA 2SRCA 4GG7A 4RC3A 3ANRA 4QYFA 1IG1A 3OOMA 3FKNA 3UG2A 1A9UA 2YDJA 2QO9A 4UB7A 4V01A 3EN7A 1JSTA 2FSLX 2RFEA 3ZSHA 4EH3A 5CF4A 5DR2A 1WBPA 3QQFA 1UKIA 4ZJIA 2ZAZA 4IW0A 4XV2A 3U6IA 3AMYA 2EVAA 3OXTA 4MF1A 4KABA 5EM6A 1G5SA 3SG9A 4MNEB 2BPMA 2PMNX 3GFWA 4FEWA 4B8LA 4TWCA 2YM7A 4PQNA 4D2RA 5K5XA 1T46A 4BB4A 4G3GA 5IA1A 1PRYA 4FV7A 5CT7A 3MVMA 4BIDA 1PY5A 4CRSA 4D1SA 1R0PA 4F9AA 1TVOA 4L00A 3V8WA 4D2WA 4FTMA 3TNHA 2YISA 1ZXEA 2HWOA 2C0IA 2XK8A 3QU0A 4BHZA 4BGHA 1H01A 3IG7A 4MXYA 3ITZA 5HO6A 1PXNA 2C6TA 3Q5ZA 4N6YA 4K77A 4U7ZA 2IW8A 1OL5A 5HNBA 4BN1A 4C59A 1O6YA 4E6QA 3EH9A 1P5EA 3CD8A 4CFUA 4NU1A 2ACXA 5GZ8A 4QQ5A 1PXIA 3HEGA 4FIJA 4I5PA 4B0GA 5HOAA 2B52A 4GV1A 1W98A 4O86A 4MBJA 3C51A 4IC8A 4WA9A 1H0VA 2CCIA 3V5TA 4N4SA 3BBWA 3KULA 3EYHA 5DR6A 2O2UA 5CU4A 4F9WA 4EUTA 1PKGA 4DCEA 5A6NA 5EK7A 4QP6A 4A4LA 5HVKA 2CKEA 4FV6A 4P5QA 5K9IA 1OKVA 3GCSA 3W8LA 2E9PA 4I93A 3RM7A 4F4PA 4M97A 3BU6A 3FSFA 4YMJA 3SAYA 4H36A 3NDMA 4RJ3A 4BCIA 4LMNA 2B9JA 3UP7A 4HCUA 1H24A 5D11A 1OMWA 4MXZA 1V1KA 3I4BA 3R7GA 5EYKA 2W9FB 4S31A 2IO6A 3LXNA 4Q9ZA 2HXLA 3ALOA 3E7VA 5EYDA 3S2PA 1M2PA 3P7CA 4BTJA 4MBIA 5HX6A 4JRVA 3VUKA 5TOZA 4C4JA 1YKRA 3MYGA 3NR9A 2QOIA 4TWOA 3TIYA 3ULIA 4WG4A 5HZNA 2B9HA 4BBFA 2RFSA 4G2FA 5C03A 3UIMA 3SV0A 2VZ6A 3MW1A 5E1EA 3ZONA 5HCXA 4YJRA 1SVGA 4ZP5A 2AC3A 4FOBA 3AXWA 4H58A 3EJ1A 3LM0A 3LOKA 4U6RA 2WELA 4QRCA 2B7AA 3AQVA 3OY1A 3R00A 4XP2A 4RMZA 3WYXA 4GU9A 4FYOA 4FIGA 2YCRA 3ORNA 3LFQA 1O9UA 2OJFE 4QP1A 4XP0A 3MVHA 1UU9A 1L8TA 3R04A 3UDBA 3E3BX 4F7SA 1KSWA 5HTIA 5IA3A 5C4KA 3HKOA 4M66A 3LJ2A 2WO6A 3W2CA 2OIQA 3GBZA 2C47A 3VUHA 2GTMA 3ZZEA 5E8TA 1H1SA 5E8WA 5HE2A 3AT2A 4NM3A 1FGKA 4R5YA 3F88A 5BX0A 1BYGA 3KN6A 1CMKE 1YOJA 2GNIA 4IVCA 2IZUA 1P4FA 1V0BA 4R8QA 4H39A 3QLGA 2KULA 3GC7A 4QQTA 3I81A 2I0VA 4WG5A 3LCOA 4N6ZA 2ITNA 3PJ1A 3MTFA 5C9CA 4WOVA 4USDA 4GEOA 1B39A 1H07A 4A9SA 2EU9A 3Q4TA 4D28A 4FNYA 3OCBA 4IBMA 2PMOX 4IJPA 4LGDA 2ZM3A 2FO0A 3GFEA 5CWZA 2ZYBA 1W0XC 3EFKA 5ETAA 4E5AX 5M07A 3OY3A 4XMOA 2C1BA 5B7VA 5JH6A 3I6UA 1PW2A 2VV9A 2YLFA 5AADA 1NY3A 3NNUA 2Y0AA 3EHAA 3GCQA 4FSRA 3RAKA 3TNQB 4WD5A 2C6EA 4OAUC 1XWSA 2R3MA 5D7VA 1PJKA 3HDMA 4IWQA 2C6LA 3MSSA 4I92A 1P2AA 3LM5A 3UO6A 2QU6A 3BBTB 3EN9A 3MFTA 4XV3A 3OBJA 5CX9A 3SLSA 4RIWB 4RX5A 2VGOA 3TZ9A 3VS2A 4YBKA 4DG2E 3DQXA 1ZWSA 2PVYA 3S95A 1H25A 4ANQA 5HESA 4OR5A 1RE8A 2GFCA 4J98A 4U45A 2XNNA 5F9EA 3R21A 3E92A 2C6OA 1GNGA 1ZAOA 3G9NA 4YTFA 3CGOA 3MY0A 2XM8A 3UPXA 4AZVA 4ZLOA 3L8PA 5DGZA 3EIDA 4RJ7A 3FI8A 3EQHA 4CVAA 3UGCA 2HW7A 4LM5A 4DFNA 2XNBA 3R9HA 4BWXA 3FWQA 3O0GA 3D15A 2WMTA 3EZRA 4IC7A 3BHTA 4F7JA 3LQ3A 4D4YA 3QQHA 5LMBA 2C4GA 3DK6A 3QQJA 5A4EA 5AWMA 3BWFA 5EM8A 3OCGA 2PUUA 3OZ6A 2QHNA 3AC4A 3IGOA 4HCTA 4NTSA 4RVKA 2HENA 4ZZMA 4H3PA 4YJQA 2XCKA 3A62A 3MWUA 4DFBA 3CEKA 5LVPA 2IG7A 4MXXA 1YHVA 2YCFA 3TKIA 1OIQA 3PJCA 4D2TA 3F3WA 4L7SA 2WQBA 3DTWA 3I7CA 4QMVA 3NUPA 3KVXA 4FKLA 2HCKA 4J52A 4CD0A 3NS9A 4L01A 5B2LA 4DFUA 1UWHA 4FEQA 4M67A 3LAUA 3ZO1A 4NCTA 3UVRA 4M69A 5EH0A 3DJ5A 4BGGA 4MKCA 2YAAA 3DJ7A 5CQUA 1OKZA 2YIYA 4UV0A 3OFMA 5LQFA 4FSQA 4HYHA 5L6OA 1QPEA 3K5VA 4PMTA 4NUSA 4LOQA 3I1AA 3K3IA 4FIEA 5BVDA 4IX6A 1W7HA 2OFUA 3PJ8A 4FV5A 3DDQA 3MJ1A 2C6IA 3UODA 2F9GA 4CLJA 4HNIA 5FTOA 3RALA 1XQZA 2OJGA 4ENXA 1Y57A 4JR7A 3PXYA 3CD3A 4F64A 5AR8A 3VNTA 4BZOA 1G8SA 5KHXA 2BKKA 2F7XE 2PL0A 4OTWA 1PF8A 2YA9A 1QMZA 3G0EA 1F5QA 3A4PA 3FZRA 2G9XA 5EW3A 2PHKA 4EH2A 5FTGA 2R0UA 3Q4UA 4C0TA 2BROA 1R78A 1MRUA 3JPVA 4JDKA 5H8BA 4D4SA 4R1VA 4ZOGA 2ZB0A 2G01A 4M14A 4X6RA 1XH6A 4WBBB 4M7IA 5DA3A 5DVRA 5JFVA 4GT5A 5AUXA 3GEQA 2UW9A 4W4XA 4F9CA 3ZFXA 2QI8A 2XNPA 3FPMA 4AG8A 2W1CA 3RMFA 2F7EE 5H9BA 2V55A 3HRFA 4UX9A 3QALE 3N4VA 4BYJA 1M2QA 3CE3A 3G9LX 3PXQA 4O96A 4HPUE 4YU2A 1KWPA 3KRXA 4IZYA 5E8SA 3CP9A 4Y8DA 3RP9A 3OF0A 1CTPE 4FF8A 1OI9A 3PA5A 2OZAA 5IH5A 3RPVA 2W06A 2YN8A 3PIZA 2VX0A 4QYGA 3GVUA 4XOYA 3VBWA 4D58A 2JKQA 2IW6A 2PE0A 3PVUA 1KOBA 1V0OA 4FV1A 3S4QA 4EZ7A 3OWLA 3EYGA 4ZTMA 4FKTA 5DOSA 4ACHA 3A60A 1Q4LA 3SGCA 1KV1A 2XZSA 2QOOA 5FDPA 3N4TA 1G3NA 4JQ8A 4O81A 3BU5A 4BCQA 1KE6A 2ITVA 4PX6A 4XS2A 5AIRA 2GS7A 2CN5A 4EI4A 1IR3A 2HY0A 4EOSA 4EZ5A 5LWNA 4FSYA 4UMUA 4QPSA 4EHGA 3QTUA 4AW1A 4XJ0A 3O8UA 4NL0A 5DRDA 2ITTA 4QMOA 2XNMA 4FSZA 3H3CA 5L8LA 3VF8A 2UUEA 3BLRA 4B8MA 4IAIA 4FV2A 4O83A 2X7OA 2H9VA 3E88A 4LI5A 4LUEA 2GNLA 4FGBA 4PL3A 5IZFA 5L2QA 4NJ3A 1FBNA 1Q99A 3IK3A 3QTXA 4BL1A 2EXCX 5E92A 3UZPA 5AR5A 2R3IA 3DBQA 3EN4A 2JGZA 4DH8A 1YXXA 4J1RA 3WYYA 5ITAA 3ETAA 2PTKA 5CLPA 4QTEA 2FA2A 4WRSA 5CF5A 4BCKA 3DKCA 3HECA 5GJDA 1VYZA 4AW0A 3ORZA 3UO5A 4GVJA 4AF3A 4X3JA 3FBVA 2J7TA 2WTWA 3HGKA 3GCPA 3I60A 2ZV7A 3L8VA 3EQDA 5DIAA 1OITA 5IQIA 4ZTSA 3UG1A 2BRMA 2VRXA 4F65A 5FGKA 1ZYLA 1PMEA 2WMVA 3COIA 2XEYA 3TTIA 4YTCA 2P0CA 1UKHA 2P4IA 5HIDA 4CTCA 5I9WA 3FL4A 3ORXA 4AW5A 2VWXA 5AV1A 5EKNA 3TZ8A 3U4UA 1QPCA 3QTWA 3TEIA 4NWMA 2C1AA 2XH5A 3IW6A 2UZEA 3CIKA 2XNGA 3I79A 3ORKA 3TV7A 4AQCA 4BCOA 5K4IA 2X8DA 3MGYA 4S32A 4EBWA 4EK3A 5FEEA 2R2PA 2PZYA 4GMYA 5EDQA 4RLLA 3UP2A 2QOKA 3DA6A 1H1WA 4RBLA 1FINA 3VBXA 1PMNA 1CSNA 2WTCA 4MVFA 4Z55A 3SRVB 4RGJA 5HORA 4PPCA 4YZDA 3HVCA 3VN9A 4ZSEA 2GS2A 3I0QA 3EL7A 4NM0A 5AAEA 2YDKA 2VTPA 5HG9A 2VWZA 3QQUA 3D2IA 3TV4A 1UU8A 4EOLA 3RM6A 5AX9A 5AUZA 2VGPA 2PVNA 4DG0E 3LMIA 2WQNA 2VTSA 3E8EA 3CGFA 4P2KA 5CAPA 1I09A 3DZQA 2PK9A 3R6XA 3W10A 1XBCA 2JBOA 3I6WA 2PUPA 5C1QB 3VBQA 4I20A 3PP0A 5FM2A 3Q6WA 4IAKA 4EOIA 1UV5A 4P5ZA 3TT0A 3SXSA 3RZBA 3FZTA 5I9VA 4O38A 2J6MA 2WMSA 4QPAA 4QMTA 4QPMA 3BYSA 4QP2A 4QMXA 5L6WL 4AWIA 4JBOA 5E4HA 2VTMA 4O84A 4O6EA 4X2GA 4J8NA 5D10A 4UYNA 4RSSA 5FDXA 5ANDA 3HUBA 1Z57A 4EH9A 4QMSA 4G6LA 3H10A 4LFIA 5J8IA 2XCHA 5K0KA 3FPQA 4HPTE 3DAEA 2Z60A 5EQYA 4X21A 2VTQA 3SX9A 4IVDA 4C57A 4C4EA 5JN2A 2OZAB 3UVQA 4IHPA 1V0PA 4AGCA 3ZZWA 5ETFA 5EQPA 4ZAUA 4R1YA 5M56A 1Q8ZA 4JQ7A 4CMTA 4CYIA 4I41A 2CMWA 2I0YA 2BTSA 4O2ZA 2YAKA 3F69A 4FKVA 4S2ZA 3ATTA 1LP4A 4TRLA 5H8EA 3GGFA 4J8MA 2VN9A 4U81A 2PYWA 2A1AB 1Q8UA 4YZ9A 3HNGA 3IECA 5JRSA 3W8QA 3SD0A 4F9BA 1STCE 2G2HA 4WNMA 5IG1A 2JFMA 3QKKA 3A7GA 4GIIA 4ZJJA 3A8XA 4PV0A 4IZ7A 3G0FA 4Y5QA 5EI2A 2UZTA 3KQ7A 3DBFA 2BTRA 4RIOA 4BR3A 3QCQA 1ZYSA 2QVSE 4BF2A 1TQIA 1KE9A 2I0HA 2PVMA 3RK5A 2J0IA 3EN5A 4J96A 3WIKA 4I1ZA 5HX8A 1FGIA 1URCA 2R3FA 2PVFA 4ZY6A 4BWPA 3NEWA 3BHYA 2W1FA 3NUYA 4G5PA 3C4ZA 3ZSGA 4NTTA 4DEAA 4FV8A 2RFNA 3QUDA 3JR1A 2F7ZE 3LJ1A 2Z7SA 4QMMA 3ZDUA 1OPKA 3PXKA 4E4MA 3GQIA 4BI1A 3HMPA 2EXMA 2RF9A 4EK8A 4O7YA 4OTFA 1SVHA 4GK2A 4FODA 1OPLA 2C0OA 2CKOA 2YM4A 3AGMA 4I4EA 4L52A 4OBPA 5D1JA 5BVEA 3CLYA 2XIRA 1DI8A 2QOQA 4QT1A 4M3QA 4JBQA 3W55A 3FMHA 3IONA 3MH2A 2BVAA 3CCNA 4IZAA 2BZIB 5J5SA 3H30A 4QNYA 1Q3DA 4ONAA 3VBVA 4Y46A 3CSVA 2P2IA 2XIKA 2WU6A 2YWVA 3GT8A 3KCKA 4ANNA 4BDHA 4ZLYA 1JAMA 4E4LA 2VTNA 3ZBXA 2QG7A 2XNOA 4O0XA 4YTIA 3F5XA 4M84A 4NCTC 2QD9A 4O0UA 3QKMA 2XYNA 3LPBA 4RA5A 4A9YA 5BPYA 1E1VA 4IWPA 5D9HA 2P33A 4GYGA 2WFYA 3Q96A 1MRYA 4EKLA 4YJOA 2H6DA 4FKPA 5JSMA 4DGOA 2UZUE 1MRVA 4JQEA 1ZZLA 4FVRA 4KKHA 2VNYA 5EFQA 1VZOA 3QTQA 4CMOA 2QODA 4Y83A 2P55A 3DPKA 3WZEA 1AQ1A 3PWDA 4RX9A 3UZTA 3PUPA 4GG5A 4EQMA 4FKRA 3PZEA 4C38A 5DEYA 2UVZA 3VRYA 2RSVA 3HMNA 1YI6A 4K8AA 3ATSA 3B8QA 1UU3A 3ROCA 4PF4A 3GI3A 4RZWA 2B53A 3FQEA 5I9ZA 2ZV9A 4UMPA 3P86A 3WF8A 2IVVA 3JUHA 2Y7JA 4G17A 5EI6A 4O82A 4LV8A 2R3GA 5JQ8A 3KA0A 4JX7A 4FEVA 1UNLA 3OW4A 1OL7A 4CFWA 4DH5A 4J95A 2QG5A 3RPSA 1M52A 3D0EA 5J1VA 3WZKA 3C4FA 3KN5A 4ASEA 5AEPA 4UMTA 4I4FA 3WI6A 4AA5A 4YR8A 3KK8A 4O0SA 2FB8A 4JJRA 1MUOA 3OC1A 5ANKA 5IA5A 4I0SA 3OROA 2YDIA 3FEGA 3MIYA 3WOWA 4Z3VA 5IUHA 1ZARA 3H9FA 5F95A 5CAVA 4R7BA 3D9VA 4XX9A 3R0TA 1REJA 4KKGA 4BKYA 4FIIA 3FI3A 3V01A 2O63A 2I40A 2QLUA 2WTKC 3MBLA 5EOBA 4D5HA 2GCDA 2C5YA 3LCTA 5EHYA 4BCNA 3ZHPC 1RDQE 1Y8GA 4DEDA 4F9YA 3HP5A 4KINA 2I1MA 5I9UA 5HQ0A 2CLQA 5CEIA 4H05A 2X4ZA 3UJGA 5FEQA 5E9EA 3BYUA 4OW8A 2UZOA 4GIHA 4D9TA 1R39A 3W2OA 1FPUA 3UNKA 3FMDA 3KRLA 3BLHA 3LFSA 3THBA 3CR0A 2JDRA 1FOTA 1NVQA 4DYMA 2XVDA 1NXKA 2J90A 3HMIA 3VC4A 3W18A 1OZ1A 4ZSAA 2GU8A 5AX3A 4ZZNA 4LMUA 4ACGA 3GC0A 2OBJA 4OBOA 3S3IA 5BVFA 3W2PA 4HVIA 3EQPA 3MB6A 1JKLA 2X6DA 4DGNA 5FXSA 2ZV8A 1IA9A 5IDNA 3OUNB 3Q04A 5FUTA 3DBDA 3L9NA 2ZV2A 2GHMA 4GSBA 4CV9A 4I5HA 2YCQA 4KB8A 3CTHA 4PDOA 3QA8A 4JL9A 3AD6A 5L8KA 4FTNA 4DITA 2VWIA 4ZMFA 3P79A 4O7ZA 4BDJA 5GZAA 3QTRA 2UW3A 1IAHA 1ZZ2A 3DLSA 3QX2A 5IH4A 3V04A 3LHJA 4RIXB 4CQEA 4RRVA 4ZY4A 4ZK5A 4I6QA 4IAZA 3RBWA 4WG3A 4II5A 1MP8A 4L8MA 1Q41A 5CI6A 2OFVA 3OT8A 4LYNA 3ERKA 4D2SA 3E8DA 4TNBA 3FLNC 1APME 1ZLTA 4KS8A 4FG8A 1GZ8A 4W9XA 4BI2A 1T45A 5KX8A 4HVHA 3UVPA 2OJJA 2DS1A 2XB7A 3QBNA 2QKWB 3A7JA 4YGAA 4ZIMA 3V5QA 2JD5A 3QTIA 1CKPA 3BYMA 1YRPA 4PP9A 4WHZA 5AR3A 4IVAA 5I3RA 4I6HA 5DRBA 1NVRA 4YZMA 4AE6A 4RFZA 3FZOA 2BZJA 1OUYA 2HAKA 1H1RA 5DE2A 1CM8A 4AZTA 5KMOA 3Q2MA 4G3FA 5BVKA 2X7FA 4HGLA 3WE8A 3BE9A 3U55A 4KRDA 2O8YA 4O27B 4RIWA 5ANOA 4C2WA 3TNIA 3JY0A 1PXMA 5F4NA 3C4CA 4S30A 3RINA 2PPQA 2X6EA 2UZLA 2QURA 4ZTRA 3DKGA 3PXFA 4LV5A 2NPQA 2GMXA 3MFRA 3ULZA 3RWQA 3DXPA 3T3UA 4C61A 4AZEA 2R9SA 3VUTA 2BAJA 1NW1A 1J7UA 4EH8A 1R1WA 3ENMA 4Y5HA 3VUDA 5D7AA 5A4LA 5EHLA 3FE3A 4RLKA 2XNEA 3Q9YA 4QYYA 1AD5A 4DH7A
chains in the Genus database with same CATH superfamily
4G9RA 2QR7A 5M09A 2A2AA 4DHIB 4BTFA 5JFXA 4RPVA 1PXOA 1NVSA 4X2NA 2UZDA 1WBTA 4QP8A 5T68A 4I5CA 3TDWA 4DFXE 4FTJA 4AN3A 3D7TB 4Y85A 4O7VA 1OBDA 2WOTA 5HBEA 2BKZA 4I0RA 1RJBA 3NIZA 3EQFA 4OBQA 1PXPA 3UZRA 2X8EA 3MPTA 2CNUA 4LL0A 2JDVA 4BVUA 4UWYA 3VRZA 1K2PA 3M2WA 4IXPA 2GHLA 5EQEA 2VD5A 3DXQA 2PE2A 4FT5A 4LGHA 2Z7LA 4KSQA 4XOZA 5EHOA 3UOKA 5CSPA 3T9IA 4O0WA 3ZTXA 1HOWA 3ZEPA 3EQGA 2BRNA 3IOPA 2YM3A 1JOWB 4PNIA 4XG7A 5ACKA 3TKUA 2R3JA 4HVGA 5G6VA 3IW8A 3G5DA 2PVJA 2X4FA 4QMNA 2ONLA 2Z8CA 3GOKA 3JVSA 1DAWA 5HEZA 4JG6A 2LAVA 4AGDA 2AQXA 4JMQA 3R9DA 4RIYB 2ZOQA 2C30A 3PIXA 5AUVA 5C01A 1XO2B 3AG9A 2HZNA 3DK3A 3LQ5A 4FVQA 2GHGA 3RKBA 4RWIA 4EJNA 2CPKE 3G6GA 4H1MA 3QHRA 1ZRZA 4GL9A 5J87A 4C36A 3M1SA 3MVJA 2O0UA 4MBLA 3H4JA 4FV0A 2YIWA 5K3YA 4AU8A 4C4FA 5A46A 2XKDA 5JQ5A 3QC4A 1XKKA 4EWQA 3KREA 2EWAA 3IKAA 3LFCA 4QTAA 2XA4A 3D94A 4U0IA 5GIPE 2R3KA 2DWBA 3W33A 1QCFA 4QMYA 5CU3A 1RQQA 1BKXA 2XKEA 4GUEA 3F66A 3P5KA 3R1SA 2BRGA 5CNNA 5CZIA 4WUNA 4APCA 4XBRA 2WTVA 3CPCA 2X2KA 3LFNA 4N57A 2X0OA 3O51A 1QPJA 5IMXA 1YWRA 1XMLA 4Z9LA 3F9NA 3EWHA 4UALA 4AFJA 2V5QA 3O2MA 3R83A 2XBJA 3DNDA 4MX9A 1SZMA 2ZMDA 4JG7A 4P7EA 3ZRLA 3OWKA 4D1XA 2J2IB 4JXFA 2XJ1A 1JKTA 2W1ZA 4FT7A 3LCKA 5E8ZA 3UMXA 2UW4A 3WF9A 3E62A 4UWBA 4X6QC 4QMUA 3Q9WA 2W99B 5BUJA 5AP1A 4YLJA 4MXCA 1OGUA 5AAFA 5BNJA 4YLLA 1OUKA 3FUPA 3HV5A 4I0TA 3DQWA 1U5QA 4A06A 2HZ4A 4ACMA 4RVLA 3R1NA 3AT3A 4U43A 4UWCA 3BKBA 3UC3A 2XP2A 3EOCA 1BL6A 5C8NA 4KUJA 5J7HA 4NFNA 5IQDA 3ZXZA 4J7BA 3FV8A 4GYIA 4QP9A 1Z5MA 4RVTA 5ANEA 5DT0A 4ZXTA 1XH7A 5CSWA 2JDSA 4MEDA 5I3OA 3CY3A 4JIAA 3QRTA 4G6NA 5A6OA 1QPDA 5CS6A 4FNWA 3RNIA 1YOMA 1RW8A 4FEUA 2FYSA 4XNEA 4FBXA 1YWNA 4EHVA 1OL6A 2X7GA 4FL3A 1GIIA 3D2KA 4TWNA 5J9ZA 3OVVA 1OIYA 3KMMA 1K3AA 3FMLA 2W1HA 3E8CA 3VS6A 5K5NA 1Q8YA 4YTHA 5KCVA 4JBVA 4L67A 4PTEA 4FSMA 2FSMX 3NVMB 5E8XA 4FKQA 5LOHA 2REIA 3R7VA 3BL7A 1U54B 4UY9A 4MK0A 4ZMEA 4GJ2A 5IQGA 3TIZA 4F78A 3AC1A 3L1SA 4BCFA 4GCJA 1M14A 2VWYA 3N9XA 3EQBA 2WMBA 5CT0A 3VW6A 4DTAA 3FDNA 5FBNC 4QTCA 5A4CA 2IZRA 5IEYA 3PVWA 4PPBA 5TF9A 4YJPA 3UQGA 2CDZA 3ZUTA 4CXAA 3VULA 4FVPA 3FLZA 5AP4A 1CDKA 4EOOA 5M44A 3DNEA 4FTTA 1KOAA 1GJOA 4ITHA 1OM1A 4B7TA 3I0OA 4IM2A 1CKJA 4WUAA 5HE0A 4IADA 3FMKA 1YHSA 2X1NA 4KBKA 1H1PA 1SM2A 3DCVA 1JPAA 4KD1A 2PUNA 5M57A 2X0GA 2WZJA 3HA8A 3PPJA 5FEDA 1TQPA 5AP7A 3E93A 3FYJX 2OO8X 5ANIA 3ZSIA 4ITJA 3PA3A 4FL1A 5ETIA 4QO9A 1BL7A 3SRVA 4XH6A 5CU0A 5B0XA 3AD4A 2C3IB 3KK9A 4JI9A 4C33A 3G15A 3UPZA 4HYSA 5E8YA 4Z7HA 5C8MA 1WBSA 2J0JA 2BAQA 3E5AA 1BUHA 3QZHA 3UIBA 3IS5A 2Y6OA 2R3RA 5BVWA 5CEMA 4K1BA 5HBJA 1H00A 5IA0A 2YM6A 3UIUA 3NPCA 4DF3A 4KA3A 5JEBA 3S0OA 4XV1A 1U4DA 5TO8A 2YIXA 2XK6A 3W2SA 5HNGA 1YW2A 4NYEA 2R3QA 5KUPA 1ZOHA 4I22A 4XHKB 5IKWA 4BDCA 5DN3A 4D0WA 1VYWA 4I6LA 2EB2A 3OEFX 4EKKA 3ANQA 1FMKA 3FLYA 2V22A 4ZEGA 3OUKA 4KBCA 2J50A 3GB2A 3QD4A 4KIOA 4NZWB 4XCUA 4GKHA 3NVKI 4OTGA 1JKSA 2WTIA 4QTDA 3QXOA 5CSXA 1WFCA 4EYMA 2VTAA 4L3JA 5HIBA 3P0MA 4MUQA 2X81A 5EKOA 1S9IA 4FV3A 2GNJA 5DYJA 1SNUA 2C6KA 3O71A 3UBDA 4TZRA 2AYPA 3PA4A 3R73A 1OL1A 4I94A 4RFMA 1FQ1B 1F0QA 5T3QA 4BDAA 4MF0A 3ALNA 5CEQA 1OB3A 3MN3A 4D55A 4CG9A 3OXZA 4AUAA 2WNTA 4ANOA 5HBHA 4WNOA 3VS3A 3PWYA 4DEHA 5I9YA 5HU3A 2Z7QA 2YJSA 3UQCA 1NA7A 2VNWA 3RTPA 4QP4A 1E1XA 2RL5A 2CHLA 4DBNA 3FY0A 5A14A 5JRQA 4PDYA 4YJTA 1J7LA 4TT7A 3QWKA 2GS6A 4YNEA 2W17A 3EKNA 1U59A 3NLBA 3OXIA 4O22A 4RX7A 5H8GA 3ZDIA 5JGAA 2PULA 5IQFA 2YZAA 3TUDA 4C8BA 2QONA 4WBOA 3W0MA 3A8WA 3R9NA 4DFZE 3HV4A 2OGVA 4YURA 3DS6A 5H3QA 1OKYA 4G3CA 2FUMA 3C50A 1XHAA 4IFGA 5CSVA 4F09A 5A3XA 4MNFA 2W5BA 3R8MA 5HO8A 5IISA 4ALWA 3MY1A 1GIHA 2B1PA 4M0ZA 4YHFA 4IVBA 4BJJA 2PWLA 3GC9A 3PSBA 4D1ZA 3C13A 2H34A 4FUXA 4JNWA 4FTIA 5DT3A 4WT6A 4GS6A 3F2RA 3NWWA 4LRJA 3RCJA 4M12A 3ACKA 3ZRKA 1FVVA 2W7XA 3W1FA 1AGWA 5J9LA 3JS2A 3QCSA 4DG3E 3TM0A 4FR4A 1Y91A 2O3PA 3DV3A 3O23A 2RIOA 3EFLA 3KRRA 4FK6A 4O7NA 1XH5A 3WF7A 1JKKA 2ITXA 2V7OA 3W0QA 4X2FA 5FG8A 4X2KA 2Y4IB 5E90A 5AV0A 1IRKA 1B6CB 4GFOA 4ASZA 2IVTA 3FKLA 2HIWA 3VUIA 4ANBA 3Q9XA 2Y8OA 3ZH8A 1YOLA 5CASA 3RI1A 3F5GA 3MH3A 4FNXA 4G1WA 5HCZA 1ZY4A 2W9ZB 2O65A 1ND4A 2R7IA 4AQKA 1XH9A 3D5VA 4FTKA 2PE1A 4UMRA 2W4JA 4IAFA 2OJ9A 3DB8A 2WQOA 2XRWA 3MS9A 2XIYA 5DI1A 3CKXA 3E8NA 4Q5EA 2ITQA 4IQ6A 4O4DA 4CLIA 3QWJA 1TKIA 2ONLC 4IMYA 3P5JC 3HRBA 3LZBA 3BPRA 3II5A 3R2BA 1IAJA 3TDVA 3EFJA 4L6QA 4O7RA 3NMUF 2BUJA 4UN0C 2J0LA 1BMKA 2FSTX 2OF4A 3LE6A 4GFMA 4FA2A 3NFFB 3UDZA 2JITA 3CQWA 3O8PA 3NUXA 4NIFB 4XG3A 2PVLA 4U5JA 5EYMA 3IW4A 4DA5A 4AOTA 3RHXA 5AP0A 2X0QA 3NUUA 3ZUUA 3P78A 1Z9XA 4AA0A 2HZ0A 5AIKA 2ETKA 4U3YA 4A07A 5TE0A 2YM5A 2B54A 5HO7A 3A99A 3LFEA 4HGSA 3QYWA 2OW3A 3ZFMA 5FQDC 3FHIA 5AA9A 4E8AA 5KMIA 3NYVA 2RGPA 3O50A 4O91A 3R30A 3PLSA 4IX3A 4RWKA 4YZNA 1A48A 3AKKA 4BBMA 3NUSA 3R7EA 3ML1A 5IUGA 3GCUA 3OD6X 3MH0A 4M0YA 4B6LA 4CZUA 2BR1A 4WNPA 1DAYA 3MFSA 4FG9A 5F20A 5L8JA 3ZO3A 5JZJA 3L8SA 3F7WA 3BZ3A 3DLZA 5IF1A 4AGWA 1ATPE 4D4VA 5L2WA 3COKA 3ZEWA 3LMGA 3VBTA 3LFAA 3NUNA 4JR3A 4W4VA 5JFSA 4R3RA 5BVOA 4YSJA 2OIBA 3BQCA 3O8TA 3CBLA 3TG1A 4AT4A 5E8VA 5BYYA 1Q62A 2W05A 2X8IA 4DDIA 2OKRA 2YLEA 4X7QA 3A2CA 3C7QA 3H0YA 3DKFA 3FMMA 2OXYA 4WO5A 3AC5A 4U79A 1WVYA 2HY81 5EI8A 2VTIA 1M17A 2BZHB 2F49A 5KNJA 3ROYA 4E5BA 1SVEA 5DG5A 2A27A 1SYKA 5HNIX 2CGVA 4QOXA 4AN2A 4FX3A 4QTBA 4G3EA 4X3FB 4BCGA 3MA3A 3R22A 3MTLA 3QRUA 3NCGA 3DGKA 3ODZX 1JNKA 3FI2A 3V3VA 4MD8E 2B9IA 4NKSA 2IW9A 2XK9A 2IPXA 4KAOA 1ZYJA 3HYHA 4E73A 4BDDA 4DBXA 2YEXA 4F6SA 1EH4A 3PTGA 2F4JA 4HYIA 3RK7A 4CCUA 2HYYA 4A7CA 4F0IA 1Q24A 4O1OA 2XS0A 3OHTA 2UZNA 5CZHA 4FT9A 2BZKB 3QA0A 4AA4A 4GH2A 4ZLZA 4BJJB 2XKCA 3KRJA 3MVLA 3NX8A 1WAKA 4FZ7A 1I44A 4I5MA 3V5PA 3HL7A 4CFFA 3AD5A 3KXHA 3LXKA 3KY2A 4CT1A 2OXXA 1YXSA 4M15A 3SOCA 5GINE 5E1SA 3DY7A 4EORA 3POZA 5HGIA 3WZDA 3R63A 3HAVA 4BICA 3CY2A 2ITPA 4Q2AA 3DJ6A 4UZHA 4DHFA 4RWLA 4IIRA 3LXLA 3B2TA 3KKVA 4TYHA 3OP5A 4FL2A 4RIXA 2ZFYA 2QOCA 3KXZA 4C3FA 4N0SA 3ORTA 2GSFA 4FTAA 4U8ZA 3DFCB 3F3TA 3U54A 5BUIA 4F7LA 1B38A 2IZTA 3FJQE 2WMRA 3PIYA 3QQKA 3VO3A 2QC6A 3FC1X 3QHWA 5HLPA 5BMSA 1H0WA 4UZDA 3IPHA 4JAIA 5JMSA 3R02A 2OLCA 2QOFA 3VONA 4S34A 3MB7A 4BCJA 3K5UA 4BDGA 2QOLA 2RG5A 2J5FA 3FXXA 3T8OA 3V5LA 4B4LA 1NT2A 3WZJA 2FVDA 5J95A 2Q0BA 3U4WA 2HWPA 2WIPA 4RVMA 2C5NA 2OXDA 3R71A 3DOGA 4PMMA 3RPYA 3QUEA 2UV2A 2VO7A 4QP3A 4RQVA 4YLKA 5FRIA 1BX6A 3ZOSA 5J7BA 2O5KA 2GQRA 1TFFA 2QCSA 4PP7A 4ACDA 2WU7A 3BEAA 3PPKA 2JDOA 4TN6A 4GU6A 4JG8A 4XBUA 4DDGA 4O7SA 4EH4A 2ETRA 4EONA 2DUVA 3QD0A 3OBGA 3MI9A 3AKLA 3GU5A 5DMZA 3TXOA 4E20A 3U6JA 1Q3WA 3R1QA 4YBJA 5HD7A 3K3JA 3QRKA 3UMWA 4AOJA 3VUGA 3P23A 4BHNA 3PVBA 4FMQA 1UWJA 2XJ0A 3LXPA 3OMVA 1ERKA 3H0ZA 4W8EA 3BHVA 3EFWA 3M11A 4G5JA 5L6PA 5ETCA 4EOPA 5FP5A 3A7IA 5HVJA 1YI3A 5CXHA 4PUZA 3QZFA 5C26A 2C0TA 3DAKA 4P90A 3NW7A 4RJ8A 2XALA 3DK7A 1WMKA 4MAOA 2JAVA 2F2CB 2IVUA 3PXZA 4DGLC 4F6UA 2WMWA 3VS7A 1OKWA 3QZGA 3R01A 4KNBA 4XG9A 4J71A 4QYHA 5HHWA 4BC6A 4FTOA 4XUFA 1E9HA 3SKCA 3D7TA 3SA0A 2DQ7X 2C3KA 4F70A 5KBRA 4FZDB 5HI2A 2QR8A 3FZPA 4OGRA 3N4UA 4IEBA 3VJOA 4CFXA 4FIFA 4EOJA 3NW6A 4KRCA 3ZO2A 5HG5A 3QYZA 2YABA 3CJGA 1M7QA 3RAIA 4APPA 4BCMA 1BI7A 2FGIA 3F5PA 5AR7A 4YO4A 4CGAA 1L3RE 3AC2A 4HCVA 3TNPC 2VWWA 3C0IA 1PXLA 4BZDA 4PDPA 3PVGA 3VHKA 2WEIA 3FC2A 3AT4A 2NNWB 3ZM9A 3BE2A 3QCXA 4E6DA 1H28A 4IANA 4C58A 1S9JA 2HK5A 3MV5A 5EW9A 1H26A 2YCSA 3UTOA 1OGYA 1TQMA 2PUIA 5CVGA 4MXAA 5HG7A 4HW7A 3FQHA 3QRJA 4PMSA 4BTMA 4DEBA 4BI0A 4MQ2A 4RIYA 3QLFA 1Q97A 5HLNA 4ZTQA 3QD2B 3WF6A 5AUUA 1PKDA 3V8SA 1YDSE 3F6XA 5GNKA 5LXMA 4HGEA 2PMLX 2ERKA 3SC1A 3V8TA 4BIBA 2XEZA 2WEVA 4K0YA 3PSCA 2ITUA 3NRMA 5ANGA 5I4NA 3HZTA 3G90X 1VR2A 5CENA 5HE3A 2H96A 3FLSA 3R2YA 4L42A 4RG0A 4K2RA 3EN6A 3S00A 2IVSA 3PJ3A 3T3VA 5CAQA 5AR2A 4BFMA 4TYHB 1OECA 3R1YA 1IEPA 5IQBA 5CU2A 5CALA 3IW7A 4YP8A 3FYKX 3G51A 4UXLA 2PMIA 4DH3A 3ZM4A 1YDRE 5I5ZA 4JX3A 4GT4A 4KBAA 4O1PA 5K4IA 3QKLA 4FSNA 4MQ1A 4A4XA 2P3GX 3Q5IA 3QUPA 3ZLSA 1KE5A 4FKGA 2LGCA 5AP5A 4CFMA 4R77A 2ZB1A 5FXRA 5CF8A 4C4IA 4L46A 4QNAA 3T9TA 5BVNA 2Y9QA 4YZCA 4JLCA 5CI7A 4DCAA 2VWVA 4O21A 3ZYAA 2HZIA 3GC8A 4IB1A 3KF4A 4XG8A 5AP3A 3UOHA 5FTQA 4AOIA 3Q9ZA 4IB5A 3RAHA 4DN5A 5M4IA 4EOQA 4JDIA 3D83A 4G31A 2WXVA 4ERKA 2ITYA 3GNIB 3B2WA 3M42A 3DZOA 4CTBA 4R78A 3G2FA 2WMXA 4WNKA 2UZVA 3HV7A 5EDRA 2X2LA 5LARA 3EQIA 4ALUA 4KS7A 4BCHA 2CLXA 1GIJA 5CAUA 2WB8A 1O6LA 5IQHA 5AMNA 2V7AA 2NRUA 3DBEA 1XJDA 4GW8A 2BAKA 5BV3A 1ZMWA 2J0MB 2B4SB 3FSKA 4ZSJA 3RWPA 3W32A 5GZ9A 2BRHA 4I3ZA 4EHEA 5M51A 1VEBA 3PY1A 5AR4A 4RWJA 1JLUE 4XRJA 3O17A 3L8XA 2Z02A 4D2PA 3VQHA 5BUEA 2BILB 4QDVA 4YJNA 5LWMA 3E3PA 2PY3A 5DPVA 4ANMA 4J99A 1GZKA 4CKJA 3H9OA 4YJSA 5L2TA 1U54A 3HA6A 3P7BA 5CNOA 4O0RA 2VO3A 1YXUA 5C27A 3VVHA 4C4HA 5DBXA 2KTYA 4U42A 2P2HA 2VUWA 4D4RA 4YHJA 4JAJA 1OIRA 1JQHA 3FZ1A 4CSVA 4D9UA 2X9FA 5HU9A 4E6CA 1ZYDA 3ZLYA 4QP7A 4G9CA 1YXTA 4HYUA 4R5SA 3KXXA 4DLIA 5G1XA 1ZOGA 4JT3A 2VTLA 3OS3A 4IB3A 3U9NA 5A4TA 5EDPA 1ZYCA 4MHAA 4MD7E 4XLVA 4PDSA 5EM5A 5HG8A 3VHEA 4DT8A 4LV7A 3ORPA 3PE2A 3IGGA 4UMQA 4UYAA 4RC4A 5HKMA 2Y4PA 4YSMA 2E9NA 4FKUA 1OPJA 3ZFYA 5D12A 3UE4A 3FXWA 5KO1A 3JVRA 3MDYA 3BELA 2ITZA 3F3UA 4FIHA 1WVWA 4NT4A 3E63A 4XP3A 3FY2A 4YC3A 5FD2A 1OVEA 3EL8A 2FH9A 2I6LA 3IDCA 4GFGA 3FXZA 3ZLWA 3FL5A 3CTJA 1UVRA 5F1ZA 2IZSA 4K33A 4EBVA 3NUAA 4FKSA 4K18A 3PDTA 2VX1A 3WZUA 4I6BA 1OBGA 2HW6A 4FC0A 3IQ7A 4PPAA 5T6KA 2OJIA 2C6DA 3KXGA 2BDFA 3P1AA 3WILA 4NSTA 5KMLA 4ENYA 5KMKA 1KUTA 3S1HA 4WSQA 4AZFA 3TZMA 4E7WA 3LFBA 5AFVA 3PPZA 4KWPA 3TTJA 3LLAA 2PZ5A 3PP1A 3GQLA 2JIUA 2R3HA 4F7NA 5LVNA 5DH3A 3MPMA 4DE4A 2AUHA 4IDTA 5JT2A 5BYLA 4K9YA 4V0GB 5M55A 4KIPA 2PSQA 1J91A 4DHZA 4FYNA 4QYEA 5IMEA 4BRXA 1M2RA 3D5UA 4L53A 4DEIA 5LMKA 2JIVA 3COHA 1MQ4A 3HMOA 4KKEA 2JBPA 3QCYA 4ERWA 4C37A 5K0XA 5KMJA 3Q60A 4FKIA 5L3AA 3ID6C 3SXRA 2JDTA 3D5XA 3MESA 4AAAA 4EYJA 4V04A 1W84A 3GENA 4FZ6A 4FE2A 2VO0A 4NW6A 2IN6A 5J1WA 2J0KA 3QX4A 4CZYB 4CFNA 3ZS5A 2RFDA 2VTHA 4DAWA 1Q8WA 2WIHA 2YJRA 3MJ2A 3ELJA 3MY5A 3IW5A 2YACA 3ET7A 5AM6A 3TJCA 5EW8A 4DH1A 1WBVA 4MYGA 4O7WA 2Q83A 2W5HA 4LG4A 4C62A 5LVOA 3SW7A 4CEGA 1A06A 2EXEA 4X0MA 4ANLA 3HLLA 3KVWA 4L43A 3MA6A 1P14A 5M08A 5M4FA 4AW2A 4JDHA 2YWPA 4IB0A 4KIKA 3FMNA 3VS1A 4TPTA 3P9JA 1ST0A 5BYZA 4OAVB 1SNXA 2YERA 3NYXA 1Q5KA 1FMOE 2WTDA 3QGWA 4O2PA 3BYOA 3ZMMA 2CKQA 3WE4A 1DM2A 4U80A 4O0TA 1J3HA 1PMUA 4HVSA 5TR6A 5A54A 3QTZA 4IH8A 3G6HA 5GJGA 2WKMA 3NNVA 4DINA 2OWBA 3E64A 4ARKA 3AC8A 3QAME 4O7LA 3HDNA 4IE9A 5IQEA 3AC3A 3P08A 4TKSA 2PVKA 1H1QA 5AV2A 4OTHA 4XV9A 3O96A 2BHEA 1HCLA 4Y73A 5J9YA 4U3ZA 4O4CA 5LVLA 3V51A 2XK7A 2GNFA 4EK6A 4E93A 2ZJWA 2C69A 5E8UA 4BCPA 2A0CX 5AV3A 3ZUVA 3KRWA 4CNHA 3IDPA 4RQKA 2XIXA 2W5AA 3U6HA 1GZNA 4MTAA 4HZRA 3NSZA 3NYOA 3BHHA 4OTRA 3K54A 4F0FA 4PTGA 1XBAA 4C2VA 4EK4A 2ZM4A 4B9DA 4HVDA 2CKPA 4I21A 4GT3A 3R7YA 3IO7A 5CEKA 3PZHA 5KHWA 2W1GA 3RGFA 2PU8A 4Q9SA 3L9MA 2XUUA 2UW7A 3F2AA 3Q4ZA 4MWHA 4XG4A 3QXPA 3NAYA 3FAAA 3KULB 3AOXA 4NM7A 2R3PA 2JKOA 3HP2A 3U51A 1J7IA 3UYSA 3EMGA 4IM3A 2NRYA 2X0PA 5HIEA 3R8PA 4TL0A 3CJFA 2VTRA 3NW5A 4C02A 1JSUA 5GJFA 2R64A 3ZBFA 4BGQA 3PXRA 4PY1A 2G2FA 3Q32A 5A9UA 4AXEA 5KZ0A 3ENHA 2BRBA 3OT3A 2BHHA 4H1JA 4WIHA 4X2JA 2XIZA 4LRMA 3RNYA 2UZWE 4YC6A 3MFUA 4BZNA 4BY9E 3BHUA 3L9LA 4M13A 4QMLA 3BV3A 3BQRA 2UW6A 4FGRA 3LMHA 3GU4A 4BDKA 2JFLA 1PYXA 4XRLA 3ZXTA 4EC9A 3OEZA 4IX5A 4EZ3A 4J53A 4AFEA 3HV6A 4NIFA 4C34A 3PLAE 3FLWA 4CMUA 3TUCA 4PL5A 2G15A 3V5WA 4EQCA 4F6WA 4JOAA 5GIOE 5FP6A 2R3NA 2ZMCA 4AT3A 3PJ2A 4UEUA 1W83A 3GU7A 4I24A 5EYCA 5IDPA 4WRGA 2R3LA 3SHEA 4U41A 5CEOA 1Y6BA 3D14A 4UBAA 5KE0A 1LR4A 4B99A 4ZTLA 3TV6A 4EH7A 1IASA 2RKUA 3UNZA 4FTLA 4EC8A 1H27A 4DHJA 3Q52A 4IJ9A 2X9EA 3GU8A 4O6LA 4W9WA 4RA4A 2PZRA 5L4QA 5JKGA 3CPBA 3R8VA 2ERZE 3RVGA 1H8FA 2WTJA 3QQGA 4C4GA 4RZVA 1R3CA 2CGUA 4N70A 2WAJA 1DS5A 5DT4A 3FMEA 1MQBA 2WQEA 4IDVA 3UC4A 2ZDTA 2OSCA 2JC6A 1Q8TA 4K6ZA 3UYTA 4EH6A 5LCKA 2OF2A 5IPJA 2GFSA 4PNKA 1JSVA 4TYEA 4YJUA 4YHTA 5AUWA 4FK3A 2BDWA 4FNZA 1BLXA 3HUCA 3OCSA 5DEWA 4BTKA 4HOKA 5D41A 2VU3A 1M7NA 3EZVA 3LLTA 4FTRA 2ESMA 4R3PA 4D2VA 3KXNA 3D7ZA 3LCSA 4USEA 4KIKB 4X3FA 2E2BA 3WIGA 1R0EA 3QTSA 4GK3A 4A9TA 5M4UA 2JAMA 3ACJA 4IAYA 4AACA 4E3CA 3ZU7A 4E4XA 5IA2A 4GUBA 5K4JA 3QC9A 3H9RA 3BEGA 2QOHA 3HX4A 4R7HA 4ACCA 2J5EA 2QNJA 3BYVA 3R7IA 3VS4A 3CKWA 1YWVA 2I7QA 5CF6A 5CANA 3BRBA 4ZZOA 2Q0NA 3AMAA 2ITWA 5L2IA 2VTOA 3RPOA 3BGZA 3NYNA 3QL8A 3V6SA 4EEVA 4CRLA 3BGQA 3R7OA 3KFAA 4JS8A 2CGXA 2YM8A 1LEWA 4PTCA 1PYEA 3CS9A 4LGGA 4BDIA 1W2CA 5DHJA 3FKOA 2BDJA 2QOBA 3HV3A 3KL8A 2PZIA 3HMMA 3OTVA 4FSWA 4I6FA 4JRNA 4QMPA 4BKZA 2YITA 4O4BB 2HELA 4AXAA 3WARA 5ICPA 2X39A 3DXNA 3F5UA 4S33A 5AUYA 3PYYA 2BFYA 3V5JA 5M06A 4XLIA 2XF0A 3BGPA 1URWA 2OH4A 4PL4A 5EOLA 1UU7A 1GAGA 4EL9A 3BLQA 3KC3A 4FSUA 3TKHA 3GOPA 4QD6A 3ODYX 4ZS4A 2XRUA 3LFFA 4FZFB 1SMHA 2VTJA 4NH1A 2H8HA 3VF9A 5IEXA 2Y6MA 4E6AA 2E9UA 3V6RA 4XYFA 4F1MA 1FVTA 3LFDA 4L44A 5AP6A 3TCPA 5HLWA 5LMAA 3TACA 2VWBA 4OTDA 4FTUA 2WD1A 4G16A 3RCDA 2UVXA 1GOLA 4IX4A 4QMWA 3MH1A 3E7OA 4MXOA 1K9AA 4OT5A 4TY1A 4XG2A 3VIDA 5LCJA 2CNQA 2WOUA 3BIZA 1U5RA 4GKIA 4G34A 4F08A 3TL8A 4AE9A 5IU2A 3VJNA 3F2NA 4JDJA 3W2RA 5CEPA 4R7IA 4FV9A 2HOGA 2C3LA 1YDTE 4LL5A 3C0GA 4KIQA 4YNOA 4I23A 2PVRA 1PHKA 3U87A 3DKOA 2GQGA 3DB6A 4V05A 5CYIA 3VW8A 1Y6AA 3UO4A 3LJ0A 3OCTA 4RFYA 3QFVA 3NCZA 3U8WA 4L3LA 4FOCA 1YQJA 5I0BA 2VWUA 1UNHA 3EQRA 3GU6A 3JYAA 2G1TA 4DEGA 1O6KA 4TWPA 4AX8A 2R0IA 2VAGA 4FKOA 3A7HA 3RZFA 4DTKA 4OTPA 4FT0A 4MCVA 4C3RA 5BQ0A 3W0OA 3HAMA 4M69B 4QMZA 1Y8YA 2OZOA 3NAXA 3Q3BA 4D5KA 1P4OA 4LUDA 3GXLA 3ORMA 4ZSGA 2CNVA 3CXWA 4OUCA 4OLIA 3FQSA 4G6OA 5IQCA 1OL2A 3I5NA 2OI4X 5HICA 1WBWA 2UVYA 2V0DA 2I0EA 3VS0A 3ZC5A 3B8R