2UW8A

Structure of pka-pkb chimera complexed with 2-(4-chloro-phenyl)-2- phenyl-ethylamine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Identification of Inhibitors of Protein Kinase B Using Fragment-Based Lead Discovery.
pubmed doi rcsb
source organism Bos taurus
total genus 107
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2uw8A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2uw8A02
3FY2A 1OIUA 3UVRA 2CNQA 3C4WA 3LMGA 3CSVA 3R8UA 2X6EA 2WEIA 4A06A 3BQCA 3BWJA 2Y7JA 2VO6A 4I23A 1YWNA 3WZJA 1OL2A 3QTXA 5EKNA 4TNBA 3CTHA 5B2LA 3A4PA 1UU8A 3U4WA 5EQEA 3FKOA 3A7FA 4C57A 4GKHA 4KUJA 2G9XA 2R3FA 3H9OA 4WD5A 1VJYA 3IKAA 3RPOA 4ASZA 4F6WA 2QU6A 4CD0A 3D7TB 2XP2A 3QUDA 3EYHA 2PVMA 4GV1A 5TR6A 3VJNA 3UOJA 2F7XE 2P3GX 3PY0A 4NIFB 4IAKA 3HLLA 4II5A 2UV2A 4GMYA 1CSNA 3LFBA 4X2KA 2YWPA 3R00A 2W5AA 2BFYA 2O8YA 1LEZA 1SM2A 2Y6MA 2W9FB 5E8SA 4F6SA 4DYMA 4FIFA 4HZSA 1ZMWA 4IB3A 3V8WA 3RBWA 4IB0A 5ACBC 5GZ9A 2JEDA 2Z7QA 4BKZA 3L9MA 4TWNA 3I60A 2W1CA 5IU2A 1XWSA 2XYUA 2BKKA 3HP5A 4XG4A 4L43A 3VBYA 5JGBA 3VRZA 3ZHPC 3GCPA 3SLSA 5BMMA 4C3RA 3RTPA 3LCKA 5KHWA 4L01A 3SQQA 5BVWA 3O8PA 3SV0A 5IG1A 2P55A 3FZOA 5AP2A 2HYYA 3SOCA 5CEKA 2XNNA 1WFCA 2ZOQA 4F0FA 1PMUA 2PVLA 3ZYAA 1BMKA 3KXMA 3QKKA 3HZTA 1KE7A 4FSQA 3ZLXA 4X21A 4BCQA 4EYMA 3SXSA 3FQSA 4FTAA 4R6VA 4CZYB 2BFXA 3BU5A 2BZHB 5LWNA 4RSSA 5IH4A 4FV9A 3RINA 5FXSA 3QQHA 2PMOX 3CR0A 2PU8A 4M15A 2W4OA 3OT3A 4ZLZA 3SW7A 4BI0A 5EKOA 2VWBA 3OOGA 3NUUA 5DR9A 4BTJA 4HGSA 3NYVA 3UNKA 4CFVA 1E1XA 4CFUA 2GQRA 4CZUA 3HMPA 1H28A 4BCGA 4GIHA 2J9MA 2XK8A 4O22A 4ZSEA 3WZDA 1GIHA 2J50A 4RBLA 5IA0A 3N4UA 5JN2A 1AD5A 3KRJA 5L8KA 3LQ3A 3U54A 3RPRA 4C2WA 3LFNA 1V1KA 1ZARA 3ORXA 3VULA 4HVIA 5JH6A 3NIZA 1YI6A 3R1QA 4C4IA 3CXWA 3AC8A 4RJ4A 4RIXA 3L1SA 2WMQA 3QRUA 4APPA 4L6QA 4TTHB 4YUQA 2XIZA 3Q6UA 4IVCA 4NJ3A 4YHTA 3AC1A 2F49A 2YISA 3PE2A 3E3BX 1UWHA 2BIKB 2OH4A 4GW8A 2HOGA 4AN2A 3QUPA 5HBJA 4RFYA 5FTQA 2WD1A 3ATSA 3D5WA 2HENA 4P4CA 3PXRA 4CFMA 2G2HA 4ZLOA 2Z02A 5FGKA 3SW4A 3POZA 1WBVA 5CI7A 4RVLA 2W4KA 5IDNA 3G0FA 5ANIA 2EB3A 3NDMA 3OMVA 3PSCA 2ERKA 4FTUA 3WOWA 4U40A 5AEPA 4DTAA 2RG5A 1J1BA 1ATPE 3QQGA 2RGPA 3KXHA 3VBXA 3ZC6A 2W4JA 4CMOA 4ENXA 3ULIA 4FIHA 4F9YA 1H1QA 4F0GA 3T9TA 3M11A 1ZOHA 4WNOA 3R8VA 4LRMA 4C38A 5AR8A 4YP8A 1GZOA 2W9ZB 3A60A 4UXLA 4IJ9A 3E8CA 5GJGA 4BHNA 4K77A 4BGQA 3R6XA 4RC3A 4C8BA 4GK4A 4EL9A 5HD4A 3VS1A 5E8XA 4HYIA 4FSYA 5L3AA 3LLAA 3MW1A 3IOPA 3O23A 2O63A 4YC3A 3RHXA 3W1FA 4EI4A 3T3VA 3QZHA 3UO5A 2VWWA 2VTRA 3QQKA 4ZXTA 1JKSA 1YDRE 4IVDA 2R3MA 3PUPA 4DFLA 4FK6A 5AR5A 2Y8OA 3W8LA 2UZUE 4WNMA 5EH0A 3UOKA 3GB2A 3VNTA 2W17A 4PP7A 5JQ8A 3WZUA 1IR3A 5DBXA 4FV7A 4XMOA 2ZDTA 3FHRA 1CKIA 1J1CA 1WBNA 3AD4A 2CNUA 3ERKA 4BDKA 1MUOA 1I44A 3ZCLA 3QX4A 3KXGA 4RX7A 3VF8A 1ZAOA 3LOKA 4AU8A 4GK3A 4BGGA 2OXDA 3QRTA 4PMSA 3DFCB 4KKHA 3F9NA 2WQEA 3EQDA 3TTIA 4BCHA 5HHWA 4ACGA 4WSYA 4MTAA 4UYNA 4KIKB 2XKEA 4Z16A 1KSWA 3AT2A 1OKYA 2BAJA 5EQPA 1YXUA 3GC0A 4FKSA 1CTPE 4O0YA 4U0IA 3D5XA 4PUZA 4AS0A 3VBVA 5M56A 5CTPA 1TKIA 4Q5HA 3KU2A 2HXLA 3Q32A 1R3CA 4OTIA 4XG8A 5HE2A 4BWXA 4HVHA 3GGFA 2EWAA 3VS6A 2GHLA 4BKYA 5DT4A 3OEZA 4IVBA 5FDXA 2PK9A 2IO6A 2JDSA 1WVWA 4FG9A 4ZZMA 4DFBA 1UU3A 5DGZA 4U9AA 1YW2A 2PVHA 4C02A 3LM5A 4EBVA 2B0QA 4FZ6A 3ORPA 3W8QA 1MQ4A 4QMUA 2B9JA 3FC2A 3K54A 1W0XC 2RSVA 4W4WA 5EM8A 4J98A 3V51A 4QYFA 4AT4A 3DLSA 3FXXA 4EH3A 1PXLA 4JRVA 3U6JA 3GC8A 3AQVA 3UMXA 4D9UA 3MPMA 4AN9A 2ETRA 2PZPA 4ASXA 3HV4A 4GH2A 1NW1A 3NUSA 3PA4A 2I0EA 1W83A 3TIYA 5A46A 2WIPA 3TV4A 3NVKI 4BDIA 4FBXA 3UVQA 4O91A 3CLYA 2Z7RA 4Y46A 4EH5A 4RVMA 5G6VA 5HGIA 1GIJA 3QUEA 3VUHA 3OBJA 3ZEPA 4AW0A 4C62A 4KINA 2NP8A 2X2MA 3MFRA 3R7YA 3VUTA 2OJJA 3M42A 5L2IA 4ASEA 3R30A 1U54A 3BV3A 1U4DA 2WAJA 3ZLSA 5DH3A 3RAIA 3SX9A 3SGCA 4YHFA 4ZOGA 2F7EE 1Q41A 2R7IA 1P4OA 3AMAA 2OICA 2O0UA 3BELA 4RLLA 5GIPE 4W9WA 1KE5A 4C59A 2J0KA 3DBCA 4KD1A 3A61A 2Y0AA 1YQJA 3O71A 2OXXA 4DGNA 3PPKA 2IZTA 2OF4A 2P2HA 2R3IA 4CFWA 2F2UA 5M55A 3P7BA 3I81A 1PHKA 3LFQA 3OW3A 5FM2A 3RCJA 1AQ1A 4NM5A 4PPBA 4FV2A 3RPVA 4GUBA 4L44A 3TG1A 4R3CA 2XK9A 1H0WA 3DBEA 1H01A 4RT7A 3BYVA 2J51A 2GTNA 2XMYA 2YM5A 4UALA 3KC3A 4NFNA 2FSLX 4AAAA 4F6UA 2HZNA 5IF1A 4CG9A 4E5BA 5I9XA 5BQ0A 2P4IA 5I5ZA 2OGVA 4BIBA 3LFAA 4QP4A 5EM6A 2OJ9A 3UPZA 1WBWA 4LQMA 4C3FA 3BIZA 3FLYA 4KRDA 3GCQA 4AQCA 4I6FA 2QOLA 4FTNA 5KNJA 2W1GA 1FGKA 1Z9XA 5DRDA 4FNYA 3TUBA 1Q3DA 2YN8A 3NGAA 5CSHA 1SYKA 5AIRA 2QNJA 4MQ2A 1IASA 3BYMA 4OBQA 2OW3A 4KA3A 2E9OA 4MYGA 4ZY5A 2QOOA 1PXIA 1I09A 2OG8A 3LJ1A 3VS5A 1DI9A 3P78A 2R7BA 4YLKA 1GY3A 5IMEA 3HMOA 4HYHA 5AP3A 1OIQA 3E8NA 2VTAA 4GJ2A 3VAPA 3P86A 3R28A 2UZNA 4GS6A 5EK7A 2WTDA 3V5QA 3NYOA 3DK7A 3QCYA 3QF9A 3IO7A 4EBWA 4XEYA 4GG7A 3AMBA 2GHMA 5DEYA 1OBDA 3LXLA 1HOWA 3GOPA 4TZRA 4F1TA 3ZM9A 4HJOA 3FI2A 4M3QA 3JXWA 3H10A 2WO6A 4FKLA 4M14A 3HVCA 1YDSE 5JEBA 1PW2A 3AD5A 1OIRA 2XK6A 3R1NA 4MD8E 2PZ5A 3D94A 1Q8WA 2XIKA 3GU8A 3K2LA 4LFIA 1J3HA 3B2TA 3DB6A 1H0VA 5HU3A 3VS0A 1WZYA 3EB0A 4RIXB 4LV8A 3FY0A 4DG0E 4RA4A 4FVPA 4GKIA 3R8LA 4H36A 4YJNA 3D4QA 1A48A 3ZC5A 3FHIA 3W2RA 4A4XA 5AP5A 5IQIA 4NFMA 3O8TA 4MQ1A 4RVTA 3PP0A 4XG2A 4JDIA 5FEEA 3ZO2A 2NRUA 3PG3A 4DCAA 3CJGA 2XCKA 3O7LD 4GIIA 4U3ZA 2ZDUA 1YXSA 2BZIB 4TYIA 5KX8A 2YABA 4EYJA 2JIIA 4FEXA 3NCGA 2QOKA 3W2PA 5AP0A 5ITAA 4PDSA 2XVDA 1ZWSA 4YGAA 4O2ZA 2CPKE 3C0HA 4YZMA 4Z7GA 5D7VA 1QPEA 2C1BA 1IAJA 3KXNA 3ZBFA 1S9IA 4UWBA 2PVJA 4FL3A 2ZV9A 4I6BA 1Z5MA 5A4QA 1DI8A 2REIA 5HCYA 4GU6A 1ZYJA 3QKLA 5JFXA 1SVEA 3F61A 4MNEA 4KIQA 3HRFA 4R1YA 2G1TA 5CQUA 2H34A 4XBRA 2VN9A 1JOWB 2J4ZA 3WF8A 5FXQA 4O7RA 4DH5A 4ZK5A 2UW8A 2C30A 2XRUA 3MDYA 4IDTA 3KRWA 3D7ZA 2EB2A 3B2WA 3OOMA 4UEUA 3RAHA 3JY9A 4O7VA 2E2BA 3PY1A 4HNFA 5EOBA 3WZKA 3AT4A 3IGOA 2YIWA 3IK3A 4IH8A 3ZZWA 4RJ3A 4FKGA 2VAGA 2O65A 3F66A 2LGCA 4QTCA 4V04A 2QOHA 4A9RA 2QODA 3R8MA 5FDPA 4A9UA 4PV0A 1BUHA 3PSDA 4S2ZA 4WUNA 5LMAA 3D15A 1P5EA 4KIPA 2OIDA 4XHKB 1Q4LA 2W1HA 5JSMA 5DEWA 1M17A 5GZAA 2W96B 4MBJA 4F9AA 3LLTA 2QLQA 3C4XA 1PF8A 3QTWA 1OPKA 4QPMA 2VV9A 3VVHA 1SMHA 4O7YA 1OPLA 3BHHA 3FLZA 3Q2MA 1IA9A 1X8BA 2BTRA 3CD3A 4B0GA 3E92A 4FSZA 4MCVA 4RWIA 4O0UA 5J9LA 4CYIA 5A4EA 3T8OA 4KWPA 2BTSA 2Y4IC 3KK8A 4QP6A 4X3FC 2EXCX 4ZIMA 4O7ZA 3DAEA 4ZLYA 1CKJA 4E4NA 1YXTA 2X4FA 3ORLA 4RIYA 4IANA 5IZFA 1W82A 3WBLA 4M12A 5DR6A 5LCJA 1STCE 3HDNA 3MB6A 3P7AA 4YBJA 5DPVA 4RZWA 5HOAA 4FOBA 5M44A 5CVGA 3FSFA 1A9UA 4IMYA 4CT2A 1PRYA 4ZTNA 2W1DA 3R73A 2WTJA 5KE0A 4CNHA 1BX6A 4FSRA 5AAEA 2UZEA 2EUFB 1R0PA 3EMGA 4GFGA 5CVFA 3CPBA 5HESA 3V5TA 3OXZA 2X4ZA 4AZTA 4AWIA 3SXFA 2PMLX 5B2MA 2G01A 3LMIA 2FH9A 2R3GA 4TY1A 3F6XA 5D11A 4QYYA 4I0TA 3TV6A 2FA2A 3ANRA 4QMTA 3IECA 4EOPA 4J99A 4LMNA 5CF6A 2ZV7A 4GVJA 4X7QA 2HCKA 3JVSA 3GUBA 4JI9A 3DA6A 3PP1A 2XK3A 4FTTA 4R7BA 3W2CA 4DH3A 1U54B 3FMMA 2WGJA 3E62A 2JC6A 4K8AA 4HPUE 4JL9A 4G3EA 3W2SA 3HMNA 3GXLA 2I40A 2YM4A 4PNKA 2WMXA 4CKIA 4IC8A 4CRSA 4D0XA 2C5VA 4BCIA 5HLNA 3IPHA 4NK9A 3DOGA 4FX3A 3IW6A 4YHJA 4XUFA 3OXIA 5HO6A 2C6KA 3COKA 3LCOA 2CDZA 5C01A 1U46A 5IQEA 2HWOA 5B7VA 3LXNA 5CU2A 4D0WA 1YOJA 4G6LA 2OBJA 2HELA 4BBFA 4IAAA 1RE8A 1REJA 4QQTA 1Z57A 4MXOA 3ODZX 3LCSA 3DNDA 4XH6A 3UIBA 3BHUA 4QP8A 4ZJJA 4AA5A 1T45A 4MHAA 3I7CA 3IDBA 1PYEA 4GU9A 4P7EA 3D0EA 2IW8A 4F65A 4M13A 5E7RA 3C51A 4PY1A 1YRPA 4B8LA 5KO1A 3R8ZA 4JT3A 2C3LA 4IM2A 3WYXA 5A54A 5KCVA 1M7QA 1PMEA 1ZMUA 2GPHA 3BBWA 3KA0A 3LQ8A 3NYXA 4QMXA 5ANJA 5ACKA 3KK9A 2F4JA 3LFSA 4DFUA 1YHVA 2VO0A 2WFYA 4R1VA 1Q8TA 2H96A 3F3ZA 2XRWA 2B54A 4U43A 1R78A 3KKVA 4EHGA 4F7JA 4HGEA 3HA6A 2UZOA 3HP2A 5LVNA 4JS8A 2BKZA 2FSTX 3C0GA 2JKMA 2WQNA 1JSTA 3PIZA 3FL4A 3L8SA 3M2WA 4DFXE 4RC4A 4EK6A 3S0OA 3KXXA 1DM2A 5A4LA 3ALNA 3F3WA 5T6KA 3TCPA 3MH1A 4TYHA 5FUTA 4MXYA 3NNUA 5FP6A 5J7HA 3CQWA 1UU9A 2QLUA 3QYWA 1ZYLA 4DEIA 5BMSA 4FKVA 3E63A 3OW4A 5E8VA 4AGUA 3WF9A 2YDKA 4S33A 3TM0A 1KWPA 1V0BA 4J7BA 3R9RA 5I9YA 4YTCA 4FV1A 4PPCA 3QWKA 4G9CA 2GNIA 2ZV8A 1TVOA 2V22A 4FKIA 4IWDA 4IC7A 4TKSA 4UV0A 5CLPA 4E6QA 3UVPA 4FTRA 3LCDA 4E4MA 4BY9E 1KOAA 3CY3A 4DLIA 1F5QA 3PE1A 1RW8A 3MY1A 2OWBA 2W05A 4FIEA 3ACKA 4OTDA 2B7AA 4RJ5A 3R1SA 2WU7A 4DFNA 3CJFA 2QURA 2PULA 4QMPA 4G5PA 4I5PA 4O0WA 2CN8A 5CU6A 4RGJA 2RL5A 5EYKA 1UNHA 5BUEA 4E1ZA 2Z2WA 3FAAA 1MRUA 1PXMA 4JR3A 4NEUA 3ZRKA 4M67A 2E9VA 4FV4A 2B1PA 1ZLTA 4QMNA 5DHJA 3VW6A 3V5LA 3ZOSA 3EKNA 4IZ7A 3TNPC 2PZIA 4IFGA 4RRVA 1REKA 4PP9A 4TRLA 4U42A 4EOQA 5A6OA 2VWUA 4AT5A 3O50A 4K9YA 3F69A 4YTFA 4S32A 3ALOA 2F2CB 3QCSA 3QA0A 4GFMA 4ANMA 2VX1A 3OEFX 2R3KA 3V01A 2C5XA 2XKFA 2XIXA 4LUEA 1DS5A 2J5EA 4L9IA 2ZM3A 2QOCA 3QTQA 3B8RA 2HIWA 3QWJA 3F2RA 4L7FA 4YTIA 3NSZA 3RK5A 5LVPA 3DTCA 3CP9A 2C6DA 5IKWA 3DU8A 2XIYA 3HV7A 4O21A 3DFAA 5E8ZA 1FMOE 2J0JA 2A0CX 5EDRA 5BPYA 4MF0A 4FOCA 1WBPA 4BF2A 3ENMA 4YLJA 3ZSIA 5AM7A 2YEXA 1UU7A 1ERKA 2ZYBA 5AUUA 2C3IB 3ZTXA 2FVDA 3PSBA 4TYEA 1ZY5A 3AGMA 3DTWA 3I79A 4OTWA 5IA3A 4MNEB 1QL6A 5ANKA 5EQYA 3HRBA 4FTOA 3ZZEA 2XEZA 3BLHA 5ANOA 3HGKA 4I92A 5I9ZA 2VNYA 1BYGA 3FBVA 3NNVA 3VUDA 3MFTA 3QTUA 4YZNA 3R7UA 5M51A 2J7TA 5JFSA 1XKKA 4E5AX 1LEWA 5EYCA 1UKIA 2JBPA 3Q60A 4GL9A 3UYSA 3ZRMA 2ITOA 5CENA 2R0IA 3NEWA 3F5XA 3F3UA 3ET7A 3ORNA 2VTPA 2UZVA 3P7CA 4JG7A 4X2NA 2JKKA 5BVOA 2P33A 3BHVA 5CF8A 4E4LA 2ZM4A 3FZPA 3KQ7A 1YHSA 2QKRA 3OF0A 2PZRA 3NW6A 3NUPA 4O0VA 3HEGA 4RX8A 3OD6X 2G2IA 3V04A 3DZOA 3PYYA 1YHWA 5AP7A 4C33A 3F5PA 5M4CA 4ORKA 4BCNA 4LRJA 4IX6A 4B7TA 1H27A 2FB8A 3QHRA 1FVTA 3MWUA 3OCGA 3R2YA 1PYXA 4JOAA 2QHMA 2VUWA 5E90A 2Z7LA 3E64A 3ZS5A 5JK3A 4IVAA 4HW7A 4CFNA 2OFUA 4ACHA 2J90A 3G15A 4JXFA 1PMNA 2H9VA 5KMJA 3QLFA 3KVXA 4P5ZA 2XZSA 1URWA 4AGCA 4DFZE 5A6NA 1NVSA 3EH9A 4H3PA 4D1SA 3Q96A 3PJ2A 4DGGA 4FSTA 3QTIA 4RIYB 4JQ8A 5CSPA 3KF7A 1Q5KA 3MI9A 4GYIA 4EH6A 2BVAA 1QPJA 1XR1A 2QCSA 3GFEA 3GQLA 2PWLA 1U5RA 4MD9E 4MD7E 4JR7A 4NSTA 3TNIA 3TNQB 4C58A 3UO4A 1U5QA 5L2QA 4O7LA 1SVHA 4RG0A 3I0QA 4QTAA 5H3QA 1JQHA 4AOIA 5D1JA 3MVJA 4H39A 5IQAA 3DXQA 4PWNA 3AC3A 4RWJA 3SA0A 3PWDA 3MBLA 3RKBA 4JX7A 2OJIA 5JKGA 4C61A 2OF2A 3PFQA 3QTSA 4PRJA 4BWKA 4NYEA 5LVLA 4YJRA 3F7ZA 4IIRA 3NUYA 1LUFA 4DC2A 2X0GA 4QD6A 4BDJA 4I6QA 2VTJA 2YCQA 3DB8A 5CT7A 4HYSA 4B8MA 4CTBA 4O84A 4JAIA 2JLDA 3DXNA 3GVUA 4XNEA 5FG8A 4OAUC 5L8LA 1FBNA 1P2AA 1YOMA 2AYPA 2E9UA 3NW7A 3TNWA 5GINE 4X2JA 1OIYA 2XB7A 1G3NA 4WKQA 3TZ8A 2BIYA 2O3PA 4R5SA 5C26A 4BN1A 4BR3A 1CKPA 5EHYA 5J8IA 1H1WA 3ORIA 4FTLA 4QMVA 2QO7A 1GAGA 3BZ3A 2JIUA 4KBCA 1GOLA 3VIDA 5M4UA 3U6IA 3EQIA 5CF4A 2RFEA 4EH7A 3WF6A 5KMIA 4Z55A 3JVRA 3AMYA 4QP2A 5IA1A 4BCJA 5M06A 3FLNC 3QCXA 4IZ5A 5HCXA 5HVYA 3D5UA 3MPAA 4JBQA 5AMNA 3EIDA 5J95A 4PTGA 3GU6A 1P14A 2A1AB 2B55A 3BPRA 3Q2JA 5IQDA 5CWZA 3ELJA 2XNOA 2BRHA 4BCPA 3EQRA 4EUUA 4XRJA 2ZVAA 3IOKA 5BVEA 3R7VA 3KFAA 3KB7A 4MXXA 5AWMA 4AT3A 4D5KA 3GENA 4NWMA 1B38A 2B9FA 4I20A 4W8EA 4EOJA 3F7WA 4JVGA 3G0EA 3QGWA 2R3JA 2GNHA 2W5HA 3GBZA 4RQVA 4WIHA 5F4NA 2H8HA 4JBPA 2VTMA 3PA3A 2UVXA 3DKFA 4R3PA 4XG3A 3R7EA 3W10A 3TDWA 3BCEA 1T46A 4IZYA 2XS0A 5CZHA 2J6MA 4APCA 3DPKA 2XNPA 2OLCA 2GCDA 5AUWA 3FZRA 3FMHA 3K3IA 2BDFA 1GZKA 3N51A 4FUYA 4IW0A 1H24A 3TIZA 3A7IA 5KMOA 3EN6A 1XH5A 1GIIA 1OL1A 4Y5HA 5EW3A 3PA5A 5D9HA 4B99A 3N4VA 5H8BA 2Q0BA 5CSWA 3O7LB 4MBIA 4H1JA 4EKLA 3UDBA 2DWBA 2VX3A 4TYHB 4PPAA 3HV5A 2QOQA 2ZV2A 2YM7A 2UZBA 4EOOA 4CVAA 2Q0NA 3ZM4A 4OW8A 4GVAA 4RIOA 2RFDA 3PIYA 3MESA 3MIYA 3AT3A 5F95A 1UA2A 3AC4A 4FV5A 3WE8A 2PUNA 4U79A 3EQGA 3D2KA 1PKGA 2ONLC 4O2PA 5ETAA 5ETIA 2FGIA 4MXCA 3EJ1A 4FEVA 4UMUA 3A7GA 4YU2A 5AV4A 5J7BA 5FBNC 2W7XA 4K11A 4XOYA 3W2QA 1XBCA 4J96A 4LV5A 3Q3BA 4S31A 3EN9A 5DIAA 3R0TA 2QO9A 4C4EA 4FKJA 1UKHA 1YI3A 1H8FA 3IS5A 2PMNX 3V5PA 3U6HA 2R4BA 2CCHA 3KL8A 3PXFA 1JNKA 4YPSA 3PXYA 3NZ0A 5AX3A 2RG6A 3BQRA 3VS4A 4QP3A 2CLQA 3BGQA 1M2RA 5E91A 4LRKA 1WCCA 2VTHA 4UWYA 3RNIA 2HXQA 4CFXA 1Q61A 4BIEA 5C27A 4L8MA 2WKMA 5I9UA 3DLZA 3GCSA 3RVGA 4Y85A 2XH5A 2J2IB 4O0SA 2IW9A 2CGVA 4JIKA 3F2NA 1M7NA 5BX0A 3FV8A 4FT9A 2GS6A 5IDPA 4HOKA 5CSXA 2GQGA 5K4JA 3IGGA 4L67A 3MH0A 4USFA 4FZAB 5L8JA 4BDFA 3U51A 4NKSA 2GHGA 4TL0A 3VQHA 3BHTA 1GZ8A 3JYAA 2BPMA 4QNYA 3PLSA 4O6LA 4ASDA 5GNKA 3FZTA 5IMXA 2BZJA 4D4RA 4I4EA 3QC4A 4O6EA 5C8NA 1XH6A 2YIXA 2HZ4A 2DQ7X 5HCZA 1OECA 4NTSA 3V5WA 2C3KA 2PTKA 5GZ8A 4ZTMA 2F9GA 3H9RA 5KHXA 2UZTA 4NT4A 4IX3A 3QD0A 4DBNA 3MB7A 3DDQA 4DEEA 2Y9QA 5KKRC 3IDCA 4XX9A 4JRNA 5CEIA 5HNBA 3WF5A 4ANSA 4DT8A 4QMWA 3Q4CA 4QTBA 4ZSGA 2X7GA 3F5GA 2BRMA 2C0OA 2IZUA 2V7AA 4FNWA 5ANDA 4GRBA 1BI8A 1ZRZA 4I22A 1G8AA 4QYGA 3EFLA 2C0TA 4YMJA 5CAPA 2X39A 4ZTQA 4K1BA 4N4SA 5CAOA 4B4LA 4WA9A 4WNPA 4G5JA 3MFUA 4EK4A 5HQ0A 4M0YA 2CSNA 2YZLA 4FV8A 5JRSA 3RI1A 5CXZA 2HZIA 2C47A 4NCTC 1OVEA 5EG3A 1JAMA 3V8SA 4BIDA 3D83A 1ZZLA 4V0GA 5EW9A 5DE2A 4I5HA 4EQMA 1O6YA 3E7VA 3OC1A 4GCJA 2KTYA 4O96A 3MY5A 3PXQA 1NT2A 2QONA 2X1NA 2X9EA 5K0KA 1TQMA 5CT0A 4O0TA 2VGPA 2WB8A 2CN5A 3NS9A 2CGUA 4C3PA 1L8TA 3COIA 2OJGA 3TNHA 4CEGA 2OKRA 4CMTA 2OH0E 4E6AA 3EL7A 2Q83A 3BGZA 4G16A 4IJPA 4RFMA 5AA8A 1Y6AA 4ITJA 3RPYA 1M2PA 2J5FA 4W8DA 2X2LA 1YXVA 4RC2A 4XLIA 2QQ7A 5TF9A 4CLIA 1V0PA 4F0IA 2ITUA 4ZY6A 4AG8A 2J0MB 1FGIA 3VF9A 4EH4A 1QCFA 2WPAA 2ERZE 4F7LA 4AGWA 5J1VA 5E1SA 2UZWE 2XYNA 3DKOA 4UMTA 4DG2E 5HVKA 2B53A 4NU1A 2YDJA 3QX2A 5AX9A 3Q6WA 3PJ8A 2HK5A 4FVQA 3GOKA 4S34A 1MP8A 2YCSA 1XH9A 2VTSA 3BRBA 4KSPA 4EOMA 5LVOA 4DN5A 3I7BA 4G1WA 1ZZ2A 4D9TA 5J9ZA 3GI3A 5EM7A 3TUCA 1M14A 3Q4ZA 3MTLA 3SRVA 3TTJA 4DEHA 5IH5A 2PYWA 3UJGA 1OMWA 3CQEA 3RCDA 5KMLA 3PJCA 3ZUVA 3OZ6A 2J0IA 1Y8YA 3BEAA 4E8AA 3R8PA 5JFVA 4WBOA 2X7FA 2V55A 4RLKA 4YJUA 4NW5A 1JBPE 2R0UA 3GU4A 4LOOA 4J52A 5H8GA 3MS9A 4CV9A 4DH7A 1XBAA 2UZDA 3A99A 4NZWB 4EH8A 3P08A 4FKQA 4W4YA 1O9UA 3VQUA 1WMKA 3NIEA 4L42A 5HD7A 5CAVA 2FSOX 3CCNA 3VBWA 5LOHA 4ITIA 4PL3A 5DN3A 4USDA 3F3TA 2ZMCA 4XOZA 4FKRA 5HG9A 3LHJA 4ZMEA 1FPUA 3LFDA 3OTUA 5CF5A 4F7SA 4U41A 3FLWA 3ZFMA 3BLQA 1DAYA 4QP9A 4GT4A 3LQ5A 4ZP5A 2V7OA 3KRRA 3D5VA 5HKMA 4X2FA 3H3CA 2JBOA 3F5UA 4C4GA 2PUUA 3NUXA 4I21A 3ZU7A 4PMTA 3CY2A 4MX9A 3CPCA 2CCIA 2NPQA 2YFXA 3FMEA 4WSQA 4CTCA 4DITA 4M69A 5C9CA 3HL7A 1Q8UA 4DGMA 4A9SA 2R2PA 4TNDA 5GJFA 4E93A 4G2FA 3DJ5A 4RVKA 3RZBA 3C13A 3DNEA 3Q4UA 4X3FA 3QRIA 4AFEA 2XIRA 3DXPA 5HI2A 3S4QA 4GUEA 1Y57A 5AR2A 2XK4A 5IA4A 5JZNA 3UNZA 4N57A 4DH8A 3I5NA 3FEGA 1KE8A 2NRYA 3OY1A 3FQEA 3A7HA 3ETAA 3QL8A 3I6WA 4ZTHA 5HG8A 4AZVA 2UW9A 3R7GA 4C2VA 4ACDA 3LE6A 3CTQA 3DS6A 4I24A 4C37A 3UNJA 4OTHA 4IAIA 3WIGA 3PIXA 4GT5A 2IVUA 4L7SA 4AP7A 4O7TA 2V62A 1H1RA 1NVQA 5FTGA 3KN6A 3V5JA 4C35A 3QC9A 5L6OA 3FKNA 4W4XA 3K5VA 1CM8A 4QQJA 3T3UA 5HE0A 1SZMA 4RZVA 3WZEA 5C4LA 1F3MC 4EH2A 2O5KA 4CYJA 4IACA 3R9OA 3FZ1A 4BHZA 2G15A 4C7TA 1OB3A 4TWOA 2JFLA 2XA4A 4TPTA 4WT6A 5ANEA 3SHEA 3MH3A 4BB4A 3H0ZA 1OKZA 2A27A 1Q97A 5HIEA 3C5IA 5E4HA 2WMTA 1JKKA 5JGAA 3HKOA 4IAZA 3E8DA 4FZ7A 3NUNA 3Q9ZA 4FNXA 2WTKC 4UMQA 3U55A 3KXZA 2XKDA 2CJMA 3NYNA 1ND4A 2PVYA 1FMKA 2R3OA 4GSBA 4UMRA 3D9VA 1YKRA 3QD2B 4X0MA 2A2AA 2JFMA 5CANA 1RJBA 4KRCA 5LCKA 4QTDA 2OZAA 3P5KA 2JDTA 4M8TA 4D1XA 3PVBA 1Q24A 1Y91A 4G34A 5DLSA 3TWJA 3JUHA 4BRXA 1UWJA 4FK3A 4KBAA 2JDVA 4NW6A 4E6CA 4LM5A 2HW6A 5HE3A 4D55A 3R04A 3GT8A 2VGOA 4FICA 5EM5A 2XNBA 4MVFA 4YJSA 2QU5A 2VWVA 2VWXA 3POOA 5E8UA 3UOHA 3ULZA 4DEGA 3UPXA 5DWRA 1WVYA 3R02A 2XJ0A 4TYJA 4E4XA 4CLJA 3OCBA 3MVHA 5DT3A 1ZOEA 3MVMA 5FEQA 3DV3A 4A07A 4DGLC 3VBTA 4BBMA 4IX4A 4ZJIA 3L9PA 4V05A 2I0VA 3SD0A 4BI2A 5K4IA 4YZDA 3VBQA 4D2RA 4JDHA 1OITA 4O0RA 3BBTB 4X3JA 4BTMA 1Q62A 5JGDA 5HEZA 2IW6A 4KSQA 4BTFA 4K33A 4QQ5A 1CMKE 2VTIA 4JJRA 4MWIA 4WHZA 2UVZA 1R0EA 3EN7A 4D28A 3JR1A 4OT6A 5IQGA 3HRCA 2WEVA 3FMDA 4EC9A 4YR8A 1M52A 2JKQA 4HGLA 3BYOA 4RFZA 4CRLA 3KF4A 5TOZA 2PUIA 4R78A 3Q52A 3QQJA 4Q9SA 3KCKA 4DGOA 2X6DA 3NMUF 3HMMA 4ALWA 2CGXA 2ZM1A 4F63A 5LMKC 1XH7A 1RQQA 3O2MA 1W7HA 3L8XA 1Y6BA 4X6QC 5AIKA 3ZLYA 4UMPA 4YJTA 4I4FA 4V0GB 3RMFA 1VZOA 3VJOA 3PJ3A 5E92A 2X8IA 3R71A 3PDTA 4DT9A 2GS2A 4WRSA 5CI6A 3TKUA 5CX9A 4XG9A 3PZHA 4PMPA 5FXRA 2JGZA 4DAWA 4ZAUA 1MQBA 4ZSAA 3PXKA 1KOBA 3AGLA 4B6LA 3UBDA 3DZQA 3ZO3A 2HW7A 2VD5A 4ENYA 5I9WA 3SG8A 1H07A 4JQ7A 3C4CA 4CFFA 3LMHA 2E9NA 4O83A 2B9HA 1XQZA 3DDPA 5TE0A 2QOBA 3A8XA 3HAVA 4QOXA 2VTLA 3KMUA 3MA6A 4JLCA 3U4UA 4U45A 5EI6A 2IPXA 4BCFA 4FT3A 5HTIA 5KBQA 3ZEWA 5KBRA 3FJQE 4JNWA 3OCTA 4AXAA 4KB8A 2CLXA 5EYDA 4D2PA 3DY7A 3S3IA 4ALUA 4QTEA 5ICPA 2OJFE 4L3PA 4WNKA 3RNYA 5CEOA 4PTCA 3ORZA 3OUNB 1ZYCA 4BCMA 5KUPA 3UODA 2W1EA 3MPTA 2OIBA 2YIYA 4L00A 3WIKA 3R01A 4FEWA 3E87A 1RDQE 3PY3A 5D10A 4FF8A 1UV5A 4AW1A 3R9NA 3UQCA 2UW0A 5T68A 2YERA 5HBHA 4WUAA 3RM7A 2C5OA 2BROA 3ZMMA 1VYZA 2ITTA 4YTHA 4LI5A 4FTMA 2ZAZA 2WMVA 4RX9A 3FMKA 1K2PA 2BUJA 3BWFA 3LZBA 3UIMA 4FKWA 3QGYA 2VWYA 3DQXA 1EH4A 4QMZA 4WRGA 3TKHA 3EZVA 5JQ5A 4AZWA 4YC8A 5AADA 5J1WA 2XF0A 2I1MA 4EHZA 3CC6A 3KREA 5IQBA 2AUHA 4TYGA 4RJ8A 4RPVA 5L2SA 3CTJA 4R7IA 2O64A 4OTQA 3N9XA 4XBUA 4FGRA 4R7HA 2DUVA 3TUDA 2QOFA 1FINA 5FBOA 4U5JA 3H4JA 3G2FA 3GU7A 4HCVA 5M4IA 3BU6A 3JS2A 1ZXEA 3QLGA 3ROCA 3QRJA 3RWPA 5EHLA 3EFJA 4QNAA 3IW4A 3IONA 1YXXA 3KGAA 5CALA 1H00A 1W84A 3HX4A 4D5HA 3HDMA 2GNGA 5EOLA 1JWHA 4I3ZA 3EFKA 3SG9A 4IWQA 1OL6A 3A2CA 4FT0A 4ERWA 4A7CA 4CMUA 5DFPA 4E6DA 5LARA 4N0SA 4FT7A 4Y83A 3MYGA 4F64A 2GQSA 5A9UA 4G3DA 2VX0A 3KRXA 4LMUA 4TT7A 3ZRLA 1IEPA 2KULA 3UZTA 2I0HA 2XM9A 4L46A 4NKAA 3SXRA 3FPMA 3QZGA 4YC6A 2Y4IB 1YI4A 1KE6A 4UYAA 4X3FB 4FTIA 1H26A 2VRXA 3LVPA 4R3RA 4XV1A 4C4FA 3LCTA 3FLQA 3BYSA 4N6ZA 2UW6A 4J53A 5EDPA 5IEVA 3DK3A 5L2TA 5J5SA 3ZO1A 3EQFA 1JKTA 5L6WL 5K3YA 2BILB 4FSNA 4ACMA 4DG3E 4F08A 3I5ZA 4IE9A 1YOLA 3KCFA 5LXMA 2XJ1A 3AC2A 2R3NA 5HLWA 4CKJA 2C0IA 3GNIB 4PDPA 4OTFA 3FUPA 1XJDA 5TO8A 3OHTA 4IXPA 5HG5A 3S00A 3VRYA 4QMOA 3UYTA 2EXEA 5LWMA 4R5YA 2YLFA 4PL5A 3ZSGA 5HBEA 3I6UA 3BKBA 5HIDA 5HICA 3KN5A 1OKVA 5JFWA 4RWKA 2UVYA 4U81A 5C03A 5TT7A 4CGAA 2PZYA 3KRLA 2QR8A 2QOIA 4OTRA 4IHPA 3NUAA 2XM8A 4PNIA 2QI8A 1L3RE 3F2AA 4YSMA 2PMIA 3QZFA 2YHVA 4FSMA 5AFVA 5CY3A 5DT0A 5K9IA 2CMWA 3QBNA 3I1AA 4H58A 3R9DA 3C5UA 5I9VA 3W18A 4BCOA 4CQGA 5CQWA 3PPJA 2CKOA 4TWCA 4AN3A 2X9FA 3E3PA 3GEQA 3OTVA 3PVGA 3R21A 4LYNA 4MXAA 4NJDA 4IQ6A 3EQPA 5HIBA 3WI6A 3WYYA 3U87A 4AE6A 4EC8A 5A4TA 4JG6A 4N6YA 3P0MA 5AV0A 3ZBXA 4KAOA 2QG5A 4UX9A 4CG8A 2WQOA 3DBQA 3NLBA 5F1ZA 3EWHA 3F3VA 3S95A 3SAYA 2UW4A 4QQCA 3FMLA 4FTKA 4CCBA 2BHEA 2VNWA 3FL5A 1VYWA 3RK7A 3QTRA 4J95A 3GP0A 4ANQA 2B4SB 3L8PA 2ZMDA 3EQBA 3TL8A 2OZAB 2ITWA 4E5WA 4LL5A 3BU3A 4FEQA 3MGYA 3GCUA 4WO5A 3UZPA 4K18A 4W4VA 4QO9A 1J7LA 2AC5A 3LKMA 4QMQA 3G9NA 2Z8CA 5J79A 2IVSA 3ITZA 4UB7A 2EXMA 4FKTA 4OR5A 4QYHA 4C4JA 5FQDC 2HY0A 2XUUA 1PXKA 2IZRA 3TI1A 1FVRA 4USEA 4NTTA 2R5TA 4XP3A 4J1RA 4L3JA 2WMRA 2PE0A 5C1QB 3BYUA 4AF3A 3FDNA 3DK6A 2C1AA 2YDIA 1PMVA 5CAQA 3OCSA 3P4KA 2WIHA 3Q9YA 4TW9A 3OG7A 3FYJX 2VU3A 4EK8A 2QG7A 1VEBA 5LVMA 4JAJA 3DAJA 4XJ0A 1NY3A 3WF7A 5DMZA 4DEDA 2X8DA 4TN6A 3CKXA 5CASA 3VHEA 2HZ0A 1ZMVA 4JDJA 3RGFA 4G3GA 1A06A 4M0ZA 5EI8A 3RP9A 4AOTA 5EI2A 1WBOA 3DBFA 4G6OA 1Q8YA 5D12A 3PRIA 3HAMA 3V8TA 4QMMA 4GFOA 3FSKA 4IZAA 4YO4A 4XLVA 3V6RA 3OWLA 2ONLA 5CAUA 5DI1A 2IZSA 3MFSA 3PTGA 4FL1A 3VO3A 4BDAA 5K0XA 4F9WA 1OI9A 3V3VA 4M7IA 5A4CA 4X2GA 5LJJA 3VW8A 2JDRA 3FI3A 4PQNA 5CVHA 3ZLWA 2PVFA 1GZNA 3ID6C 2SRCA 3COMA 4DINA 3C9WA 5T3QA 2GNLA 4MKCA 3ZUTA 3FI4A 5C8KA 4QPSA 4MAOA 3VWAA 1J7UA 2OFVA 5AA9A 2YAAA 2R3PA 4IEBA 1QMZA 4FIJA 1OM1A 4XP0A 3IW5A 1OBGA 2UW5A 4M68A 1G5SA 2PPQA 5HO8A 4HVSA 5H9BA 3BE2A 2WMUA 3DKCA 3NX8A 4HCTA 4L52A 4A9YA 3IW8A 3QQFA 4ID7A 4QRCA 3IQ7A 4YURA 4U80A 4FC0A 4CV8A 5FLFA 5HZNA 1NA7A 3PXZA 4EOKA 2X8EA 5GHVA 3U9NA 4GT3A 4BBEA 4DH1A 1O6LA 4Z3VA 1H4LA 2YIQA 3FMNA 3Q5IA 3RWQA 3DBDA 2WU6A 3Q4TA 4BFMA 4EQCA 5KMMA 4EZ5A 2PHKA 3BLRA 4O38A 3QXOA 4J8MA 3OS3A 5KMNA 5EHOA 5CEMA 5H2UA 5AR7A 3RAWA 1Q8ZA 3IW7A 4HGTA 5CNNA 3QCQA 1B6CB 4ANNA 5CU3A 5AR3A 4S30A 4EK3A 3LFFA 1G8SA 2W1FA 3Q53A 1NXKA 3AOXA 5E8YA 5DA3A 1YVJA 4FIIA 4M84A 5HORA 3VUGA 5IH6A 3Q5ZA 2WHBA 4MWHA 2XNMA 4ZZOA 4BYJA 3VS2A 2C6IA 2XKCA 3R63A 5IPJA 1ZYSA 2I0YA 2YM3A 4R77A 3C4EA 2YA9A 2AC3A 5BVNA 3QD3A 4L3LA 1OUYA 3FWQA 5HG7A 1SNUA 1MRYA 4NCTA 2Z60A 3QFVA 4UZHA 2P0CA 4BDDA 3KULA 1JLUE 2C6LA 2VO3A 2VTTA 4G6NA 4MK0A 2PSQA 2CKEA 4ZTSA 4BC6A 4JBVA 4YZ9A 4BGHA 3C1XA 4RA5A 5AV3A 3PG1A 4P90A 4G3CA 4X6RA 1W98A 3AG9A 3QU0A 3LFCA 3PVUA 3D2IA 3ZFYA 5AP4A 2F57A 2XJ2A 1SNXA 3LJ0A 4KBKA 2FUMA 4NUSA 2W5BA 4FZFB 4LOPA 4RIWA 2CKPA 4BYIA 4BZOA 4BICA 2YWVA 4Y73A 3G51A 4ACCA 5G1XA 2IG7A 4Q5EA 4P2KA 1FQ1B 4O7WA 5AR4A 2C6TA 3BE9A 3QQLA 3U8WA 3VUIA 2C68A 1JVPP 1PJKA 4O86A 2BALA 4G17A 3GCVA 3IG7A 2ITZA 3D14A 4P5QA 1ZY4A 2ZB1A 3BX5A 3KY2A 3PJ1A 5C8MA 5JZJA 1HCKA 3HV6A 4KIOA 4A4LA 4ZEGA 3DJ6A 4AOJA 2R3HA 5BVFA 5JT2A 3F82A 1H1SA 5BVDA 5C4KA 4AUAA 4AX8A 4YSJA 5IA5A 2JITA 4E26A 4EWQA 5GIOE 2PY3A 1KV1A 3QD4A 2V0DA 3NRMA 4AACA 5I0BA 3G90X 5K5NA 4H05A 1CDKA 2CHLA 3A4OX 4ITHA 4XP2A 2VTQA 1IA8A 4F9BA 2EU9A 1ZOGA 3QA8A 2OZOA 3ZXZA 5A3XA 1Y8GA 4LGDA 2YCFA 1XBBA 4FODA 3UP7A 4ZMFA 4YPDA 2YAKA 3G9LX 4KS8A 4PL4A 4PX6A 5CYIA 4BDCA 5DOSA 1R39A 4BDBA 4D4YA 3RHKA 5M08A 2F7ZE 4EOLA 4OGRA 4IDVA 3H30A 5M57A 3NAYA 5H8EA 4DLJA 2BRNA 3R7IA 3NVMB 5F9EA 3TXOA 5ETCA 2WXVA 2VO7A 5CXHA 2QD9A 2ITVA 4F09A 2YZAA 3FYKX 3VN9A 2GMXA 4KS7A 4OBPA 5FM3A 5FP5A 4FKUA 3HV3A 1YDTE 5AM6A 3FZSA 3PRFA 4TXCA 4I0SA 5AUXA 2I6LA 4U97A 4ALVA 2WTWA 4OTPA 3C0IA 3CQUA 3DGKA 4E73A 4FA2A 4DF3A 5CEQA 5AUZA 3EQHA 4WG4A 4AZEA 4XV9A 4J71A 4WOVA 3G6HA 3ORKA 3AXWA 4XG7A 3E88A 4ZTRA 4LGHA 5CU0A 3GFWA 1W8CA 4XRLA 4CQEA 1K3AA 2IJMA 5I4NA 3FPQA 5IUGA 1V0OA 2ACXA 3ZDUA 1SVGA 4AZFA 5HNIX 3EOCA 2GS7A 3UIXA 1BL7A 1PXPA 5D7AA 1O6KA 4ZZNA 3QXPA 3O96A 4FUXA 4OT5A 4QMSA 4U8ZA 3U9CA 4AE9A 3FXWA 4A9TA 2I7QA 3S2PA 4FEUA 5AV1A 4JBOA 4FE2A 4IWOA 1KV2A 2GDOA 1OZ1A 4QP1A 2C6MA 2OXYA 3C50A 3JY0A 3UQFA 2E9PA 4ANBA 5J5TA 3TJDA 3UTOA 3C4ZA 4ARKA 2PL0A 1Q3WA 4RJ7A 2JD5A 5K5XA 3HNGA 4H3BA 3EN4A 4UWCA 4YJVA 4FYNA 4DFYA 4E7WA 4U44A 1XH4A 3QRKA 5DG5A 3BV2A 5AV2A 1NVRA 2ITXA 4OTGA 1LR4A 4FL2A 4PDOA 5D41A 4BDHA 4O7NA 4Y95A 2LAVA 2WMWA 5TKDA 3BEGA 3UC4A 4FMQA 3EKKA 3K3JA 4YBKA 4HVDA 5IEXA 5J9YA 3HYHA 3C4FA 3VC4A 1OGUA 2B9IA 1DAWA 4NH1A 4DHFA 2QKWB 3RALA 1E1VA 1IAHA 2FO0A 1OUKA 4D4SA 3ORMA 4HYUA 5HLPA 4B9DA 4YJPA 1UNLA 4YJQA 3W16A 3M1SA 4OBOA 2X7OA 3II5A 3KMMA 4JDKA 5IQCA 2A19B 2X81A 2XK7A 4J97A 3HMIA 3P9JA 4ZTLA 2BAQA 4DBXA 5DNRA 4EORA 3DJ7A 3LIJA 4IM0A 4UY9A 3WE4A 4D2SA 4F9CA 1S9JA 4UZDA 3Q04A 5L2WA 2VWIA 1FOTA 3KVWA 2BDJA 2IVVA 4MEDA 4PMMA 4FV3A 1P4FA 4C0TA 3S1HA 3EQCA 5IQFA 4JG8A 5DVRA 2BMCA 5HVJA 3RZFA 5IEYA 5HX6A 5GJDA 4W9XA 4BVUA 3SDJA 5LMBA 3QKMA 4I6HA 3ANQA 5M09A 4M66A 5FD2A 2ZJWA 2XBJA 3UE4A 2JIVA 1XO2B 1YWRA 2XEYA 3GC9A 2XCHA 3I0OA 5ANGA 5HX8A 3EZRA 4EKKA 3UOLA 2JKOA 3PWYA 2R3RA 1IRKA 2YJSA 4I5MA 4BWPA 3HUBA 3PZEA 3ATTA 5M4FA 2WTIA 4HZRA 4F4PA 5HO7A 4ANOA 5AP6A 3R7OA 2NO3A 2VWZA 1WAKA 3R2BA 3VHKA 4BZNA 5CEPA 5CU4A 3VS3A 2YACA 3MY0A 1TQPA 4G9RA 5HE1A 2BR1A 4CKRA 2IN6A 4O81A 2G2FA 4Y72A 3OP5A 2PE1A 1UNGA 2PUPA 2BRBA 3ENHA 5KKRB 2GTMA 2R9SA 3CD8A 2VTNA 3QQUA 3R22A 1UVRA 5CSVA 4EUTA 4U6RA 4XYFA 2YLEA 2BCJA 4FG8A 4GJ3A 1IG1A 5M07A 1JSUA 4IADA 2OIQA 3ODYX 3AD6A 4FZDB 1WBSA 4QMLA 4BKJA 5CNOA 2FSMX 3L9LA 5IA2A 4Q9ZA 1R1WA 3TV7A 2HY81 3DT1A 1JPAA 5L6PA 5B2KA 3H0YA 4ZSJA 5LMKA 4RMZA 3MIAA 4OAVB 3OVVA 4XG6A 4WBBB 4GK2A 3MTFA 2O2UA 3BGPA 3KULB 2C6EA 4L68A 3MJ1A 2DYLA 4FI1A 4CCUA 2WMSA 3CGFA 3TKIA 4BZDA 4O27B 4YO6A 2GU8A 2ETMA 2IWIA 5I3OA 1BKXA 4YNEA 4EHVA 4RJ6A 5L4QA 3BHYA 3WARA 2YITA 4MXZA 1MRVA 3NNWA 4IAYA 4PF4A 3UP2A 2GNJA 4AA4A 1BI7A 2YCRA 4K0YA 4RIWB 2P2IA 3H9FA 3FKLA 4YZCA 5FEDA 2WOUA 5J87A 1HCLA 2GSFA 3O17A 1M2QA 2R3QA 5EDQA 1JKLA 3DKGA 3LJ2A 3JPVA 4OUCA 3EN5A 4AGDA 3NW5A 2GFSA 3UIUA 3ZONA 1WBTA 2Y6OA 4H3QA 3PLAE 4FV6A 4WG5A 2C6OA 3T9IA 3OXTA 4ZS4A 3E93A 2DS1A 2HAKA 3FLSA 1OKWA 5F94A 4DTBA 3L8VA 4K6ZA 4FKPA 2XNGA 3R1YA 2V5QA 4FGBA 3D7TA 2ZB0A 3DAKA 4FSUA 2YM8A 4PTEA 4AZSA 3KEXA 4BDEA 5IUHA 5FRIA 2QHNA 4NIFA 5AAFA 3LW0A 4M97A 5BYLA 1H1PA 1H25A 1Q99A 3W32A 4RX5A 3UGCA 4YLLA 4CXAA 1E9HA 3LXPA 2WNTA 3AC5A 3REPA 3RK9A 4EHEA 4XV3A 4ERKA 3WILA 3C7QA 5IQHA 2BAKA 4GEOA 2XBAA 2WTVA 5AUTA 2H6DA 4I1ZA 4NL0A 4DE4A 5IUIA 3NAXA 4A4OA 5BNJA 3ROYA 4Z7HA 5B0XA 2WOTA 2ITYA 3MV5A 5LQFA 3EL8A 2YIRA 2W1IA 4IX5A 4U7ZA 4BTKA 5BUIA 4EZ7A 3GC7A 4G31A 4FG7A 4LG4A 2A4LA 4KKEA 2OI4X 5CZIA 4FT5A 3OT8A 3QTZA 3ZDIA 4EK5A 2OK1A 3P1AA 4I93A 3QALE 2QO2A 4IWPA 3UG1A 3SVVA 3TJCA 1K9AA 1U59A 1VR2A 3VUKA 4D2WA 3CIKA 4MH7A 3TEIA 3B8QA 3OFMA 4MF1A 2RF9A 2WQMA 3ZXTA 5JRQA 4FVRA 3UZRA 4UXQA 2BDWA 4QMYA 2W0JA 4F1MA 3I4BA 3UO6A 3G33A 4WG3A 4EZ3A 4RWLA 3O51A 4NM0A 3UMWA 3LFEA 4G3FA 1J7IA 4E3CA 2W1ZA 5HTCA 3OWJA 3L9NA 4DEBA 4EWHA 1BLXA 3PVWA 2QVSE 4KNBA 3CE3A 1GNGA 3ZSHA 2B52A 4FKOA 2OO8X 2OSCA 3OWKA 2IVTA 4BDGA 1QPDA 3CGOA 4C36A 4L45A 4F99A 2QR7A 4IM3A 2JDOA 4QT1A 5A14A 4O82A 3A8WA 2JAVA 3KMWA 1GJOA 3FXZA 2PVNA 5EYMA 4NM7A 3FE3A 3FMJA 4R8QA 4FNZA 3W55A 4BCKA 1OPJA 2W06A 3CEKA 1TQIA 4DA5A 3TZMA 3LXKA 2R64A 3QHWA 3LPBA 5FTOA 3R9HA 4D1ZA 3W33A 2X2KA 3COHA 3BI6A 2WZJA 3DCVA 3GQIA 3NNXA 3P23A 3SRVB 3NWWA 5BUJA 4EEVA 2YM6A 4JIAA 2YJRA 2BHHA 4YZBA 1PXNA 5EW8A 4QPAA 5KZ0A 2XNEA 3SC1A 5JMSA 4CZTA 5AJQA 2RKUA 2RFSA 4XCUA 4DEAA 3EYGA 2EVAA 1YWVA 3CBLA 1AGWA 1ZYDA 2RIOA 3HUCA 3R83A 5I3RA 4JQEA 4AW2A 2UZLA 1PXOA 3A7JA 2J0LA 5DYJA 5AAGA 4MNFA 2UUEA 3OROA 4ANLA 3TN8A 3IDPA 4O1OA 3E7OA 1LPUA 5BVKA 3RAKA 4C4HA 1FVVA 1BL6A 5KMKA 2ITPA 4YNOA 3TDVA 1PXJA 4L53A 3TT0A 4E20A 5HTBA 2WMBA 3ACJA 4BI1A 4EQUA 2FYSA 2ETKA 3OWPA 5AUVA 1URCA 3Q9XA 3TZ9A 4FV0A 2Z7SA 1F0QA 2C4GA 3FI8A 1PKDA 1JSVA 4IBMA 4F7NA 4I94A 3QAME 4AW5A 2WTKB 3P79A 4XS2A 4DCEA 4O1PA 2VTOA 3RJCA 3LM0A 2PE2A 2BZKB 4IAFA 3FC1X 4D58A 4CT1A 4D4VA 2OU7A 4UN0C 1QPCA 3K5UA 4K2RA 4ZJVA 5BYYA 4M69B 4U3YA 2HWPA 3RPSA 3F88A 2CNVA 4EOIA 4AFJA 3ZUUA 5F20A 3MH2A 4IFCA 1PY5A 2W99B 3ZO4A 1KUTA 2NNWB 4D2VA 2VZ6A 3MJ2A 4LOQA 4RQKA 4O0XA 4MBLA 4NM3A 5HU9A 3NCZA 4V01A 4F70A 5HNGA 2WMAA 3EFWA 2GNFA 4HPTE 5E8WA 4I5CA 4Z9LA 3A62A 3ZH8A 4Q2AA 2PVKA 5FWKK 5CS6A 1B39A 4ZS0A 1LP4A 2R3LA 2CGWA 4KIKA 3CS9A 3HA8A 5E8TA 3TZ7A 2BRGA 4JX3A 5IISA 5DRBA 4EH9A 3MA3A 3QYZA 3E5AA 2PVRA 4F1OA 2C3JA 2GFCA 1APME 5EFQA 2ITQA 2WELA 3Q9WA 4YJOA 1XH8A 4FTJA 3SOAA 4QYEA 4Y8DA 5BYZA 4LUDA 3UG2A 3UQGA 3MN3A 2Y4PA 3VUMA 4OLIA 4EJNA 1XHAA 3NR9A 4ONAA 5KZIA 3CKWA 3GU5A 3O0GA 3THBA 5E9EA 2WQBA 5AP1A 5ETFA 4O7SA 3EHAA 4Y5QA 4FIGA 4DTKA 1WVXA 2WTCA 4AA0A 2C5NA 4LGGA 4GG5A 2ITNA 2ESMA 4FR4A 3QZIA 4LL0A 3E8EA 3G5DA 4PDYA 4XV2A 4ZY4A 2CKQA 2RFNA 4HNIA 3ORTA 1J91A 2QC6A 4QP7A 3SKCA 4GYGA 4BL1A 4CSVA 2C69A 3OY3A 3VS7A 3FQHA 4HCUA 4IB5A 4J8NA 4FTQA 2C5YA 1H08A 3HECA 4N70A 4EJ7A 3ZFXA 3PPZA 4ZSLA 1OL7A 4C34A 3OUKA 4I0RA 4HVGA 4EOSA 3O8UA 4EONA 4KKGA 3LAUA 2UW7A 3MSSA 3NPCA 3TACA 3UC3A 3W2OA 4FSWA 5M53A 3RM6A 3OBGA 5E1EA 3G6GA 4KABA 5AUYA 4D2TA 5DR2A 4TWPA 3DQWA 1KE9A 2UW3A 3MVLA 2JAMA 4H1MA 4IB1A 3N4TA 4UBAA 1OL5A 4FYOA 3V6SA 4FTCA 4I41A
chains in the Genus database with same CATH superfamily
3FY2A 1OIUA 3UVRA 2CNQA 3C4WA 3LMGA 3CSVA 3R8UA 2X6EA 4QDVA 2WEIA 4A06A 3BQCA 3BWJA 2Y7JA 2VO6A 4I23A 1YWNA 3WZJA 1OL2A 3QTXA 5EKNA 4TNBA 3CTHA 5B2LA 3A4PA 1UU8A 3U4WA 5EQEA 3FKOA 3A7FA 4C57A 4GKHA 4KUJA 2G9XA 2R3FA 3H9OA 4WD5A 1VJYA 3IKAA 3RPOA 4ASZA 4F6WA 2QU6A 4CD0A 3D7TB 2XP2A 3QUDA 3EYHA 2PVMA 4GV1A 5TR6A 3VJNA 3UOJA 2F7XE 1XMMA 2P3GX 3PY0A 4NIFB 4IAKA 3HLLA 4II5A 2XALA 2UV2A 4GMYA 1CSNA 3LFBA 4X2KA 2XAMA 2YWPA 3R00A 2W5AA 2BFYA 2O8YA 1LEZA 1SM2A 2Y6MA 2W9FB 5E8SA 4F6SA 4DYMA 4FIFA 4HZSA 1ZMWA 4IB3A 3V8WA 3RBWA 4IB0A 5ACBC 5GZ9A 2JEDA 2Z7QA 4BKZA 3L9MA 4TWNA 4AXFA 3I60A 2W1CA 5IU2A 1XWSA 2XYUA 2BKKA 3HP5A 4XG4A 4L43A 3VBYA 5JGBA 3VRZA 3ZHPC 3GCPA 3SLSA 5BMMA 4C3RA 3RTPA 3LCKA 5KHWA 4L01A 3SQQA 5BVWA 3O8PA 3SV0A 3W0QA 5IG1A 2P55A 3FZOA 5AP2A 2HYYA 3SOCA 5CEKA 2XNNA 1WFCA 2ZOQA 4F0FA 1PMUA 2PVLA 3ZYAA 1BMKA 3KXMA 3QKKA 3HZTA 1KE7A 4FSQA 3ZLXA 4X21A 4BCQA 4EYMA 3SXSA 3FQSA 3UDZA 4FTAA 4R6VA 4CZYB 2BFXA 3BU5A 2BZHB 5LWNA 4RSSA 5IH4A 4FV9A 3RINA 5FXSA 3QQHA 2PMOX 3CR0A 2PU8A 4M15A 2W4OA 3OT3A 4ZLZA 3SW7A 2X0OA 4BI0A 5EKOA 2VWBA 3OOGA 3NUUA 5DR9A 4BTJA 4HGSA 3NYVA 3UNKA 4CFVA 1E1XA 4CFUA 2GQRA 4CZUA 3HMPA 1H28A 4BCGA 4GIHA 2J9MA 2XK8A 4O22A 4ZSEA 3WZDA 1GIHA 2J50A 4RBLA 5IA0A 3N4UA 5JN2A 1AD5A 3KRJA 5L8KA 3LQ3A 3U54A 3RPRA 4C2WA 3LFNA 1V1KA 1ZARA 3ORXA 3VULA 4HVIA 5JH6A 3NIZA 1YI6A 3R1QA 4C4IA 3CXWA 3AC8A 4RJ4A 4RIXA 3L1SA 2WMQA 3QRUA 4APPA 4L6QA 4TTHB 4YUQA 2XIZA 3Q6UA 4IVCA 1ST0A 4NJ3A 4YHTA 3AC1A 2F49A 2YISA 3PE2A 3E3BX 1UWHA 2BIKB 2OH4A 4GW8A 2HOGA 4AN2A 1OGYA 3QUPA 5HBJA 4RFYA 5FTQA 2WD1A 3ATSA 3D5WA 2HENA 4P4CA 3PXRA 4CFMA 2G2HA 4ZLOA 2Z02A 5FGKA 3SW4A 3POZA 1WBVA 5CI7A 4RVLA 2W4KA 5IDNA 3G0FA 5ANIA 2EB3A 3NDMA 2IF8A 3OMVA 2ERKA 3PSCA 4FTUA 3WOWA 4U40A 5AEPA 4DTAA 2RG5A 1J1BA 1ATPE 3QQGA 2RGPA 3KXHA 3VBXA 3ZC6A 2W4JA 4CMOA 4ENXA 3ULIA 4FIHA 4F9YA 1H1QA 4F0GA 3T9TA 3M11A 1ZOHA 4WNOA 3R8VA 4LRMA 4C38A 5AR8A 4YP8A 1GZOA 2W9ZB 3A60A 4UXLA 4IJ9A 3E8CA 5GJGA 4BHNA 4K77A 4BGQA 3R6XA 4RC3A 4C8BA 4GK4A 4EL9A 5HD4A 3VS1A 1W2DA 5E8XA 4HYIA 4FSYA 5L3AA 3LLAA 3MW1A 3IOPA 3O23A 2O63A 4YC3A 3RHXA 3W1FA 4EI4A 3T3VA 3QZHA 3UO5A 2VWWA 2VTRA 3QQKA 4ZXTA 1JKSA 1YDRE 4IVDA 2R3MA 3PUPA 4DFLA 4FK6A 5AR5A 2Y8OA 3W8LA 2UZUE 4WNMA 5EH0A 3UOKA 3GB2A 3VNTA 2W17A 4PP7A 5JQ8A 3WZUA 1IR3A 5DBXA 4FV7A 4XMOA 2ZDTA 3FHRA 1CKIA 1J1CA 1WBNA 3AD4A 2CNUA 3ERKA 4BDKA 1MUOA 1I44A 3ZCLA 3QX4A 3KXGA 4RX7A 3VF8A 1ZAOA 3LOKA 4AU8A 4GK3A 4BGGA 2OXDA 3QRTA 4PMSA 3DFCB 4KKHA 3F9NA 2WQEA 2X0QA 3EQDA 3TTIA 4BCHA 5HHWA 4ACGA 4WSYA 4MTAA 4UYNA 4KIKB 2XKEA 4Z16A 1KSWA 3AT2A 1OKYA 2BAJA 5EQPA 1YXUA 3GC0A 4FKSA 1CTPE 4O0YA 4U0IA 3D5XA 4PUZA 4AS0A 3VBVA 5M56A 5CTPA 1TKIA 4Q5HA 3KU2A 2HXLA 3Q32A 1R3CA 4OTIA 4XG8A 5HE2A 4BWXA 4HVHA 3GGFA 3BL9A 2EWAA 3VS6A 2GHLA 4BKYA 5DT4A 3OEZA 4IVBA 5FDXA 2PK9A 2IO6A 2JDSA 1WVWA 4FG9A 4ZZMA 4DFBA 1UU3A 5DGZA 4U9AA 1YW2A 2PVHA 4C02A 3LM5A 4EBVA 2B0QA 4FZ6A 3ORPA 3W8QA 1MQ4A 4QMUA 2B9JA 3FC2A 3K54A 1W0XC 2RSVA 4W4WA 5EM8A 4J98A 3V51A 4QYFA 4AT4A 3DLSA 3FXXA 4EH3A 1PXLA 4JRVA 3U6JA 3GC8A 3AQVA 3UMXA 4D9UA 3MPMA 4AN9A 2ETRA 2PZPA 4ASXA 3HV4A 4GH2A 1NW1A 3NUSA 3PA4A 2I0EA 1W83A 3TIYA 5A46A 2WIPA 3TV4A 3NVKI 4BDIA 4FBXA 3UVQA 4O91A 3CLYA 2Z7RA 4Y46A 4EH5A 4RVMA 5G6VA 5HGIA 1GIJA 3QUEA 3VUHA 4DHZA 3OBJA 3ZEPA 4AW0A 4C62A 4KINA 2NP8A 2X2MA 3MFRA 3R7YA 3VUTA 2OJJA 3M42A 5L2IA 4ASEA 3R30A 1U54A 3BV3A 1U4DA 2WAJA 3ZLSA 5DH3A 3RAIA 3SX9A 3SGCA 4YHFA 4ZOGA 2F7EE 1Q41A 2R7IA 1P4OA 3AMAA 2OICA 2O0UA 3BELA 4RLLA 5GIPE 4W9WA 1KE5A 4C59A 2J0KA 3DBCA 4KD1A 3A61A 2Y0AA 1YQJA 3O71A 2OXXA 4DGNA 3PPKA 2IZTA 2OF4A 2P2HA 2R3IA 4CFWA 2F2UA 5M55A 3P7BA 3I81A 1PHKA 3LFQA 3OW3A 5FM2A 3RCJA 1G8KA 1AQ1A 4NM5A 4PPBA 4FV2A 3RPVA 4GUBA 4L44A 3TG1A 4R3CA 2XK9A 1H0WA 3DBEA 1H01A 4RT7A 3BYVA 2J51A 2GTNA 2XMYA 2YM5A 4UALA 3KC3A 4NFNA 2FSLX 4AAAA 4F6UA 2HZNA 5IF1A 3TYKA 4E5BA 5I9XA 5BQ0A 2P4IA 5I5ZA 4CG9A 2OGVA 4BIBA 3LFAA 4QP4A 5EM6A 2OJ9A 3UPZA 1WBWA 4LQMA 4C3FA 3BIZA 3FLYA 4KRDA 3GCQA 4AQCA 4I6FA 2QOLA 4FTNA 5KNJA 2W1GA 1FGKA 1Z9XA 5DRDA 4FNYA 3TUBA 1Q3DA 2YN8A 3NGAA 5CSHA 1SYKA 5AIRA 2QNJA 4MQ2A 1IASA 3BYMA 4OBQA 2OW3A 4KA3A 2E9OA 4MYGA 4ZY5A 2QOOA 1PXIA 1I09A 2OG8A 3LJ1A 3VS5A 1DI9A 3P78A 2R7BA 4YLKA 1GY3A 5IMEA 3HMOA 4HYHA 5AP3A 1OIQA 3E8NA 4MUQA 2VTAA 4GJ2A 3VAPA 3P86A 3R28A 2UZNA 4GS6A 5EK7A 2WTDA 3V5QA 3NYOA 3DK7A 3QCYA 3QF9A 3IO7A 4EBWA 4XEYA 4GG7A 3AMBA 2GHMA 5DEYA 1OBDA 3LXLA 4FRFA 1HOWA 3GOPA 4TZRA 4F1TA 3ZM9A 4HJOA 3FI2A 4M3QA 3JXWA 3H10A 2WO6A 4FKLA 4M14A 3HVCA 1YDSE 5JEBA 1PW2A 3AKKA 3AD5A 1OIRA 2XK6A 3R1NA 4MD8E 2PZ5A 3D94A 1Q8WA 2XIKA 3GU8A 3K2LA 4LFIA 1J3HA 3B2TA 3DB6A 1H0VA 5HU3A 3VS0A 1WZYA 3EB0A 4RIXB 4LV8A 3FY0A 4DG0E 4RA4A 4FVPA 4GKIA 3R8LA 4H36A 4YJNA 3D4QA 1A48A 3ZC5A 3FHIA 3W2RA 4A4XA 5AP5A 5IQIA 4NFMA 3O8TA 4MQ1A 4RVTA 3PP0A 4XG2A 4JDIA 5FEEA 3ZO2A 2NRUA 3PG3A 4DCAA 3CJGA 2XCKA 3O7LD 4GIIA 4U3ZA 2ZDUA 1YXSA 2BZIB 4TYIA 5KX8A 2YABA 4EYJA 2JIIA 4FEXA 3NCGA 1TFFA 2QOKA 3W2PA 5AP0A 5ITAA 4PDSA 2XVDA 1ZWSA 4YGAA 1W2CA 4O2ZA 2CPKE 3C0HA 4YZMA 4Z7GA 5D7VA 1QPEA 2C1BA 1IAJA 3KXNA 3ZBFA 1S9IA 4UWBA 2PVJA 4FL3A 2ZV9A 4I6BA 1Z5MA 5A4QA 1DI8A 2REIA 5HCYA 4GU6A 1ZYJA 3QKLA 5JFXA 1SVEA 3F61A 4MNEA 4KIQA 3HRFA 4R1YA 2G1TA 5CQUA 2H34A 4XBRA 2VN9A 1JOWB 2J4ZA 3WF8A 5FXQA 4O7RA 4DH5A 4ZK5A 2UW8A 2C30A 2XRUA 3MDYA 4IDTA 3KRWA 3D7ZA 2EB2A 3B2WA 3OOMA 4UEUA 3RAHA 3JY9A 4O7VA 2E2BA 3PY1A 4HNFA 5EOBA 3WZKA 3AT4A 3IGOA 2YIWA 3IK3A 4IH8A 3ZZWA 4RJ3A 4FKGA 2VAGA 2O65A 3F66A 2LGCA 4QTCA 4V04A 2QOHA 4A9RA 2QODA 3R8MA 5FDPA 4A9UA 4PV0A 1BUHA 3PSDA 4S2ZA 4WUNA 5LMAA 3D15A 1P5EA 4KIPA 2OIDA 4XHKB 1Q4LA 2W1HA 5JSMA 5DEWA 1M17A 5GZAA 2W96B 4MBJA 4F9AA 3LLTA 2QLQA 3C4XA 1PF8A 3QTWA 1OPKA 4QPMA 2VV9A 3VVHA 1SMHA 4O7YA 1OPLA 3BHHA 3FLZA 3Q2MA 1IA9A 1X8BA 2BTRA 3CD3A 4B0GA 3E92A 4FSZA 4MCVA 4RWIA 4O0UA 5J9LA 4CYIA 5A4EA 3T8OA 4KWPA 2BTSA 2Y4IC 3KK8A 4QP6A 4X3FC 2EXCX 4ZIMA 4O7ZA 3DAEA 4ZLYA 1CKJA 4E4NA 1YXTA 2X4FA 3ORLA 4RIYA 4IANA 5IZFA 1W82A 3WBLA 4M12A 5DR6A 5LCJA 1STCE 3HDNA 3MB6A 3P7AA 4YBJA 5DPVA 4RZWA 5HOAA 4FOBA 5M44A 5CVGA 3FSFA 1A9UA 4IMYA 4CT2A 1PRYA 4ZTNA 2W1DA 3R73A 2WTJA 5KE0A 4CNHA 1BX6A 3W0NA 4FSRA 5AAEA 2UZEA 2EUFB 1R0PA 3EMGA 4GFGA 5CVFA 3CPBA 5HESA 3V5TA 3OXZA 2X4ZA 4AZTA 4AWIA 3SXFA 2PMLX 5B2MA 2G01A 3LMIA 2FH9A 2R3GA 4TY1A 3F6XA 5D11A 4QYYA 4I0TA 3TV6A 2FA2A 3ANRA 4QMTA 3IECA 4EOPA 4J99A 4LMNA 5CF6A 2ZV7A 4GVJA 4X7QA 2HCKA 3JVSA 3GUBA 4JI9A 3DA6A 3PP1A 2XK3A 4FTTA 4R7BA 3W2CA 4DH3A 1U54B 3FMMA 2WGJA 3E62A 2JC6A 4K8AA 4HPUE 4JL9A 4G3EA 4FJVA 3W2SA 3HMNA 3GXLA 2I40A 2YM4A 4PNKA 2WMXA 4CKIA 4IC8A 4CRSA 4D0XA 2C5VA 4BCIA 5HLNA 3IPHA 4NK9A 3DOGA 4FX3A 3IW6A 4YHJA 4XUFA 3OXIA 5HO6A 2C6KA 3COKA 3LCOA 2CDZA 5C01A 1U46A 5IQEA 2HWOA 5B7VA 3LXNA 5CU2A 4D0WA 1YOJA 4G6LA 2OBJA 2HELA 4BBFA 4IAAA 1RE8A 1REJA 4QQTA 1Z57A 4MXOA 3ODZX 3LCSA 3DNDA 4XH6A 3UIBA 3BHUA 4QP8A 4ZJJA 4AA5A 1T45A 4MHAA 3I7CA 3IDBA 1PYEA 4GU9A 4P7EA 3D0EA 2IW8A 4F65A 4M13A 5E7RA 3C51A 4PY1A 1YRPA 4B8LA 5KO1A 4O4BB 3R8ZA 4JT3A 2C3LA 4IM2A 2A98A 3WYXA 5A54A 1M7QA 1PMEA 1ZMUA 2GPHA 3BBWA 3KA0A 3LQ8A 3NYXA 4QMXA 5ANJA 5ACKA 3KK9A 2F4JA 3LFSA 4DFUA 1YHVA 2VO0A 2WFYA 4R1VA 1Q8TA 4DHIB 2H96A 3F3ZA 2XRWA 2B54A 4U43A 1R78A 3KKVA 4EHGA 4F7JA 4HGEA 3HA6A 2UZOA 3HP2A 5LVNA 4JS8A 2BKZA 2FSTX 3C0GA 2JKMA 2WQNA 1JSTA 3PIZA 3FL4A 3L8SA 3M2WA 4DFXE 4RC4A 4EK6A 3S0OA 3KXXA 1DM2A 5A4LA 3ALNA 2X0PA 3F3WA 5T6KA 3TCPA 3MH1A 4TYHA 5FUTA 4MXYA 3NNUA 5FP6A 5J7HA 3CQWA 1UU9A 4BJJA 2QLUA 3QYWA 1ZYLA 4DEIA 5BMSA 4FKVA 3E63A 3OW4A 5E8VA 4AGUA 3WF9A 2YDKA 4S33A 3TM0A 1KWPA 1V0BA 4J7BA 3R9RA 5I9YA 4YTCA 4FV1A 4PPCA 1ST4A 3QWKA 4G9CA 2GNIA 2ZV8A 1TVOA 2V22A 4FKIA 4IWDA 4IC7A 4TKSA 4UV0A 5CLPA 4E6QA 3UVPA 4FTRA 3LCDA 4E4MA 4BY9E 1KOAA 3CY3A 4DLIA 1F5QA 3PE1A 1RW8A 3MY1A 2OWBA 2W05A 4FIEA 3ACKA 4OTDA 2B7AA 4RJ5A 3R1SA 2WU7A 4DFNA 3CJFA 2QURA 2PULA 4QMPA 4G5PA 4I5PA 4O0WA 2CN8A 5CU6A 4RGJA 2RL5A 5EYKA 1UNHA 5BUEA 4E1ZA 2Z2WA 4JMQA 3FAAA 1MRUA 1PXMA 4JR3A 4NEUA 3ZRKA 4M67A 2E9VA 4FV4A 2B1PA 1ZLTA 4QMNA 5DHJA 3VW6A 3V5LA 3ZOSA 3EKNA 4IZ7A 3TNPC 2PZIA 4IFGA 4RRVA 1REKA 4PP9A 4TRLA 4U42A 4EOQA 5A6OA 2VWUA 4AT5A 3O50A 4K9YA 3F69A 4YTFA 4S32A 3ALOA 2F2CB 3QCSA 3QA0A 4GFMA 4ANMA 2VX1A 3OEFX 2R3KA 3V01A 2C5XA 2XKFA 2XIXA 4LUEA 1DS5A 2J5EA 4L9IA 2ZM3A 2QOCA 3QTQA 3B8RA 2HIWA 3QWJA 3F2RA 4L7FA 4YTIA 3NSZA 3RK5A 5LVPA 3DTCA 3CP9A 2C6DA 5IKWA 3DU8A 2XIYA 3HV7A 4O21A 3DFAA 5E8ZA 1FMOE 2J0JA 2A0CX 5EDRA 5BPYA 4MF0A 4FOCA 1WBPA 4BF2A 3ENMA 2AQXA 4YLJA 3ZSIA 5AM7A 2YEXA 1UU7A 1ERKA 2ZYBA 5AUUA 2C3IB 3ZTXA 2FVDA 3PSBA 4TYEA 1ZY5A 3AGMA 3DTWA 3I79A 4OTWA 5IA3A 4MNEB 5KCVA 1QL6A 5ANKA 5EQYA 3HRBA 4FTOA 3ZZEA 2XEZA 3BLHA 5ANOA 3HGKA 4I92A 5I9ZA 2VNYA 1BYGA 3FBVA 3NNVA 3VUDA 3MFTA 3QTUA 4YZNA 3R7UA 5M51A 2J7TA 5JFSA 1XKKA 4E5AX 1LEWA 5EYCA 1UKIA 2JBPA 3Q60A 4GL9A 3UYSA 3ZRMA 2ITOA 5CENA 2R0IA 3NEWA 3F5XA 3F3UA 3ET7A 3ORNA 2VTPA 2UZVA 3P7CA 4JG7A 4X2NA 2JKKA 5BVOA 2P33A 3BHVA 5CF8A 4E4LA 2ZM4A 3FZPA 3KQ7A 1YHSA 2QKRA 3OF0A 2PZRA 3NW6A 3NUPA 4O0VA 3HEGA 4RX8A 3OD6X 2G2IA 3V04A 3DZOA 3PYYA 1YHWA 5AP7A 4C33A 3F5PA 5M4CA 4ORKA 4BCNA 4LRJA 4IX6A 4B7TA 1H27A 2FB8A 3QHRA 1FVTA 3MWUA 3OCGA 3R2YA 3UDSA 1PYXA 4JOAA 2QHMA 2VUWA 5E90A 2Z7LA 3E64A 3ZS5A 5JK3A 4IVAA 4HW7A 4CFNA 2OFUA 4ACHA 2J90A 3G15A 4JXFA 1PMNA 2H9VA 5KMJA 3QLFA 3KVXA 4P5ZA 2ZFYA 2XZSA 1URWA 4AGCA 4DFZE 5A6NA 1NVSA 3EH9A 4H3PA 4D1SA 3Q96A 3PJ2A 4DGGA 4FSTA 3QTIA 4RIYB 4JQ8A 5CSPA 3KF7A 1Q5KA 3MI9A 4GYIA 4EH6A 2BVAA 1QPJA 1XR1A 2QCSA 3GFEA 3GQLA 2PWLA 1U5RA 4MD9E 4MD7E 4JR7A 4NSTA 3TNIA 3TNQB 4C58A 3UO4A 1U5QA 3O5AA 5L2QA 4O7LA 1SVHA 4RG0A 3I0QA 4QTAA 5H3QA 1JQHA 4AOIA 5D1JA 3MVJA 4H39A 5IQAA 3DXQA 4PWNA 3AC3A 4RWJA 3SA0A 3PWDA 3MBLA 3RKBA 4JX7A 2OJIA 5JKGA 4C61A 2OF2A 3PFQA 3QTSA 4PRJA 4BWKA 4NYEA 5LVLA 4YJRA 3F7ZA 4IIRA 3NUYA 1LUFA 4DC2A 2X0GA 4QD6A 4BDJA 4I6QA 2VTJA 2YCQA 3DB8A 5CT7A 4HYSA 4B8MA 4CTBA 4O84A 4JAIA 2JLDA 3DXNA 3GVUA 4XNEA 5FG8A 4OAUC 5L8LA 1FBNA 1P2AA 1YOMA 2AYPA 2E9UA 3NW7A 3TNWA 4QEBA 4X2JA 5GINE 1OIYA 2XB7A 1G3NA 4WKQA 3TZ8A 2BIYA 2O3PA 4R5SA 5C26A 4BN1A 4BR3A 1CKPA 5EHYA 5J8IA 1H1WA 3ORIA 4FTLA 4QMVA 2QO7A 1GAGA 3BZ3A 2JIUA 4KBCA 1GOLA 3VIDA 5M4UA 3U6IA 3EQIA 5CF4A 2RFEA 4EH7A 3WF6A 5KMIA 4Z55A 3JVRA 3AMYA 4QP2A 5IA1A 4BCJA 5M06A 3FLNC 3QCXA 4IZ5A 5HCXA 5HVYA 3D5UA 3MPAA 4JBQA 5AMNA 3EIDA 5J95A 4PTGA 3GU6A 1P14A 2A1AB 2B55A 3BPRA 3Q2JA 5IQDA 5CWZA 3ELJA 2XNOA 2BRHA 4BCPA 3EQRA 4EUUA 4XRJA 2ZVAA 3IOKA 5BVEA 3R7VA 3KFAA 3KB7A 4MXXA 5AWMA 4AT3A 4D5KA 3GENA 4NWMA 1B38A 2B9FA 4I20A 4W8EA 4EOJA 3F7WA 4JVGA 3G0EA 3QGWA 2R3JA 2GNHA 2W5HA 3GBZA 4RQVA 4WIHA 5F4NA 2H8HA 4JBPA 2VTMA 4O4EA 1W2FA 3PA3A 2UVXA 3DKFA 4R3PA 4XG3A 3R7EA 3W10A 3TDWA 3BCEA 1T46A 4IZYA 2XS0A 5CZHA 2J6MA 4APCA 3DPKA 2XNPA 2OLCA 2GCDA 5AUWA 3FZRA 3FMHA 3K3IA 2BDFA 1GZKA 3N51A 4FUYA 4IW0A 1H24A 3TIZA 3A7IA 5KMOA 3EN6A 1XH5A 1GIIA 1OL1A 4Y5HA 5EW3A 3PA5A 5D9HA 4B99A 3N4VA 5H8BA 2Q0BA 5CSWA 3O7LB 4MBIA 4H1JA 4EKLA 3UDBA 2DWBA 2VX3A 4TYHB 4PPAA 3HV5A 2QOQA 2ZV2A 2YM7A 2UZBA 4EOOA 4CVAA 4BJJB 2Q0NA 3ZM4A 4OW8A 4GVAA 4RIOA 2RFDA 3PIYA 3MESA 3MIYA 3AT3A 5F95A 1UA2A 3AC4A 4FV5A 3WE8A 2PUNA 4U79A 3EQGA 3D2KA 1PKGA 2ONLC 4O2PA 5ETAA 5ETIA 2FGIA 4MXCA 3EJ1A 4FEVA 4UMUA 3A7GA 4YU2A 5AV4A 5J7BA 5FBNC 2W7XA 4K11A 4XOYA 3W2QA 1XBCA 4J96A 4LV5A 3Q3BA 4S31A 3EN9A 5DIAA 3R0TA 2QO9A 4C4EA 4FKJA 1UKHA 1YI3A 1H8FA 3IS5A 2PMNX 3V5PA 3U6HA 2R4BA 2CCHA 3KL8A 3PXFA 1JNKA 4YPSA 3PXYA 3NZ0A 5AX3A 2RG6A 3BQRA 3VS4A 4QP3A 2CLQA 3BGQA 1M2RA 5E91A 4LRKA 1WCCA 2VTHA 4UWYA 3RNIA 2HXQA 4CFXA 1Q61A 4BIEA 5C27A 4L8MA 2WKMA 5I9UA 3DLZA 3GCSA 3RVGA 4Y85A 2XH5A 2J2IB 4O0SA 2IW9A 2CGVA 4JIKA 3F2NA 1M7NA 5BX0A 3FV8A 4FT9A 2GS6A 5IDPA 4HOKA 5CSXA 2GQGA 5K4JA 3IGGA 4L67A 3MH0A 4USFA 4FZAB 5L8JA 4BDFA 3U51A 4NKSA 2GHGA 4TL0A 3VQHA 3BHTA 1GZ8A 3JYAA 2BPMA 4QNYA 3PLSA 4O6LA 4ASDA 5GNKA 3FZTA 5IMXA 2BZJA 4D4RA 4I4EA 3QC4A 4O6EA 5C8NA 1XH6A 2YIXA 2HZ4A 2DQ7X 5HCZA 1OECA 4NTSA 3V5WA 2C3KA 2PTKA 5GZ8A 4ZTMA 2F9GA 3H9RA 5KHXA 2UZTA 4NT4A 4IX3A 3QD0A 4DBNA 3MB7A 3DDQA 4DEEA 2Y9QA 5KKRC 3IDCA 4XX9A 4JRNA 5CEIA 5HNBA 3WF5A 4ANSA 4DT8A 4QMWA 3Q4CA 4QTBA 4ZSGA 2X7GA 3W0RA 3F5GA 2BRMA 2C0OA 2IZUA 2V7AA 4FNWA 5ANDA 4GRBA 1BI8A 1ZRZA 4I22A 1G8AA 4QYGA 3EFLA 2C0TA 4YMJA 5CAPA 2X39A 4ZTQA 4K1BA 4N4SA 5CAOA 4B4LA 4WA9A 4WNPA 4G5JA 3MFUA 4EK4A 5HQ0A 4M0YA 2CSNA 2YZLA 4FV8A 5JRSA 3RI1A 5CXZA 2HZIA 2C47A 4NCTC 1OVEA 5EG3A 1JAMA 3V8SA 4BIDA 3D83A 1ZZLA 4V0GA 5EW9A 5DE2A 4I5HA 4EQMA 1O6YA 3E7VA 3OC1A 4GCJA 2KTYA 4O96A 3MY5A 3PXQA 1NT2A 2QONA 2X1NA 2X9EA 5K0KA 1TQMA 5CT0A 4O0TA 2VGPA 2WB8A 2CN5A 3NS9A 2CGUA 4C3PA 1L8TA 3COIA 2OJGA 3TNHA 4CEGA 2OKRA 4CMTA 2OH0E 4E6AA 3EL7A 2Q83A 3BGZA 4G16A 4IJPA 4O4DA 4RFMA 5AA8A 1Y6AA 4ITJA 3RPYA 1M2PA 2J5FA 4W8DA 2X2LA 1YXVA 4RC2A 4XLIA 2QQ7A 5TF9A 4CLIA 1V0PA 4F0IA 2ITUA 4ZY6A 4AG8A 2J0MB 1FGIA 3VF9A 4EH4A 1QCFA 2WPAA 2ERZE 4F7LA 4AGWA 5J1VA 5E1SA 2UZWE 2XYNA 3DKOA 4UMTA 4DG2E 5HVKA 2B53A 4NU1A 2YDJA 3QX2A 5AX9A 3Q6WA 3PJ8A 2HK5A 4FVQA 3GOKA 4S34A 1MP8A 2YCSA 1XH9A 2VTSA 3BRBA 4KSPA 4EOMA 5LVOA 4DN5A 3I7BA 4G1WA 1ZZ2A 4D9TA 5J9ZA 3GI3A 5EM7A 3TUCA 1M14A 3Q4ZA 3MTLA 3SRVA 3TTJA 4DEHA 5IH5A 2PYWA 3UJGA 1OMWA 3CQEA 3RCDA 5KMLA 3PJCA 3ZUVA 3OZ6A 2J0IA 1Y8YA 3BEAA 4E8AA 3R8PA 5JFVA 4WBOA 2X7FA 2V55A 4RLKA 4YJUA 4NW5A 1JBPE 2R0UA 3GU4A 4LOOA 4AXCA 4J52A 5H8GA 3MS9A 4CV9A 4DH7A 1XBAA 2UZDA 3A99A 4NZWB 4EH8A 3ML1A 3P08A 4FKQA 4W4YA 1O9UA 3VQUA 1WMKA 3NIEA 4L42A 5HD7A 5CAVA 2FSOX 3CCNA 3VBWA 5LOHA 4ITIA 4PL3A 5DN3A 4USDA 3NFGB 3F3TA 2ZMCA 4XOZA 4FKRA 5HG9A 3LHJA 4ZMEA 1FPUA 3LFDA 3OTUA 5CF5A 4F7SA 4U41A 3FLWA 3ZFMA 3BLQA 1DAYA 4QP9A 4GT4A 3LQ5A 4ZP5A