2Y4IB

Ksr2-mek1 heterodimer
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
279
structure length
265
Chain Sequence
SIFLQEWDIPFEQLEIGELIGKGRFGQVYHGRWHGEVAIRLIDIERDNEDQLKAFKREVMAYRQTRHENVVLFMGACMSPPHLAIITSLCKGRTLYSVVRDAKIVLDVNKTRQIAQEIVKGMGYLHAKGILHKDLKSKNVFYDKVVITDFGLFSEDKLRIQNGWLCHLAPEIIRQLSPDEDKLPFSKHSDVFALGTIWYELHAREWPFKTQPAEAIIWQMGTGMKPNLSQIGMGKEISDILLFCWAFEQEERPTFTKLMDMLEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords KINASE SUPPRESSOR OF RAS 2
publication title A Raf-Induced Allosteric Transition of Ksr Stimulates Ksr and Raf Phosphorylation of Mek
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 56
structure length 265
sequence length 279
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2y4iB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2y4iB01
2WQEA 3EZRA 4BCHA 2ITWA 3KEXA 2YIYA 4OBPA 5CAOA 2YIQA 4IB1A 5HTCA 1CTPE 1JVPP 3NUSA 5BVFA 4IM3A 5CT7A 3RM7A 4ZZNA 1ZZLA 3ORIA 3HLLA 2O8YA 4I6QA 4NW6A 2KTYA 3GEQA 4HZRA 4O81A 3NLBA 3MDYA 4M84A 1HCKA 1WBVA 3FLZA 2Z7SA 3QLGA 1S9IA 2YWPA 4BBMA 3KRRA 4F63A 4ZOGA 3ERKA 3NYOA 1I09A 5IEYA 1GY3A 3DK3A 4QMOA 5CLPA 4G31A 3FMLA 4JG7A 4CD0A 2IJMA 5IH4A 5KMLA 3LCTA 3QQFA 4QQJA 3C1XA 2WMXA 3V5JA 4BIBA 4D4VA 5BVNA 4W4YA 5T68A 2Y8OA 4L43A 3PSCA 3UYTA 2PZYA 4WKQA 2WAJA 3V5PA 4EZ5A 3T8OA 3FJQE 4U3YA 5IF1A 5M44A 3ZEWA 4OTWA 2HCKA 4ITHA 5E8SA 2IZRA 3A7JA 5CVGA 3F7ZA 4U42A 3UO4A 4AACA 3OF0A 5CYIA 1YI6A 1Y6BA 3U87A 1FVTA 1OB3A 2GNJA 1G5SA 3OCBA 3TXOA 5LMKA 4R7HA 4FA2A 3U6HA 5EHYA 4F9BA 5K9IA 2FVDA 3QZHA 4MQ1A 4TYIA 1H25A 3R7EA 4C62A 4DE4A 5BVEA 3CXWA 3DB6A 4IJPA 5L2IA 3HAVA 4MH7A 4A9RA 3FBVA 2J2IB 4ZTSA 4I0TA 5HG7A 3HP2A 3L9MA 2YA9A 2X2KA 3RPYA 1XJDA 3ALOA 2XIYA 1URCA 4CZTA 3QRUA 4E4NA 2CGWA 2VTRA 4CFFA 3VIDA 2QOBA 4FOCA 3S3IA 4AZWA 4IVAA 2CKEA 4HW7A 2WTVA 5AV2A 2QOQA 4CFXA 2BROA 4F1TA 5A4TA 1DAYA 3KULB 4ZIMA 2QLQA 3UC4A 1LP4A 3HRBA 5HE1A 4ZTNA 5I9WA 2VRXA 3BBWA 3IG7A 4C37A 4C2VA 4I94A 4WNKA 4F08A 2VX0A 3FHIA 5CI6A 4LYNA 4KA3A 4B6LA 2AYPA 4IMYA 4B8LA 2ITUA 4MXOA 3TNWA 3BGQA 4UMPA 4YC6A 5ANDA 5HVKA 3BU6A 3TKIA 4KIPA 2H8HA 3UDBA 2C6OA 4IEBA 3PXRA 4HYHA 3ZEPA 5CSXA 4FEUA 1BLXA 4H58A 3ZLWA 2Z2WA 2CGXA 5EK7A 2ZV8A 3PY3A 3N4TA 4FIJA 3BKBA 5E8WA 5TR6A 4B7TA 2ACXA 3KK8A 3GU7A 2PULA 3NVKI 4FV1A 3QQGA 5EYKA 1KE7A 1GIJA 2VTLA 3NGAA 3A2CA 4AS0A 3CSVA 3NNWA 2F7ZE 1QCFA 2E9PA 3NZ0A 4BTKA 2QR7A 2HW7A 3QTQA 4G6OA 4JX3A 5DNRA 3P78A 4XOZA 5IA1A 5HCXA 2QU6A 4E6CA 2W4KA 4GFOA 4AG8A 3AC2A 1UU3A 2PYWA 5A4LA 3VJNA 2W99B 5FTOA 1Q4LA 3GC8A 4I5HA 4BHNA 4C4GA 4FTTA 3MH1A 1PW2A 3VUDA 3DFCB 5E8YA 4BKJA 3RK7A 2I40A 2Z7RA 2ZJWA 3JVRA 3R02A 5IDPA 4A07A 4UALA 4J1RA 2F49A 4DLIA 2PU8A 5K0KA 1CKPA 1JKTA 1UU7A 2BCJA 2J5FA 3CKWA 3E5AA 3N51A 4L7FA 5AR2A 5EYCA 3OEZA 3VJOA 1WBTA 2PVHA 5A6NA 3POZA 3CGOA 4LMNA 2HZIA 3COMA 1O6LA 3EWHA 4CV8A 5H2UA 4ZY6A 2V55A 3FY2A 3IS5A 4BRXA 5E90A 1Q8YA 3H9OA 4U3ZA 2EVAA 4FVQA 3DAJA 5EQYA 2ETRA 4IWPA 4L00A 3OBJA 2Z02A 3PG1A 3LCOA 3VUGA 2FH9A 3UVPA 4AFJA 4EOLA 5AV4A 5J9YA 5JN2A 2R3OA 4G3GA 2VWYA 4J97A 2RKUA 4YZCA 5JEBA 5LCKA 3SXRA 1G8AA 4TYHA 4DFNA 2F9GA 3I5NA 4NH1A 4YC8A 5AV0A 4UWYA 5EDPA 2C68A 4ZLOA 5M51A 3UZRA 4CFVA 4TT7A 4BGGA 5JFSA 4KBCA 4AX8A 5A4QA 1B39A 3Q04A 4U0IA 4QNAA 4DFYA 5A9UA 3COIA 2XKEA 3LE6A 3FHRA 3HV4A 4BL1A 2XNNA 4XG2A 3BE2A 2BAJA 3MGYA 4KKEA 4ZTRA 4FEWA 3SOAA 2UW0A 4QMPA 2ZM1A 3EFKA 5BYYA 1OPLA 4RVTA 5AUXA 5H8GA 5B2MA 4KWPA 2WMRA 2WQBA 4UXLA 2BALA 3P7CA 5HE3A 4O0TA 4E4XA 4AZEA 1OITA 2P2IA 2VO3A 3UNJA 4NEUA 4DCEA 5K5XA 2VN9A 2IN6A 4I3ZA 3VS2A 3KGAA 2XIKA 2BRNA 2R3MA 1H1RA 4RA5A 4QTAA 5EYDA 3H9FA 2CCHA 3C13A 3LMGA 4ZSJA 4IQ6A 3G9LX 3ENMA 2XF0A 3QQUA 4JOAA 5TE0A 1JSUA 2UZUE 3PA5A 3MFTA 3QCQA 1V1KA 3PZEA 4F9YA 4V0GA 1H1SA 3MSSA 2CKQA 4IWDA 2X8EA 4XG7A 3A60A 2IO6A 2WTIA 4YTFA 3EYHA 2BZKB 1YHSA 2WQMA 4WSYA 5LVNA 3Q2JA 3D4QA 1XBCA 3BHVA 2QNJA 4PMTA 2XBJA 5GIOE 5I9ZA 1OL1A 2FUMA 3FMNA 2R5TA 4GT3A 3PVBA 4G6LA 1BX6A 4P5ZA 4HGSA 4CNHA 2W17A 4TW9A 3ZLSA 1ZLTA 1PYXA 4EOSA 4FT3A 4AUAA 5IQDA 3FKNA 4ZZMA 4KSQA 5FBOA 2XIZA 2REIA 4G3CA 2PWLA 2PVRA 2Q0BA 1Q5KA 2YM4A 4JRNA 4NM5A 3I4BA 4ZTMA 4LRJA 4CGAA 2FO0A 4FIHA 1GIHA 3KXXA 3UOKA 2E9OA 3CE3A 4APCA 1W82A 2YLEA 3FQEA 4PPAA 2R4BA 4JQ7A 3NUAA 5BX0A 4UMTA 3FC1X 2WD1A 4LUDA 5DI1A 4C02A 2JKQA 3VUHA 4KS8A 4ALUA 2CGVA 3QRTA 4BC6A 4D28A 3OXTA 2WIHA 4K18A 3DOGA 1LEWA 2BUJA 2PVKA 3OFMA 4L53A 5HIDA 4BCGA 2OW3A 3LAUA 1IRKA 5DFPA 3A4PA 2PMLX 2HWPA 3A7FA 4G6NA 4WG5A 5TF9A 4QMZA 3SC1A 3VO3A 3UOLA 1CMKE 2W9FB 5D7AA 5F94A 3TZ7A 3TJCA 3GFWA 4EQCA 4WG3A 4NK9A 4Y95A 2YHVA 3DV3A 4HYIA 4QMVA 4EOIA 5CEQA 1UNGA 5IDNA 1F3MC 1J3HA 2Y4PA 4F6UA 4NM7A 3BHHA 1U5QA 3RZFA 3SV0A 3PXFA 3TNHA 3CS9A 2J0MB 2QR8A 3EQPA 4IAKA 4A7CA 4NUSA 3QGYA 3ID6C 5ANEA 4FTOA 2OJFE 1Z57A 1YDRE 4DN5A 1O6YA 2UW5A 3H0ZA 2I0HA 4OTQA 2YFXA 4PF4A 5AX3A 3TTJA 4BCIA 3CTHA 4MAOA 3FMHA 2C3KA 2CJMA 3ZBFA 4XHKB 2W1EA 3CIKA 3TDVA 1U54A 2XRWA 3V5LA 3NAXA 4UMRA 5AR5A 2J51A 5HNIX 5IKWA 4MBJA 2XK3A 4GU9A 3ZC6A 5HCZA 3T3UA 3UIXA 5CX9A 3AD6A 5DR9A 5DWRA 4QP9A 3UIBA 3MS9A 2OFVA 5C1QB 4FSMA 4JBOA 5HG5A 3AXWA 4CQEA 4D5HA 4HPUE 5AFVA 3JY0A 4FKQA 4OTFA 5ACBC 4K0YA 3ROCA 3GXLA 4CRSA 5HTIA 1PMNA 2UVYA 4CMTA 5EI8A 3NAYA 4RG0A 3CC6A 3EQCA 5A54A 4YJPA 5BUJA 3HV7A 3MH3A 2F4JA 3F66A 1W83A 4TWPA 5AADA 1BL6A 5E8XA 2WU7A 4YHTA 4EC9A 3F3TA 2WOTA 4OW8A 4QPAA 4LI5A 3MJ1A 5K4JA 1MQ4A 2QC6A 4AF3A 3QCXA 4TL0A 2FSMX 3HECA 4UMUA 3BU3A 3DBEA 3RCJA 5BVDA 5BVWA 5KMMA 4AW2A 4CG8A 4OBOA 5E8ZA 3RNYA 4OR5A 3MPAA 3OHTA 3LMHA 3MVMA 3RK9A 3RP9A 4FTMA 1ZARA 4YUQA 4ASZA 2YCSA 1SM2A 1KV1A 4GK4A 4PMSA 3SG9A 2R3GA 3TL8A 4EOQA 4WNPA 3PJ3A 3HMOA 2BIKB 1ZAOA 3WE8A 4AA4A 1PHKA 1P4OA 1FBNA 4HVIA 1UNHA 2Q83A 5E9EA 5JKGA 4R3RA 4RWLA 3U9NA 3VBVA 1ZMUA 4O7ZA 3A8WA 3C4WA 3NUYA 3N4UA 4D0XA 5IEXA 5AR3A 4AGDA 1TVOA 3KN6A 4FKWA 2JDTA 3LPBA 3R63A 4FTKA 4H1MA 5CQWA 1OIQA 2YDIA 3NIEA 3PYYA 4L68A 2BRGA 3G15A 4QP7A 4BGHA 3H4JA 3KMUA 5IQIA 4NYEA 1F0QA 4NTTA 3ELJA 3VF8A 4ALWA 4M15A 2QONA 5DG5A 2F7XE 2P4IA 3GOKA 2QCSA 4IX6A 4OTDA 4ZSGA 1RQQA 2WU6A 3KULA 3P08A 3NCGA 3MPTA 4M0ZA 3ITZA 5CY3A 3AMYA 1H8FA 2XS0A 1Y8GA 4LM5A 2JD5A 4IVDA 3ZU7A 3VW8A 3Q60A 3PPZA 3PVGA 5EM8A 5HE2A 5HO6A 3VRZA 4G3EA 3UPZA 3BQRA 2V22A 2OBJA 4EUUA 1BYGA 3Q4UA 3QRIA 3ZZEA 3HV5A 4Y8DA 4A9UA 1G8SA 3B8RA 3R0TA 4IJ9A 4FEVA 3ZRLA 4AZTA 2RGPA 3CPCA 4PTGA 2HAKA 1V0OA 4NWMA 2BFXA 2RIOA 2LGCA 4NSTA 4LFIA 4UMQA 3ZO1A 5IISA 5M4IA 4D2RA 3FDNA 5LOHA 3KKVA 5HNBA 3C7QA 4XBUA 3UO5A 2F57A 3IKAA 3WIKA 3NEWA 1TKIA 5BNJA 2GSFA 5LWMA 3RJCA 2C6MA 2P3GX 3GGFA 1OPJA 4DEAA 3ZS5A 2WELA 1R0EA 1YI3A 3LJ1A 4JBPA 1H27A 3MB6A 3VUTA 3HMIA 4AU8A 2BZHB 3BELA 3VHEA 3CJGA 3WYXA 4YPSA 3DBCA 4QD6A 2BHHA 5LVPA 2XVDA 5CSHA 4YJRA 3C5IA 2R3IA 3PJ1A 3QZGA 3AT4A 2OK1A 5KKRC 4LOOA 3FLSA 3EFJA 4WO5A 2EXMA 4YURA 4NKAA 3WZKA 3FMJA 2R3NA 2WNTA 4RX7A 2UZLA 3R7OA 4X3FB 3MFRA 2VTPA 3AC8A 3RINA 3TJDA 4QP8A 4I41A 4PPCA 3GU4A 1OIRA 2XM9A 4PL4A 4S31A 4C4FA 2EWAA 3U55A 1JSTA 4TTHB 2IW9A 4J8MA 4O21A 3WF9A 3M1SA 3Q2MA 3JYAA 5AUWA 1ZYCA 2E2BA 5CVFA 4F7NA 2YEXA 4O7YA 3C4FA 3DJ5A 4CT1A 4Z3VA 5I3OA 4QPSA 5AMNA 3I6UA 3PXZA 5HESA 2ZAZA 5JFXA 5AR4A 4OTIA 4FTUA 4RA4A 5ETIA 3R8ZA 3KRXA 2QG7A 3U54A 1PXKA 1A06A 1XH5A 2GS6A 3FLYA 3W1FA 4YJQA 2BRHA 2OJGA 2WPAA 3QFVA 3OCGA 4R8QA 3KXGA 3CLYA 5CU4A 2JFMA 3QD0A 5L2SA 4ZTHA 2OF4A 3F9NA 4BDGA 4ERKA 3A7HA 2XIXA 2B53A 4QRCA 4R7BA 2BAQA 1MRVA 4O0YA 4PDOA 2WTWA 1DAWA 3GU8A 3PXKA 2I6LA 5HG9A 3MY0A 3PZHA 3U8WA 4FKPA 2GFSA 3BPRA 4S32A 1SNUA 3L8PA 5J5SA 1GZNA 4ANLA 2B9HA 4DC2A 5KMNA 3COKA 3LFAA 4I93A 3V51A 4ZJJA 3D2KA 2FB8A 4U40A 3QRJA 1YWVA 4BTFA 3HYHA 2X2LA 2HZ0A 1K2PA 1YWRA 4K6ZA 4EOJA 3F69A 3MA3A 3DKOA 4ASEA 2XCKA 5KCVA 4G3DA 2A19B 1ZMVA 1VZOA 3TUDA 3MA6A 3UZTA 1E9HA 4XNEA 2GNFA 2F2CB 1OKZA 4FIFA 4S2ZA 4FZAB 2PY3A 3WILA 4CFNA 2VO6A 3OY3A 5JQ8A 4YSMA 3RK5A 3ZO2A 2XM8A 4ZSEA 2UZVA 4HCVA 3NUNA 3PFQA 3L8SA 1HOWA 3V8SA 5A4EA 5A6OA 2OWBA 3CEKA 3R28A 5DYJA 2PK9A 5ANGA 3O96A 4CKJA 4D1ZA 3VRYA 1FQ1B 1MP8A 1YI4A 3I81A 4JG6A 4LUEA 4C3RA 5J7BA 3OVVA 3QXPA 3FLNC 3O7LB 2EU9A 2BDWA 5ANKA 2RG6A 3D7TB 5GINE 2W1HA 4GMYA 2YITA 5EG3A 3ATTA 2BTSA 4EC8A 1YDSE 2QOLA 4FT0A 4C59A 3PE2A 2JGZA 4LOQA 4MCVA 4M13A 3ZONA 4I4EA 3BYOA 3E8NA 2Y0AA 4RLLA 5A14A 3FMEA 4EUTA 2QQ7A 2UZTA 2OH0E 4J53A 4GCJA 2QOOA 2WO6A 4RJ3A 5CAPA 5FEDA 3VN9A 1EH4A 3MVJA 3V8TA 4E4MA 1H08A 3QTZA 5DA3A 1UVRA 5IU2A 3P23A 1XR1A 3BQCA 4LV5A 3QTXA 4D1XA 5HO8A 3DXNA 3EHAA 1W0XC 2YN8A 2UZDA 2VWXA 3OWKA 4MXYA 4YZMA 3RM6A 4BCNA 4RFMA 2RG5A 4XMOA 2BIYA 3MTFA 3OBGA 2FSOX 4FTJA 2A2AA 5HTBA 3SW7A 5B0XA 1Q24A 2XMYA 3ANQA 3P5KA 3FWQA 5AV1A 3TN8A 3R2YA 3TUCA 2IVTA 3E92A 4DH1A 1YXSA 1P2AA 1WCCA 4M8TA 4BB4A 3RPOA 4AQCA 3HUCA 1V0BA 4EJ7A 1YQJA 3EN6A 1MUOA 1VYWA 1ZRZA 5KX8A 3UTOA 5HCYA 4F0IA 1YRPA 1IR3A 4XG4A 4DH8A 3W2OA 2VNWA 3ZOSA 1QMZA 1WVXA 1ZYJA 4L44A 2GHLA 4ACGA 2OICA 1M17A 3VWAA 4F70A 5DLSA 4FSNA 4O2ZA 5IEVA 5IQHA 2ITXA 4EHVA 2IZUA 4O2PA 3R7IA 2GQSA 2XP2A 4DH3A 2IWIA 3GUBA 3QALE 2VWBA 3E88A 1SVEA 2HELA 2PZPA 5IA5A 3TKHA 1JWHA 1NVQA 2ZOQA 4O0UA 4ZSAA 3EKKA 5B2KA 3PP1A 2R2PA 3K54A 4J96A 4LGGA 1BUHA 4EK3A 3NW6A 4I5MA 5C27A 4D2VA 4IB5A 5M53A 2YM8A 3RAHA 4IH8A 4HOKA 4ASDA 4XOYA 5JSMA 4TY1A 3W8QA 3QKMA 2HZ4A 4I0RA 5EW9A 3MESA 4QT1A 3FZOA 4OUCA 5IH5A 3SRVB 4J7BA 4GG7A 4QQTA 3GU6A 4MNEA 4V01A 1TQMA 4XP3A 4L7SA 3L9NA 4AT3A 4RX8A 5HBHA 3OY1A 4I6FA 4NIFB 3PA4A 1AQ1A 2XK9A 4C61A 3LLTA 3W2QA 3RPVA 4BTMA 4IE9A 2OLCA 3TZMA 4FEQA 4WNMA 5B2LA 1YXUA 1LEZA 3SD0A 5HBJA 3IONA 4HPTE 4E20A 1YW2A 3EZVA 4TWCA 1H1PA 2ZB0A 2NNWB 4NFMA 5D9HA 3THBA 3H3CA 5TT7A 3VBTA 4ACCA 2JKOA 3QUDA 2XBAA 5AUZA 3D2IA 3SOCA 3KQ7A 3B2WA 3BHYA 3D0EA 4PX6A 2A27A 2Z8CA 5K4IA 5J9LA 3NYVA 4A4OA 3B2TA 3LCSA 3FE3A 4BR3A 2W1CA 3O0GA 3I6WA 5KZ0A 2P0CA 3TV4A 3EB0A 4L67A 4MD7E 4MWIA 3UQFA 1J1BA 3FZRA 4CCBA 4DITA 4N0SA 4OAUC 4ONAA 3R9OA 3IW4A 1ZYDA 4DTBA 3PLAE 4BDFA 4KIQA 1FMOE 3VUMA 4V0GB 5AEPA 4O83A 2WIPA 1PXMA 4IZAA 4BDCA 1ERKA 1U59A 1IA8A 3WZJA 2XNBA 4BCJA 2H34A 3GCSA 3IK3A 3KF4A 4ZTLA 4BCPA 2B7AA 4F1OA 5EHLA 2QVSE 1YWNA 2YM6A 3BGPA 5AAFA 4BDDA 4RIWB 3ZFXA 2E9NA 4CMOA 4EI4A 5GZAA 3HVCA 5AP5A 4J95A 3JVSA 4FKSA 3GBZA 1PMUA 5KMIA 3QA0A 4MF0A 5KNJA 4ZZOA 2B9JA 3A61A 3RTPA 3QCYA 1J7LA 2WHBA 5KMOA 4F7LA 4QTDA 5DH3A 4FZFB 2NO3A 3TV7A 3EN7A 3KMWA 4FKJA 3RAWA 3D9VA 5I0BA 4DGMA 4Y5HA 2CKPA 3R8PA 2C1BA 1XH7A 3E8DA 2OJIA 2G01A 4AWIA 4CMUA 2HY81 1R3CA 3TACA 4GT5A 4MXZA 3DZOA 3UQGA 3OTVA 4E1ZA 4F9WA 1KSWA 2V5QA 2JBPA 4K1BA 1REKA 5JGAA 4H1JA 1T45A 2QO2A 4DG3E 1FINA 3LJ0A 3PIXA 4I20A 4O38A 1WVWA 4RC3A 3VQUA 4K33A 2V7AA 2DQ7X 5M07A 2BZJA 3BCEA 2R0UA 3AOXA 5FEEA 3OG7A 5C03A 2B55A 5CQUA 5IH6A 3ZC5A 3MFUA 1Q8ZA 5DPVA 3AC1A 3W55A 2PHKA 3IO7A 1KV2A 4CLJA 2GNGA 3LM0A 5CXZA 3QC4A 1WMKA 3QQHA 3L8XA 5I9UA 3RPRA 4FTIA 4X6QC 3W2CA 2WOUA 3OUNB 5DRBA 3TV6A 4L3JA 4PUZA 4C4HA 4MTAA 3DAKA 3LXPA 3QHRA 2OI4X 3HV6A 4PDSA 4U45A 5AP2A 3U51A 5EHOA 4BDAA 4BZOA 5IA0A 2HENA 1OGUA 2Y4IC 1PMVA 2RSVA 5G6VA 1MRYA 1YHWA 4F0FA 5L4QA 3DXQA 5CU3A 1R39A 3V8WA 4X2KA 4BCKA 4EORA 5HQ0A 4XV2A 3CGFA 4E7WA 4X0MA 3W16A 4RJ5A 4RZWA 2I0YA 4C2WA 2CNVA 4CQGA 2HIWA 3SXSA 1QPEA 1PXLA 3LKMA 4E5WA 3OWLA 4GUBA 5HGIA 1H24A 5HORA 4IAZA 5LJJA 4RIOA 4DT9A 4HJOA 2XZSA 2QLUA 3EN4A 4ANQA 3MY1A 4EK5A 5AAEA 3OOGA 3Q4CA 3ODYX 4DG2E 2HK5A 2ZB1A 3DFAA 2BVAA 4H39A 2EXCX 2C0IA 5J87A 2W4OA 5KUPA 2BR1A 3K5VA 3OROA 5GJGA 3ZH8A 2GS7A 4DINA 3R9HA 3EJ1A 3RMFA 3ZDUA 1Z5MA 2O2UA 4FNYA 3DKGA 2H96A 3G33A 4WBOA 3ZM4A 2JDOA 1DI8A 3O17A 3ZXTA 4G9RA 4YHFA 3ZZWA 5BMMA 3GB2A 4PRJA 3C0HA 3TTIA 4JAIA 3CY2A 4MKCA 2I0EA 3ET7A 2DUVA 3ZHPC 4Z16A 3FL5A 4GV1A 3IW6A 4PL5A 2J4ZA 3BEAA 2V0DA 1BI8A 1PXPA 4BKYA 5CXHA 1VR2A 1IASA 2QOIA 3HRFA 5DIAA 5KBRA 4G5PA 3VC4A 1RJBA 2XNPA 4OTGA 1OUKA 4QYFA 3AD5A 2R7BA 4FX3A 5I4NA 1OL7A 3QD4A 1T46A 3GCQA 3UP7A 3QTSA 1SVHA 2A4LA 4RLKA 4PNIA 5F95A 3D7TA 3OP5A 3FXZA 3SXFA 3BRBA 4C4IA 4EYJA 3NMUF 3FL4A 3S4QA 5GZ8A 3QCSA 4P90A 3QTWA 1R78A 4TYJA 4XG9A 2IPXA 3F7WA 1ZY5A 3V3VA 3LQ5A 5FTGA 3SVVA 2YIXA 2QO7A 1PY5A 2PSQA 3IDPA 3DLZA 4YNOA 4JDJA 4RC2A 3Q9XA 3KXHA 3R21A 4B99A 4DCAA 5EOBA 2P33A 3LMIA 5G1XA 2X4ZA 3KCFA 2XNGA 4G5JA 1A48A 2E9VA 2W5AA 3C4ZA 2CHLA 3QTRA 2B1PA 4FV5A 3LXNA 1FGKA 3ANRA 3KFAA 4EH9A 3I7CA 3ORXA 4BY9E 2X8IA 2CLXA 4O0SA 2VZ6A 4GYGA 4J8NA 5IZFA 4FR4A 3F3VA 4P5QA 3W10A 2WMBA 1U5RA 3TIYA 3GC9A 3WARA 1OKVA 4FV3A 5EQEA 5H8BA 3KA0A 3Q4TA 4IBMA 4DH7A 1UWHA 1UA2A 3CTQA 3HKOA 5TO8A 4JS8A 2R3RA 3JXWA 2GNIA 4FKOA 4DTAA 1OIUA 4FVPA 4E93A 5HEZA 2W1FA 4MXXA 4TWOA 4J52A 3R1SA 4CSVA 4NKSA 4CFMA 3V6RA 4XV9A 4A9YA 4FSTA 4I0SA 4KIKB 4HGTA 5J7HA 3DJ6A 4FZ7A 2QD9A 2QODA 3RVGA 5I9XA 2HZNA 3R1QA 3FMDA 4OGRA 2VO0A 3F3ZA 4FV4A 1PKDA 3CTJA 4RWIA 4L6QA 3PDTA 5HLPA 3BU5A 1HCLA 3MN3A 3ORPA 2JDVA 2VTIA 3NYXA 4LV8A 4FV0A 1DS5A 3RI1A 4KRDA 4BICA 4HVDA 5JZJA 3CD8A 5T6KA 4DGOA 4GG5A 4D1SA 1SZMA 2OSCA 3TNPC 4FUXA 4ANSA 3SG8A 3R7VA 4K8AA 1OZ1A 4RIYB 4WUNA 2XK8A 4JDKA 5D1JA 4UV0A 2WXVA 3DCVA 3FI2A 4FBXA 2OGVA 5KMKA 4YPDA 2J9MA 2W9ZB 3Q3BA 5GJDA 3RAIA 4GFMA 3F5PA 5E8VA 4C4JA 4ZMFA 1R1WA 3PRIA 2PVYA 1UV5A 2VU3A 3SLSA 3SRVA 4ZXTA 3DLSA 3QD2B 2YAAA 5E8TA 2AC3A 3UQCA 4N4SA 4D4SA 3FPMA 1PRYA 4L8MA 4XV3A 4E6AA 4USFA 4FSQA 5CNOA 4FVRA 2X0GA 3K5UA 4WBBB 4XEYA 3VBXA 3DZQA 3TT0A 4QTBA 5HLWA 4O0XA 5IG1A 3MY5A 4YTIA 5CSVA 5EM5A 3E62A 4X2GA 3FPQA 4U81A 2X8DA 2YERA 5EYMA 4JXFA 3ORKA 1Q3WA 1ND4A 3R2BA 2VTNA 2PUPA 4JDHA 2PVMA 3FI4A 3R9NA 1G3NA 4MWHA 4UB7A 3F2NA 4EOPA 4IADA 4FV8A 3DNDA 2HXQA 5I5ZA 3QKKA 2B54A 2Y9QA 1NW1A 2FGIA 4GVAA 4S33A 3A99A 2C1AA 4FV2A 3VS6A 1K9AA 2ITYA 2Z60A 4IM0A 4EZ7A 4PNKA 5HO7A 4EONA 4TZRA 1JSVA 1PYEA 2C5VA 1H07A 3FLQA 4IDTA 3W2SA 5FRIA 4Q5HA 3W2PA 4KINA 4BYJA 4HNIA 3ZO4A 3UODA 5E91A 2C3LA 5HNGA 4L9IA 2B9FA 4TN6A 4EQUA 3JR1A 2J0LA 4JDIA 4DYMA 1YHVA 2WMVA 3GU5A 5F1ZA 5IUIA 5GHVA 4PP7A 3AD4A 4PL3A 5DGZA 5J8IA 1TQPA 4HYSA 4F65A 5ITAA 4N57A 2J6MA 4J99A 4L42A 4DGGA 3K2LA 3PA3A 2VGOA 5E7RA 2JFLA 4DFZE 2Y7JA 4YJOA 3IW5A 2PPQA 3ZM9A 3C50A 1O9UA 3NSZA 5C8KA 2EXEA 3EQFA 3TZ9A 2ITQA 2ITZA 3B8QA 2HW6A 4BWPA 2YDKA 5IA4A 4HGEA 1Q61A 4LOPA 4EZ3A 5JGBA 4G3FA 3F5UA 4RIWA 3CQUA 3BX5A 3OXZA 2WB8A 2PE1A 4ITIA 4EBWA 4ZP5A 3Q6WA 4Q5EA 5GZ9A 1GNGA 1KUTA 4EQMA 3PTGA 4DT8A 3AMBA 4MBLA 3RWQA 1M7QA 4IX4A 4EYMA 5CS6A 4B4LA 2RFNA 3VNTA 3UE4A 1H26A 5AUUA 2PVLA 1UU9A 2GTMA 4GK3A 5CT0A 5AP3A 4E73A 2BMCA 2PL0A 4KNBA 3MIAA 2R9SA 4OT5A 4PDPA 4YZNA 3MIYA 2VX1A 4BI1A 1W98A 2YJSA 2GTNA 4BI2A 2FYSA 4RMZA 4IC8A 3ROYA 4D2SA 1Q8UA 5TOZA 3BHTA 3PY0A 4RVLA 3RWPA 2OXXA 3I79A 5L8KA 5L3AA 4FNXA 3ORMA 3C0IA 2ETMA 1H0VA 2V62A 3FSKA 4RZVA 2PUNA 4LL0A 3UOHA 4JLCA 3OW3A 3GT8A 3PWYA 3R7GA 3A4OX 4GVJA 4W4VA 5AUYA 4YSJA 4MK0A 2R3FA 3M2WA 2W7XA 4XG6A 3HV3A 4F7JA 4FL1A 3CBLA 2IZTA 4FSZA 4DGNA 4FE2A 4ZMEA 4ZLZA 4ZS4A 3D14A 4EH4A 3GCUA 3OCTA 4H36A 3ULZA 5E92A 5DEYA 1QPDA 2XYNA 4M97A 4RWJA 4M7IA 5ACKA 4H3QA 3OZ6A 3R1YA 1KE8A 4TKSA 3I0QA 4WIHA 5HE0A 3UMXA 3PJ8A 5AIKA 2JIUA 2QOFA 4QPMA 4IB3A 5HKMA 3A7GA 2UW7A 4MF1A 4R1YA 4S30A 1Q8TA 4E5AX 4RGJA 4YTCA 5I3RA 4AP7A 5JH6A 4FKIA 3O71A 4CTBA 3GCVA 4XG8A 2CPKE 4BBEA 4UBAA 2WTKB 2B52A 1WBOA 2SRCA 2C6EA 4AE9A 2XA4A 3PSDA 4IWQA 3FXXA 2C3IB 2LAVA 5AWMA 1F5QA 3R8UA 5T3QA 3QBNA 5EDRA 4II5A 3N9XA 4GEOA 4ACHA 3DXPA 2YCRA 4NCTA 4FL2A 5A3XA 4EWQA 5FGKA 4JL9A 2G15A 2ZM3A 2J5EA 1L3RE 2VTHA 3DAEA 3EQIA 3MFSA 4FNWA 4FZDB 4C0TA 2BFYA 3RAKA 3WF7A 4IAIA 3MBLA 5L6OA 5K3YA 3KVXA 2GNHA 3NNVA 4H3BA 4CTCA 3QLFA 4U9AA 2X7GA 3FYKX 3O23A 1KOBA 2CGUA 3ZSGA 1J7UA 1KE5A 2OO8X 4U6RA 4FIIA 5M57A 4M68A 2YCQA 3FMKA 5FP5A 3FI8A 2BPMA 5HVJA 4JAJA 3PJ2A 4F7SA 4GT4A 3TEIA 2VWZA 5L6WL 3R8VA 1YOLA 4B0GA 2X6DA 4U44A 2JDSA 2XK4A 3CP9A 2UZEA 2VX3A 2XKDA 2PE0A 3DDPA 1FVVA 3KL8A 4IB0A 4RC4A 3W8LA 1QPJA 2V7OA 3GNIB 5LXMA 5JZNA 4O91A 3DKFA 3V04A 5ETFA 3BLQA 1GIIA 4EBVA 1NT2A 3GC7A 1TQIA 4WNOA 3NUXA 1KOAA 4RJ4A 2QO9A 3G6GA 1NVSA 3KU2A 4O1PA 4D2TA 2HXLA 3EQHA 5CI7A 4NT4A 5FXQA 3PP0A 4ZEGA 3U9CA 4Y72A 4BKZA 4FMQA 3AC5A 3QKLA 4J98A 1JLUE 3G5DA 4GJ2A 1JQHA 3ZLYA 3UMWA 3LHJA 3C4XA 3R22A 4AA0A 2ERKA 3EMGA 4N6ZA 2OIDA 3IGGA 4I92A 4YMJA 3PRFA 2NRUA 4M12A 3U6IA 5H3QA 4ZJIA 3UC3A 3ZBXA 2JAMA 4QMMA 1ZXEA 2DWBA 5GJFA 2G2FA 4PDYA 3QYWA 4D0WA 4LG4A 5E8UA 3SAYA 5CAVA 2WEVA 3TG1A 4GW8A 5CEMA 5EQPA 1QL6A 2CN5A 3NNUA 3QL8A 2A0CX 4C36A 3PPJA 3NDMA 4Q9ZA 4HCUA 4D55A 4DF3A 1REJA 3IOKA 4FK3A 4KABA 4C35A 2X6EA 3VAPA 4I5PA 3MWUA 4O1OA 3OWPA 4I5CA 4FT9A 5CF4A 5IQEA 1NXKA 4FYOA 5HIBA 1RE8A 3KXNA 4FKGA 1CKIA 3DQXA 2OXYA 4AGUA 4BHZA 5GNKA 3A62A 5D41A 3V5TA 2OZOA 1NVRA 4NW5A 2CCIA 4Z7GA 4XH6A 1Q8WA 2NP8A 3DKCA 5L6PA 2ZV2A 3CCNA 4JVGA 4DG0E 1WAKA 4O84A 5IA3A 3WIGA 2XUUA 5EM6A 1P4FA 1PXJA 3CPBA 5BQ0A 1J7IA 1VJYA 3OUKA 4GFGA 4F9CA 4C8BA 4BN1A 3AMAA 3TCPA 4DEBA 3HA8A 4FSYA 4ACDA 2C6DA 3FKLA 4IZYA 3EKNA 5CTPA 4F1MA 3Q5ZA 3PIZA 3JUHA 4KRCA 3VULA 4AZSA 3FZ1A 4AOTA 2PUIA 2UW4A 4Z55A 4TYHB 4DEEA 2XCHA 2QI8A 3PXQA 3QU0A 3VS1A 3VUKA 5ICPA 4R1VA 4DBNA 3MVLA 3HRCA 3BE9A 3QHWA 4IDVA 4RIYA 3QC9A 4DFXE 3EN5A 4HVSA 2PE2A 2C5XA 5IMEA 5JQ5A 4MVFA 2ETKA 4IW0A 4RSSA 4QYGA 3QX4A 4BGQA 5M08A 2RL5A 4WOVA 2C6LA 5IMXA 3A7IA 1GAGA 2XNEA 5EW3A 3ZRMA 5DE2A 3VQHA 5HBEA 4FODA 4XP2A 4IANA 1WBWA 3LQ3A 4C3PA 5LCJA 4JBVA 4DEHA 3CKXA 4YJNA 2Y4IB 4O0WA 1RDQE 2E9UA 2W1GA 2WQNA 4QQ5A 4O7NA 2CLQA 3LXLA 4OTPA 4FV7A 4NTSA 3RHXA 4ENYA 4JNWA 4IM2A 2J50A 2W4JA 2XEZA 4QTEA 4BCQA 2UVXA 3AQVA 4IX3A 1M52A 2ZDUA 2O64A 4EH2A 5IPJA 4KS7A 3WBLA 4AA5A 3ZUVA 4O0VA 3LFCA 5HU3A 3ORLA 5L8JA 4QMXA 3EYGA 2G1TA 4QOXA 4EH8A 2HWOA 3S0OA 4O96A 2XKFA 3BHUA 1XQZA 3HNGA 5J79A 2CNUA 3CJFA 3IOPA 3GCPA 2ZMDA 3V5WA 4QMQA 5CAQA 2WZJA 3WZEA 4ID7A 5I9VA 3UP2A 2XIRA 5AP0A 3SX9A 4ZY4A 4O22A 3W18A 2VNYA 3BEGA 3K3IA 4IHPA 4AOIA 3UOJA 5CZIA 5CWZA 3ACJA 3DDQA 4BF2A 4F64A 3W33A 5CF5A 3OXIA 2VV9A 2ZYBA 5GIPE 3QRKA 3OW4A 3O7LD 4RX5A 4IAYA 3E64A 3OCSA 1MQBA 3BBTB 1H28A 2PZIA 3TIZA 3DS6A 2OU7A 5C9CA 4WRGA 3FQHA 1V0PA 4F0GA 3EFLA 2YIRA 3H0YA 3L9LA 5LARA 3LCKA 4AW0A 3HEGA 4EH5A 4NJ3A 1UKHA 2R3JA 4OT6A 3E87A 4RQKA 3FSFA 2NPQA 5DR6A 4JR3A 4D2WA 3WF8A 2H9VA 1M2RA 4V04A 5J5TA 4APPA 4ITJA 4ZTQA 4AFEA 3D94A 1OL2A 4X3FC 1JKLA 2PZ5A 3VF9A 4JIAA 2PVNA 1YKRA 3LQ8A 4JBQA 3R9RA 4UY9A 4PPBA 5AM7A 3QQKA 4AT5A 3R71A 4D4RA 1M2PA 3GP0A 3S00A 4FGRA 5EI6A 1IA9A 5FXRA 3MH2A 3DPKA 3QXOA 3FEGA 4KUJA 2C6KA 3BYVA 1OKWA 4I1ZA 4IZ7A 4R5YA 2BDFA 2NRYA 4UYAA 4Y83A 3AG9A 3EQBA 4YO4A 5DN3A 2B0QA 5A4CA 2JITA 4G16A 4L01A 3OT8A 1Y91A 5H8EA 4E4LA 2ITOA 2QHNA 3VS5A 1SMHA 1FOTA 1K3AA 5LMAA 3ZFMA 4TYEA 1APME 5E1SA 4LGDA 4LQMA 4U80A 1OI9A 4XJ0A 5J95A 5IUHA 3L9PA 4FNZA 3E63A 3MJ2A 4D9TA 1SVGA 5C8NA 1NY3A 2WEIA 4JI9A 4IACA 3F2RA 4ASXA 3C4EA 3LZBA 1Q62A 4FI1A 3R00A 4F6SA 4BDJA 4NM0A 1BI7A 2HY0A 1OM1A 4KBAA 3IDBA 3QYZA 4ACMA 4UWBA 2VTMA 4EOKA 4JJRA 4YJVA 5ANOA 5DT0A 5EOLA 4CG9A 4CRLA 1KE9A 4QYHA 5AR8A 4KBKA 3R1NA 5FXSA 4V05A 4YLKA 3F88A 3G2FA 5CEOA 2Y6MA 4RX9A 3GC0A 5K5NA 1M2QA 4XLVA 4FTLA 3ZCLA 2CKOA 4I23A 2RF9A 2O63A 4CT2A 3QAME 1VYZA 5M55A 5CAUA 3TNQB 4D2PA 4BDEA 5F20A 2R0IA 2GCDA 1YXVA 3PPKA 4HNFA 3RBWA 3TKUA 4QMNA 2PVJA 4MXAA 1FVRA 3ZRKA 3BYSA 3FMMA 2P2HA 3HX4A 4TPTA 2RFSA 2YLFA 1YDTE 2EB2A 2OIBA 4U97A 4UN0C 3EQDA 3LLAA 4USEA 3QA8A 2OKRA 4NU1A 3FC2A 5KBQA 2ERZE 4U79A 1E1XA 4K9YA 5DEWA 5HICA 3IDCA 2FSTX 4YJUA 2XKCA 3Q6UA 1Q99A 4X7QA 5J1VA 3LIJA 4OTRA 3NR9A 5ETCA 3KY2A 4FF8A 3LFSA 4FK6A 4QMYA 5JRSA 3TM0A 4GUEA 5LMBA 1PKGA 3R30A 4N70A 4K2RA 4M0YA 3TI1A 3ZSIA 5IQAA 2OJJA 4Q9SA 2R7IA 4QP1A 4X3FA 3I5ZA 2QU5A 3JS2A 3RGFA 4X3JA 4ORKA 3HL7A 4XG3A 3VVHA 2W06A 3HMPA 1XH8A 1PXIA 3HMMA 3NX8A 2W1IA 5C4LA 5HVYA 2PUUA 1JNKA 3F6XA 4FSUA 1YXXA 2QOKA 2CSNA 2HYYA 2IZSA 2BAKA 4C34A 4OLIA 3NUUA 4RT7A 2UZBA 3UNZA 3PVWA 5FD2A 5HX8A 3QQJA 3OC1A 1ZZ2A 1J91A 2XB7A 4LRMA 4AGCA 1SYKA 1UNLA 4PTCA 5JFWA 2OG8A 5L8LA 2I7QA 4U41A 5BVKA 2ONLC 3UVRA 3I7BA 1ZYSA 5EW8A 2IG7A 3D5XA 3SA0A 5JGDA 1XBBA 4BIDA 2XH5A 5I9YA 5J9ZA 3HA6A 4EK8A 3E3BX 2R3PA 3OD6X 4W8EA 2R3HA 4O6LA 2J0JA 3FUPA 5TKDA 3R9DA 4F99A 3R7YA 2X81A 3IGOA 3IECA 4G34A 4I24A 3DA6A 2KULA 1E1VA 4FSRA 3VUIA 1QPCA 4F6WA 3T3VA 3O8UA 4N6YA 2IW6A 3AT3A 5AP6A 2UW6A 1Y6AA 2GMXA 4C7TA 1JPAA 1WBPA 2JBOA 1Q41A 2W5HA 1OL5A 4FG7A 2G2HA 5HHWA 5DHJA 4BDIA 4RBLA 3PUPA 3RALA 4IAAA 3QF9A 1PMEA 3POOA 5DBXA 4EKKA 2XNMA 4MEDA 3P9JA 4W9WA 5DT4A 3UNKA 3BWJA 4EK6A 4M69B 4XX9A 3LFFA 3PY1A 4E26A 1X8BA 3F2AA 2GNLA 3H30A 4GIHA 1XWSA 4QMSA 3Q32A 3RZBA 4F09A 4M66A 4IIRA 1OBGA 1XKKA 3LFDA 3BWFA 4GRBA 4TWNA 5FWKK 4BFMA 3WF5A 4IXPA 5FDXA 2QG5A 3U4WA 4QMTA 1WBNA 4IFGA 3HUBA 5CNNA 5D11A 4CLIA 4ZJVA 1GZKA 3H9RA 1ATPE 2R64A 2YIWA 4OBQA 4KIOA 2XJ0A 3AGMA 2ITVA 4CZYB 3T9TA 2W5BA 2YZAA 2WTJA 2OF2A 2ZM4A 5FQDC 4CYJA 4ZY5A 5FDPA 4HYUA 2WMAA 5IUGA 4CV9A 3WYYA 3PIYA 4ALVA 4FV6A 3P7BA 4ZSLA 3BLRA 4TNDA 4AGWA 4XLIA 3QWKA 1LUFA 1OECA 4RJ8A 4UZDA 4CFUA 1U4DA 2WMWA 5JRQA 2W05A 1W8CA 4RJ7A 5DMZA 3R83A 4TYGA 5FG8A 3UG2A 2BDJA 4BDBA 3BV2A 4EOMA 2BKKA 2JLDA 4O7SA 3MH0A 4AN3A 1STCE 1XH4A 5K0XA 4FKUA 3SKCA 5M06A 3DQWA 3FZPA 3NW5A 2J0IA 4F9AA 3ORNA 5JK3A 4Y5QA 1XO2B 5DT3A 3O50A 5E4HA 2ONLA 4IC7A 4IVCA 3FLWA 4YNEA 4S34A 5HU9A 3JPVA 3S2PA 1IAHA 4ZK5A 3WOWA 3KVWA 1UWJA 5ETAA 1URWA 2Z7QA 2YM7A 4FT7A 1DM2A 2C5NA 2WFYA 1UU8A 2UW9A 1JKSA 1GJOA 3NRMA 4FKRA 4LL5A 3V01A 4BWKA 3EOCA 3KRLA 4AAAA 4QP3A 4O7LA 4I21A 5DR2A 5F9EA 4CFWA 1M14A 3DTCA 3KK9A 3OEFX 3HDNA 1OPKA 3DU8A 5AAGA 3NS9A 4FUYA 3C5UA 3CQWA 5CEKA 2CMWA 5KMJA 2ITNA 4QNYA 4O7TA 5BVOA 4FG8A 1PXNA 5HX6A 2QURA 2XEYA 3ZSHA 2C30A 3NWWA 2VTQA 4DFBA 1JAMA 4R78A 2BRBA 3ZYAA 4C4EA 4O7VA 1CSNA 3TNIA 3SW4A 2X7OA 4FG9A 3PJCA 2QOCA 4GS6A 3ATSA 3QX2A 4MHAA 3VBWA 3MTLA 3E8EA 2AUHA 4DTKA 3UVQA 4E3CA 5KKRB 2WMUA 4IVBA 4XRJA 2ESMA 4EOOA 4DEGA 2IVSA 2C0TA 2OH4A 3Q53A 3DK7A 3E3PA 1WBSA 4U43A 2YM3A 2F2UA 1JKKA 4YTHA 5M09A 4UXQA 3SQQA 3MV5A 3QWJA 2J7TA 2A1AB 5HLNA 3PXYA 4BDKA 3CQEA 4MX9A 3F61A 3FV8A 3BI6A 4IZ5A 4LMUA 4MD8E 3D5VA 3P7AA 5CVHA 4O0RA 3UG1A 4OAVB 3ZFYA 5C01A 4NIFA 4BWXA 1Y8YA 2UZWE 3GVUA 4UWCA 4XV1A 2X1NA 5DVRA 2QKRA 4BZNA 3Q9WA 1LPUA 3R01A 1OL6A 5L2WA 3UO6A 4BDHA 1OMWA 3LVPA 4EWHA 5BMSA 3NVMB 3KB7A 3F82A 4YGAA 1OIYA 4ERWA 1W7HA 3LM5A 5AP4A 1P14A 3FAAA 2HOGA 2G9XA 4J71A 2Q0NA 5CF8A 3O51A 3LFQA 4AW1A 3DY7A 2WTDA 3OT3A 2XJ2A 4R6VA 4RVKA 4G17A 5ANJA 2O65A 4HVGA 4O86A 1CM8A 5EFQA 4ZS0A 4EH3A 5EM7A 2VWUA 4EH7A 4NFNA 2UUEA 3OS3A 4MBIA 1PJKA 4ANNA 5LVMA 4JQEA 2QHMA 4RIXB 5C4KA 4D58A 3ZXZA 4EEVA 3MI9A 1H01A 3S1HA 1WFCA 2XYUA 1GOLA 2P55A 3C51A 3UZPA 4E5BA 2YM5A 4PWNA 1OVEA 3BYUA 2PTKA 4KKGA 4GYIA 5HIEA 4YLLA 3MVHA 3QUPA 4PTEA 3UBDA 2GHMA 4EH6A 4D4YA 2YCFA 3NNXA 4FKVA 4XS2A 2C47A 2RFDA 3DBQA 5CU2A 2X9EA 2GQRA 3O2MA 4JQ8A 4L45A 4RWKA 5FEQA 4R5SA 1P5EA 2XK6A 4RPVA 5HOAA 2YJRA 3P1AA 4A4LA 4FL3A 4ZAUA 3F5XA 4UZHA 3JY9A 3BLHA 2PMNX 3ETAA 4FZ6A 4QMLA 4PQNA 2JIIA 4XBRA 4FYNA 2C4GA 1AD5A 1PXOA 2WQOA 3ORTA 1JOWB 3ORZA 4P2KA 2FA2A 2VWWA 2YAKA 4ANOA 3EL8A 4ANBA 4EK4A 4BCOA 4DGLC 5JT2A 4R3CA 5CZHA 4NCTC 4L46A 3G9NA 3D5WA 4FTRA 4HVHA 2WKMA 5BUIA 4DFLA 4FTAA 3ZMMA 2R3LA 3LOKA 4I4FA 1ZY4A 2YACA 4FTNA 4G2FA 2ZDTA 4P4CA 2AC5A 3SGCA 2W0JA 3D83A 2GFCA 3C0GA 5M56A 2ZV9A 4QMWA 3F5GA 4BTJA 3Q9YA 4JIKA 4MNEB 4FIEA 2VUWA 2X7FA 5AP1A 2VWIA 3KRJA 4ARKA 1FMKA 2JKKA 5AM6A 4O6EA 3KXMA 1NA7A 4C3FA 2OFUA 3DNEA 5DRDA 5FM3A 2ITTA 2VTOA 2RFEA 2OZAB 3FXWA 3II5A 1VEBA 3KCKA 3LCDA 4FTCA 3SDJA 3G6HA 4L52A 3WZUA 3OWJA 1DI9A 3PSBA 4I6BA 4C57A 1GZ8A 5M4FA 3E8CA 5M4UA 3QZIA 3HMNA 3PVUA 4G1WA 2BILB 1CKJA 1XHAA 4YO6A 5KHWA 2YWVA 3DT1A 4RFZA 4GSBA 1WVYA 3Q9ZA 1W84A 2EB3A 5BUEA 4KD1A 4CXAA 3COHA 4FKLA 4ZLYA 3H10A 4GL9A 4QYYA 2XRUA 4X6RA 5JFVA 1B38A 4DAWA 3EQRA 4U8ZA 2VGPA 3FZSA 3SHEA 4GJ3A 3VBQA 3G0FA 5H9BA 3ZUTA 4QTCA 4YZDA 3NCZA 4WHZA 5LQFA 3AC4A 4YP8A 2WMQA 2IVUA 3Q52A 4FICA 4JG8A 3R8MA 3VS7A 4A9SA 2VAGA 4FIGA 4CKRA 4GK2A 4P7EA 3C9WA 3REPA 3LFNA 1ZOHA 3KF7A 1AGWA 4BCMA 3W2RA 1B6CB 4YLJA 2W96B 3I1AA 4CZUA 4FKTA 3HZTA 2EUFB 3PG3A 3U6JA 3WF6A 5IQFA 3UGCA 3RPSA 3P86A 5KE0A 2BKZA 3PLSA 2F7EE 2YABA 3Q4ZA 2X9FA 1H1WA 5C8MA 3LFBA 3OTUA 2I1MA 3PE1A 2VWVA 2JIVA 5CANA 1Z9XA 3LFEA 3EN9A 3RHKA 5AV3A 4YJTA 5J1WA 2J0KA 4FSWA 4IWOA 4WRSA 4AW5A 3NPCA 4BCFA 4X2FA 3GI3A 4DLJA 3UIMA 4C38A 4HCTA 5CASA 2C6IA 3O8PA 5IQCA 3QQLA 2XJ1A 3EFWA 4U5JA 2VTAA 4H05A 5ANIA 3R04A 4XYFA 4BBFA 4E6QA 1LR4A 4XCUA 4YJSA 3R8LA 5FBNC 4X2NA 3IPHA 4L3PA 4K77A 3OMVA 4JT3A 4KB8A 2JKMA 4XRLA 5M4CA 4CCUA 5FM2A 3QUEA 1ZOEA 3FI3A 3VS0A 4CVAA 2UW8A 2CDZA 4PY1A 1J1CA 1H0WA 1I44A 1PF8A 2BHEA 3V6SA 3AT2A 3C4CA 3M11A 3P0MA 4HGLA 2C6TA 3MYGA 4I6HA 5AIRA 5EDQA 3CD3A 3LJ2A 2PVFA 3GFEA 4QQCA 4G9CA 4Q2AA 3U4UA 3FY0A 2DYLA 2FSLX 1JBPE 4M69A 3I60A 4M14A 4QO9A 3BZ3A 3E7VA 3UJGA 3DTWA 4AXAA 3RCDA 5KO1A 3FKOA 3I0OA 4D5KA 3AGLA 2WTCA 3WZDA 3ZLXA 5FUTA 3KREA 4YBKA 1L8TA 5JMSA 4RFYA 2YDJA 1IEPA 2IW8A 2C5YA 5HD7A 2GS2A 2W1ZA 3KRWA 4Y46A 5D10A 2Z7LA 2XNOA 4WT6A 4EHZA 5CSPA 5HZNA 3D15A 3ZDIA 1H1QA 4BI0A 2BZIB 4I22A 4K11A 2IVVA 3V5QA 4ANMA 3QZFA 2UW3A 4BZDA 4ENXA 5L2TA 4NL0A 4Y85A 3MB7A 5LVLA 3P79A 3BIZA 5D12A 3VS3A 2X4FA 3TDWA 3D7ZA 4IX5A 5BYLA 4MD9E 4AZVA 2VTJA 3CY3A 4AOJA 3DJ7A 3KMMA 2ZMCA 4B9DA 3HGKA 2Y6OA 1IG1A 5FTQA 4D9UA 3K3JA 4MXCA 3DK6A 3G51A 4RJ6A 4JR7A 2BRMA 5FP6A 3P4KA 4HZSA 3LXKA 3TUBA 4RRVA 4FGBA 4FC0A 1IAJA 4QP6A 1CDKA 3IW7A 5EKOA 4WSQA 4A4XA 3EQGA 3Q96A 4CEGA 4QP4A 2YISA 4DBXA 2XK7A 3HP5A 4GIIA 1YVJA 4DEDA 4FOBA 2B9IA 3MPMA 4UEUA 4R77A 3ZO3A 1YOMA 4YZBA 2W1DA 1ZYLA 4QMUA 4NM3A 4O27B 2QKWB 2PZRA 4TXCA 4FV9A 4USDA 1M7NA 2R3KA 3G90X 3QTUA 3UPXA 2ZVAA 3Q5IA 2O3PA 3NUPA 4KIKA 2BTRA 2GDOA 3IW8A 2GHGA 4RQVA 4YBJA 5EI2A 4DHFA 4EHEA 2UZNA 4XP0A 3KXZA 3O8TA 5CF6A 2CN8A 2I0VA 5CSWA 4W4WA 3AC3A 5HG8A 4PP9A 5CENA 1Q97A 2O0UA 4QP2A 2O5KA 4FT5A 4TRLA 4MNFA 1OUYA 3WE4A 2R3QA 4JRVA 4W4XA 5AP7A 2C3JA 3UIUA 3F3WA 3M42A 3GENA 5IQGA 3NW7A 4U7ZA 4IAFA 2DS1A 2VD5A 3F3UA 4YC3A 1GZOA 4C33A 5AA8A 4RVMA 4YHJA 4GKIA 5AR7A 4QYEA 4UYNA 2C0OA 1R0PA 3ZUUA 4DH5A 1Y57A 5CU6A 2ZV7A 3BV3A 2UVZA 3VHKA 3MW1A 2ITPA 2WMTA 3EL7A 2X2MA 3E7OA 3R73A 5CU0A 4M3QA 1YXTA 1U46A 2GPHA 3RKBA 4A9TA 5AX9A 4B8MA 2YZLA 4NZWB 5IQBA 1FPUA 4MQ2A 1H00A 4GU6A 3EIDA 4PMPA 5AUTA 4Z9LA 4WA9A 4AN2A 3D5UA 5HD4A 4TNBA 4X2JA 5D7VA 3NYNA 5HI2A 4OTHA 4F4PA 4JX7A 5F4NA 4Y73A 4BIEA 5A46A 1OBDA 4H3PA 4WG4A 3N4VA 4XUFA 3UYSA 5EKNA 4IFCA 2C5OA 4GKHA 4AE6A 5KHXA 2C69A 3ZTXA 3DGKA 2H6DA 3EH9A 1BL7A 3QTIA 5C26A 2GQGA 4RIXA 4KSPA 4YZ9A 2CNQA 3HAMA 4EL9A 3BGZA 4LRKA 5B7VA 4O82A 1XBAA 2B4SB 3ODZX 3E93A 1RW8A 4DFUA 5E1EA 4NJDA 3VW6A 1FGIA 5AJQA 1UKIA 3KC3A 5FLFA 4DA5A 2VTSA 3L1SA 5DOSA 3BYMA 1OKYA 2QOHA 4Z7HA 3GQIA 1H4LA 2OXDA 3QD3A 5CALA 1BKXA 5L2QA 4FEXA 2WTKC 3DB8A 5CEIA 4CYIA 3CR0A 3L8VA 4M67A 4DEIA 3LW0A 3RNIA 3ULIA 2UV2A 2WGJA 3R7UA 3DBFA 3S95A 1ZMWA 2J90A 1ZOGA 4LGHA 5BYZA 2OJ9A 3TZ8A 1YOJA 4MYGA 4L3LA 4YR8A 5EH0A 5LWNA 4KAOA 4UX9A 3GQLA 3R6XA 5IA2A 4W8DA 3NIZA 4W9XA 5LMKC 4BVUA 2PMIA 3VBYA 2VO7A 4E8AA 3GOPA 3FQSA 3FYJX 2G2IA 4E6DA 1S9JA 4GH2A 4PV0A 5KZIA 4O7WA 1MRUA 4KKHA 2VTTA 3KN5A 4FTQA 3VS4A 4EJNA 5CEPA 2JAVA 4WD5A 5AA9A 2GU8A 3ENHA 5LVOA 3T9IA 2UZOA 3PWDA 3OOMA 1BMKA 4AN9A 4R7IA 3QGWA 1ZWSA 3ACKA 1WZYA 3A8XA 1SNXA 4R3PA 4O7RA 3HDMA 3W32A 2OZAA 4YU2A 1XH6A 3G0EA 4C58A 4EHGA 4PMMA 2JDRA 2OIQA 2JEDA 4A06A 3TWJA 2JC6A 1Q3DA 4WUAA 2WMSA 3ALNA 3FZTA 3DBDA 4AT4A 1KWPA 1XH9A 2PMOX 1O6KA 4EKLA 1A9UA 1U54B 5AUVA 3WI6A 4BYIA 5BPYA 4AZFA 2X39A 4CKIA 4X21A 1KE6A 3IQ7A
chains in the Genus database with same CATH superfamily
2WQEA 3EZRA 4BCHA 2ITWA 3KEXA 2YIYA 4OBPA 5CAOA 2YIQA 4IB1A 5HTCA 1CTPE 1JVPP 3NUSA 5BVFA 4IM3A 5CT7A 3RM7A 4ZZNA 1ZZLA 3ORIA 3HLLA 2O8YA 4I6QA 4NW6A 2KTYA 3GEQA 4HZRA 4O81A 3NLBA 3MDYA 4M84A 1HCKA 1WBVA 3FLZA 2Z7SA 3QLGA 1S9IA 2YWPA 4BBMA 4DDGA 3KRRA 4F63A 4ZOGA 3ERKA 3NYOA 1I09A 5IEYA 1GY3A 3DK3A 4QMOA 5CLPA 4G31A 3FMLA 4JG7A 4CD0A 2IJMA 5IH4A 5KMLA 3LCTA 3QQFA 4QQJA 3C1XA 2WMXA 3V5JA 4BIBA 4D4VA 5BVNA 4W4YA 5T68A 2Y8OA 4L43A 3PSCA 3UYTA 2PZYA 4WKQA 2WAJA 3V5PA 4EZ5A 3T8OA 3FJQE 4U3YA 4MUQA 5IF1A 5M44A 3ZEWA 4OTWA 2HCKA 4ITHA 5E8SA 2IZRA 3A7JA 5CVGA 3F7ZA 4U42A 3UO4A 4AACA 3OF0A 5CYIA 1YI6A 1Y6BA 3U87A 1FVTA 1OB3A 2GNJA 1G5SA 3OCBA 3TXOA 5LMKA 4R7HA 4FA2A 3U6HA 5EHYA 4F9BA 5K9IA 2FVDA 3QZHA 4MQ1A 4TYIA 1H25A 3R7EA 4C62A 4DE4A 5BVEA 3CXWA 3DB6A 4IJPA 5L2IA 3HAVA 4MH7A 4A9RA 3FBVA 2J2IB 4ZTSA 4I0TA 3W0SA 5HG7A 3HP2A 3L9MA 2YA9A 2X2KA 3RPYA 1XJDA 3ALOA 2XIYA 1URCA 4CZTA 3QRUA 4E4NA 2CGWA 2VTRA 4CFFA 3VIDA 2QOBA 4FOCA 3S3IA 4AZWA 4IVAA 2CKEA 4HW7A 2WTVA 5AV2A 2QOQA 4CFXA 2BROA 4F1TA 5A4TA 1DAYA 3KULB 4ZIMA 2QLQA 3UC4A 1LP4A 3HRBA 5HE1A 4ZTNA 5I9WA 2VRXA 3BBWA 3IG7A 4C37A 4C2VA 4I94A 4WNKA 4F08A 2VX0A 3FHIA 5CI6A 4LYNA 4KA3A 4B6LA 2AYPA 4IMYA 4B8LA 2ITUA 4MXOA 3TNWA 3BGQA 4UMPA 4YC6A 5ANDA 5HVKA 3BU6A 3TKIA 4KIPA 2H8HA 3UDBA 2C6OA 4IEBA 3PXRA 4HYHA 3ZEPA 5CSXA 4FEUA 1BLXA 4H58A 3ZLWA 2Z2WA 2CGXA 5EK7A 2ZV8A 3PY3A 3N4TA 4FIJA 3BKBA 5E8WA 5TR6A 4B7TA 2ACXA 3KK8A 3GU7A 2PULA 3NVKI 4FV1A 3QQGA 5EYKA 1KE7A 4JMQA 1GIJA 2VTLA 3NGAA 3A2CA 4AS0A 3CSVA 3NNWA 2F7ZE 1QCFA 2E9PA 3NZ0A 4BTKA 2QR7A 2HW7A 3QTQA 4G6OA 4JX3A 5DNRA 3P78A 4XOZA 5IA1A 5HCXA 2XAMA 2QU6A 4E6CA 2W4KA 4GFOA 4AG8A 3AC2A 1UU3A 2PYWA 5A4LA 3VJNA 2W99B 5FTOA 1Q4LA 3GC8A 4I5HA 4BHNA 4C4GA 4FTTA 3MH1A 1PW2A 3VUDA 3DFCB 5E8YA 4BKJA 3RK7A 4QDVA 2I40A 2Z7RA 2ZJWA 3JVRA 3R02A 5IDPA 4A07A 4UALA 4J1RA 2F49A 4DLIA 2PU8A 5K0KA 1CKPA 1JKTA 1UU7A 2BCJA 2J5FA 3CKWA 3E5AA 3N51A 4L7FA 5AR2A 5EYCA 3OEZA 3VJOA 1WBTA 2PVHA 5A6NA 4BJJB 3POZA 3CGOA 4LMNA 2HZIA 3COMA 1O6LA 3EWHA 4CV8A 5H2UA 4ZY6A 2V55A 3FY2A 3IS5A 4BRXA 5E90A 1Q8YA 3H9OA 4U3ZA 2EVAA 4LV7A 4FVQA 3DAJA 5EQYA 2ETRA 4IWPA 4L00A 3OBJA 4O4DA 2Z02A 3PG1A 3LCOA 3VUGA 2FH9A 3UVPA 4AFJA 4EOLA 5AV4A 5J9YA 5JN2A 2R3OA 4G3GA 2VWYA 4J97A 2RKUA 4YZCA 5JEBA 5LCKA 3SXRA 1G8AA 4TYHA 4DFNA 2F9GA 4AXDA 3I5NA 4NH1A 4YC8A 5AV0A 4UWYA 5EDPA 2C68A 4ZLOA 5M51A 3UZRA 4CFVA 4TT7A 4BGGA 5JFSA 4KBCA 4AX8A 5A4QA 1B39A 3Q04A 4U0IA 4QNAA 4DFYA 5A9UA 3COIA 2XKEA 3LE6A 3FHRA 3HV4A 4BL1A 2XNNA 4XG2A 3BE2A 2BAJA 3MGYA 4KKEA 4ZTRA 4FEWA 3SOAA 2UW0A 4QMPA 2ZM1A 3EFKA 5BYYA 1OPLA 4RVTA 5AUXA 5H8GA 5B2MA 4KWPA 2WMRA 2WQBA 4UXLA 2BALA 3P7CA 5HE3A 4O0TA 4E4XA 4AZEA 1OITA 2P2IA 2VO3A 3UNJA 4NEUA 4DCEA 5K5XA 2VN9A 2IN6A 4I3ZA 3VS2A 3KGAA 2XIKA 2BRNA 2R3MA 1H1RA 4RA5A 4QTAA 5EYDA 3H9FA 2CCHA 3C13A 3LMGA 4ZSJA 4IQ6A 3G9LX 3ENMA 2XF0A 3QQUA 4JOAA 5TE0A 1JSUA 2UZUE 3PA5A 3MFTA 3QCQA 1V1KA 3PZEA 4F9YA 4V0GA 1H1SA 3MSSA 2CKQA 4IWDA 3AKKA 2X8EA 4XG7A 3A60A 2IO6A 2WTIA 4YTFA 3EYHA 2BZKB 1YHSA 2WQMA 4WSYA 5LVNA 3Q2JA 3D4QA 1XBCA 3BHVA 2QNJA 4PMTA 2XBJA 5GIOE 5I9ZA 1OL1A 2FUMA 3FMNA 2R5TA 4GT3A 3PVBA 4G6LA 1BX6A 4P5ZA 4HGSA 4CNHA 2W17A 4TW9A 3ZLSA 1ZLTA 1PYXA 4EOSA 4FT3A 4AUAA 5IQDA 3FKNA 4ZZMA 4KSQA 5FBOA 2XIZA 2REIA 4G3CA 2PWLA 2PVRA 2Q0BA 1Q5KA 2YM4A 4JRNA 4NM5A 3I4BA 4ZTMA 4LRJA 4CGAA 2FO0A 4FIHA 1GIHA 3KXXA 3UOKA 2E9OA 3CE3A 4APCA 1W82A 2YLEA 3FQEA 4PPAA 2R4BA 4JQ7A 3NUAA 5BX0A 4UMTA 3FC1X 2WD1A 4LUDA 5DI1A 4C02A 2JKQA 3VUHA 4KS8A 4ALUA 2CGVA 3QRTA 4BC6A 4D28A 3OXTA 2WIHA 4K18A 3DOGA 1LEWA 2BUJA 2PVKA 3OFMA 4L53A 5HIDA 4BCGA 2OW3A 3LAUA 4FRFA 1IRKA 1VLRA 5DFPA 3A4PA 2PMLX 2HWPA 3A7FA 4G6NA 4WG5A 5TF9A 4QMZA 3SC1A 3VO3A 3UOLA 1CMKE 2W9FB 5D7AA 5F94A 3TZ7A 3TJCA 3GFWA 4EQCA 4WG3A 4NK9A 4Y95A 2YHVA 3DV3A 4HYIA 4QMVA 4EOIA 5CEQA 1UNGA 5IDNA 1F3MC 1J3HA 2Y4PA 4F6UA 4NM7A 3BHHA 1U5QA 3RZFA 3SV0A 3PXFA 3TNHA 3CS9A 2J0MB 2IF8A 2QR8A 3EQPA 4IAKA 4A7CA 4NUSA 3QGYA 3ID6C 4DDIA 5ANEA 4FTOA 2OJFE 1Z57A 1YDRE 4DN5A 1O6YA 2UW5A 3H0ZA 2I0HA 4OTQA 2YFXA 4PF4A 5AX3A 3TTJA 4BCIA 3CTHA 4MAOA 3FMHA 2C3KA 2CJMA 3ZBFA 4XHKB 2W1EA 3CIKA 3TDVA 1U54A 2XRWA 3V5LA 3NAXA 4UMRA 5AR5A 2J51A 5HNIX 5IKWA 4MBJA 2XK3A 4GU9A 3ZC6A 5HCZA 3T3UA 3UIXA 5CX9A 3AD6A 5DR9A 5DWRA 4QP9A 3UIBA 3MS9A 2OFVA 5C1QB 4FSMA 4JBOA 5HG5A 3AXWA 4CQEA 4D5HA 4HPUE 5AFVA 3JY0A 4FKQA 4OTFA 5ACBC 4K0YA 3ROCA 3GXLA 4CRSA 5HTIA 1PMNA 2UVYA 4CMTA 5EI8A 3NAYA 4RG0A 3CC6A 3EQCA 5A54A 4YJPA 5BUJA 3HV7A 3MH3A 3W0OA 2F4JA 3F66A 1W83A 4TWPA 5AADA 1BL6A 5E8XA 2WU7A 4YHTA 4EC9A 3ML1A 3F3TA 2WOTA 4OW8A 4QPAA 4LI5A 3MJ1A 5K4JA 1MQ4A 2QC6A 4AF3A 3QCXA 4TL0A 2FSMX 3HECA 4UMUA 3BU3A 3DBEA 3RCJA 5BVDA 5BVWA 5KMMA 4AW2A 4CG8A 4OBOA 5E8ZA 3RNYA 4OR5A 3MPAA 3OHTA 3LMHA 3MVMA 3RK9A 3RP9A 4FTMA 1ZARA 4YUQA 4ASZA 2YCSA 1SM2A 1KV1A 4GK4A 4PMSA 3SG9A 2R3GA 3TL8A 4EOQA 1G8JA 4WNPA 3PJ3A 3HMOA 2BIKB 1ZAOA 3WE8A 4AA4A 1PHKA 1P4OA 1FBNA 4HVIA 1UNHA 2Q83A 5E9EA 5JKGA 4R3RA 4RWLA 3U9NA 3VBVA 1ZMUA 4O7ZA 3A8WA 3C4WA 3NUYA 3N4UA 4D0XA 5IEXA 5AR3A 4AGDA 1TVOA 3KN6A 4FKWA 2JDTA 3VONA 3LPBA 3R63A 4FTKA 4H1MA 5CQWA 1OIQA 2YDIA 3NIEA 3PYYA 4L68A 2BRGA 3G15A 4QP7A 4BGHA 3H4JA 3KMUA 5IQIA 4NYEA 1F0QA 4NTTA 3ELJA 3VF8A 4ALWA 4M15A 2QONA 5DG5A 2F7XE 2P4IA 3GOKA 2QCSA 4IX6A 4OTDA 4ZSGA 1RQQA 2WU6A 3KULA 3P08A 3NCGA 3MPTA 4M0ZA 3ITZA 5CY3A 3AMYA 1H8FA 2XS0A 1Y8GA 4LM5A 2JD5A 4O4EA 4IVDA 3ZU7A 3VW8A 3Q60A 3PPZA 3PVGA 5EM8A 5HE2A 5HO6A 3VRZA 5BV3A 4G3EA 3UPZA 3BQRA 2V22A 2OBJA 4EUUA 1BYGA 3Q4UA 3QRIA 3ZZEA 3HV5A 4Y8DA 4A9UA 1G8SA 3B8RA 3R0TA 4IJ9A 4FEVA 3ZRLA 4AZTA 2RGPA 3CPCA 4PTGA 2HAKA 1V0OA 4NWMA 2BFXA 2RIOA 2LGCA 4NSTA 4LFIA 4UMQA 3ZO1A 5IISA 5M4IA 4D2RA 3FDNA 5LOHA 3KKVA 5HNBA 3C7QA 4XBUA 3UO5A 2F57A 3IKAA 3WIKA 3NEWA 1TKIA 5BNJA 2GSFA 5LWMA 3RJCA 2C6MA 2P3GX 3GGFA 1OPJA 4DEAA 1W2CA 3ZS5A 2WELA 1R0EA 1YI3A 3LJ1A 4JBPA 1H27A 3MB6A 3VUTA 3HMIA 4AU8A 2BZHB 3BELA 3VHEA 3CJGA 3WYXA 4YPSA 3DBCA 4QD6A 2BHHA 5LVPA 2XVDA 5CSHA 4YJRA 3C5IA 2R3IA 3PJ1A 3QZGA 3AT4A 2OK1A 5KKRC 4LOOA 3FLSA 3EFJA 4WO5A 2EXMA 4YURA 4NKAA 3WZKA 3FMJA 2R3NA 2WNTA 4RX7A 2UZLA 3R7OA 4X3FB 3MFRA 2VTPA 3AC8A 3RINA 3TJDA 4QP8A 4I41A 4PPCA 3GU4A 1OIRA 2XM9A 4BJJA 4PL4A 4S31A 4C4FA 2AQXA 2EWAA 3U55A 1JSTA 4TTHB 2IW9A 4J8MA 4O21A 3WF9A 3M1SA 3Q2MA 3JYAA 5AUWA 1ZYCA 2E2BA 5CVFA 4F7NA 2YEXA 4O7YA 3C4FA 3DJ5A 4CT1A 4Z3VA 5I3OA 4QPSA 5AMNA 3I6UA 3PXZA 5HESA 2ZAZA 5JFXA 5AR4A 4OTIA 4FTUA 4RA4A 5ETIA 3R8ZA 3KRXA 2QG7A 3U54A 1PXKA 1A06A 1XH5A 2GS6A 3FLYA 3W1FA 4YJQA 2BRHA 2OJGA 2WPAA 3QFVA 3OCGA 4R8QA 3KXGA 3CLYA 5CU4A 2JFMA 3QD0A 5L2SA 4ZTHA 2OF4A 3F9NA 4BDGA 4ERKA 3A7HA 2XIXA 2B53A 4QRCA 4R7BA 2BAQA 1MRVA 4O0YA 4PDOA 2WTWA 1DAWA 3GU8A 3PXKA 2I6LA 5HG9A 3MY0A 3PZHA 3U8WA 4FKPA 2GFSA 3BPRA 4S32A 1SNUA 3L8PA 5J5SA 1GZNA 4ANLA 2B9HA 4DC2A 5KMNA 3COKA 3LFAA 4I93A 3AKLA 3V51A 4ZJJA 3D2KA 2FB8A 4U40A 3QRJA 1YWVA 4BTFA 3HYHA 2X2LA 2HZ0A 1K2PA 1YWRA 4K6ZA 4EOJA 3F69A 3MA3A 3DKOA 4ASEA 2XCKA 5KCVA 4G3DA 2A19B 1ZMVA 1VZOA 3TUDA 3MA6A 3UZTA 1E9HA 4XNEA 2GNFA 2F2CB 1OKZA 4FIFA 4S2ZA 4FZAB 2PY3A 3WILA 4CFNA 2VO6A 3OY3A 5JQ8A 4YSMA 3RK5A 3ZO2A 2XM8A 4ZSEA 2UZVA 4HCVA 3NUNA 3PFQA 3L8SA 1HOWA 3V8SA 5A4EA 5A6OA 2OWBA 3CEKA 3R28A 5DYJA 2PK9A 5ANGA 3O96A 4CKJA 4D1ZA 3VRYA 1FQ1B 1MP8A 1YI4A 3I81A 4JG6A 4LUEA 4C3RA 5J7BA 3OVVA 3QXPA 3FLNC 3O7LB 2EU9A 2BDWA 5ANKA 2RG6A 3D7TB 5GINE 2W1HA 4GMYA 2YITA 5EG3A 3ATTA 2BTSA 4EC8A 1YDSE 2QOLA 4FT0A 4C59A 3PE2A 2JGZA 4LOQA 4MCVA 4M13A 3ZONA 4I4EA 3BYOA 3E8NA 2Y0AA 4RLLA 5A14A 3FMEA 4EUTA 2QQ7A 2UZTA 2OH0E 4J53A 4GCJA 2QOOA 2WO6A 4RJ3A 5CAPA 5FEDA 3VN9A 1EH4A 3MVJA 3V8TA 4E4MA 1H08A 3QTZA 5DA3A 1UVRA 5IU2A 3P23A 1XR1A 3BQCA 4LV5A 3QTXA 4D1XA 5HO8A 3DXNA 3EHAA 1W0XC 2YN8A 2UZDA 2VWXA 3OWKA 4MXYA 4YZMA 3RM6A 4BCNA 4RFMA 2RG5A 4XMOA 2BIYA 3MTFA 3OBGA 2FSOX 4FTJA 2A2AA 5HTBA 3SW7A 5B0XA 1Q24A 2XMYA 3ANQA 3P5KA 3FWQA 5AV1A 3TN8A 3R2YA 3TUCA 2IVTA 3E92A 4DH1A 1YXSA 1P2AA 1WCCA 4M8TA 4BB4A 3RPOA 4AQCA 3HUCA 1V0BA 4EJ7A 1YQJA 3EN6A 1MUOA 1VYWA 1ZRZA 5KX8A 3UTOA 5HCYA 4F0IA 1YRPA 1IR3A 4XG4A 4DH8A 3W2OA 2VNWA 3ZOSA 1QMZA 1WVXA 1ZYJA 4L44A 2GHLA 4ACGA 2OICA 1M17A 3VWAA 4F70A 5DLSA 4FSNA 4O2ZA 5IEVA 5IQHA 2ITXA 4EHVA 2IZUA 4O2PA 3R7IA 2GQSA 2XP2A 4DH3A 2IWIA 3GUBA 3QALE 2VWBA 3E88A 1SVEA 2HELA 2PZPA 5IA5A 3TKHA 1JWHA 1NVQA 2ZOQA 4O0UA 4ZSAA 3EKKA 5B2KA 3PP1A 2R2PA 3K54A 4J96A 4LGGA 1BUHA 4EK3A 3NW6A 4I5MA 5C27A 4D2VA 4IB5A 5M53A 2YM8A 3RAHA 4IH8A 4HOKA 4ASDA 4XOYA 5JSMA 4TY1A 3W8QA 3QKMA 2HZ4A 4I0RA 5EW9A 3MESA 4QT1A 3FZOA 4OUCA 5IH5A 3SRVB 4J7BA 3UDZA 4GG7A 4QQTA 3GU6A 4MNEA 4V01A 1TQMA 4XP3A 4L7SA 3L9NA 4AT3A 4RX8A 5HBHA 3OY1A 4I6FA 4NIFB 3PA4A 1AQ1A 2XK9A 4C61A 3LLTA 3W2QA 3RPVA 4BTMA 4IE9A 2OLCA 3TZMA 4FEQA 4WNMA 5B2LA 1YXUA 1LEZA 3SD0A 5HBJA 3IONA 4HPTE 4E20A 1YW2A 3EZVA 4TWCA 1H1PA 2ZB0A 2NNWB 4NFMA 5D9HA 3THBA 3H3CA 5TT7A 3VBTA 4ACCA 2JKOA 3QUDA 2XBAA 5AUZA 3D2IA 3SOCA 3KQ7A 3B2WA 3BHYA 3D0EA 4PX6A 2A27A 2Z8CA 5K4IA 5J9LA 3NYVA 4A4OA 3B2TA 3LCSA 3FE3A 4BR3A 2W1CA 3O0GA 3I6WA 5KZ0A 2P0CA 3TV4A 3EB0A 4L67A 4MD7E 4MWIA 3UQFA 1J1BA 3FZRA 4CCBA 4DITA 4N0SA 4OAUC 4ONAA 3R9OA 3IW4A 1ZYDA 4DTBA 3PLAE 4BDFA 4KIQA 1FMOE 3VUMA 4V0GB 5AEPA 4O83A 2WIPA 1PXMA 4IZAA 4BDCA 1ERKA 1U59A 1IA8A 3WZJA 2XNBA 4BCJA 2H34A 3GCSA 3IK3A 3KF4A 4ZTLA 4BCPA 2B7AA 4F1OA 5EHLA 2QVSE 1YWNA 2YM6A 3BGPA 5AAFA 4BDDA 4RIWB 3ZFXA 2E9NA 4CMOA 4EI4A 5GZAA 3HVCA 5AP5A 4J95A 3JVSA 4FKSA 3GBZA 1PMUA 5KMIA 3QA0A 4MF0A 5KNJA 4ZZOA 2B9JA 3A61A 3RTPA 3QCYA 1J7LA 2WHBA 5KMOA 4F7LA 4QTDA 1OGYA 5DH3A 4FZFB 2NO3A 3TV7A 3EN7A 3KMWA 4FKJA 3RAWA 3D9VA 5I0BA 4DGMA 4Y5HA 2CKPA 3R8PA 2C1BA 1XH7A 3E8DA 2OJIA 2G01A 4O4CA 4AWIA 4CMUA 2HY81 1R3CA 3TACA 4GT5A 4MXZA 3DZOA 3UQGA 3UDTA 3OTVA 4E1ZA 4F9WA 1KSWA 2V5QA 2JBPA 4K1BA 1REKA 5JGAA 4H1JA 1T45A 2QO2A 4DG3E 1FINA 3LJ0A 3PIXA 4I20A 4O38A 1WVWA 4RC3A 3VQUA 4K33A 2V7AA 2DQ7X 5M07A 2BZJA 3BCEA 2R0UA 3AOXA 5FEEA 3OG7A 5C03A 2B55A 5CQUA 5IH6A 3ZC5A 3MFUA 1Q8ZA 5DPVA 4FJVA 3AC1A 3W55A 2PHKA 3IO7A 1KV2A 4CLJA 2GNGA 3LM0A 5CXZA 3QC4A 1WMKA 3QQHA 3L8XA 5I9UA 3RPRA 4FTIA 4X6QC 3W2CA 2WOUA 3OUNB 5DRBA 1W2FA 3TV6A 4L3JA 4PUZA 4C4HA 4MTAA 3DAKA 3LXPA 3QHRA 2OI4X 3HV6A 4PDSA 4U45A 5AP2A 3U51A 5EHOA 4BDAA 4BZOA 5IA0A 2HENA 1OGUA 2Y4IC 1PMVA 2RSVA 5G6VA 1MRYA 1YHWA 4F0FA 5L4QA 3DXQA 5CU3A 1R39A 3V8WA 4X2KA 4BCKA 4EORA 5HQ0A 4XV2A 3CGFA 4E7WA 4X0MA 3W16A 4RJ5A 4RZWA 2I0YA 4C2WA 2CNVA 4CQGA 2HIWA 3SXSA 1QPEA 1PXLA 2ZFYA 3LKMA 4E5WA 3OWLA 4GUBA 5HGIA 1H24A 5HORA 4IAZA 5LJJA 4RIOA 4DT9A 4HJOA 2XZSA 2QLUA 3EN4A 4ANQA 3MY1A 4EK5A 5AAEA 3OOGA 3Q4CA 3ODYX 4DG2E 2HK5A 2ZB1A 3DFAA 2BVAA 4H39A 2EXCX 2C0IA 5J87A 2W4OA 5KUPA 2BR1A 3K5VA 3OROA 5GJGA 3ZH8A 2GS7A 2X0PA 4DINA 3R9HA 1TFFA 3EJ1A 3RMFA 3ZDUA 1Z5MA 2O2UA 4FNYA 3DKGA 2H96A 3G33A 4WBOA 3ZM4A 2JDOA 1DI8A 3O17A 3ZXTA 4G9RA 4YHFA 3ZZWA 5BMMA 3GB2A 4PRJA 3C0HA 3TTIA 4JAIA 3CY2A 4MKCA 2I0EA 3ET7A 2DUVA 3ZHPC 4Z16A 3FL5A 4GV1A 3IW6A 4PL5A 2J4ZA 3BEAA 2V0DA 1BI8A 1PXPA 4BKYA 5CXHA 1VR2A 1IASA 2QOIA 3HRFA 5DIAA 5KBRA 1XMMA 4G5PA 3VC4A 1RJBA 2XNPA 4OTGA 1OUKA 4QYFA 3AD5A 2R7BA 4FX3A 5I4NA 1OL7A 3QD4A 1T46A 3GCQA 3UP7A 3QTSA 1SVHA 2A4LA 4RLKA 4PNIA 5F95A 3D7TA 3OP5A 3FXZA 3SXFA 3BRBA 4C4IA 4EYJA 4I6LA 3NMUF 3FL4A 3S4QA 5GZ8A 3QCSA 4P90A 3QTWA 1R78A 4TYJA 4XG9A 2IPXA 3F7WA 1ZY5A 3V3VA 3LQ5A 2IEWA 3SVVA 2YIXA 2QO7A 5FTGA 1PY5A 2PSQA 3IDPA 3DLZA 4YNOA 4JDJA 4RC2A 3Q9XA 3KXHA 3R21A 4B99A 4DCAA 5EOBA 2P33A 3LMIA 5G1XA 2X4ZA 3KCFA 2XNGA 4G5JA 1A48A 2E9VA 2W5AA 3C4ZA 2CHLA 3QTRA 2B1PA 4FV5A 3LXNA 1FGKA 3ANRA 3KFAA 4EH9A 1G8KA 3I7CA 3ORXA 4BY9E 2X8IA 2CLXA 4O0SA 2VZ6A 4GYGA 4J8NA 5IZFA 4FR4A 3KIOC 3F3VA 4P5QA 3W10A 2WMBA 1U5RA 3TIYA 3GC9A 3WARA 1OKVA 4FV3A 5EQEA 5H8BA 3KA0A 3Q4TA 4IBMA 4DH7A 1UWHA 1UA2A 3CTQA 3HKOA 5TO8A 4JS8A 2R3RA 3JXWA 2GNIA 4FKOA 4DTAA 1OIUA 4FVPA 4E93A 5HEZA 2W1FA 4MXXA 4TWOA 4J52A 3R1SA 4CSVA 4NKSA 4CFMA 3V6RA 4XV9A 4A9YA 4FSTA 4I0SA 4KIKB 4HGTA 5J7HA 3DJ6A 4FZ7A 2QD9A 2QODA 3RVGA 5I9XA 2HZNA 3R1QA 3FMDA 4OGRA 2VO0A 3F3ZA 4FV4A 1PKDA 3CTJA 4RWIA 4L6QA 3PDTA 5HLPA 3BU5A 1HCLA 3MN3A 3ORPA 2JDVA 2VTIA 3NYXA 4LV8A 4FV0A 2X0QA 1DS5A 3RI1A 4KRDA 4BICA 4HVDA 5JZJA 3CD8A 5T6KA 4DGOA 4GG5A 4D1SA 1SZMA 2OSCA 3TNPC 4FUXA 4ANSA 3SG8A 3R7VA 4K8AA 1OZ1A 4RIYB 4WUNA 2XK8A 4JDKA 5D1JA 4UV0A 2WXVA 3DCVA 3FI2A 4FBXA 2OGVA 5KMKA 4YPDA 2J9MA 2W9ZB 3Q3BA 5GJDA 3RAIA 4GFMA 3F5PA 5E8VA 4C4JA 4ZMFA 1R1WA 3PRIA 2PVYA 1UV5A 2VU3A 3SLSA 3SRVA 4ZXTA 3DLSA 3QD2B 2YAAA 5E8TA 2AC3A 3UQCA 4N4SA 4D4SA 3FPMA 1PRYA 4L8MA 4XV3A 4E6AA 4USFA 4FSQA 3W0QA 5CNOA 4FVRA 2X0GA 3K5UA 4WBBB 4XEYA 3VBXA 3DZQA 3TT0A 4QTBA 5HLWA 4O0XA 5IG1A 3MY5A 4YTIA 5CSVA 5EM5A 3E62A 4X2GA 3FPQA 4U81A 2X8DA 2YERA 5EYMA 4JXFA 3ORKA 1Q3WA 1ND4A 3R2BA 4DHZA 2VTNA 2PUPA 4JDHA 2PVMA 3FI4A 3R9NA 1G3NA 4MWHA 4UB7A 3F2NA 4EOPA 4IADA 4FV8A 3DNDA 2HXQA 5I5ZA 3QKKA 2B54A 2Y9QA 1NW1A 2FGIA 4GVAA 4S33A 3A99A 2C1AA 4FV2A 3VS6A 1K9AA 2ITYA 2Z60A 4IM0A 4EZ7A 4PNKA 5HO7A 4EONA 4TZRA 1JSVA 1PYEA 2C5VA 1H07A 3FLQA 4IDTA 3W2SA 5FRIA 4Q5HA 3W2PA 4KINA 3NFGB 4BYJA 4HNIA 3ZO4A 3UODA 5E91A 2C3LA 5HNGA 4L9IA 2B9FA 4TN6A 4EQUA 3JR1A 2J0LA 4JDIA 4DYMA 1YHVA 2WMVA 3GU5A 5F1ZA 5IUIA 5GHVA 4PP7A 3W0NA 3AD4A 4PL3A 5DGZA 5J8IA 1TQPA 4HYSA 4F65A 5ITAA 4N57A 2J6MA 4J99A 4L42A 4DGGA 3K2LA 3PA3A 2VGOA 5E7RA 2JFLA 4DFZE 2Y7JA 4YJOA 3IW5A 2PPQA 3ZM9A 3C50A 1O9UA 3NSZA 5C8KA 2EXEA 3EQFA 3TZ9A 2ITQA 2ITZA 3B8QA 2HW6A 4BWPA 2YDKA 5IA4A 4HGEA 1Q61A 4LOPA 4EZ3A 5JGBA 4AQKA 4G3FA 3F5UA 4RIWA 3CQUA 3BX5A 3OXZA 2WB8A 2PE1A 4ITIA 4EBWA 4ZP5A 3Q6WA 4Q5EA 5GZ9A 1GNGA 1KUTA 4EQMA 3PTGA 4DT8A 3AMBA 4MBLA 3RWQA 1M7QA 4IX4A 4EYMA 4F78A 5CS6A 4B4LA 2RFNA 3VNTA 3UE4A 1H26A 5AUUA 2PVLA 1UU9A 2GTMA 4GK3A 5CT0A 5AP3A 4E73A 2BMCA 2PL0A 1W2DA 4KNBA 3MIAA 2R9SA 4OT5A 4PDP