2Y4IB

Ksr2-mek1 heterodimer
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
279
structure length
265
Chain Sequence
b'SIFLQEWDIPFEQLEIGELIGKGRFGQVYHGRWHGEVAIRLIDIERDNEDQLKAFKREVMAYRQTRHENVVLFMGACMSPPHLAIITSLCKGRTLYSVVRDAKIVLDVNKTRQIAQEIVKGMGYLHAKGILHKDLKSKNVFYDKVVITDFGLFSEDKLRIQNGWLCHLAPEIIRQLSPDEDKLPFSKHSDVFALGTIWYELHAREWPFKTQPAEAIIWQMGTGMKPNLSQIGMGKEISDILLFCWAFEQEERPTFTKLMDMLEKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords KINASE SUPPRESSOR OF RAS 2
publication title A Raf-Induced Allosteric Transition of Ksr Stimulates Ksr and Raf Phosphorylation of Mek
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 56
structure length 265
sequence length 279
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2y4iB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2y4iB01
4RC2A 3ZYAA 4YC8A 1UV5A 2VUWA 4TZRA 3QTIA 3L1SA 4TW9A 3RPVA 1NVSA 2UZLA 3PTGA 4D9UA 4NU1A 5I9UA 3QX2A 4FV5A 4FV6A 2Z60A 3RI1A 4W9XA 4ALWA 5AWMA 3H0YA 2GQGA 3SXFA 3H9RA 3M42A 4C8BA 3OCSA 5BQ0A 4AUAA 4IDVA 3ORKA 4PL4A 4YJPA 1F3MC 4IZYA 4YNEA 1PXMA 5A4EA 4EOJA 4G6LA 5IQCA 3HGKA 5HD7A 1RQQA 2E9OA 1MP8A 3BBTB 4O0XA 3RAKA 2WIHA 2XEZA 2CJMA 4L01A 5FBNC 4YBKA 3VWAA 3RALA 2C3IB 4QYYA 3DK3A 3FQHA 3L9PA 4M69B 4APPA 4ZMEA 4BCKA 1ZLTA 4BTMA 5IMXA 4O86A 4FYNA 2RSVA 5HE0A 3MA3A 2GS6A 1PXKA 2PVHA 3D5VA 5F94A 3WZJA 2BKZA 2QOIA 4MF0A 3H9OA 4BWXA 2J4ZA 3CIKA 2RG5A 3MFUA 4ARKA 3U6IA 4FKRA 4I5HA 4JIAA 4M0ZA 4CVAA 5E8XA 2PUPA 1UU8A 3D15A 3PXRA 2JGZA 1H00A 5IDNA 3JXWA 4DG0E 4E26A 3CJFA 5CEPA 3ET7A 4NYEA 4X0MA 3QX4A 4QMOA 1YW2A 3VUKA 3N4UA 2R3GA 5CAPA 5DPVA 3A7GA 4FVRA 3BRBA 4LQMA 3KC3A 5CSHA 4AOIA 1M7NA 3D2IA 3C4WA 3GC0A 4E20A 4QNYA 2IW6A 1J7IA 4BGGA 4HVDA 3G51A 4ANNA 4UMRA 4O7ZA 5GZ8A 4A4LA 1ZY4A 4XOYA 1F5QA 5LARA 1Q62A 3I5ZA 3SRVA 2G2HA 4ZJJA 4BDHA 2C6LA 2HENA 4MBJA 3PZHA 4UMQA 1R3CA 4I3ZA 1PYXA 3RHXA 5A46A 2XS0A 3UOHA 2BDJA 3BV2A 2XIZA 4RBLA 4BGQA 3KXMA 3VS2A 3O50A 3ZFMA 4M0YA 3GXLA 4PMMA 2PUNA 4NM5A 3FLNC 3VUGA 4B8LA 4ITHA 5GIPE 1YKRA 4IH8A 3KY2A 3E63A 4YNOA 2YLEA 5ANGA 4C34A 2EXEA 4FKSA 4A7CA 2EB2A 3Q60A 3UP2A 1DI8A 3EN7A 3EOCA 5EKNA 4FGRA 4AA0A 2JAMA 2IPXA 4FV2A 4AFEA 3FXXA 4NM0A 4YP8A 2XNNA 2XK9A 3KRJA 3V51A 2C6TA 2JIUA 4AX8A 4DGOA 1OB3A 1XKKA 3PPZA 4ENYA 3L8PA 2BRGA 3O8TA 4K6ZA 3V5LA 2PMIA 4JG6A 4PX6A 1KSWA 1XH6A 4H58A 4E4LA 5J9ZA 3JVSA 3JS2A 4R6VA 4ITJA 3RK7A 4BDFA 3UZTA 1YDSE 4M84A 2OZAA 2W7XA 3FY0A 3PY0A 3W10A 1H07A 5F95A 4X21A 2GDOA 1UNGA 5HE3A 3GBZA 1Q8TA 4GVJA 1UU9A 5EI8A 2CKEA 3PP1A 4DEHA 2PU8A 5CEQA 4FKJA 4S33A 3JVRA 3MN3A 2BRNA 2VTPA 2W1IA 4YZDA 5CT0A 4FEUA 1KV2A 4EYMA 2CKPA 2VTOA 4OBOA 4FC0A 2XK8A 4CFWA 3UG1A 4FTOA 4OR5A 5DVRA 3P9JA 2XB7A 3LKMA 2IVVA 4YPSA 2X9FA 2R3HA 3R0TA 4Z3VA 1KE5A 5M4IA 2ZV9A 5D10A 2B9FA 5I3OA 2PVNA 3VHKA 3L8XA 4NT4A 1OBGA 1K9AA 3HVCA 3MGYA 4F6WA 3Q6UA 1STCE 3L9MA 3FMNA 4EQCA 4FV1A 2XRWA 1NW1A 1T45A 3FPMA 3A99A 3KFAA 1OKZA 4MXXA 2IW9A 3N9XA 5G1XA 2XMYA 3ORTA 3D83A 3P7AA 3FSKA 3HAMA 5M06A 1QCFA 1SVGA 4GEOA 4PPAA 4D1SA 5D1JA 5J5TA 2VTSA 3RCDA 3MESA 2JIVA 4O7NA 3ITZA 2O63A 4CFMA 3IQ7A 3LFCA 4EHEA 1OUYA 3KL8A 4GFOA 2ITXA 3BEAA 4GT4A 4WO5A 5FXSA 3V6RA 1KOAA 2GSFA 1WVWA 3E7VA 3QTWA 4L67A 5AP6A 1J7UA 4D2PA 4LRJA 3MY0A 3ZM9A 3F7WA 2HW6A 4RWJA 1XWSA 3FXZA 2YCSA 4IE9A 4EHZA 1KV1A 2WMAA 4ZMFA 4RZVA 4O91A 1OUKA 5LQFA 4JT3A 3VN9A 3KVXA 4GS6A 3ZC6A 1J7LA 3HV6A 1RW8A 5ANOA 4JVGA 5KMOA 3QCSA 2BRBA 1XH9A 3SC1A 2X6DA 4F64A 2J0IA 3LCOA 1IA8A 3R28A 2GHMA 3TNHA 2VTRA 1JVPP 4H3QA 4EC9A 5DEYA 4EZ3A 4FKOA 1OKYA 2QU6A 3FJQE 3KCKA 4BCIA 1HOWA 1FGKA 1YXUA 5IQAA 4D2SA 4S31A 2G1TA 2YACA 4ZZNA 3NAXA 4PMPA 3AT3A 5AM6A 1ZARA 4O0TA 4V04A 3L9LA 5CVHA 5F20A 5HEZA 3W55A 1Q97A 4OAUC 2R3PA 4O0SA 3C4CA 3DNDA 5IQBA 3VRZA 5D12A 5CEOA 4IM2A 4YJRA 1H08A 3NUAA 4P90A 3MWUA 3SLSA 2GNGA 3BQRA 3IO7A 3AOXA 1B39A 4BDAA 4TXCA 2R3KA 5IA3A 2Y0AA 4F9WA 3EMGA 5AUWA 2V0DA 3A61A 4ACDA 4MBLA 5BX0A 3AT4A 3ELJA 2CNVA 5ANEA 1URWA 2WB8A 3BLRA 3MTLA 4J1RA 1GY3A 1GZOA 2G2IA 3TTJA 2YFXA 2OIDA 3G90X 1A9UA 2BZIB 2VTJA 2W0JA 4E5AX 5J1VA 1E9HA 4MH7A 4KIKA 3AGLA 3HV7A 4JL9A 4MXOA 4JQ8A 4O2PA 2JDTA 4Z7GA 3L9NA 4RVTA 4DEDA 2ITZA 3WZDA 4G3GA 2R3QA 4XBUA 3SXSA 5GJGA 2OF2A 2OJIA 4AT3A 2VTQA 5AV4A 5CVFA 2VWZA 4PP9A 3GP0A 4FSTA 4ZTSA 4FIJA 2X81A 4D4RA 3UOJA 2I1MA 5EOBA 2E2BA 3D0EA 2YCRA 3E62A 2BKKA 1BI7A 2EB3A 3A8WA 4FIEA 4X2KA 4J98A 5GZ9A 3O17A 4UYAA 4PP7A 2WTIA 4J8NA 4JG8A 3GC7A 2DYLA 5HBJA 5J8IA 5EYCA 3ZMMA 3QQJA 4BR3A 4BCMA 1TQMA 4KNBA 2O65A 4EOQA 4AGWA 4GV1A 1JSUA 5H8EA 3P86A 2OK1A 2YWPA 5ANIA 3NNXA 3SA0A 2VD5A 2BCJA 3GB2A 4JR3A 3IS5A 3MB7A 3G9LX 4RRVA 4ANSA 3TUDA 5HESA 1LR4A 3FKOA 1PKGA 5C8NA 2W5AA 3OMVA 4YLJA 1NA7A 3TXOA 3R7GA 1G5SA 4GT5A 4OTFA 3QQFA 4FNYA 4AN2A 5M53A 3TKUA 3UGCA 2X2LA 3NUXA 5EYDA 5LMKC 3QRJA 1ZMVA 3O2MA 4IWOA 3L8VA 4BTFA 3SG8A 2ITUA 4DBXA 3BZ3A 1J1BA 3OY3A 4MTAA 3MW1A 3OXZA 3FZTA 3VAPA 3PDTA 3PVWA 2PVRA 3KB7A 4FICA 4KKEA 3AXWA 4WA9A 5BYLA 3OY1A 3HRCA 4XP0A 3VF9A 2A2AA 2QLQA 4LMNA 4D2TA 2DS1A 3PLAE 3NGAA 4CXAA 2EXCX 5I3RA 3ZS5A 2CN5A 1YVJA 2OKRA 2XBAA 3FLWA 4USDA 4FV3A 3W33A 1BI8A 3ZLSA 3F5GA 3QTQA 3VQHA 2PTKA 4FSYA 5AAEA 1XH5A 5J5SA 4M13A 4QMTA 3LIJA 4F7LA 4EKLA 1OIUA 3K54A 1ZOGA 3DJ5A 3GU6A 4K2RA 5K5XA 4S30A 4I23A 4K11A 2FUMA 3Q9ZA 1GZNA 2EUFB 4EH5A 4N57A 4QMVA 4ANBA 3NNUA 3K5UA 4EH9A 3Q96A 4F0IA 4DT8A 3NSZA 3NW6A 4RIYA 5DE2A 3D2KA 2P3GX 1H1QA 2QC6A 2YCQA 4BCGA 4YBJA 3F5PA 5IEXA 3DOGA 2OJJA 2OBJA 1R0PA 2WTKC 2W1FA 4DEIA 2R3RA 1BL6A 4IB1A 2PVKA 4ASZA 3QTRA 4EBWA 4ORKA 4V0GA 4IFCA 4MXAA 5DH3A 5AUTA 4IFGA 1KE9A 4Q5EA 3V5PA 1UKIA 3DFCB 5CF4A 2YWVA 4R7IA 4N70A 4ZS4A 2QR8A 3KRXA 4F08A 4NK9A 2C0OA 4AFJA 4IZ5A 4EK5A 4ZY5A 3R1YA 2YM3A 5CNOA 5DOSA 3CS9A 3BWFA 2ZM3A 4FV4A 4UY9A 5M07A 2UVXA 3R8LA 5BPYA 3LFEA 4FTQA 4PMSA 3CY2A 2UZNA 4QTAA 3REPA 2AC5A 4O0UA 1BYGA 1H28A 5CEIA 5E1EA 4YJUA 3IGGA 1NT2A 3LCTA 4ZY6A 3D7TA 3HV3A 2XM9A 5EDRA 4FTNA 3DXQA 3BYVA 4YC3A 2ITOA 4OTQA 1OL5A 5B2LA 3FI4A 4GYGA 3QU0A 4GJ2A 4I93A 3COKA 2WIPA 2FA2A 2ZMCA 4HPUE 3S95A 4EUTA 4EWHA 3NYVA 1U54B 3TL8A 5HTIA 2JFLA 3MH2A 5FTOA 3NW5A 2WQNA 3RJCA 2UW9A 1QL6A 4DH7A 5HD4A 2P0CA 5E9EA 1OVEA 3QQKA 4NW6A 2SRCA 4J96A 4MK0A 3KXXA 4AAAA 3EQIA 3JY9A 2OG8A 4IEBA 4MHAA 4ENXA 3VS3A 2QHMA 4C62A 2WO6A 2X7OA 5HVYA 5LCKA 3VUIA 4E4NA 2QOHA 3DTCA 3PG3A 4BDEA 3PIYA 5FP6A 4I6QA 3WBLA 4NM3A 3RAHA 3U4UA 2HWOA 2XK3A 3LMHA 4UWBA 1KE7A 1Q61A 2WOUA 3I0OA 2C0IA 3DB6A 2VWIA 4IAFA 3T8OA 3VVHA 4AGDA 4F9YA 4XV2A 4RX9A 4HVIA 2OICA 3FL4A 4FGBA 5CU6A 4HYUA 2PZ5A 2JDVA 3C4FA 3P0MA 3SV0A 3ZU7A 3E87A 1OPLA 3LHJA 4TYHA 4BFMA 4GK3A 5HIDA 3FMEA 4RX8A 3P23A 4UBAA 4FKVA 2YIRA 3PXYA 2HAKA 3PE2A 2VWVA 3T9TA 1XBCA 2C6EA 3HUBA 3G9NA 4X2NA 4QMUA 3V8WA 3THBA 2UUEA 2XRUA 3ZXZA 4USEA 3MIYA 5F1ZA 4BDCA 5KKRB 3U4WA 2XBJA 2CDZA 4AW5A 3LQ5A 3RPRA 3ZO3A 1UU7A 3DU8A 3UQGA 1FVRA 3VBYA 4ASDA 4A9RA 4FT5A 4FKUA 4DBNA 5C8KA 2CNUA 1Q3DA 1AQ1A 1F0QA 4M67A 2B4SB 3AC5A 2DQ7X 2F2CB 3HUCA 3KMWA 2QOQA 3DAEA 4QQJA 1DAWA 5FDXA 2Z7QA 4QTBA 4DH8A 2VTTA 3F3WA 5IEVA 4BBMA 1L3RE 3KXNA 1CKIA 2VWXA 5HCXA 4EH4A 4DCAA 2UZBA 3EFLA 1SNUA 5CAOA 4UWCA 2QCSA 3LFQA 4XLIA 4C38A 4XNEA 4QT1A 5LVOA 3MFSA 3QL8A 4DEBA 4P5QA 4FTMA 3R9DA 2WMVA 4MNEA 2XIKA 1H27A 3DPKA 3AG9A 5TT7A 3TV6A 1GAGA 3QBNA 4FT9A 4BBEA 3OCBA 2B7AA 4PDYA 3FZPA 3RINA 2H8HA 3FV8A 4R3CA 4QYHA 4O82A 1WCCA 4FIFA 4U7ZA 3D9VA 4L3JA 4C58A 3FMDA 4JBVA 3FAAA 3R7YA 3TCPA 4ERKA 2VNYA 1JKSA 2GQSA 4DLJA 4ZOGA 4PNKA 4H39A 2W5HA 4KA3A 1PXNA 5BUEA 5K0XA 3EQBA 5FEQA 4K77A 3TKHA 4CLIA 3LW0A 1ZMUA 2NP8A 3CQUA 3ACJA 2YERA 4L7SA 3GNIB 5FDPA 3W8QA 4NL0A 2Z8CA 3KXZA 2PMOX 1U5RA 4ITIA 4TPTA 5E7RA 4FG7A 2I0YA 4BZOA 4C02A 3OVVA 2WTJA 5AUYA 3D5WA 3QQUA 1VJYA 3TWJA 3WIGA 4DC2A 1W83A 4BKYA 4BCFA 3DT1A 2J7TA 1PW2A 2W05A 4CMTA 4IAYA 3QYZA 2W4JA 3GOKA 3UQCA 3HAVA 4GKIA 4IHPA 5HIBA 3HDMA 4DTKA 2OFVA 4RZWA 5EH0A 4W4VA 4HGSA 3S1HA 3EFKA 5DMZA 1ATPE 4CCBA 1OPKA 4BL1A 2Y6OA 2QG7A 2ZV8A 5HQ0A 1YDTE 3DBQA 3LM0A 2YITA 1UWHA 2WNTA 3ODZX 5HNGA 3EIDA 3UE4A 3GU4A 1KE6A 1IG1A 3ZSGA 3Q4TA 4EHVA 4U3ZA 4Z7HA 4FEWA 5EYKA 4AW0A 1URCA 1R39A 3F88A 4EEVA 4QMPA 4F9BA 2IJMA 2JD5A 1WBWA 3PA4A 3FLSA 1FVVA 2FYSA 4LUEA 2X4ZA 2XH5A 5AV1A 5IQFA 5L8JA 3FC1X 4AOJA 1NVRA 2PVJA 4D4SA 2J50A 4AN3A 3FLQA 2JDSA 2C3JA 5FBOA 2ITVA 2ITYA 3MS9A 4YJQA 4YO6A 4GG7A 4AZWA 4D4VA 3FMLA 3P1AA 1QMZA 3ZTXA 1Q4LA 2WD1A 4G6NA 3QZGA 3KRLA 3II5A 3GCVA 5DRBA 4XP2A 3T3UA 5ETFA 1P14A 1U4DA 2EXMA 3M2WA 4BC6A 4EH6A 4S32A 3L8SA 1ZAOA 3UP7A 4DFNA 1SZMA 3SQQA 4L45A 2HZNA 2BDWA 4RLLA 2FSLX 4EH3A 3Q4ZA 3DBFA 2RFDA 2ZJWA 3VF8A 4CTCA 4APCA 4LRMA 3HEGA 5F4NA 4QQTA 3CTQA 3OROA 2C47A 5K3YA 3PIZA 5FWKK 1Z9XA 2PVYA 1OITA 4FTLA 4AA4A 1HCKA 1PXIA 4U6RA 4IZAA 4E1ZA 3G6GA 3TKIA 3O71A 3IK3A 4CT2A 2C3LA 2GS7A 5CWZA 2O0UA 2PL0A 2H34A 1GIHA 5LVLA 2YIXA 3LQ3A 4CKJA 4WG3A 3TTIA 1YOMA 1MQ4A 2W17A 3G2FA 1HCLA 4WT6A 2R3FA 4DEAA 3ZSIA 3VC4A 2PPQA 2HIWA 5IU2A 4I24A 3EWHA 5AP0A 3RNIA 1M2QA 2QNJA 4KBAA 3RK9A 5C4KA 3IECA 4UX9A 3F3UA 3IW6A 1OL2A 3BEGA 5L8KA 1NVQA 1S9IA 2OWBA 4IX4A 3TI1A 4DH3A 5CF8A 4MKCA 1LEWA 1Y91A 1ZZLA 3AD6A 4F65A 3HA8A 3KMMA 3DS6A 4QMMA 4BYJA 5BVNA 3M1SA 4UMTA 2ITPA 2BMCA 4U3YA 5K9IA 5CX9A 3PSBA 4GRBA 2LAVA 1OIYA 3ZBFA 2WMXA 1PXOA 2GNIA 4U41A 4YJOA 2R3NA 2C6DA 5TO8A 3IGOA 4I94A 2ONLA 3BWJA 3O8UA 4KWPA 4BZDA 4FNZA 4J52A 4RWKA 2XNOA 3B8RA 4WNPA 5JFXA 1UNHA 3QZFA 3SW4A 3H10A 4JRVA 4DFLA 5J9YA 4BI1A 4RIWB 2BIYA 4XX9A 3VS1A 4JOAA 2HYYA 3W2PA 4A07A 4AG8A 4F9AA 5KE0A 3WI6A 1FGIA 2JC6A 2PK9A 2XKFA 4YTHA 3CY3A 3C0GA 4FNWA 2XKCA 1H26A 3P7BA 4DF3A 1OL6A 5BMSA 4B7TA 4EONA 4W8EA 5C01A 3H0ZA 3FPQA 5M4CA 3AD4A 1Q24A 4PMTA 3KA0A 2I0EA 4YZBA 1PXLA 4R5YA 5A14A 2JEDA 4LOOA 3WF9A 4G3EA 5JQ5A 1Q8UA 2J0JA 3PY3A 4X2JA 4F1TA 4DH5A 5E92A 3H3CA 3VW6A 5DA3A 5JZNA 1U59A 1R0EA 4ZAUA 4AE6A 4GL9A 2BDFA 1XH7A 4IM0A 4QP9A 2BRHA 2ZAZA 1FQ1B 4DHFA 5H3QA 3UMXA 4U79A 3BX5A 2C5VA 4TT7A 5JFVA 3BHYA 3I81A 5JH6A 3KK8A 2WMTA 5DLSA 3BGZA 3I6UA 4IWDA 4C4GA 2UZUE 4F7SA 4ZTNA 3O23A 4FEQA 5DR9A 3MVMA 2PHKA 5HCZA 2W1DA 4FV7A 1PJKA 3HLLA 4NFNA 4DTBA 1H1RA 1V0PA 4QP7A 4WNKA 3FXWA 1Q41A 3COHA 3LAUA 2W06A 4XG7A 4U80A 5TKDA 3NUNA 2W4KA 4MXCA 4FZDB 3GGFA 3PPKA 4FZFB 4TYEA 1A48A 2WMUA 3W2RA 4D28A 3VULA 4WD5A 1X8BA 1Q99A 4M97A 4F99A 2XJ2A 3QALE 4EOSA 4DFZE 3R30A 4E3CA 3IW7A 2YZAA 3O8PA 4O7LA 4XCUA 5DYJA 5DNRA 1M14A 5B7VA 4K33A 5GJFA 4QYFA 2UZTA 2VV9A 2BAJA 1IEPA 4HYSA 4QD6A 4RJ7A 1YXTA 4WNOA 4A4XA 4ALVA 3SGCA 3UOKA 5DR2A 4FL2A 5CF6A 3EZRA 3OHTA 2OU7A 3LVPA 2BPMA 2B55A 4C7TA 4D2WA 3TZ8A 3EQDA 4YTFA 3R9RA 2ACXA 5CI6A 1O6LA 4Y5HA 3SG9A 3W32A 5CY3A 3MVJA 5CZIA 4QMNA 4M68A 5L2WA 2BAQA 3Q4CA 2F7ZE 3F7ZA 4RSSA 4BZNA 2A1AB 3TNPC 2XYUA 4J71A 5FD2A 1PY5A 2GPHA 5CSWA 4KAOA 4O0RA 4KABA 4UXLA 3EN9A 3QRTA 4IX3A 2PVMA 4L43A 2PZRA 3EHAA 4RIXB 2B9JA 4FSWA 4ANLA 4TWOA 3QXPA 4G2FA 5AAFA 5LWMA 1EH4A 4JNWA 4I4FA 4X6RA 2YZLA 3KF7A 2ONLC 4FG9A 2CLXA 2JDRA 2ZM4A 5CAQA 4EK3A 3QD3A 2QKWB 2WMRA 3AMAA 3TIYA 3AC3A 3QAME 3F3ZA 3HMOA 1NXKA 2QO7A 3IG7A 4E93A 3NX8A 1V0BA 2V7OA 3KULB 4RWLA 3A8XA 2IVUA 3FL5A 2ETKA 5AV0A 3WOWA 4FIHA 5GINE 4RA5A 1JBPE 1YWRA 3S4QA 1YDRE 2G15A 2RF9A 3DJ7A 2ERKA 4NJDA 2A27A 3RZFA 2JBOA 4U97A 3OC1A 4AE9A 3F2AA 3A7FA 4PV0A 4E5WA 2V62A 3UIMA 5L3AA 3ID6C 4N6YA 3VS6A 4JBOA 2Z7LA 4QYGA 1OI9A 2YIYA 3ZRKA 3GUBA 3PJ1A 4D5KA 5GZAA 4O6LA 4AOTA 2HWPA 5K4JA 4ZTHA 4NWMA 3HA6A 4GU6A 2QVSE 2XK4A 2CHLA 2OXDA 3AC4A 4RLKA 4WSYA 3D94A 1JPAA 2XA4A 4XYFA 3V5QA 2WZJA 4QMZA 3W2OA 5I9XA 4QMWA 4W4WA 1VYWA 3LCDA 3PXZA 3EYHA 3NDMA 4IQ6A 3FZ1A 4KRDA 1MUOA 3FMJA 4LL0A 4YGAA 5EM6A 3RM7A 4BBFA 4F7JA 4MVFA 3IONA 1WMKA 4KRCA 4I1ZA 4ALUA 5JRQA 3FDNA 1TVOA 1QPCA 1A06A 3D14A 3DNEA 4QO9A 4I5MA 4C4IA 4J8MA 2ZYBA 3V01A 4EWQA 2Y9QA 3DQWA 1CM8A 3ALOA 1YOLA 2XVDA 4PTGA 3UC3A 3KREA 3RHKA 2IVTA 3ORIA 4DG2E 4AA5A 3TDVA 2OW3A 4E4XA 4ZTMA 3HMNA 4O21A 1P4FA 1JKKA 3MTFA 3WE4A 4BCQA 4EK8A 1WBPA 3KEXA 2CSNA 3R04A 4IIRA 4JIKA 5LMKA 4MCVA 3ATTA 1PYEA 3B2WA 2WMQA 4EL9A 4PL3A 2ZOQA 3FHRA 5IA5A 3RM6A 3OUKA 5CEMA 2ETRA 4AN9A 5J79A 4ZTRA 4OTDA 2VWYA 3TZ7A 4NIFB 4IB5A 4RWIA 3N4VA 5ACKA 2RG6A 4RJ3A 3CEKA 4WRSA 4BB4A 4DT9A 3QKMA 4F1MA 3BGPA 5CSXA 1PMNA 1BKXA 5BVDA 5EQPA 2VTNA 2HZ4A 4EOKA 3FE3A 4BI0A 3OUNB 2CGWA 3T3VA 4DE4A 2QO2A 4BIDA 1W8CA 2GMXA 1H24A 3IOKA 4I5PA 4IMYA 5M09A 4IAKA 5AR3A 3ZRLA 2CGUA 4ZLYA 5IA2A 5HGIA 3GU8A 4FUYA 3ZEPA 2F57A 4QP2A 3A7HA 5TOZA 3MFRA 2BTRA 5K4IA 1ERKA 2C5XA 2WQEA 4XMOA 3F69A 4FE2A 1Z57A 2QQ7A 3V8SA 3F82A 4OBQA 4PPCA 3EN4A 2FGIA 4L53A 3SOCA 2C0TA 5IG1A 1IASA 3OCGA 4KIOA 4EJ7A 4JQ7A 3HDNA 1LEZA 2VN9A 4UZHA 1ZYJA 2YHVA 4G3FA 3EH9A 4E8AA 5FLFA 3CKXA 3OFMA 1IAHA 4GYIA 3OXIA 3PLSA 4B4LA 4YSJA 3UC4A 2VWUA 5B2KA 5KMMA 5KMIA 2VX3A 3KCFA 3COIA 4GH2A 5EHOA 5B0XA 3SX9A 3SW7A 3Q2MA 3EQGA 3ZUVA 4C0TA 2J51A 5GIOE 1W0XC 3CR0A 3P78A 1H4LA 5HOAA 4O7RA 5KMJA 5C4LA 4G5JA 5A54A 4KIQA 3WE8A 3ZO4A 4C36A 1JWHA 3G33A 1YXXA 5AJQA 2J5FA 1REKA 1E1XA 3DGKA 3OT3A 3POOA 3RKBA 1M52A 2NNWB 3ZBXA 3PVUA 4OUCA 4Y95A 3TJCA 2B53A 3LFBA 3ZUUA 4CZTA 3EL7A 4FKIA 3ODYX 5CXHA 4ZJVA 4UV0A 3K5VA 3SXRA 3U6HA 1CKJA 2J2IB 3KQ7A 4ZTQA 4FSUA 4L46A 5KMLA 1JSTA 1XBBA 1UA2A 3IDPA 4FODA 1Y8YA 3MFTA 2XNMA 3QQGA 5JRSA 3N4TA 4Y73A 2B0QA 2FSTX 1GJOA 5FP5A 5M55A 3E92A 3FBVA 2G2FA 4J53A 2C6OA 4R1VA 3RPSA 4J95A 3RZBA 4E7WA 4BVUA 1OL7A 1GOLA 3I1AA 5FXRA 5J7HA 4ZZOA 2W5BA 3P7CA 4PTCA 4G34A 3BYMA 4S34A 4XG6A 3RTPA 2QOKA 3C13A 4XLVA 5IQEA 5AUXA 3PXFA 3ACKA 4FZAB 1FPUA 3OG7A 3RGFA 1WBVA 5EYMA 3UG2A 4AW1A 2A0CX 3F3TA 4Z55A 5JGAA 3E7OA 4IVCA 5AP7A 4WKQA 4FV8A 2RFEA 4BYIA 3ETAA 4XHKB 5KCVA 1CKPA 4EI4A 4MEDA 4KSQA 2JLDA 2VRXA 2CGVA 3AGMA 3DBDA 5KZ0A 3S0OA 4RGJA 5DI1A 3SRVB 4AS0A 3VBTA 2E9NA 3OEFX 3ORXA 2XIYA 4K9YA 5IUHA 4V05A 3DLZA 3GQLA 3GT8A 4F63A 3S00A 3QYWA 3LOKA 4FIGA 3ZHPC 2W1EA 3Q5IA 4ZLZA 4TL0A 4JDJA 3FMKA 4QMLA 3UVRA 2E9PA 4ZS0A 2VAGA 5DN3A 4FKWA 3BU5A 4YJTA 4BF2A 3DJ6A 4I0TA 3W18A 1I09A 4IVBA 2R3LA 2WAJA 4E5BA 4DN5A 3FQSA 4BDBA 4GUBA 5DT4A 1U46A 5ETCA 3R02A 3MVLA 2VWBA 3R2YA 4NZWB 4XV3A 3I60A 4NCTC 1TKIA 5IMEA 4IB0A 3MY5A 3MPTA 4RFMA 4AZFA 4EH7A 3OBGA 2P2HA 3VO3A 2GNJA 3I7BA 1SMHA 4FX3A 4O7TA 4I0RA 3NLBA 4OT6A 5KKRC 2WMSA 2ESMA 5BVWA 3PXQA 4G17A 3TN8A 1OBDA 2H9VA 2O8YA 2HXLA 4A9YA 4JAJA 2EVAA 4UMPA 4GK2A 5IA4A 2OZAB 4XBRA 3C9WA 4EUUA 4F6UA 4GK4A 4RQKA 4AGUA 1VR2A 3CTJA 5AR7A 4WNMA 4G3CA 5H2UA 3QRKA 5L2QA 1M17A 4RFZA 5A3XA 4BIBA 4NM7A 4YPDA 1I44A 4P4CA 2J5EA 1MRYA 2EU9A 2VZ6A 3DKGA 2VTAA 3OW4A 4CZYB 1PMEA 4KSPA 5C9CA 4EK6A 3PVGA 4L52A 4LGHA 2PUUA 5TR6A 4O27B 4CT1A 4DEEA 3NRMA 2XK7A 3GCSA 1LPUA 5IA0A 4C35A 4IAIA 3LXLA 4NUSA 2PE2A 5IZFA 1OIRA 3TUCA 3NW7A 3AD5A 5IF1A 2IZTA 4BWKA 3IW5A 1FVTA 4N0SA 1U5QA 4UWYA 3PWYA 2JKMA 5H8GA 1OMWA 4R8QA 2FH9A 5EDQA 4O0VA 3LJ1A 4MQ1A 2RIOA 5LVPA 2J90A 2W1CA 3LCKA 5M51A 4DCEA 4KKHA 3HMPA 4LV5A 3TUBA 3CBLA 4EYJA 4IVDA 5AM7A 3RWPA 5E8UA 4L7FA 5E90A 5KZIA 2BIKB 4LGDA 5A6NA 4TWPA 1OGUA 5EHLA 4ACGA 3DY7A 1T46A 4WUNA 4X7QA 4EC8A 3HMIA 1XR1A 3KVWA 4HYHA 5DT0A 3IPHA 4I6HA 5ICPA 5HICA 1MRUA 4AACA 4YURA 3HMMA 2YJRA 4GFGA 4XRLA 1PXPA 2AC3A 4U8ZA 4YC6A 1WZYA 4CQEA 3ALNA 4FKQA 2CMWA 5AR2A 1Q8WA 1TQIA 2WFYA 2XK6A 2WEIA 2Y7JA 3PJ3A 2WQOA 3F3VA 4WSQA 5M57A 5JZJA 4L42A 3R9OA 3DBEA 1OL1A 2PZPA 4CG8A 3CKWA 3NNVA 1J91A 3BE9A 1E1VA 3MJ2A 1MRVA 1ZXEA 4IW0A 1KE8A 5FGKA 1BX6A 3RCJA 3NYOA 2W1GA 5A4CA 1H25A 1OZ1A 2C5YA 2KULA 2QG5A 5E8TA 1J3HA 2C5OA 4JXFA 3VBQA 5HLNA 2OXXA 3MH1A 5HE2A 2BTSA 4A9TA 4BICA 1WVYA 4O1PA 5EM8A 3ZO2A 1B38A 5HKMA 4ZIMA 3NUSA 5EFQA 4D2VA 1SVEA 3O0GA 3I4BA 5E8WA 3O7LB 4YZ9A 3G0EA 3BQCA 3DV3A 3FY2A 2ZDTA 3QC9A 4FF8A 4NKAA 2OJGA 4D0XA 4ERWA 2G01A 4X3JA 4PDSA 1Z5MA 5HIEA 3R21A 5CSVA 4HVSA 4M69A 2VWWA 1TQPA 4W9WA 1V1KA 4IWPA 1P4OA 1ZYSA 2FB8A 3IW8A 3EQHA 5HO8A 4O96A 3QUDA 4I22A 4R3RA 5FG8A 3ZCLA 3K3IA 4FTJA 3B8QA 3AC1A 4C2VA 5JEBA 3HECA 1XH8A 2RFSA 4IX6A 3C7QA 3WF8A 4EOMA 1H1PA 3HNGA 3V5WA 2GTNA 3F5UA 4DGLC 2P2IA 2GFSA 3WARA 4F0FA 2IZRA 3DA6A 3FUPA 3DDQA 5HG7A 5BVEA 3UDBA 5A6OA 5JFSA 5J9LA 3EFWA 2C6KA 5JQ8A 3TEIA 2VGOA 2WOTA 2HELA 4HZSA 5HNBA 5EM5A 4C2WA 4CTBA 2QOBA 4YSMA 1H0VA 5EW9A 3R9HA 4TY1A 5K0KA 5IDPA 3ROCA 2WGJA 4ZXTA 4IJ9A 5HBHA 4LYNA 3W2QA 4G9RA 2BUJA 4EZ5A 2HK5A 2X6EA 5JGBA 3LZBA 3UPZA 2J9MA 4XRJA 4XG4A 3FQEA 3QWKA 4J99A 4HPTE 2XM8A 5ETAA 4G16A 4DA5A 5FQDC 3U55A 1XBAA 2YABA 3COMA 3F6XA 3VJOA 3MI9A 2ERZE 5AIKA 3VS4A 2AUHA 3OWJA 3QD0A 4X3FB 3PJ8A 5IKWA 5AADA 2HZ0A 3QF9A 3IDBA 3LMGA 3QHRA 3I7CA 4UZDA 5J7BA 4IC7A 4C37A 2E9VA 3GI3A 3I6WA 4RFYA 4HVHA 5JFWA 5CYIA 4RIXA 1YXSA 4W4YA 2JAVA 3ANQA 4NW5A 3A7JA 1JQHA 4ZP5A 5IH5A 2J6MA 3OD6X 3ZONA 2JKOA 2F2UA 4AZVA 5D9HA 3FLZA 2UW4A 4U42A 4PDPA 1KUTA 4YJSA 3UZRA 2Y4IB 3FZRA 4F0GA 3P5KA 3ATSA 2BHHA 3LE6A 3VW8A 3DZQA 4XV9A 1YHWA 2J0LA 4GU9A 4I5CA 2PY3A 4U0IA 3GFWA 3MH3A 4FV0A 4NFMA 4E6QA 3A4OX 3KULA 4A9SA 2CGXA 3OTUA 3A7IA 3TDWA 1O6KA 3SVVA 1S9JA 5KBQA 2XJ0A 2CLQA 2H6DA 3ZLXA 4V01A 4QMQA 4GT3A 3DAKA 3KRRA 4Y72A 4O83A 3UPXA 1UVRA 2QO9A 3QKKA 4JR7A 2BROA 2OFUA 2O2UA 2QI8A 5AP1A 4QP6A 3IKAA 2KTYA 2OJ9A 1SM2A 3CC6A 5M4UA 4MD8E 4HW7A 4YR8A 2OZOA 4KINA 2X2KA 1H8FA 3UTOA 3R2BA 4CNHA 4R7BA 4F6SA 2UW8A 3LMIA 4ZLOA 4BDGA 2UW5A 3UIBA 2UZDA 2OF4A 4AZSA 2C5NA 4MXYA 2R3JA 5L4QA 3QGYA 4L00A 3G15A 4CFXA 3ZFXA 3U54A 3BI6A 3MJ1A 2ITTA 2X0GA 4RIYB 4ZTLA 4GJ3A 3UO4A 3W8LA 4EOLA 5L2IA 4K1BA 3QA0A 3UODA 5FTQA 5ACBC 5A4LA 3FHIA 4QPMA 3BE2A 2BFXA 1WFCA 2C6MA 4ZSLA 3BU3A 1RDQE 1R78A 5AV3A 5C1QB 4V0GB 4RJ6A 2UZVA 5HX6A 2PE1A 2YAKA 2XKEA 4AT4A 4O7YA 5EI6A 5ETIA 1UKHA 3U9NA 4K0YA 4DEGA 3ZO1A 4OTWA 4E73A 3Q53A 3QD2B 3RNYA 3PZEA 4QQCA 4YZNA 1O9UA 3LJ2A 5AR4A 5L6OA 3HL7A 2YIQA 3R6XA 4PL5A 4QRCA 4PUZA 3UO6A 4HOKA 1LP4A 2W4OA 2O3PA 4QOXA 2RKUA 4FBXA 5DG5A 2X8EA 4JBQA 4BDDA 4M15A 5HORA 3EB0A 2JBPA 3A60A 2GCDA 3JYAA 4U44A 5EOLA 4FL1A 3BV3A 3OW3A 4ZSAA 3W2CA 4IANA 1UWJA 3QCXA 3ROYA 3AMBA 4IBMA 4OTRA 3HRFA 2UZOA 3ZSHA 4TWCA 3PA5A 2OH0E 2OSCA 4EOPA 5C26A 4B99A 4CV9A 4R78A 4LOPA 2R2PA 3GCQA 4FK3A 4UB7A 3BCEA 4O2ZA 3ULIA 1REJA 3JPVA 5LJJA 4L8MA 5DEWA 4MBIA 5AV2A 2CPKE 4UMUA 4M66A 4U81A 4ANOA 2V22A 3LXNA 3OXTA 2YDJA 2PE0A 3MSSA 2W9ZB 4F1OA 1QPJA 3DB8A 3EN5A 4UEUA 3O96A 4GMYA 4FOBA 5EW8A 4BCJA 5BUIA 3QA8A 4O1OA 3NUYA 2Y8OA 4OTGA 3FKLA 4MXZA 4MF1A 3KGAA 4FSQA 4NKSA 4F9CA 5I9ZA 4NEUA 1PRYA 1UNLA 4TYGA 2I6LA 5EKOA 3UNJA 3FZSA 2ZV7A 2CNQA 3GFEA 4G3DA 2GTMA 2HXQA 3UOLA 3OOMA 5IUGA 3ZDIA 1YWNA 3PA3A 5D41A 5F9EA 3UIXA 3UVPA 1ND4A 5FUTA 4O81A 1NY3A 3C0IA 3DZOA 4G31A 5AX9A 1ZWSA 4H05A 4H1MA 3TNQB 4CMOA 4J7BA 2QR7A 3ZLYA 4W8DA 4D0WA 4D1ZA 3V8TA 2WQBA 5AX3A 4F70A 3CP9A 1JKLA 3FWQA 4FKLA 5HLPA 4L44A 4H3PA 4XG9A 3AT2A 1OIQA 4WHZA 3RMFA 4UN0C 2YM8A 1Q5KA 3C0HA 5AEPA 5E1SA 5BUJA 1BLXA 2UW6A 3EYGA 4TRLA 5BVFA 3BYUA 3SHEA 3CLYA 3FMHA 3VS5A 4GVAA 3CGOA 2YA9A 2G9XA 4FT3A 3AC2A 3FMMA 2WKMA 3R8ZA 3CPCA 1PKDA 5LVNA 4B9DA 2R3MA 3W2SA 5CEKA 1JOWB 5IA1A 3PSCA 3NYXA 5EQYA 5CU4A 2X8IA 5CU3A 4XG3A 2C3KA 2R0UA 3EKNA 4YLKA 3RVGA 3Q3BA 5CANA 2B52A 3SOAA 5HTBA 4D58A 1YHSA 3NYNA 4CGAA 3R8MA 2R3IA 4MNEB 4G9CA 4XP3A 3R7VA 3NZ0A 2OIBA 3EL8A 3KMUA 5AR8A 5HTCA 4OGRA 3TACA 5AP2A 5LXMA 5CNNA 5C03A 4AGCA 5A4QA 5DWRA 2QHNA 2UW3A 1ZYDA 2YDKA 5AP3A 4GKHA 3BHTA 3D5XA 4FMQA 3Q6WA 3VQUA 2B1PA 4IADA 5FM3A 3C4XA 3E8CA 4H36A 3HX4A 4CRLA 5E91A 4MX9A 2YEXA 4X2FA 2C69A 4IM3A 4LV8A 4HCUA 3CTHA 3BBWA 1P5EA 3BU6A 1WBOA 1GIJA 4RJ5A 5DRDA 3B2TA 2VTIA 3QTUA 1JKTA 2XZSA 2CN8A 5A4TA 2XIRA 3NVMB 4QPSA 5E8SA 5CZHA 3VUDA 2OH4A 3C1XA 4NH1A 3AC8A 1QPEA 2FO0A 3HKOA 4C4JA 3R1NA 1B6CB 2VTLA 3R9NA 2UV2A 1W98A 4BGHA 1OKWA 3OT8A 3VJNA 5LOHA 3I0QA 3OCTA 4EBVA 4EH8A 2LGCA 4PY1A 4Z16A 2PYWA 3P79A 2UVZA 3PRIA 4S2ZA 2QONA 2ITNA 3PIXA 4YZCA 3SDJA 3UZPA 4BRXA 3UJGA 4CFFA 1WBTA 4ACCA 2HW7A 5AMNA 4EQUA 1H1WA 3LFSA 2C6IA 2X2MA 3LFFA 4HJOA 4RX5A 3ENHA 4OLIA 4QMXA 4CKRA 2JFMA 2W1HA 5KHWA 4FL3A 4ZSEA 3F61A 4L3LA 3PJ2A 4F7NA 2WMBA 4G5PA 4WBBB 2I0HA 5J95A 3RWQA 2GHGA 3EQCA 4BIEA 4Y85A 4D2RA 4JX3A 3BHUA 3ZFYA 4YO4A 3GENA 4NJ3A 4AXAA 4DTAA 3C4ZA 2QURA 5DHJA 2PMNX 4F4PA 1ZYCA 4HNIA 3CCNA 1UU3A 3EKKA 3TV4A 3NEWA 3QCYA 3RAIA 5CENA 4AW2A 1BUHA 1YI3A 2JDOA 3QCQA 3E3PA 5HBEA 3R8UA 4B6LA 2PUIA 4RVMA 3I5NA 3QC4A 1PF8A 4Q9SA 4WOVA 4EOOA 3LFDA 4FEXA 3VRYA 4JG7A 4HYIA 3BYSA 4TWNA 5E8ZA 4MQ2A 4JX7A 5TF9A 3PY1A 2IZSA 2O5KA 5DGZA 2ZMDA 5HX8A 4BCNA 4I6FA 4M12A 2IVSA 3QTZA 4BDIA 3PPJA 4FT0A 4HGEA 1SNXA 1SVHA 2VO7A 3ANRA 2XF0A 3MB6A 2F49A 3VHEA 4WBOA 3QFVA 4U40A 2WQMA 4RQVA 4O6EA 4IVAA 4C57A 4CFUA 4P7EA 4RVKA 4U9AA 2PWLA 2IN6A 2YIWA 3D7ZA 2HY81 1KOBA 4FTRA 3DFAA 3MV5A 2GS2A 2XEYA 4FTCA 2Q83A 3VNTA 3R63A 4H1JA 2XNBA 3R22A 4Y5QA 4FEVA 2FSMX 2WEVA 3EQRA 4KD1A 1U54A 3V04A 3ORNA 3GC8A 3G5DA 4LGGA 4FTUA 4Y46A 4JAIA 2YM4A 4PDOA 5CSPA 3FEGA 1XH4A 4UYNA 3U51A 3PFQA 1JNKA 4JI9A 2R7BA 3PRFA 5HNIX 1W7HA 4ID7A 5DT3A 3UIUA 3KF4A 4MWHA 4E6CA 5CQUA 1FMOE 2YCFA 4ZZMA 3E3BX 2RGPA 3QD4A 1K3AA 3RPOA 5AUUA 2O64A 2BHEA 4O0YA 5CF5A 5KBRA 3UO5A 1VZOA 5BNJA 3DKOA 5KNJA 5L2SA 3CD3A 3ORLA 3TNWA 4A4OA 3FSFA 5CQWA 2JKKA 4FR4A 4FTAA 4TYIA 4Y83A 2YN8A 2P4IA 4FI1A 3OOGA 4TN6A 3Q5ZA 3R73A 2OLCA 4DITA 1ZRZA 3HRBA 3MA6A 4YZMA 4IWQA 3VBVA 2XIXA 2YJSA 4NCTA 3DKCA 5DR6A 3LLAA 4E6DA 2IWIA 1FBNA 3HP2A 4BY9E 3IOPA 3ZLWA 2YM5A 4EHGA 1RJBA 3ORPA 2Z7SA 3EQPA 2R5TA 3E8DA 3W16A 2BZHB 3E88A 3QTSA 3EJ1A 3Q9XA 4QP1A 3ZRMA 5HU9A 2I0VA 3N51A 1YRPA 1JSVA 4M7IA 5AFVA 4GG5A 3DKFA 5AP5A 4OTPA 1PHKA 5DBXA 2WTCA 5CU2A 4WG5A 5FEEA 4FIIA 3R01A 3F2NA 2PSQA 1RE8A 4A06A 1K2PA 3UMWA 1FINA 2IW8A 3WZKA 3PP0A 2W9FB 4EH2A 1M2RA 4DFBA 3T9IA 3VIDA 5KO1A 4Y8DA 3ZM4A 2ITWA 2BRMA 4FT7A 2F4JA 2VX0A 3UYSA 4RVLA 3QUPA 4TNBA 3UQFA 3HZTA 2J0KA 1M7QA 3LFNA 5FXQA 2XCKA 3GVUA 3SKCA 2XCHA 5E8VA 1LUFA 2R4BA 1PMUA 3CXWA 3NIEA 4FKPA 4WIHA 5CI7A 3SD0A 3UYTA 2I7QA 2WU7A 3ORZA 5HHWA 3R7IA 5JK3A 5M56A 4DFYA 5JKGA 3AMYA 3NNWA 4FTKA 5J1WA 3FKNA 1DM2A 5CVGA 3LPBA 4EKKA 4RT7A 2X9EA 3QQLA 3O51A 4LRKA 4C4EA 2YISA 2VO3A 3KXGA 5HI2A 3R7UA 3KRWA 3GCUA 1GZ8A 3NIZA 2NRYA 4UALA 1WVXA 4G1WA 5I9VA 1R1WA 4CG9A 5AAGA 5GNKA 2Z7RA 2FVDA 3QKLA 4D55A 4AQCA 1VEBA 2X7FA 2WU6A 3TIZA 3PUPA 3WIKA 5B2MA 4ZK5A 3R83A 3C5IA 3BPRA 2ZV2A 4JLCA 3FI2A 4L9IA 4B8MA 5CU0A 2XNEA 2PVFA 3TM0A 1WBNA 3A2CA 1H0WA 3QLGA 4FSRA 4FA2A 2Q0NA 4BN1A 4CFNA 2W1ZA 2X4FA 3QTXA 4OAVB 2HCKA 5HVJA 4K8AA 4FVPA 5CALA 4RJ8A 5HZNA 3GOPA 2P55A 4OTHA 5IQIA 3LM5A 4RX7A 3R7EA 4K18A 3NUUA 3R8VA 3MIAA 4JDHA 2BZKB 2GFCA 4X3FA 3LJ0A 4I6BA 5L2TA 4YTIA 3ORMA 4IAAA 3OWLA 3G0FA 4U5JA 4C61A 5CXZA 3BHVA 5AA9A 4WRGA 4QP3A 2OGVA 5H8BA 3TZ9A 1ZOEA 3HYHA 2Z2WA 3RBWA 3OWPA 2PULA 2C1BA 2A19B 3GC9A 4NTTA 4TTHB 4ANMA 4AU8A 4R1YA 4D5HA 1GNGA 1ZYLA 4GSBA 3BKBA 1Q8YA 1YOJA 3TG1A 3U8WA 4DLIA 4GIIA 3ZEWA 4I41A 4YHFA 3R71A 2X1NA 5C8MA 2XP2A 4TNDA 4C3PA 5I5ZA 1FOTA 4KS7A 4JDKA 3F2RA 1WAKA 4CEGA 4PNIA 2XNGA 1VYZA 2OO8X 4FSMA 5KMNA 3CE3A 3GU5A 4QNAA 1CMKE 4FOCA 4FTTA 4YU2A 3KN6A 4O7VA 2C4GA 3VS7A 5I9YA 4XEYA 3MDYA 2BALA 2X7GA 3S2PA 3POZA 4ZSGA 3BELA 3BLQA 3E8EA 5HG8A 3DK7A 3O7LD 4ZY4A 5HU3A 4IJPA 4FYOA 1XJDA 1W82A 5CLPA 2GQRA 5IQGA 5I0BA 2P33A 1JLUE 2NO3A 3NCZA 5M08A 2IZUA 4U43A 4KKGA 5D7VA 2V5QA 5CAVA 3CSVA 2B9IA 3ZC5A 4OW8A 3PE1A 3EFJA 4BKZA 4YHTA 3AQVA 1AGWA 2ETMA 4PQNA 3NMUF 4FTIA 3QUEA 2R0IA 4O38A 4OT5A 1BMKA 4OBPA 4RIOA 4YTCA 5FM2A 4XUFA 3WF5A 2HOGA 4M3QA 4QQ5A 4CSVA 4DGNA 3E93A 4D1XA 4QMYA 3IDCA 3ZZWA 4DH1A 3OF0A 2WELA 4JDIA 3DBCA 4DFUA 2GNFA 2OJFE 4EZ7A 4XG8A 5M4FA 3D5UA 5IUIA 4BCPA 5IPJA 3LQ8A 2QLUA 4BCOA 1WBSA 3F66A 5KHXA 3NAYA 3Q9YA 3DTWA 4QP4A 4BDJA 4X6QC 4AZEA 2E9UA 2OXYA 4XH6A 3U9CA 1IA9A 4ACHA 3WF7A 1P2AA 3MPMA 2GHLA 1YI6A 4F09A 4DAWA 5HLWA 4RMZA 5GHVA 3OTVA 3D4QA 3LLTA 2GU8A 4FV9A 1SYKA 2YDIA 4I21A 4MNFA 4FZ6A 5E8YA 2XJ1A 4M14A 4IAZA 4HCTA 2VO0A 2XYNA 4EOIA 4O7SA 2VX1A 3HV5A 5FTGA 3PVBA 1DI9A 4ASXA 5EW3A 4QTCA 4XS2A 3CQWA 2GNLA 4IZ7A 3OWKA 3BGQA 5ANDA 1O6YA 2BVAA 4RIWA 2B9HA 3SAYA 3QXOA 1ZMWA 5L6WL 2BR1A 4R5SA 3V5TA 1Y6BA 5HO7A 4LFIA 4XG2A 4BKJA 2XNPA 1KWPA 1JAMA 4IX5A 5AIRA 3WF6A 4D9TA 5BVOA 4X2GA 3VUTA 4FKTA 4IDTA 4YLLA 3NCGA 1APME 3DXNA 4LL5A 3R7OA 3WYYA 1Y8GA 2QD9A 5HVKA 4O84A 2V7AA 4X3FC 4E6AA 2VNWA 2WTVA 4UXQA 4AZTA 2QODA 2ITQA 3S3IA 1OKVA 3FYKX 3NR9A 3KK9A 3LXPA 4MD7E 4PRJA 2ZB0A 4BI2A 1V0OA 3NWWA 5BMMA 3VS0A 2HY0A 4R77A 3OS3A 1IRKA 2PVLA 3RK5A 4QTEA 5JGDA 5IQHA 5D7AA 3QZIA 4O7WA 5EG3A 4QYEA 3K2LA 5EHYA 3VUMA 5EDPA 5I9WA 3MY1A 4AP7A 2VO6A 5DIAA 3ZXTA 2Y6MA 4CV8A 5JMSA 4HGLA 4GCJA 5T3QA 3MBLA 3OZ6A 2Y4IC 3DLSA 3KKVA 2VU3A 1G3NA 4L68A 4HGTA 4WUAA 3V5JA 5IEYA 2VGPA 2NRUA 3Q4UA 1OM1A 2R64A 2W99B 1QPDA 2ZB1A 4YHJA 2QOFA 5D11A 2WTKB 3Q04A 3MVHA 1G8AA 1IAJA 2X39A 4FNXA 4RJ4A 4QP8A 4WG4A 3QRUA 4CYIA 3E5AA 3HP5A 4HNFA 4C3RA 4EORA 3A4PA 4PF4A 4RPVA 3C5UA 4GIHA 4YUQA 3A62A 4CFVA 4C3FA 3ENMA 5BYZA 5G6VA 1W84A 1ZZ2A 5HG9A 2WMWA 1XQZA 3ZDUA 3V6SA 4Z9LA 4CRSA 1H01A 3M11A 4KIKB 4Q9ZA 3WZEA 5IISA 3GCPA 3PG1A 3BYOA 3OEZA 3F9NA 1Y57A 4XOZA 3NS9A 4HZRA 4XV1A 4LI5A 3UBDA 1PXJA 2XKDA 3PJCA 2YAAA 3RAWA 3DK6A 5LMAA 3Q9WA 3FC2A 5AA8A 5AUVA 3R1QA 3BIZA 4CYJA 4AF3A 3H30A 4HVGA 2VTHA 1M2PA 4C4HA 4IC8A 2IG7A 3LXKA 4RC4A 4FVQA 4FK6A 5HG5A 5EI2A 4TKSA 3ZH8A 5LCJA 2AYPA 2X8DA 2F7EE 1ZOHA 2WXVA 2H96A 5L8LA 3EZVA 5CTPA 2B54A 4L3PA 3WYXA 4LMUA 4KB8A 3DDPA 4ANQA 3FZOA 3C4EA 3JUHA 4YJNA 2XUUA 2CCIA 5JT2A 3GEQA 2YLFA 4R3PA 4H3BA 4AT5A 4EJNA 1J1CA 5IQDA 3W1FA 3Q32A 5A9UA 4MWIA 3HV4A 3UVQA 2HZIA 4N4SA 4BHZA 4FZ7A 3P4KA 3QRIA 2RL5A 3H9FA 4R7HA 2GNHA 1H1SA 3CQEA 3KXHA 4DGMA 3UNZA 4IXPA 4OTIA 3MPAA 4I20A 3C50A 4RC3A 2J0MB 5EQEA 2BAKA 3TZMA 3FYJX 4BHNA 5K5NA 2RFNA 3JR1A 5H9BA 1YWVA 5KMKA 1CTPE 2QOCA 5M44A 4ONAA 5JN2A 5I4NA 4NTSA 4MAOA 1FMKA 5LWNA 4DFXE 1DAYA 4PWNA 4C59A 4C33A 5FEDA 4QTDA 5AR5A 4DYMA 3UNKA 1YHVA 2WTDA 2CKOA 3LFAA 5E4HA 2F9GA 4EK4A 4BTKA 3CGFA 3QGWA 3Q52A 3CD8A 5TE0A 2Y4PA 3DQXA 4ACMA 4FKGA 4L6QA 1G8SA 2JITA 3JY0A 5T68A 4CQGA 2YM7A 3H4JA 3VBXA 2W96B 2PZIA 5CT7A 2C30A 1OPJA 1Y6AA 3EQFA 3BHHA 1XHAA 3EN6A 3E8NA 3DCVA 2NPQA 5ANKA 4LG4A 4DG3E 2UZEA 4W4XA 3FI8A 4G6OA 4FSZA 3V3VA 4MYGA 4B0GA 4BCHA 4MD9E 4IB3A 3TV7A 3Q2JA 4GUEA 4BTJA 3C51A 1YQJA 2QOLA 4GW8A 4RG0A 4CD0A 2DWBA 4TYJA 3I79A 5CAUA 5ITAA 3FLYA 2YM6A 2QU5A 2UW0A 4CCUA 5J87A 5LMBA 1IR3A 5EK7A 1Q8ZA 3QWJA 4FUXA 2CCHA 4FG8A 2R7IA 3FI3A 4YMJA 5CASA 2FSOX 3MYGA 4O0WA 2QKRA 3QHWA 3PWDA 5JSMA 2V55A 4GFMA 4AWIA 4BDKA 2F7XE 3QQHA 4I92A 3WILA 4LM5A 3F5XA 3TT0A 2WTWA 4XJ0A 2R9SA 3VBWA 4P2KA 1BL7A 3TJDA 4O22A 5LVMA 1XO2B 3ZUTA 4E4MA 4CLJA 2Q0BA 3IW4A 1GZKA 4JBPA 5T6KA 3ULZA 4CKIA 4JJRA 4ASEA 4CMUA 3OP5A 4KS8A 2QOOA 2BILB 2BZJA 3PSDA 4Q5HA 1YI4A 3R8PA 2CKQA 4EQMA 2ZDUA 2C68A 3CJGA 2C1AA 3KU2A 4PTEA 5HO6A 5BYYA 3G6HA 5DFPA 3D7TB 2IO6A 2ZVAA 4JRNA 4LUDA 3WZUA 4JS8A 1CDKA 4D4YA 2JKQA 1L8TA 2UVYA 3OBJA 1Q3WA 3QZHA 4U45A 3GU7A 1MQBA 2BFYA 2PZYA 2I40A 2WHBA 3DAJA 2PMLX 4NIFA 4KBCA 5FRIA 3RP9A 3RPYA 4A9UA 4BWPA 5L6PA 4DGGA 1AD5A 4YJVA 5BVKA 2Z02A 1CSNA 2REIA 4N6ZA 3LCSA 3ZZEA 4CZUA 5IH4A 2WPAA 1OECA 4USFA 3VUHA 4I0SA 4PPBA 1DS5A 4FSNA 1ZY5A 3CPBA 3R1SA 4I4EA 2ZM1A 3QLFA 5HE1A 4KBKA 4DINA 5AUZA 3U87A 5C27A 4RA4A 2UW7A 1PMVA 2DUVA 4Q2AA 5AP4A 5IH6A 5KX8A 4KUJA 1YXVA 5ANJA 3K3JA 2R3OA 3P08A 4LOQA 5HCYA 3DXPA 3TNIA 1GIIA 4II5A 2EWAA 2OI4X 5CS6A 5KUPA 3E64A 4ZEGA 3U6JA 4ZSJA 3R00A 5GJDA 4QMSA 3KN5A 2VTMA 3GQIA 3NVKI 2A4LA 3NUPA 3PYYA 4ZJIA 4TYHB 4NSTA 3ERKA 3ZOSA 2JIIA 4HCVA 5EM7A 3MH0A 2OIQA 4JQEA 3PXKA 4IACA 4M8TA 2UZWE 3BLHA 3NPCA 4KIPA 4C4FA 4P5ZA 4QPAA 4J97A
chains in the Genus database with same CATH superfamily
4RC2A 3ZYAA 4YC8A 1UV5A 2VUWA 4TZRA 3QTIA 3L1SA 4TW9A 3RPVA 1NVSA 2UZLA 3PTGA 4D9UA 4NU1A 5I9UA 3QX2A 4FV5A 4FV6A 2Z60A 3RI1A 4W9XA 4ALWA 5AWMA 3H0YA 2GQGA 3SXFA 3H9RA 3BL7A 3M42A 4C8BA 3OCSA 5BQ0A 4AUAA 4IDVA 3ORKA 4PL4A 4YJPA 1F3MC 4IZYA 4YNEA 1PXMA 5A4EA 4EOJA 1XMMA 4G6LA 5IQCA 3HGKA 5HD7A 1RQQA 2E9OA 1MP8A 3BBTB 4O0XA 3RAKA 2WIHA 2XEZA 2CJMA 4L01A 5FBNC 4YBKA 4AXCA 3VWAA 3RALA 2C3IB 4QYYA 3DK3A 3FQHA 3L9PA 4M69B 4APPA 4ZMEA 4BCKA 1ZLTA 4BTMA 5IMXA 4O86A 4FYNA 2RSVA 5HE0A 3MA3A 2GS6A 1PXKA 2PVHA 3D5VA 5F94A 3WZJA 3BLAA 2BKZA 2QOIA 4MF0A 3H9OA 4BWXA 2J4ZA 3CIKA 2RG5A 3MFUA 4ARKA 3U6IA 4FKRA 4I5HA 4JIAA 4M0ZA 4CVAA 5E8XA 2PUPA 1UU8A 3D15A 3PXRA 2JGZA 1H00A 5IDNA 3JXWA 4DG0E 4E26A 3CJFA 5CEPA 3ET7A 4NYEA 4X0MA 3QX4A 4QMOA 1YW2A 3VUKA 3N4UA 2R3GA 5CAPA 5DPVA 3A7GA 4FVRA 3BRBA 4LQMA 3KC3A 5CSHA 4AOIA 1M7NA 3D2IA 3C4WA 3GC0A 4E20A 4QNYA 2IW6A 1J7IA 4BGGA 4HVDA 3G51A 4ANNA 4UMRA 4O7ZA 5GZ8A 4A4LA 1ZY4A 4XOYA 1F5QA 5LARA 1Q62A 3I5ZA 3SRVA 2G2HA 4ZJJA 4BDHA 2C6LA 2HENA 4MBJA 3PZHA 4UMQA 1R3CA 4I3ZA 1PYXA 3RHXA 5A46A 2XS0A 3UOHA 2BDJA 3BV2A 2XIZA 4RBLA 4BGQA 3KXMA 3VS2A 3O50A 3ZFMA 4M0YA 3GXLA 4PMMA 2PUNA 2XAMA 4NM5A 3PUFC 3FLNC 3VUGA 4B8LA 4ITHA 5GIPE 1YKRA 4IH8A 3KY2A 3E63A 4YNOA 2YLEA 5ANGA 4C34A 2EXEA 4JMQA 4FKSA 4A7CA 2EB2A 3Q60A 3UP2A 1DI8A 3EN7A 3EOCA 5EKNA 4FGRA 4AA0A 2JAMA 2IPXA 4FV2A 4AFEA 3FXXA 4NM0A 4YP8A 2XNNA 2XK9A 3KRJA 3V51A 2C6TA 2JIUA 4AX8A 4DGOA 1OB3A 1XKKA 3PPZA 4ENYA 3L8PA 2BRGA 3O8TA 4K6ZA 3V5LA 2PMIA 4JG6A 4PX6A 1KSWA 1XH6A 4H58A 4E4LA 5J9ZA 3JVSA 3JS2A 4R6VA 4ITJA 3RK7A 4BDFA 3UZTA 1YDSE 4M84A 2OZAA 2W7XA 3FY0A 3PY0A 3W10A 1H07A 5F95A 4X21A 4O4EA 2GDOA 1UNGA 5HE3A 3GBZA 1Q8TA 4GVJA 1UU9A 5EI8A 2CKEA 3PP1A 4DEHA 2PU8A 5CEQA 4FKJA 4S33A 3JVRA 3MN3A 2BRNA 2VTPA 2W1IA 4YZDA 5CT0A 4FEUA 1KV2A 4EYMA 2CKPA 2VTOA 4OBOA 3AKKA 4FC0A 2XK8A 4CFWA 3UG1A 4FTOA 4OR5A 5DVRA 3P9JA 2XB7A 3LKMA 2IVVA 4YPSA 2X9FA 2R3HA 3R0TA 4Z3VA 1KE5A 5M4IA 2ZV9A 5D10A 2B9FA 5I3OA 2PVNA 3VHKA 3L8XA 4NT4A 1OBGA 1K9AA 3HVCA 3MGYA 4F6WA 3Q6UA 1STCE 3L9MA 3FMNA 4EQCA 4FV1A 2XRWA 1NW1A 4DDGA 1T45A 3FPMA 3A99A 3KFAA 1OKZA 4MXXA 2IW9A 3N9XA 5G1XA 2XMYA 3AKLA 3ORTA 3D83A 3P7AA 3FSKA 3HAMA 5M06A 1QCFA 1SVGA 4GEOA 4PPAA 4D1SA 5D1JA 5J5TA 2VTSA 3RCDA 3MESA 2JIVA 4O7NA 3ITZA 2O63A 4CFMA 3IQ7A 3LFCA 4EHEA 1OUYA 3KL8A 4GFOA 2ITXA 3BEAA 4GT4A 4WO5A 5FXSA 3V6RA 1KOAA 2GSFA 1WVWA 3E7VA 3QTWA 4L67A 5AP6A 1J7UA 4D2PA 4LRJA 3MY0A 3ZM9A 3F7WA 2HW6A 4RWJA 1XWSA 3FXZA 2YCSA 4IE9A 4EHZA 1KV1A 2WMAA 4ZMFA 4RZVA 4O91A 1OUKA 5LQFA 4JT3A 3VN9A 3KVXA 4GS6A 3ZC6A 1J7LA 3HV6A 1RW8A 5ANOA 4JVGA 5KMOA 3QCSA 2BRBA 1XH9A 3SC1A 2X6DA 4F64A 2J0IA 3LCOA 1IA8A 3R28A 2GHMA 3TNHA 2VTRA 1JVPP 4H3QA 4EC9A 5DEYA 4EZ3A 4FKOA 1OKYA 2QU6A 3FJQE 3KCKA 4BCIA 1HOWA 1FGKA 1YXUA 5IQAA 4D2SA 4S31A 2G1TA 2YACA 4ZZNA 3NAXA 4PMPA 3AT3A 5AM6A 1ZARA 4O0TA 4V04A 3L9LA 5CVHA 5F20A 5HEZA 3W55A 1Q97A 4OAUC 2R3PA 4O0SA 3C4CA 3DNDA 5IQBA 3VRZA 5D12A 5CEOA 4IM2A 4YJRA 1H08A 3NUAA 4P90A 3MWUA 3SLSA 2GNGA 3BQRA 3IO7A 3AOXA 1B39A 4BDAA 4TXCA 2R3KA 5IA3A 2Y0AA 4F9WA 3EMGA 5AUWA 2V0DA 3A61A 4ACDA 4MBLA 5BX0A 3AT4A 3ELJA 2CNVA 5ANEA 1URWA 2WB8A 3BLRA 3MTLA 4J1RA 1GY3A 1GZOA 2G2IA 3TTJA 2YFXA 2OIDA 3G90X 1A9UA 2BZIB 2VTJA 2W0JA 4E5AX 5J1VA 1E9HA 4MH7A 4KIKA 3AGLA 3HV7A 4JL9A 4MXOA 4JQ8A 4O2PA 2JDTA 4Z7GA 3L9NA 4RVTA 4DEDA 2ITZA 3WZDA 4G3GA 2R3QA 4XBUA 3SXSA 5GJGA 2OF2A 2OJIA 4AT3A 2VTQA 5AV4A 5CVFA 2VWZA 4PP9A 3GP0A 4FSTA 4ZTSA 4FIJA 2X81A 4D4RA 3UOJA 2I1MA 3UDSA 5EOBA 2E2BA 3D0EA 2YCRA 3E62A 2BKKA 1BI7A 2EB3A 3A8WA 4FIEA 4X2KA 4J98A 5GZ9A 3O17A 4UYAA 4PP7A 2WTIA 4J8NA 4JG8A 3GC7A 2DYLA 5HBJA 5J8IA 5EYCA 3ZMMA 3QQJA 4BR3A 4BCMA 3TYKA 1TQMA 4KNBA 2O65A 4EOQA 4AGWA 4GV1A 1JSUA 5H8EA 3P86A 2OK1A 2YWPA 5ANIA 3NNXA 3SA0A 2VD5A 2BCJA 3GB2A 3NFGB 4JR3A 3IS5A 3MB7A 3G9LX 4RRVA 4ANSA 3TUDA 5HESA 1LR4A 3FKOA 1PKGA 5C8NA 2W5AA 3OMVA 4YLJA 1NA7A 3TXOA 3R7GA 1G5SA 4GT5A 4OTFA 3QQFA 4FNYA 4AN2A 5M53A 3TKUA 3UGCA 2X2LA 3NUXA 5EYDA 5LMKC 3QRJA 1ZMVA 3O2MA 4IWOA 3L8VA 4BTFA 3SG8A 2ITUA 4DBXA 3BZ3A 1J1BA 3OY3A 4MTAA 3MW1A 3OXZA 3FZTA 4LDTA 3VAPA 3PDTA 3PVWA 2PVRA 3KB7A 4FICA 4KKEA 3AXWA 4WA9A 5BYLA 3OY1A 3HRCA 4XP0A 3VF9A 2A2AA 2QLQA 4LMNA 4D2TA 2DS1A 3PLAE 3NGAA 4CXAA 2EXCX 5I3RA 3ZS5A 2CN5A 1YVJA 2OKRA 2XBAA 3FLWA 4USDA 4FV3A 3W33A 1BI8A 3ZLSA 3F5GA 3QTQA 3VQHA 2PTKA 4FSYA 5AAEA 1XH5A 5J5SA 4M13A 4QMTA 3LIJA 4F7LA 4EKLA 1OIUA 3K54A 1ZOGA 3DJ5A 3GU6A 4K2RA 5K5XA 4S30A 4I23A 4K11A 2FUMA 3Q9ZA 1GZNA 2EUFB 4EH5A 4N57A 4QMVA 4ANBA 3NNUA 3K5UA 4EH9A 3Q96A 4F0IA 4DT8A 3NSZA 3NW6A 3W0NA 4RIYA 5DE2A 3D2KA 2P3GX 1H1QA 2QC6A 2YCQA 4BCGA 4YBJA 3F5PA 5IEXA 3DOGA 2OJJA 2OBJA 1R0PA 2WTKC 2W1FA 4DEIA 2R3RA 1BL6A 4IB1A 2PVKA 4ASZA 3QTRA 4EBWA 4ORKA 4V0GA 4IFCA 4MXAA 5DH3A 5AUTA 4IFGA 1KE9A 4Q5EA 3V5PA 1UKIA 3DFCB 2AEGA 5CF4A 2YWVA 4R7IA 4N70A 4ZS4A 2QR8A 3KRXA 4F08A 4NK9A 2C0OA 4AFJA 4IZ5A 4EK5A 4ZY5A 3R1YA 2YM3A 5CNOA 5DOSA 3CS9A 3BWFA 2ZM3A 4FV4A 4UY9A 5M07A 2UVXA 3R8LA 5BPYA 3LFEA 4FTQA 4PMSA 3CY2A 2UZNA 4QTAA 3REPA 2AC5A 4O0UA 1BYGA 1H28A 5CEIA 5E1EA 4YJUA 3IGGA 1NT2A 3LCTA 4ZY6A 3D7TA 3HV3A 2XM9A 5EDRA 4FTNA 3DXQA 3BYVA 4YC3A 2ITOA 4OTQA 1OL5A 5B2LA 3FI4A 4GYGA 3QU0A 4GJ2A 4I93A 3COKA 2WIPA 2FA2A 2ZMCA 4HPUE 3S95A 4EUTA 4EWHA 3NYVA 1U54B 3TL8A 5HTIA 2JFLA 3MH2A 5FTOA 3NW5A 2WQNA 3RJCA 2UW9A 1QL6A 4DH7A 5HD4A 2P0CA 5E9EA 1OVEA 3QQKA 4NW6A 2SRCA 4J96A 4MK0A 3KXXA 4AAAA 3EQIA 3JY9A 2OG8A 4IEBA 4MHAA 4ENXA 3VS3A 2QHMA 4C62A 2WO6A 2X7OA 5HVYA 5LCKA 3VUIA 4E4NA 2QOHA 3DTCA 3PG3A 4BDEA 3PIYA 5FP6A 4I6QA 3WBLA 4NM3A 3RAHA 3U4UA 2HWOA 2XK3A 3LMHA 4UWBA 1KE7A 1Q61A 2WOUA 3I0OA 2C0IA 3DB6A 2VWIA 4IAFA 3T8OA 3VVHA 4AGDA 4F9YA 4XV2A 4RX9A 4HVIA 2OICA 3FL4A 4FGBA 5CU6A 4HYUA 2PZ5A 2JDVA 3C4FA 3P0MA 3SV0A 3ZU7A 3E87A 1OPLA 3LHJA 4TYHA 4BFMA 4GK3A 5HIDA 3FMEA 4RX8A 3P23A 2AQXA 4UBAA 4FKVA 2YIRA 3PXYA 2HAKA 3PE2A 2VWVA 3T9TA 4F78A 1XBCA 2C6EA 3HUBA 3G9NA 4X2NA 4QMUA 3V8WA 3THBA 2UUEA 2XRUA 3ZXZA 4USEA 3MIYA 5F1ZA 4BDCA 5KKRB 3U4WA 2XBJA 2CDZA 4AW5A 3LQ5A 3RPRA 3ZO3A 1UU7A 3DU8A 3UQGA 1FVRA 3VBYA 4ASDA 4A9RA 4FT5A 4FKUA 4DBNA 5C8KA 2CNUA 1Q3DA 1AQ1A 1F0QA 4M67A 2B4SB 3AC5A 2DQ7X 2F2CB 3HUCA 3KMWA 2QOQA 3DAEA 4QQJA 1DAWA 5FDXA 2Z7QA 4QTBA 4DH8A 2VTTA 3F3WA 5IEVA 4BBMA 1L3RE 3KXNA 1CKIA 2VWXA 5HCXA 4EH4A 3W0RA 4DCAA 2UZBA 3EFLA 1SNUA 5CAOA 4UWCA 2QCSA 3LFQA 4XLIA 4C38A 4XNEA 4QT1A 5LVOA 3MFSA 3QL8A 4DEBA 4P5QA 4FTMA 3R9DA 2WMVA 4MNEA 2XIKA 1H27A 3DPKA 3AG9A 5TT7A 3TV6A 1GAGA 3QBNA 4FT9A 4BBEA 3OCBA 2B7AA 4PDYA 3FZPA 3RINA 2H8HA 3FV8A 4R3CA 4QYHA 4O82A 1WCCA 4FIFA 4U7ZA 4FJVA 3D9VA 4L3JA 4C58A 3FMDA 4JBVA 3FAAA 3R7YA 3TCPA 4ERKA 2VNYA 1JKSA 2GQSA 4DLJA 4ZOGA 4PNKA 4H39A 2W5HA 4KA3A 1PXNA 5BUEA 5K0XA 3EQBA 5FEQA 4K77A 3TKHA 4CLIA 3LW0A 1ZMUA 2NP8A 3CQUA 3ACJA 2YERA 4L7SA 3GNIB 5FDPA 3W8QA 4NL0A 2Z8CA 3KXZA 2PMOX 1U5RA 4ITIA 4TPTA 5E7RA 4FG7A 2I0YA 4BZOA 4C02A 3OVVA 2WTJA 5AUYA 3D5WA 3QQUA 1VJYA 3TWJA 3WIGA 4DC2A 4DHZA 1W83A 4BKYA 4BCFA 3DT1A 2J7TA 1PW2A 2W05A 4CMTA 4IAYA 3QYZA 2IF8A 2W4JA 3GOKA 3UQCA 3HAVA 4GKIA 4IHPA 5HIBA 3HDMA 4DTKA 2OFVA 4RZWA 5EH0A 4W4VA 4HGSA 3S1HA 3EFKA 5DMZA 1ATPE 4CCBA 1OPKA 4BL1A 2Y6OA 2QG7A 2XALA 2ZV8A 5HQ0A 1YDTE 3DBQA 3LM0A 2YITA 1UWHA 2WNTA 3ODZX 5HNGA 3EIDA 3UE4A 3GU4A 1KE6A 1IG1A 3ZSGA 3Q4TA 4EHVA 4U3ZA 4Z7HA 4FEWA 5EYKA 4AW0A 1URCA 1R39A 3F88A 4EEVA 4QMPA 4F9BA 2IJMA 2JD5A 1WBWA 3PA4A 3FLSA 1FVVA 2FYSA 4LUEA 2X4ZA 2XH5A 5AV1A 5IQFA 5L8JA 3FC1X 4AOJA 1NVRA 2PVJA 4D4SA 2J50A 4AN3A 3FLQA 2JDSA 3UDTA 2C3JA 5FBOA 2ITVA 2ITYA 3MS9A 4YJQA 4YO6A 4GG7A 4AZWA 4D4VA 3FMLA 3P1AA 1QMZA 3ZTXA 1Q4LA 2WD1A 4G6NA 3QZGA 3KRLA 3II5A 3GCVA 5DRBA 4XP2A 3T3UA 4AAYA 5ETFA 1P14A 1U4DA 2EXMA 3M2WA 4BC6A 4EH6A 4S32A 3L8SA 1ZAOA 3UP7A 4DFNA 1SZMA 3SQQA 4L45A 2HZNA 2BDWA 4RLLA 2FSLX 4EH3A 3Q4ZA 3DBFA 2RFDA 2ZJWA 3VF8A 4CTCA 4APCA 4LRMA 3HEGA 5F4NA 4QQTA 3CTQA 3OROA 2C47A 5K3YA 3PIZA 5FWKK 1Z9XA 2PVYA 1OITA 4FTLA 4AA4A 1HCKA 1PXIA 4U6RA 4IZAA 4E1ZA 3G6GA 3TKIA 3O71A 3IK3A 4CT2A 2C3LA 2GS7A 5CWZA 2O0UA 2PL0A 2H34A 1GIHA 5LVLA 2YIXA 3LQ3A 4CKJA 4WG3A 3TTIA 1YOMA 1MQ4A 2W17A 3G2FA 1HCLA 4WT6A 2R3FA 4DEAA 3ZSIA 3VC4A 2PPQA 2HIWA 5IU2A 4I24A 3EWHA 5AP0A 3RNIA 1M2QA 2QNJA 4KBAA 3RK9A 5C4KA 3IECA 4UX9A 3F3UA 3IW6A 1OL2A 3BEGA 5L8KA 1NVQA 1S9IA 2OWBA 4IX4A 3TI1A 4DH3A 5CF8A 4MKCA 1LEWA 1Y91A 1ZZLA 3AD6A 4F65A 3HA8A 3KMMA 3DS6A 4QMMA 4BYJA 5BVNA 3M1SA 4UMTA 2ITPA 2BMCA 4U3YA 5K9IA 5CX9A 3PSBA 4GRBA 2LAVA 1OIYA 3ZBFA 2WMXA 1PXOA 2GNIA 4U41A 4YJOA 2R3NA 2C6DA 5TO8A 3IGOA 4I94A 2ONLA 3BWJA 3O8UA 4KWPA 1VLRA 4BZDA 4FNZA 4J52A 4RWKA 2XNOA 3B8RA 4WNPA 5JFXA 1XMLA 1UNHA 3QZFA 3SW4A 3H10A 4JRVA 4DFLA 5J9YA 4BI1A 4RIWB 2BIYA 4XX9A 3VS1A 4JOAA 2HYYA 3W2PA 4A07A 4AG8A 4F9AA 5KE0A 3WI6A 1FGIA 2JC6A 2PK9A 2XKFA 4YTHA 3CY3A 2NYAA 3C0GA 4FNWA 2XKCA 5BV3A 1H26A 3P7BA 4DF3A 4DHJA 1OL6A 5BMSA 4B7TA 4EONA 4W8EA 5C01A 3H0ZA 3FPQA 5M4CA 3AD4A 1Q24A 4PMTA 3KA0A 2I0EA 4YZBA 1PXLA 4R5YA 5A14A 2JEDA 4LOOA 3WF9A 4G3EA 5JQ5A 1Q8UA 2J0JA 3PY3A 4X2JA 4F1TA 4DH5A 5E92A 3H3CA 3VW6A 5DA3A 5JZNA 1U59A 1R0EA 4ZAUA 4AE6A 4GL9A 2BDFA 1XH7A 4IM0A 4QP9A 2BRHA 2ZAZA 1FQ1B 4DHFA 5H3QA 3UMXA 4U79A 3BX5A 2C5VA 4TT7A 5JFVA 3BHYA 3I81A 5JH6A 3KK8A 2WMTA 5DLSA 3BGZA 3I6UA 4IWDA 4C4GA 2UZUE 4F7SA 4ZTNA 3O23A 4FEQA 5DR9A 3MVMA 2PHKA 5HCZA 2W1DA 4FV7A 1PJKA 3HLLA 4NFNA 4DTBA 1H1RA 1V0PA 4QP7A 4WNKA 3FXWA 1Q41A 3COHA 3LAUA 2W06A 4XG7A 4U80A 5TKDA 2XANA 3NUNA 2W4KA 4MXCA 4FZDB 3PFYA 3GGFA 3KIOC 3PPKA 4FZFB 4TYEA 1A48A 2WMUA 3W2RA 4D28A 3VULA 4WD5A 1X8BA 1Q99A 4M97A 4F99A 2IEWA 2XJ2A 3QALE 4EOSA 4DFZE 3R30A 4E3CA 3IW7A 2YZAA 3O8PA 4O7LA 4XCUA 5DYJA 5DNRA 1M14A 5B7VA 4K33A 5GJFA 4QYFA 2UZTA 2VV9A 2BAJA 1IEPA 4HYSA 4QD6A 4RJ7A 1YXTA 4WNOA 4A4XA 4ALVA 3SGCA 3UOKA 5DR2A 4FL2A 5CF6A 3EZRA 3OHTA 2OU7A 3LVPA 2BPMA 2B55A 4C7TA 4D2WA 3TZ8A 3EQDA 4YTFA 3R9RA 2ACXA 5CI6A 1O6LA 4Y5HA 3SG9A 3W32A 5CY3A 3MVJA 5CZIA 4QMNA 4M68A 5L2WA 2BAQA 3Q4CA 2F7ZE 3F7ZA 4RSSA 4BZNA 2A1AB 3TNPC 2XYUA 4J71A 5FD2A 1PY5A 2GPHA 5CSWA 4KAOA 4O0RA 4KABA 4UXLA 3EN9A 3QRTA 4IX3A 2PVMA 4L43A 2PZRA 3EHAA 4RIXB 2B9JA 4FSWA 4ANLA 4TWOA 3QXPA 4G2FA 5AAFA 5LWMA 1EH4A 4JNWA 4I4FA 4X6RA 2YZLA 3KF7A 2ONLC 4FG9A 2CLXA 2JDRA 2ZM4A 5CAQA 4EK3A 3QD3A 2QKWB 2WMRA 3AMAA 3TIYA 3AC3A 3QAME 3F3ZA 3HMOA 1NXKA 2QO7A 3IG7A 4E93A 3NX8A 1V0BA 2V7OA 3KULB 4RWLA 3A8XA 2IVUA 3FL5A 2ETKA 5AV0A 3WOWA 4FIHA 5GINE 4RA5A 1JBPE 1YWRA 3S4QA 1YDRE 2G15A 2RF9A 3DJ7A 2ERKA 4NJDA 2A27A 3RZFA 2JBOA 4U97A 3OC1A 4AE9A 3F2AA 3A7FA 4PV0A 4E5WA 2V62A 3UIMA 5L3AA 3ID6C 4N6YA 3VS6A 4JBOA 2Z7LA 4QYGA 1OI9A 2YIYA 3ZRKA 3GUBA 3PJ1A 4D5KA 3W0MA 5GZAA 4O6LA 4AOTA 2HWPA 5K4JA 4ZTHA 4NWMA 3HA6A 4GU6A 2QVSE 2XK4A 2CHLA 2OXDA 3AC4A 4RLKA 4WSYA 3D94A 1JPAA 2XA4A 4XYFA 3V5QA 2WZJA 4QMZA 3W2OA 5I9XA 4QMWA 4W4WA 1VYWA 3LCDA 3PXZA 3EYHA 3NDMA 4IQ6A 3FZ1A 4KRDA 1MUOA 3FMJA 4LL0A 4YGAA 5EM6A 3RM7A 4BBFA 4F7JA 4MVFA 3IONA 1WMKA 4KRCA 4I1ZA 4ALUA 5JRQA 3FDNA 1TVOA 1QPCA 1A06A 3D14A 3DNEA 4QO9A 4I5MA 4C4IA 4J8MA 2ZYBA 3V01A 4EWQA 2Y9QA 3DQWA 1CM8A 3ALOA 1YOLA 2XVDA 4PTGA 3UC3A 3KREA 3RHKA 2IVTA 3ORIA 4DG2E 4AA5A 3TDVA 2OW3A 4E4XA 4ZTMA 3HMNA 4O21A 1P4FA 1JKKA 3MTFA 3WE4A 4BCQA 4EK8A 1WBPA 3KEXA 2CSNA 3R04A 4IIRA 4JIKA 5LMKA 4MCVA 3ATTA 1PYEA 3B2WA 2WMQA 4EL9A 4PL3A 2ZOQA 3FHRA 5IA5A 3RM6A 3OUKA 5CEMA 2ETRA 4AN9A 5J79A 4ZTRA 4OTDA 2VWYA 3TZ7A 4NIFB 4IB5A 4RWIA 3N4VA 5ACKA 2RG6A 4RJ3A 3CEKA 4WRSA 4BB4A 4DT9A 3QKMA 4F1MA 3BGPA 5CSXA 1PMNA 1BKXA 5BVDA 5EQPA 2VTNA 2HZ4A 4EOKA 3FE3A 4BI0A 1OGYA 3OUNB 2CGWA 3T3VA 4DE4A 2QO2A 4BIDA 1W8CA 2GMXA 1H24A 3IOKA 4I5PA 4IMYA 5M09A 4IAKA 5AR3A 3ZRLA 2CGUA 4ZLYA 5IA2A 5HGIA 3GU8A 4FUYA 3ZEPA 2F57A 4QP2A 3A7HA 5TOZA 3MFRA 2BTRA 5K4IA 1ERKA 2C5XA 2WQEA 4XMOA 3F69A 4FE2A 1Z57A 2QQ7A 3V8SA 3F82A 2ZFYA 4OBQA 4PPCA 3EN4A 2FGIA 4L53A 3SOCA 2C0TA 5IG1A 1IASA 3OCGA 4KIOA 4EJ7A 4JQ7A 3HDNA 1LEZA 2VN9A 4UZHA 1ZYJA 2YHVA 4G3FA 3EH9A 4E8AA 5FLFA 3CKXA 2A98A 3OFMA 1IAHA 4GYIA 3OXIA 3PLSA 4B4LA 4YSJA 3UC4A 2VWUA 5B2KA 5KMMA 5KMIA 2VX3A 1W2DA 3KCFA 3COIA 4GH2A 5EHOA 5B0XA 3SX9A 3SW7A 3Q2MA 3EQGA 3ZUVA 4C0TA 2J51A 5GIOE 1W0XC 3CR0A 3P78A 4AQKA 1H4LA 5HOAA 4O7RA 5KMJA 5C4LA 4G5JA 5A54A 4KIQA 3WE8A 3ZO4A 4C36A 1JWHA 3G33A 1YXXA 5AJQA 2J5FA 1REKA 1E1XA 3DGKA 3OT3A 3POOA 3RKBA 1M52A 2NNWB 3ZBXA 3PVUA 4OUCA 4Y95A 3TJCA 2B53A 3LFBA 3ZUUA 4CZTA 3EL7A 4FKIA 3ODYX 5CXHA 4ZJVA 4UV0A 3K5VA 3SXRA 3U6HA 1CKJA 2J2IB 3KQ7A 4ZTQA 4FSUA 4L46A 5KMLA 1JSTA 1XBBA 1UA2A 3IDPA 4FODA 1Y8YA 3MFTA 2XNMA 3QQGA 5JRSA 3N4TA 4Y73A 2B0QA 2FSTX 1GJOA 5FP5A 5M55A 3E92A 3FBVA 2G2FA 4J53A 2C6OA 4R1VA 3RPSA 4J95A 2XAOA 3RZBA 4E7WA 4BVUA 1OL7A 1GOLA 3I1AA 5FXRA 5J7HA 4ZZOA 2W5BA 3P7CA 4PTCA 4G34A 3BYMA 4S34A 4XG6A 3RTPA 2QOKA 3VONA 3C13A 4XLVA 5IQEA 5AUXA 3PXFA 3ACKA 4FZAB 1FPUA 3OG7A 3RGFA 1WBVA 5EYMA 3UG2A 4AW1A 2A0CX 3F3TA 4Z55A 5JGAA 3E7OA 4IVCA 5AP7A 4WKQA 4FV8A 2RFEA 4BYIA 3ETAA 4XHKB 5KCVA 1CKPA 4EI4A 4MEDA 4KSQA 2JLDA 2VRXA 2CGVA 3AGMA 3DBDA 5KZ0A 3S0OA 4RGJA 5DI1A 3SRVB 4AS0A 3VBTA 2E9NA 3OEFX 3ORXA 2XIYA 4K9YA 5IUHA 4V05A 3DLZA 3GQLA 3GT8A 4F63A 3S00A 3QYWA 3LOKA 4FIGA 3ZHPC 2W1EA 3BL9A 3Q5IA 4ZLZA 4TL0A 4JDJA 3FMKA 4QMLA 3UVRA 2E9PA 4ZS0A 2VAGA 5DN3A 4FKWA 3BU5A 4YJTA 4BF2A 3DJ6A 4I0TA 3W18A 1I09A 4IVBA 2R3LA 2WAJA 4E5BA 4DN5A 3FQSA 4BDBA 4GUBA 5DT4A 1U46A 5ETCA 3R02A 3MVLA 2VWBA 3R2YA 4NZWB 4XV3A 3I60A 4NCTC 1TKIA 5IMEA 4IB0A 3MY5A 3MPTA 4RFMA 4AZFA 4EH7A 3OBGA 2P2HA 3VO3A 2GNJA 3I7BA 1SMHA 4FX3A 4O7TA 4I0RA 3NLBA 4OT6A 5KKRC 2WMSA 2ESMA 5BVWA 3PXQA 4G17A 3TN8A 1OBDA 2H9VA 2O8YA 2HXLA 4A9YA 4JAJA 2EVAA 4UMPA 4GK2A 5IA4A 2OZAB 4XBRA 3C9WA 4EUUA 4F6UA 4GK4A 4RQKA 4AGUA 1VR2A 3CTJA 5AR7A 4WNMA 4G3CA 5H2UA 3QRKA 5L2QA 1M17A 4RFZA 5A3XA 4BIBA 4NM7A 4YPDA 1I44A 4P4CA 2J5EA 1MRYA 2EU9A 2VZ6A