3A7JA

Human mst3 kinase in complex with mnadp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
287
structure length
286
Chain Sequence
MQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine kinase 24 (STE20 homolog, yeast)
publication title Structures of human MST3 kinase in complex with adenine, ADP and Mn2+.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 286
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3a7jA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3a7jA01
2YZLA 4GVJA 2VAGA 4FZFB 4IB3A 5HHWA 1MQ4A 4RT7A 4KIQA 4O2PA 5A4TA 5K0XA 3EFWA 4GUEA 3ZFXA 4FTAA 4USFA 2ZB0A 3LFFA 4EL9A 2YCFA 1LR4A 3R6XA 1FPUA 5HOAA 1GNGA 2FSOX 2AYPA 4EH8A 2YM8A 4ERKA 2CKQA 4QMLA 4ASZA 3R8VA 3SRVB 4DFYA 3UQCA 4DT8A 2Y0AA 4HYSA 3LFNA 4OUCA 4EJNA 3W2PA 5I3OA 4EHEA 4YNEA 3S95A 3ZZWA 1LUFA 4I6FA 5DA3A 3M1SA 5C8NA 3LPBA 4YTIA 1PXNA 3TIYA 1YWNA 4C02A 4I6BA 4FG8A 3G0FA 3CKXA 5F94A 3PSBA 2XF0A 4ITJA 3U9CA 4AGWA 4DEEA 4YJQA 4LI5A 5CS6A 2XNGA 2JLDA 3IOPA 1Q3WA 2I6LA 3VQHA 2NO3A 4IFCA 2W17A 4BYJA 4XJ0A 1T45A 5C8KA 5L6OA 1OL7A 3RHXA 2X2MA 3QQGA 4PNIA 3G5DA 4IB1A 4D5KA 2OJGA 2VTLA 2WMTA 5CVHA 3KVWA 2X7GA 3ZRKA 4FYOA 5AV0A 3IK3A 4LRJA 2WFYA 5EQYA 2PE0A 4QPAA 5IPJA 2BAJA 5KMMA 4AQCA 5EH0A 3BHUA 5C03A 2BR1A 4A4LA 1A06A 4QP7A 4YHFA 4ZK5A 4C4JA 4NFMA 4Z16A 1FQ1B 5LVPA 2FO0A 2J0JA 5FEDA 3RM7A 4QQJA 5JRSA 3KC3A 4ARKA 1PW2A 2V7OA 3FI2A 3QQJA 4QMXA 1YXXA 1H07A 4GFOA 1CSNA 5JT2A 3LCDA 5AWMA 5HG9A 5CALA 4XLIA 2OK1A 3GQIA 2XKEA 4QTDA 2GS2A 2UVYA 3HKOA 3MVMA 1P4OA 5IMXA 2JDSA 1CTPE 4JDIA 4KIOA 1JWHA 4IWDA 2BVAA 2UZDA 3OCTA 4WT6A 4ZY4A 3JVRA 3DLZA 4XP2A 1APME 3BPRA 2XK8A 4AACA 4HW7A 5K4IA 2PE1A 3HAVA 3BBTB 3OXTA 4I0RA 5FXSA 4KS7A 2QG7A 3MESA 4O38A 3DZQA 2R3FA 4Y46A 3BZ3A 4O7VA 3F9NA 4AS0A 5IDNA 3I0QA 3BU6A 1W98A 1PXLA 2PVKA 3HDMA 4ZTQA 3HV5A 4ALUA 3PY3A 3D5VA 1U59A 3GP0A 4Y85A 4F70A 5J5SA 3HV7A 5IKWA 1O6LA 4F9BA 1U54A 2BTRA 4FICA 4TYGA 4BCNA 3V5JA 3WF8A 5LVOA 1K3AA 5L2SA 3PDTA 5FTOA 5AM6A 4DTBA 3PXRA 3VWAA 3PIXA 4KBAA 3RWQA 4IADA 1OZ1A 3W2QA 3D15A 3MTFA 3WZKA 3POOA 3MH3A 3N9XA 4M69B 4WA9A 3W8QA 3AMBA 3QA8A 3RPYA 2YIRA 4Y5HA 4FGBA 4AFEA 4C58A 2OJ9A 3Q5IA 4OAVB 4AOIA 2IW9A 2JDOA 2DQ7X 3FLZA 3NW5A 3MPMA 3ZLWA 4BCKA 4JNWA 1BL7A 2W4OA 2WOTA 3QXPA 4J1RA 3WZUA 4MXXA 1J7IA 4IAFA 3OCSA 3OF0A 1YQJA 3AD5A 3V6RA 1OKZA 4NM0A 4BDCA 4ZLOA 4MQ1A 2WEIA 4DGOA 3EQRA 1XBAA 4O0XA 3DQXA 4N4SA 5K0KA 3CS9A 4I5CA 3G9LX 5BUIA 4DE4A 3OUKA 2C0TA 5T3QA 3A7GA 4APCA 4AT4A 3OWLA 2VX1A 3D5UA 3QTRA 4GH2A 1NA7A 2G15A 4O0RA 5CAVA 1IG1A 5BVKA 4F1OA 3OC1A 2NNWB 2B0QA 2IW6A 2XK9A 4O7SA 1VJYA 2I0VA 3QWJA 4LRKA 3TI1A 1Q8WA 2OIBA 1JQHA 3MA3A 4RJ6A 2RSVA 4USDA 3SGCA 3UNKA 4EUUA 4OBQA 4E4MA 2GTMA 3VO3A 2Z2WA 1ZOHA 3DFCB 3TIZA 5BUEA 2YZAA 4CMTA 2F7ZE 3CXWA 4APPA 3S0OA 3KU2A 3O8TA 3PG3A 4D4SA 3P7CA 2OH0E 5JFVA 4TWCA 4DEGA 2NRUA 2VTSA 3DBDA 5DNRA 3SOAA 4BYIA 5IQIA 4K2RA 1G5SA 4NWMA 5CVFA 5IH4A 3F69A 5AX3A 3QCSA 3JVSA 2BROA 3NCZA 3ATSA 2R3NA 3C0GA 4JAIA 4DFXE 1NVRA 2JD5A 1ZYCA 4LGHA 4EEVA 5BVNA 1ND4A 4AWIA 4M12A 5AM7A 1FBNA 5A54A 3RK5A 3V8TA 5E9EA 3GCUA 4WOVA 5BVFA 2XK7A 3DTWA 2PVNA 2W7XA 1XH7A 5E8WA 2R3OA 1CKJA 4XV3A 3QBNA 4AGCA 4ZAUA 5BX0A 5JFSA 1Q62A 3H9RA 2F9GA 3IDPA 4IAYA 4QRCA 2C6TA 3CBLA 3ORXA 1AGWA 2JIVA 3GQLA 4MAOA 4MF0A 5AP1A 1H24A 3IW6A 3A62A 4UMTA 5TF9A 4CQEA 2R2PA 3BEGA 4MD7E 2QOBA 3M2WA 2G2IA 4WBBB 3VS3A 5FXQA 4FV6A 4PTCA 2C4GA 3R1NA 4LGDA 4PMPA 4FKOA 2XEZA 3LQ8A 4YJTA 3TTJA 1KV1A 4EZ5A 4IX6A 4RJ3A 5AP0A 3NMUF 3LLTA 2QOKA 2C6LA 3D2IA 4D58A 2PVYA 4LUEA 3K3JA 4O0YA 2QOFA 3ZDUA 4C38A 3PWYA 4OTIA 3IPHA 4K18A 4IZ7A 1JSVA 2X9FA 5BYYA 5LVNA 3LHJA 4FV3A 3OY1A 3OWPA 3QUDA 4HNIA 4XP3A 5CEMA 3PJ3A 3LFAA 4FSQA 3FPQA 2C5VA 2JBOA 4XV9A 4L44A 3PIYA 1FVVA 5ETFA 4CYJA 3Q96A 3NPCA 4PMSA 2X81A 3FEGA 3EQBA 4EH2A 1ZWSA 3QGYA 5EQPA 2FVDA 4D2TA 4IM2A 5HI2A 3PUPA 5EOBA 5HTCA 4NW6A 3PXYA 1IEPA 4AW0A 2GQRA 5M06A 4ZSGA 3E8DA 4GYIA 2UW8A 2YACA 4KABA 1R39A 1XJDA 3IONA 4AAAA 3I6UA 2VV9A 5KZIA 3LFQA 4RWKA 2B9HA 2GHMA 3T9IA 1FVRA 3LE6A 5M4UA 3GVUA 3E88A 1PMEA 2HYYA 3OW4A 4FKSA 4S32A 3BWJA 3KULA 4XYFA 5DT0A 4DCEA 4F6UA 4DEAA 4MD9E 4FV8A 5EKNA 3NSZA 4EOLA 4FV7A 3AQVA 5A14A 3QCYA 3UG1A 4FF8A 3LCOA 3IGOA 1RE8A 4YZNA 3NVMB 4BI1A 1HCKA 2R3HA 4KBKA 5F20A 3TZ8A 3O0GA 1B6CB 4U6RA 4CFMA 3MIYA 2X8EA 2OO8X 2A19B 3DAJA 3OS3A 3PTGA 4FIGA 4PP9A 2F57A 4CZUA 2WEVA 4YTFA 1H1WA 3HZTA 3LXLA 3CGOA 4BI0A 4NYEA 3TDWA 4U79A 5E90A 4EUTA 2H96A 3FLWA 3E8CA 4FEVA 5CLPA 4I0TA 2GFSA 4XV1A 3VRYA 4FVPA 1H8FA 4O86A 2IZUA 3BBWA 4FG7A 4LOOA 4AX8A 3QD0A 5K5NA 3MY0A 5AP4A 2QC6A 4H3QA 5D7VA 4NL0A 3ROCA 4FOCA 4CLJA 4RGJA 4G31A 4CRLA 4EZ7A 4I4EA 5JN2A 4C4EA 1GIHA 4FSTA 5CU6A 5AR5A 4FZAB 4AW5A 2Y4IC 4TZRA 2QI8A 4RIYB 3KXXA 4F9AA 3NUPA 5KBRA 1WZYA 4U3ZA 2XB7A 3F82A 4PDPA 5DRBA 2OF4A 1OKVA 3DFAA 2OJIA 4XEYA 5CEQA 3CJFA 3SAYA 4PWNA 5M09A 5J95A 3TJCA 3KL8A 4IHPA 4C61A 3DKGA 4FV0A 2XNBA 2XCHA 2XBJA 3TWJA 4ANLA 3NUUA 2B1PA 4EHVA 2Y7JA 2XJ1A 2Y4IB 3KF7A 1BMKA 2EXMA 2BIKB 4ZTRA 3QZFA 3WF7A 5IQBA 3A7IA 3KN6A 3LCTA 2ZYBA 5L6PA 5BVWA 5DEWA 1Z57A 3KKVA 2QOLA 5G6VA 4O81A 3MDYA 2H8HA 3DAKA 5ACKA 3WE8A 2HAKA 3QZGA 2R7IA 3HL7A 3AG9A 4MKCA 4JR7A 1TQIA 3A2CA 3I5ZA 2RIOA 3QD2B 5EW9A 2WMWA 2WMXA 2FA2A 2QODA 2BIYA 5CEOA 4C3RA 2QKWB 3W1FA 1U5RA 4R77A 2BRHA 3ZRLA 5ETAA 4EH6A 1M2QA 2G2HA 5EI2A 4PV0A 3VUIA 3D94A 2YDKA 4P4CA 1PXOA 2PPQA 5HQ0A 4J52A 2E9PA 3P7BA 5CU0A 3TZMA 4J8MA 3F2NA 1ZMWA 3PFQA 3AMYA 4R78A 4MH7A 4JIKA 4CCBA 2WKMA 1YHSA 4CT2A 3TM0A 4HVSA 3SA0A 4GJ2A 3DXPA 3V8SA 1YW2A 2PUPA 1MQBA 2G9XA 3NRMA 4HNFA 5C4LA 4PQNA 3Q53A 1O6KA 4EK5A 5E4HA 4RVKA 2R3GA 2YM6A 4AFJA 1JSTA 3KVXA 5ACBC 4YHTA 2E2BA 3I79A 1H1RA 4J97A 4AF3A 1F5QA 3UPZA 1XBBA 1KE8A 2W1HA 4C4IA 2ZB1A 2WU6A 5AA9A 1LPUA 3GC9A 3WOWA 2WIPA 3ET7A 4G6OA 4Y73A 3HAMA 1WAKA 3BHHA 4DGGA 3PJ1A 3VHEA 1YKRA 4DFLA 1NVQA 4DLJA 2JBPA 4HYUA 5HCYA 3UO6A 4C57A 3TUDA 3SKCA 3H9FA 2GTNA 4ANBA 2Q0NA 4EJ7A 3FPMA 4WRGA 5CSWA 5EI8A 3FQHA 4FIEA 5IA1A 3H0YA 3UC3A 1IASA 2YITA 3C4CA 3Q2MA 4QQCA 4QMOA 5BUJA 3H9OA 5FUTA 2YISA 1XH5A 4RPVA 3MPTA 1P5EA 5DHJA 4BIBA 4HGTA 3VUTA 1XO2B 4EOMA 2R3LA 4K8AA 4J98A 4NM7A 3LJ2A 2XNMA 4IE9A 5DT3A 4KSPA 4S34A 5HEZA 3RAWA 3JPVA 2WMAA 4FSWA 3NZ0A 4RMZA 1YOLA 3QWKA 3P1AA 4RFMA 2J90A 2HY0A 3RCDA 1ZY4A 2IVSA 3W16A 4FG9A 3VUHA 3O7LD 2QOIA 1YHWA 4TWNA 4JBPA 2QOHA 4ENYA 3MPAA 3JUHA 5E8TA 1URCA 4BDFA 3ZS5A 4ITHA 4CMUA 4HCUA 4ZMFA 3EKNA 3BV3A 4O6LA 4XBRA 4X2FA 1M7NA 3JY0A 4RQVA 5DRDA 5DOSA 3O7LB 3JY9A 5FBOA 3VS6A 4E3CA 4O84A 3PE1A 4OT6A 3HMMA 4AXAA 1REJA 5CY3A 1YDTE 4PPCA 5CNOA 3W33A 2RG5A 5JH6A 4XX9A 2XJ2A 5AAGA 4KRDA 4O0SA 2ITNA 4C3FA 3KB7A 4MBIA 4E73A 3F2AA 2O63A 3L9MA 5IMEA 1Y8GA 5BVDA 1KSWA 3F5XA 1OL6A 5M51A 2HIWA 3FZTA 3II5A 2EXEA 2UW9A 3C0IA 3IKAA 3NYNA 5DPVA 5BMSA 2XJ0A 4FTIA 4B7TA 4L46A 5LWNA 5JFWA 3LFSA 1KWPA 3D5XA 4R8QA 3VBTA 4E6QA 4BR3A 1LEWA 4FBXA 3VW8A 2W0JA 4IX5A 3RNYA 2A4LA 3EZVA 3FLQA 2FSTX 4I21A 5IEVA 4QTEA 1WVWA 4CTBA 3UC4A 1M2PA 3PE2A 4A4OA 2YM4A 1H1PA 4U5JA 3QGWA 3RKBA 1H01A 3F88A 4EH7A 2WNTA 4PP7A 5J79A 4BVUA 3BIZA 4WNPA 3A61A 4E8AA 4QYYA 3OWKA 4FTKA 2VTQA 3ZHPC 4QYHA 5A6OA 2XH5A 4BCOA 3TZ9A 4D28A 4AW1A 1ZRZA 2IZRA 3E63A 3EFJA 4X3FC 4BC6A 4C7TA 2UZOA 1R78A 3PJ2A 3TV4A 2PSQA 4RJ7A 3HMIA 2WB8A 4XRJA 3Q4ZA 3VS2A 3QCQA 1A48A 4N57A 5KX8A 2C6MA 4JG7A 4MXCA 4QNAA 2XMYA 3RJCA 4EK4A 4Z7GA 5KKRC 4FGRA 3NUXA 4GEOA 5CI6A 1H1SA 4F7SA 2OZAB 4CCUA 4L9IA 4EK3A 4H1JA 2J2IB 5AJQA 3I5NA 4U97A 4O7TA 4JS8A 4X3FB 4TTHB 4J71A 4DH1A 5HX8A 3EN6A 5B2MA 3W18A 2W9FB 4MF1A 5EG3A 5IDPA 5BMMA 2VNYA 2BTSA 5EDRA 4AOTA 4KIPA 5KKRB 3QCXA 1G8AA 5DYJA 1J1CA 2IWIA 3KA0A 3PRIA 4WUAA 4EH4A 4B6LA 4LRMA 4CKJA 1FGKA 3B2WA 4D1XA 5IUHA 5LQFA 2UW3A 3FXWA 2RFSA 4M0ZA 4D1ZA 4FTQA 5CQUA 4OTPA 3ZZEA 5AADA 3MN3A 3QQFA 2CCIA 2JFLA 4MNEB 2J7TA 4BGQA 3P08A 2GNHA 1P2AA 2CHLA 4EHGA 1OL2A 4YSJA 3FMLA 2XUUA 4LOQA 4DBXA 2WTWA 3JXWA 1W84A 4OTQA 5D41A 3TV7A 3DBEA 3UYSA 4YLKA 3MFTA 1GZNA 4TYHA 5E92A 4S30A 4M7IA 4FIHA 5FDPA 4WKQA 2R5TA 1U5QA 3C0HA 3QTQA 5HE0A 4YGAA 1RW8A 1YI4A 5I9VA 4F63A 2BPMA 5K5XA 2W1GA 4ANQA 4XG6A 2O3PA 4PNKA 4JVGA 2XEYA 3QQUA 4V05A 3V8WA 4EOIA 3HV6A 4FNZA 4LL0A 3RINA 3G51A 3ORNA 3F7WA 3PVWA 4BDJA 3OTVA 1F3MC 5CF6A 2PULA 4U45A 4QD6A 5DFPA 4MCVA 5KMOA 3OFMA 5FQDC 2VGPA 2O65A 4JIAA 1K9AA 2YJRA 4BBMA 3P4KA 4AE9A 5AA8A 1UKIA 4EOJA 1VYZA 2YFXA 2W9ZB 5AP5A 4N70A 3GC8A 2Z60A 5ICPA 2C5OA 4UMUA 3UP2A 2W1CA 4HZSA 4WBOA 4IEBA 3V5LA 3UVRA 3PG1A 3AMAA 4UALA 4HGLA 4FUXA 2W1DA 2XZSA 1HOWA 3FJQE 4FIFA 3V5TA 4CFUA 1SYKA 2BZIB 4ZZNA 2CGXA 3BQCA 5M55A 5LXMA 5D7AA 3E92A 3H3CA 3TUCA 2GS6A 1YI6A 5A46A 3PXFA 2VTNA 5L8KA 5IQEA 3FMHA 4F7JA 1I09A 4HVHA 4O82A 1H1QA 2J50A 2A2AA 4G3CA 4YP8A 1VYWA 4Y5QA 1J1BA 1U46A 3BYOA 2BFYA 4YO4A 2R64A 4O7WA 4IACA 2Y9QA 5GJDA 1PYXA 5IQAA 3TEIA 3LXKA 3G6GA 3C4WA 4IJPA 4TWOA 1GIIA 4X0MA 2VTJA 4D2PA 2HXQA 3R8PA 2ZVAA 3KCKA 2RKUA 3NW6A 4ZXTA 4PL3A 3EN4A 2ITYA 2YM7A 3HRFA 3I81A 4XS2A 2YIXA 3EQCA 5BYZA 3I6WA 2BDFA 3E8EA 4R1YA 4AA5A 2XIYA 5KE0A 3I7BA 1QPJA 3EQIA 4FT7A 3AC5A 3EN9A 4ONAA 4RIWB 5EM6A 5C1QB 3H4JA 3IDCA 4G16A 3VUMA 2Z02A 2PUIA 3ETAA 1WBSA 3ZH8A 4ZS0A 4AE6A 3QF9A 3NNWA 2XKDA 3B8RA 4RLKA 2C0IA 3ZLXA 4F0IA 3AC2A 3B8QA 4F9CA 5HZNA 4BDAA 5FGKA 5L2IA 1UWJA 2F7EE 4I41A 3U9NA 5IISA 1YXUA 2GHGA 3V04A 4DEHA 3BHTA 2ITZA 2Y4PA 1H28A 3Q3BA 2VO3A 4A4XA 1ZARA 1PXMA 2VWBA 2XRUA 2B7AA 2YLEA 3NYVA 3PSDA 3QC4A 3R63A 3BLRA 4QQ5A 3ZRMA 4FIIA 5JZNA 5A4CA 3C51A 3VQUA 1S9IA 3T3VA 5LMKA 4KB8A 4FL1A 4IX3A 3MYGA 4YJPA 3QRKA 2G01A 4WUNA 2B55A 4RJ8A 5CU4A 2PVRA 5J9ZA 4M84A 4BKYA 4AN9A 4FKQA 5J9YA 2YIQA 4G5JA 4IVCA 1SM2A 3JR1A 3F3ZA 4O7LA 3QTUA 4YZMA 1OIRA 1ZYDA 2W96B 1U54B 3DPKA 4WHZA 3AT4A 5JGAA 5CSPA 3AC3A 3DK3A 4DG3E 3MGYA 4MTAA 5EHYA 1PRYA 2R3JA 1PF8A 4HVDA 4WG4A 1V0OA 1CDKA 3S2PA 2RFEA 3C7QA 5IA0A 5HVJA 3ZBFA 3QUEA 2QG5A 4HCTA 3DKCA 2W1FA 2ZAZA 4DFUA 4BDEA 3FDNA 3COMA 5EM7A 5CZHA 3D7TB 3R8ZA 4AA0A 5HLPA 4QYFA 4JXFA 4MYGA 2EU9A 4PMTA 3IG7A 3EL7A 2KULA 3R73A 4JT3A 4U9AA 3W2CA 3UIXA 3D14A 4Q5EA 2CKEA 2OICA 2C47A 3FZSA 2I1MA 3FQEA 1JBPE 1WBOA 2QO7A 4O7RA 1H27A 3FUPA 4XG8A 3SDJA 1DAYA 2UW6A 2XRWA 4ASDA 4F7NA 2WTIA 1GOLA 2HXLA 3EFLA 4RLLA 4FZ6A 2FSMX 2H9VA 4G3EA 4OR5A 1O6YA 2P55A 5B7VA 2B4SB 3QD4A 4BGGA 3FXXA 4G17A 3W55A 2RL5A 3O2MA 1PHKA 4FC0A 4RWJA 1BUHA 1P4FA 4RWIA 2IVVA 5IQHA 2HZ4A 2XIXA 2YAAA 4FOBA 4A7CA 1KOBA 4C0TA 3BI6A 2JDTA 2FSLX 3BGZA 1BKXA 4EBWA 4K33A 2J6MA 3FZOA 1QL6A 5A3XA 4MNFA 3LMGA 1UU7A 4TKSA 3ZM4A 5CAUA 4NJ3A 3GU8A 3W8LA 5I9XA 5K3YA 4O83A 3TUBA 3C9WA 3TCPA 5CAOA 2GNIA 3TG1A 5KBQA 1OMWA 2J5EA 1B38A 2HOGA 5AAEA 3PWDA 3SXRA 5EDPA 3CKWA 4G3DA 3L8XA 1ZYSA 3BYMA 4R7BA 2UZLA 1MRVA 3P0MA 3K5UA 4EZ3A 5AFVA 2V22A 4M66A 1PMUA 2UV2A 4MHAA 4P5QA 1CKIA 1M7QA 4OBPA 3HVCA 4UX9A 4IWOA 3DLSA 4P5ZA 3DXQA 1W82A 4I24A 4PY1A 3LOKA 4FTUA 3EJ1A 4XH6A 1E1VA 3DGKA 1B39A 2C69A 3BYSA 5IA2A 5LJJA 3U87A 3FYKX 4K0YA 4E4NA 4UV0A 4I20A 2RFDA 2VD5A 1CM8A 4LUDA 4UB7A 4V0GB 4YC8A 5DH3A 4QP4A 3UNZA 3HRCA 2WQBA 3GUBA 4ZSLA 2P3GX 4KIKA 2J0IA 4ANNA 4DLIA 2OU7A 3QRTA 3O8PA 4IH8A 3TXOA 4Q9SA 4D4RA 5FLFA 2OXYA 2A1AB 4IVBA 4FTMA 1OPLA 5IEXA 4TNBA 3TT0A 2WXVA 3PZEA 2VWYA 4A9TA 2V0DA 1GY3A 2JKQA 2X9EA 4JR3A 5AUXA 4Z7HA 2W06A 3KMUA 1S9JA 3KF4A 2YIYA 2VO0A 3QRJA 4RBLA 5IU2A 1ATPE 3BHYA 2UZBA 1JOWB 3LFCA 3OROA 1M2RA 3QZIA 3KRRA 4L3PA 2ZDTA 5HIDA 3VUKA 2GHLA 3KGAA 3RK9A 2PVMA 4YPSA 4EH3A 5EDQA 3QUPA 3FLNC 4LV5A 3U8WA 3AC8A 3K54A 3OMVA 3HMOA 4II5A 3QQHA 4ASXA 3BLHA 4FKRA 2WGJA 4GYGA 2ZM1A 1ZXEA 4PDSA 5HLWA 1PXKA 3R7UA 2CNQA 5J87A 3F3UA 1L8TA 4GL9A 3OOGA 3TKIA 3Q04A 3KK9A 2Y6MA 4RX7A 2JIUA 3FZPA 4FKUA 3I1AA 3Q4UA 3NVKI 5GINE 5HTIA 3CIKA 5C4KA 5A4QA 4JBOA 3L8SA 4DGMA 3P23A 3U54A 3TTIA 4EONA 3VHKA 5E8XA 3HUBA 2CGVA 4KA3A 4FTJA 4M8TA 3RPVA 2CGWA 2O64A 3WI6A 1UNHA 3ZSHA 3LKMA 3NUAA 1Q99A 3HP5A 3KRJA 2R3RA 2YA9A 2QQ7A 4L7SA 2PZRA 3ENHA 3UNJA 3ZSIA 1H4LA 2UVZA 3SHEA 5GHVA 1Y6AA 1JPAA 2VWIA 1ZZ2A 4V01A 4TN6A 3PPKA 1YWRA 3A4OX 3ATTA 4X2KA 4RC4A 3WZDA 1UU8A 2AC3A 1FMKA 4FSRA 2J51A 5H3QA 1EH4A 3OUNB 5FBNC 2VTRA 4WG5A 4HVGA 3NWWA 2BHHA 2ZV7A 4FVQA 4L00A 4UY9A 2R3IA 3UIMA 3PYYA 1KUTA 4M69A 1R3CA 3PVUA 2ESMA 2GSFA 4ITIA 4C62A 2AC5A 3GU4A 1ERKA 5L4QA 4QMTA 1GAGA 2BUJA 5G1XA 4LV8A 4Q5HA 5EM8A 4W9XA 3F66A 4Y95A 3PP1A 4KUJA 2VWVA 2QO9A 4DH7A 1AD5A 2WZJA 1DM2A 5CAQA 1M52A 2HELA 4C34A 3MVLA 4W8DA 4EHZA 2Z8CA 3ODZX 3R9DA 2ZV2A 3AT2A 1UA2A 1UV5A 4XCUA 4O0VA 4GT3A 4FTTA 2WQNA 4RA4A 3PY1A 3W10A 3A99A 4TT7A 4DG0E 3QTIA 3DNDA 4ZZOA 4FTCA 4X2NA 3DKOA 1HCLA 3PP0A 2XK3A 3QQLA 3QU0A 2IZTA 4IXPA 4BTFA 1L3RE 3ORKA 3ZO3A 4LG4A 3LFBA 2BAKA 3E7VA 4IVDA 2VUWA 4UWBA 4BCQA 4TRLA 4EKKA 3NR9A 4RFZA 3EHAA 4QQTA 2VWXA 3R30A 3HMNA 3QTZA 3NGAA 5HGIA 3AD4A 5I9UA 4A06A 4E1ZA 4N0SA 4GK2A 4RRVA 5A9UA 5F9EA 5KMIA 3GOKA 2HWPA 5BNJA 4M97A 3O96A 4CZTA 3LMIA 4ALWA 2C3LA 4YUQA 5CT0A 3NDMA 4GU6A 4M3QA 1Z9XA 2OWBA 3M11A 5HE1A 5JQ5A 4IM0A 3FQSA 5HIBA 3LQ3A 3EQHA 3QX2A 4X7QA 5DI1A 2JDVA 1KE7A 4YZ9A 4BTKA 4C4GA 2X4ZA 4F0FA 2G2FA 1RDQE 3D7ZA 2UZWE 4I22A 4MXOA 4BL1A 5M4IA 1FMOE 5E1SA 2X7FA 1YXVA 2XP2A 3WF9A 1W83A 4DTAA 1MRUA 4XG4A 3Q9XA 2WTDA 3QTSA 3VC4A 4EK8A 5EQEA 1DS5A 4I3ZA 4KKHA 3UQGA 4GMYA 4CFVA 3OVVA 3IO7A 4FEQA 3ORIA 4G1WA 4BB4A 4XG9A 1JVPP 3MA6A 4BZNA 3DU8A 4PL4A 5AR7A 5AV1A 3UO5A 4U42A 3TNIA 2GNGA 3CR0A 2R3KA 1GZ8A 4L52A 4D0XA 3A7HA 5HU9A 4JOAA 4EKLA 3FKLA 3UO4A 2ZMDA 3FSKA 3RM6A 4UWYA 3SV0A 3VJOA 3FZRA 3R2YA 2YCQA 3MJ2A 4UZHA 3WIGA 5LMBA 2YM3A 1XH8A 3F3TA 3GT8A 4AZFA 5CU2A 1OKYA 2XVDA 3ZFYA 4JX3A 3GI3A 3GCPA 4LFIA 4RSSA 3FZ1A 5AMNA 5HBHA 2HCKA 4FTLA 3M42A 3ORZA 3FKOA 3NCGA 4ZTNA 5TR6A 4X2GA 3VS7A 4MQ2A 5JRQA 2B9IA 3A8XA 2VTTA 5AX9A 4D4YA 4ZS4A 3F61A 4XG7A 3WF6A 5CWZA 5CT7A 2C6IA 5FP6A 3ZSGA 5AUZA 3OTUA 5E1EA 4Y72A 3LCKA 5FTGA 3NUNA 1XR1A 5JQ8A 4IM3A 3AC1A 2GNFA 4U43A 3WF5A 5LWMA 1JKTA 5IA5A 3G6HA 2JKOA 2Y6OA 4O2ZA 3NIZA 4FX3A 3ZXTA 4DC2A 3SOCA 4MWHA 3E93A 1ZOGA 2I7QA 3BU5A 4DH5A 5ANJA 3SX9A 3DBFA 3MVHA 3FL4A 3TV6A 1YVJA 5B0XA 4I93A 3UBDA 3R02A 3L8PA 2J5FA 3DKFA 3EWHA 5AR2A 4GSBA 4BKZA 2IN6A 3O8UA 4IAZA 3OT3A 2VNWA 2W4KA 3Q9ZA 3D5WA 3CE3A 4G3GA 3U4WA 4FA2A 1H0WA 4GW8A 4U41A 4L7FA 3VS5A 5IH5A 5A4LA 3CCNA 4J95A 3DK7A 1KE5A 2R3MA 3QKMA 3G2FA 3ZC5A 4FKIA 3FYJX 4YZCA 4QP8A 3FAAA 3T8OA 2OJJA 3FMDA 4ZTLA 3UZRA 5IA3A 4X6RA 4JG6A 4XUFA 4RIYA 1O9UA 4FV2A 3NYOA 1XQZA 1YHVA 3CQUA 4L01A 4NK9A 4C37A 5AUWA 5AV4A 1RQQA 1VEBA 4A07A 3ALNA 3AGLA 4EQUA 4I94A 3ID6C 4EI4A 5FDXA 4O7ZA 5M57A 3H30A 4GUBA 2CSNA 2VGOA 3R9HA 1W0XC 2PL0A 3TL8A 4IC8A 3F5PA 5EM5A 2UW0A 3NAXA 4IAAA 1J7UA 2IZSA 4AT5A 4B4LA 2XKCA 4BWXA 2XYNA 4RG0A 5LVLA 3FXZA 3HGKA 1ZYJA 3C13A 4ZLYA 2XNPA 3BE9A 3OXZA 3P9JA 3E64A 4ID7A 3PPZA 4EOKA 5DEYA 5M08A 2JC6A 4BTMA 4DF3A 3GGFA 2QHMA 2CN5A 1UNGA 1PKGA 2OXDA 2ZV8A 5TO8A 3IS5A 1WFCA 2VTOA 4JG8A 2Z7RA 4PTGA 3FMMA 5KZ0A 4C33A 2BAQA 3BYVA 3UZPA 5FG8A 3O51A 3FMNA 3O17A 3QZHA 1BL6A 4WNKA 2QLUA 4UXLA 1BYGA 2QCSA 1JSUA 3CD8A 3QLGA 3UOKA 2ACXA 2H34A 5F95A 3EOCA 4WD5A 5M44A 4L42A 1WBTA 3PY0A 1BI7A 4JX7A 3MFRA 3BLQA 3WARA 4HOKA 2JDRA 4JDJA 3VRZA 4TW9A 1OECA 2DYLA 4IZYA 1V0BA 2X2LA 2EUFB 3WZJA 3ZOSA 2XIKA 3C50A 3ELJA 4LOPA 4TNDA 3OG7A 4WO5A 2PVLA 4GIIA 1LP4A 4DFBA 4U8ZA 2LAVA 5JSMA 2YAKA 2F4JA 2QOQA 2ETRA 4GT4A 4HYHA 4F6SA 1Q97A 5LCKA 3UIUA 4RX5A 2ZJWA 3P5KA 3PSCA 3ROYA 3EQGA 5FP5A 1XH9A 1Q8TA 5I5ZA 4GRBA 1H08A 2YN8A 2VTAA 4YZDA 4BZDA 3R1QA 2OG8A 3ODYX 5ANEA 3TJDA 4FV9A 3MFUA 1J7LA 5GJFA 3LXNA 4IWPA 4E7WA 3PRFA 3U51A 3ZUVA 4E5AX 4EYMA 5IG1A 4ORKA 3DTCA 5IUIA 4P7EA 5GIPE 4EOSA 3VBXA 2REIA 4AOJA 4DGNA 2EXCX 2OW3A 4W4VA 3H0ZA 4BRXA 3UVPA 3HUCA 1IA9A 4FKVA 5ETIA 4I5PA 1BX6A 3FHIA 3IW7A 2Q83A 2LGCA 2PE2A 3DB6A 4BZOA 3BCEA 2F2CB 4S33A 1W8CA 4YJRA 3ORMA 3C5IA 2WOUA 3ENMA 1TQMA 4I6HA 4DN5A 4AA4A 4GT5A 4CQGA 5CEKA 5HU3A 4FODA 2OI4X 1DI9A 4I6QA 5C8MA 4RIOA 3R9RA 1UKHA 4O0WA 2YHVA 3QD3A 3UDBA 5L2QA 4FKPA 4G2FA 3QRUA 4XP0A 5DGZA 4C36A 3T9TA 4FTRA 2EVAA 3ZFMA 3MJ1A 4D5HA 1YI3A 3OZ6A 1Y8YA 4A9UA 3D4QA 3KQ7A 2XNNA 4EOPA 2HW7A 1GJOA 2HWOA 5D10A 4KAOA 3NEWA 2QD9A 2R4BA 1OM1A 4FSUA 4XHKB 2OLCA 3FY0A 4BHZA 2OXXA 4WNMA 5D12A 1WBWA 4KBCA 3RNIA 3PXZA 4AZSA 3NS9A 4WIHA 2X2KA 3RAKA 4NCTA 2XK6A 4FIJA 1YXSA 5KMLA 4DAWA 4ERWA 3RWPA 4E26A 1Q24A 2ITWA 4GG5A 4EQCA 2PVFA 4XLVA 5FD2A 4YJVA 3FMJA 3UIBA 2OZOA 2ZOQA 4N6YA 4ACHA 4OGRA 4TYJA 3ZM9A 3R71A 3TZ7A 1E1XA 5I9ZA 4EBVA 3L9PA 1Q8ZA 5C01A 1R1WA 1IR3A 2AUHA 3QTWA 2WMBA 5H2UA 2R9SA 4XNEA 3E5AA 5D11A 4ZY5A 4FEWA 4Z55A 4IDVA 3KRLA 3C4ZA 5HKMA 4GKIA 4GK4A 3A7JA 4ZY6A 3DXNA 1YDRE 3QL8A 3N4VA 4W8EA 4FT9A 3ZCLA 2IVUA 2IG7A 2C3JA 3TNHA 2R3QA 4CVAA 5IF1A 5FWKK 4ZSEA 1PJKA 3U6HA 1OKWA 3D9VA 1DI8A 2J0LA 3NAYA 3MSSA 3FHRA 3OXIA 3E8NA 4NJDA 5L2TA 2P4IA 2C3KA 3OEZA 4JBVA 5AR4A 3VJNA 1WVXA 4JQ8A 4CG8A 5CEPA 3R21A 3UG2A 3UOJA 4UMRA 4D0WA 5LMKC 4YMJA 5EYMA 1OGUA 3DBCA 3COHA 4PTEA 2I40A 4XV2A 5CF8A 2P0CA 2CJMA 3HV4A 5IEYA 4NZWB 4YHJA 2WELA 3QFVA 2F49A 2KTYA 3ITZA 3QYZA 2PZ5A 3Q2JA 4TPTA 4O22A 2XNEA 4Z3VA 4LM5A 4RIXA 3TACA 5I3RA 2X6EA 3HDNA 4H3BA 1IRKA 4HJOA 4NU1A 5BVEA 4LMNA 5HE3A 4ZLZA 3V5QA 3HEGA 4BKJA 4F65A 3RAHA 4AUAA 4I5MA 4E4XA 3SW4A 4L68A 5EW8A 5CQWA 4BCJA 4EYJA 4Y83A 2JAMA 5CF4A 3MS9A 5M4FA 2QURA 1V1KA 4KRCA 4HGSA 1WVYA 2FB8A 4FT5A 1H0VA 1NW1A 3P79A 4U40A 5FM3A 3ULZA 1OBGA 1OUYA 2YDJA 4BIDA 4K1BA 4RZVA 5HNBA 3H10A 4FUYA 5DMZA 2OJFE 3CPCA 3SQQA 2G1TA 3RHKA 3WIKA 1OB3A 4HPUE 3LZBA 3N4TA 4DCAA 3C4EA 4DFZE 5J7HA 2B9FA 1ZAOA 2ITQA 2QLQA 4QP9A 4J8NA 5AUUA 1PMVA 3CP9A 4G9CA 2HZ0A 2ERZE 1E9HA 2OZAA 2J9MA 5AUYA 4FKWA 1FOTA 3F3WA 2C5NA 5JGDA 4X3FA 5E7RA 4DEDA 4QMQA 1OUKA 3DAEA 5CU3A 5EW3A 4CFNA 4OBOA 3EQFA 2X6DA 2ZDUA 3SLSA 3MFSA 2WPAA 3CY2A 1R0PA 4YLLA 4CFWA 4BY9E 1QCFA 4X3JA 4B8MA 3K2LA 5DWRA 3ACJA 4ZSJA 2XNOA 3THBA 2B52A 4USEA 4ANOA 1T46A 3OD6X 4RJ5A 5DIAA 3N4UA 5GZ8A 2UZEA 3PA5A 4OTFA 5JZJA 4I0SA 4BCFA 4QP6A 3MH1A 5DR6A 4NIFA 4MNEA 4FZDB 4R7HA 5CSHA 4F1MA 1RJBA 5A4EA 4L3LA 4O21A 4YU2A 2V5QA 4F9YA 2VX0A 4YC6A 1IAHA 3KMMA 2CKPA 4EWHA 1M14A 1ZY5A 2PZYA 3MB7A 4ZJVA 5EK7A 4FMQA 3EN5A 1YWVA 2UZVA 2QOOA 2HENA 2QR7A 1UU3A 4F1TA 4FTOA 3VNTA 1H00A 2HK5A 1WBPA 2RG6A 4RFYA 5J1WA 3FI8A 3C1XA 5IQCA 1IAJA 5B2KA 2HW6A 4NH1A 1SNUA 4OTHA 3U6IA 3FMEA 3QRIA 5FRIA 5AP6A 4R1VA 1PMNA 4GJ3A 4UEUA 5HLNA 4L8MA 4QMZA 2R0IA 3HNGA 4MK0A 3EYGA 3E62A 3RZBA 3UOHA 1W7HA 4NW5A 3COIA 4O91A 4F09A 3E3BX 3QHWA 3FLSA 4AT3A 5T6KA 4CNHA 3Q6WA 3NNVA 3QALE 4RJ4A 4OTRA 5AIRA 2C30A 5DVRA 2R3PA 4TYEA 4EC9A 4K9YA 3QXOA 4HZRA 2C0OA 3NIEA 4QYEA 5TOZA 3V3VA 2OIQA 3BWFA 2BZJA 2PUUA 3OW3A 2FYSA 3HMPA 3HYHA 3G33A 3KEXA 4PPBA 4ACGA 4C8BA 1F0QA 3PXKA 3FI3A 4L45A 4FEUA 2IW8A 5BQ0A 3IGGA 4ZJIA 4CFFA 3FY2A 3KRXA 3CGFA 2BILB 3KK8A 4PMMA 5IQFA 3TKUA 4KIKB 4L43A 5DR2A 3VIDA 2F7XE 3CQEA 3LAUA 5J7BA 3REPA 4MXAA 4I4FA 5D9HA 3DCVA 1XWSA 3DJ7A 4LGGA 3V51A 3BGQA 4QP3A 4CMOA 2XK4A 4R5YA 2X4FA 4A9RA 4NT4A 2WD1A 5LCJA 5HG5A 3A60A 3POZA 4FR4A 3MB6A 4XOZA 4DEBA 4LL5A 1P14A 1R0EA 1PXIA 4AZTA 4FL2A 2ONLA 4AGUA 5AR8A 1G8SA 4BGHA 2W5BA 4O1OA 4QTAA 2Z7LA 1QPEA 3ZU7A 2BKKA 4D2WA 2DWBA 3CTHA 2F2UA 3GU5A 5HVYA 3CTJA 3QKLA 3GENA 4MXZA 4RC3A 3EFKA 4E4LA 1KE6A 4F64A 4YR8A 1H26A 4C2WA 4DHFA 4PX6A 4R5SA 3COKA 3E87A 4NUSA 4RIWA 4U44A 3A4PA 4PF4A 2WMUA 2ITVA 4BCIA 4E5BA 1ZMVA 2I0EA 1YXTA 3BE2A 3FL5A 5GJGA 3ORLA 3U6JA 4X21A 4CTCA 3QYWA 1PKDA 5L6WL 2PUNA 1KOAA 2Y8OA 4QMVA 5EYKA 4BHNA 2IPXA 5TT7A 2GNLA 4I92A 4BICA 2HZIA 5IA4A 4IX4A 3O23A 3MVJA 3R1SA 4MBLA 3ZLSA 2XYUA 5HO8A 3TKHA 2BCJA 4YTCA 4ZP5A 3ZUUA 1XH6A 3ERKA 3OOMA 4GFMA 4IZAA 4IW0A 3CQWA 1G3NA 2Z7SA 3SRVA 1PXPA 3EN7A 3VVHA 3IW5A 3G90X 3BHVA 3VBYA 3BYUA 5EYCA 5FEEA 3WZEA 4BBFA 3C5UA 5K4JA 2PYWA 2QNJA 2YWPA 1PYEA 3HRBA 2QOCA 1Q4LA 2OFVA 4IQ6A 5JEBA 2VN9A 3L8VA 3G9NA 1UU9A 4RVLA 4YJUA 4TXCA 4EOQA 3WBLA 2WTJA 3SD0A 5M56A 4AZEA 4IWQA 3UYTA 4BDKA 5KHWA 1MUOA 1Z5MA 5HX6A 4B9DA 5M07A 4O0TA 5CYIA 4C4HA 2X8DA 1KV2A 2VRXA 5KCVA 4B8LA 4FT0A 2CMWA 3I60A 4UWCA 3MTLA 3EB0A 4IAKA 3UTOA 4GFGA 3D7TA 2YABA 4J96A 3NNUA 2UZNA 4BDDA 3ZO1A 2QU6A 4FNWA 2JITA 4NM3A 4WSYA 4IC7A 4XMOA 3ZBXA 1XKKA 5CVGA 4EWQA 3HV3A 5E8VA 4JI9A 3BU3A 2OIDA 2A27A 4YTHA 4JRNA 5I4NA 1Q3DA 3KREA 4TY1A 4QOXA 4JDHA 1Y6BA 2ZV9A 4D2SA 2ITPA 2PZIA 3QLFA 4H36A 3V5WA 3R00A 4W4YA 3R04A 4IDTA 5HO7A 3G0EA 3F2RA 3A8WA 3QQKA 2XKFA 5BVOA 3UMWA 4X6QC 1J91A 3GXLA 4X2JA 2BZHB 4TWPA 2WTKC 5CF5A 2CGUA 4MXYA 4FTNA 4CRSA 4BF2A 3GOPA 3CLYA 3OBJA 3EKKA 3NUYA 4WNOA 4S31A 4GCJA 4M0YA 2QR8A 3TNWA 3KFAA 2I0HA 4J7BA 4C35A 3QHRA 5DLSA 4DTKA 3Q52A 3SXFA 3KULB 3R9NA 1SVGA 4IMYA 3UGCA 4OAUC 2OSCA 3PA3A 4LMUA 4IVAA 3Q9WA 4TYIA 4DGLC 2W1ZA 4MX9A 4DH8A 3LLAA 1XH4A 3RPRA 4C2VA 5CENA 2IO6A 4DEIA 2WTKB 4IAIA 1FGIA 2UUEA 4BCGA 4BDIA 5T68A 1PY5A 4MWIA 1WCCA 4DBNA 5HD4A 2C1BA 3PJ8A 2C3IB 5CAPA 4AN2A 4QMPA 5B2LA 2CNVA 5DN3A 3RBWA 4FEXA 2O2UA 4UMQA 3RTPA 2ITOA 1FVTA 1SVEA 4IJ9A 4RQKA 3GBZA 4ZTHA 4BWPA 3DOGA 3P78A 2GPHA 4KWPA 4PPAA 4GS6A 4UYNA 4R3PA 3MV5A 3RPSA 3W32A 4QTCA 4KNBA 4JQ7A 3RPOA 1SNXA 2W99B 3R01A 3LFDA 1OBDA 3I4BA 4L67A 3HA6A 4V0GA 2PTKA 3NUSA 2R0UA 3RZFA 3MBLA 3ULIA 3SVVA 2VTIA 4EK6A 4GVAA 3DB8A 2OGVA 4U7ZA 2OKRA 5ANIA 4A9YA 3IECA 2XM8A 3WE4A 4Z9LA 2BMCA 4D2VA 4AG8A 3VW6A 2ITXA 2EWAA 3MI9A 4E6AA 2PY3A 3TNQB 5EFQA 4WSQA 4AZWA 2NPQA 3SG9A 3MH2A 4U3YA 2PVJA 1WBVA 2ITUA 3OEFX 5HD7A 3CSVA 1VZOA 2WQOA 3HP2A 4FNXA 5DE2A 3T3UA 3DJ6A 2VU3A 4ZZMA 2JKMA 3AC4A 1SMHA 4QMUA 5HNGA 1IA8A 4UZDA 4CSVA 2PMLX 3BQRA 3PVGA 1X8BA 4QMWA 2DS1A 4FKGA 5CNNA 1YRPA 4RVTA 2BRMA 4NTSA 4K6ZA 4W9WA 4EOOA 4JJRA 3KY2A 1ZZLA 5E8SA 4Q9ZA 3FV8A 3GFWA 3R1YA 1ZOEA 4HYIA 3TN8A 2BALA 4FV5A 4E5WA 2GQSA 1URWA 4QMSA 4IFGA 2J4ZA 4ZMEA 2BHEA 2QO2A 1REKA 3EH9A 4IB0A 3PIZA 5I0BA 3JS2A 2WMQA 3OY3A 4OLIA 5AP7A 5L8JA 4IB5A 2BDWA 3IW8A 1KE9A 4CLIA 3OP5A 4F6WA 3WILA 3OWJA 3CY3A 3ZTXA 1J3HA 4IBMA 3GNIB 2C6KA 2GCDA 2BRBA 3VS0A 5C26A 3R7IA 5JKGA 3N51A 3R7GA 3GC0A 4ALVA 3FKNA 3EQDA 5IQGA 3PLAE 3OBGA 3ZEWA 3R8UA 2VTHA 2UZTA 4UMPA 4RWLA 5ANOA 3G15A 4JQEA 1Y91A 4E93A 3F5UA 4MVFA 1DAWA 3VULA 2E9VA 1BLXA 2W1IA 4G5PA 3NW7A 4YURA 1OI9A 3KN5A 3VF9A 2CN8A 2J0KA 1OITA 2PU8A 3VUGA 3Q6UA 2HZNA 1K2PA 3RP9A 5CXHA 3LJ0A 3LM5A 4QPMA 4ASEA 1AQ1A 3JYAA 2O0UA 3Q32A 2P33A 4C59A 2PHKA 2V62A 3KMWA 2GMXA 4G34A 4GU9A 5CASA 3W2SA 3NX8A 2CNUA 4R3RA 4V04A 4AP7A 4PUZA 2FUMA 4CT1A 3VUDA 3LMHA 1SZMA 4LQMA 5ANGA 5LMAA 3BEAA 3K5VA 4KINA 3VS1A 3UODA 5ETCA 3WYYA 2WTVA 4ANSA 4JRVA 4PRJA 4EQMA 5EKOA 5FM2A 1XBCA 4NSTA 4U80A 5J8IA 1GZOA 3S1HA 3QC9A 5IZFA 3EMGA 4QMMA 5E8ZA 3K3IA 4OW8A 4BTJA 3D83A 2VWWA 2C1AA 4ACCA 4G6NA 3LFEA 3Q5ZA 1OPKA 1VR2A 2YLFA 1NT2A 5C9CA 3F7ZA 4F7LA 4PDOA 2JEDA 1A9UA 2X8IA 5H9BA 5KHXA 5K9IA 5DT4A 4H1MA 4P2KA 5HCXA 3AD6A 4CFXA 2I0YA 1OL5A 3LIJA 4FL3A 3CJGA 2ETKA 3A7FA 1LEZA 3RAIA 4N6ZA 4B99A 3GU6A 2UVXA 2XM9A 1UVRA 3C4XA 5CZIA 3MW1A 3TNPC 2WHBA 4IZ5A 5AUTA 3R7OA 1OVEA 2RGPA 2JIIA 1XHAA 1Q5KA 1WMKA 5EYDA 3OCGA 5LVMA 3DJ5A 3ANQA 2W05A 4FNYA 3EZRA 3NYXA 4LYNA 2R7BA 3PA4A 2XCKA 4DINA 4O7YA 4L6QA 4EH5A 1SVHA 4BFMA 4AGDA 4FK3A 3UE4A 2UW5A 4JAJA 4GV1A 5EHLA 3W2RA 4FSYA 2YERA 3P7AA 2QHNA 4NTTA 3BKBA 5E8YA 3RK7A 5I9WA 2O5KA 4CV8A 4XG2A 4DG2E 4CV9A 1Q41A 4FZ7A 2CKOA 2ZM4A 3BGPA 3VS4A 3MY5A 5EI6A 5HIEA 3KXZA 4QYGA 3PPJA 4O0UA 3QA0A 3HA8A 4M15A 3ZO4A 3RALA 5J1VA 3EL8A 3ANRA 3SXSA 2WTCA 4CKRA 3FE3A 5IUGA 4GKHA 5H8BA 4YLJA 3BRBA 3VF8A 4BWKA 1WBNA 4RVMA 4CD0A 2WMRA 2C5YA 2OFUA 4RX9A 3CEKA 4FKTA 4NM5A 5M4CA 5JFXA 2W5AA 4Y8DA 3SG8A 3FMKA 4GG7A 4JDKA 3KXNA 4FV1A 3ZEPA 1OIYA 4YPDA 4O7NA 2UW4A 3RVGA 4F99A 3F6XA 4QT1A 5AUVA 3AOXA 3OHTA 2C5XA 3FWQA 5TE0A 4QP1A 5GZ9A 5FTQA 4BI2A 5L2WA 3BV2A 2UZUE 4CEGA 1JAMA 3FBVA 4ACDA 5CTPA 4FVRA 3I7CA 3QX4A 2GU8A 5M53A 1JKKA 3L9NA 3KXMA 2DUVA 2OBJA 3QTXA 4M14A 2QU5A 4ZEGA 2ZMCA 3R28A 3S3IA 2BRNA 4BDBA 3DY7A 4HGEA 1M17A 5J9LA 4YBKA 4QNYA 4A9SA 4BDHA 4J53A 5ITAA 2BRGA 4FT3A 3ZONA 4KSQA 5CX9A 3HECA 1FINA 3TDVA 4OTWA 5HESA 2W5HA 2VTMA 4MEDA 2NRYA 1ZLTA 3UP7A 2PMOX 3IOKA 4G6LA 4NCTC 4R6VA 4RA5A 5H8GA 4ZIMA 4B0GA 4DFNA 1Q8UA 5L3AA 4UBAA 1NXKA 3RGFA 4EH9A 2YWVA 2FH9A 2UW7A 5TKDA 3PVBA 3EQPA 3FSFA 5CSVA 1QPDA 2Q0BA 3UMXA 5I9YA 3ZXZA 3ZLYA 5HVKA 2VWUA 4FI1A 5AV3A 2H6DA 3ALOA 3IW4A 3VBQA 3W2OA 4WG3A 2X0GA 3DNEA 2JKKA 4GK3A 4XG3A 3VBWA 2WMSA 1TQPA 4QMNA 4F0GA 5KMNA 3R83A 5AV2A 3E3PA 5FEQA 4D55A 3Q4TA 5HICA 1JLUE 3DBQA 2CLXA 3LXPA 4FSZA 3ZDIA 4CXAA 4ZTMA 4YC3A 2J0MB 5JK3A 3UJGA 3L1SA 5KMKA 4PDYA 3UVQA 3DDPA 1GIJA 3PJCA 3GCVA 4DA5A 2B9JA 4D1SA 2B54A 3ORPA 4K11A 4O6EA 3E7OA 3LQ5A 3PXQA 5GNKA 4UN0C 3KCFA 4K77A 4TL0A 3DDQA 3GB2A 4NFNA 2RFNA 5E91A 4U0IA 3MY1A 4AZVA 3QKKA 3V6SA 4QTBA 1PXJA 4MBJA 5CSXA 1UWHA 2WQMA 1MRYA 4YJNA 4ACMA 5JMSA 3GFEA 3ACKA 4R7IA 2GFCA 3IDBA 4TYHB 5D1JA 4E6CA 1NVSA 2CLQA 4U81A 5EHOA 3P86A 5HO6A 3PZHA 2PWLA 5BPYA 3UZTA 2VWZA 3ZO2A 4J99A 2VO7A 4NKSA 5DG5A 4IIRA 4YJSA 3FI4A 4XBUA 3ZYAA 3CD3A 2YIWA 3KXGA 3QAME 4YJOA 4KKGA 3SW7A 2X7OA 1I44A 2X1NA 3C4FA 3FC1X 4IANA 5A6NA 3RMFA 5KO1A 1OIUA 2HY81 2QVSE 4RIXB 5HG7A 4CG9A 3NNXA 4W4XA 2E9OA 2VTPA 4WRSA 4EORA 5KNJA 3ZUTA 2XS0A 3EIDA 4ZTSA 5HE2A 4RC2A 4O27B 5HBEA 3R7YA 3SC1A 2ZM3A 3OT8A 5HORA 5AP2A 3DT1A 5F1ZA 3GC7A 3LVPA 4QPSA 4AN3A 3L9LA 4FYNA 4JBQA 4DITA 2BZKB 2EB2A 2OF2A 3Q4CA 4ZSAA 2SRCA 2O8YA 4H58A 2QKRA 3GCQA 3PLSA 2V7AA 3DA6A 4RZWA 2BDJA 2YEXA 2XIZA 1Q61A 3F5GA 3BX5A 4QO9A 3EYHA 3I0OA 4BDGA 3S00A 3U4UA 3LM0A 3UQFA 3AXWA 5J5TA 3CPBA 5GZAA 1JKSA 2WIHA 3GEQA 4BCMA 2C6EA 3MWUA 2XIRA 4FV4A 4G9RA 4EC8A 4BCHA 1OIQA 4O1PA 2PZPA 4GIHA 3RCJA 4ANMA 2Z7QA 4H3PA 5IH6A 2IVTA 2YJSA 4D9TA 3DQWA 2BKZA 2YCSA 1YOJA 3R9OA 4L53A 2VO6A 2PMNX 2IJMA 4KD1A 1JKLA 1STCE 2C6DA 3DK6A 2XBAA 4E6DA 2PVHA 1TVOA 3AT3A 2P2HA 3NLBA 3KXHA 1ZMUA 3LW0A 3S4QA 1H25A 2YM5A 2EB3A 4OTDA 3KRWA 5H8EA 1QPCA 5AEPA 4HVIA 4D4VA 4Q2AA 3O50A 4NIFB 5C27A 5CI7A 3ZMMA 4F08A 3MH0A 1MP8A 4KKEA 2P2IA 3R8MA 2YCRA 3Q9YA 4PL5A 5LOHA 5BYLA 3D0EA 5ANDA 5AR3A 5CEIA 4KS8A 4HPTE 3RI1A 2CDZA 3R2BA 1NY3A 1Q8YA 4BIEA 3LCSA 1U4DA 4AW2A 2A0CX 4XOYA 2OH4A 2ITTA 2E9UA 3Q60A 4BCPA 5FXRA 4BBEA 4FSNA 4C3PA 3B2TA 4NEUA 2X39A 4FKLA 3UPXA 4OTGA 5HG8A 1OL1A 4YO6A 4YNOA 4L3JA 2B53A 2FGIA 2W4JA 2V55A 4UYAA 3HLLA 4HCVA 2RF9A 3R0TA 2GQGA 1YOMA 2WU7A 5GIOE 2GNJA 4UXQA 5HBJA 4JLCA 4OT5A 4P90A 4M68A 4G3FA 5KUPA 4W4WA 2VZ6A 4ZOGA 3HX4A 2ETMA 4S2ZA 5HTBA 4CGAA 4F9WA 4M13A 1JNKA 2ERKA 3LJ1A 3VN9A 4ENXA 1V0PA 4F4PA 1GZKA 4I5HA 3GU7A 3O71A 5DR9A 4CYIA 2W1EA 2VX3A 5AAFA 3ZC6A 3GCSA 4QP2A 3D2KA 3FC2A 2WAJA 5AIKA 2JAVA 3R22A 4FE2A 2ONLC 5AP3A 1TKIA 3F3VA 1OPJA 4QMYA 3V5PA 4FK6A 3VBVA 5CXZA 3CTQA 5HNIX 4R3CA 4DYMA 3OCBA 4H39A 4YZBA 4I23A 3UOLA 4YBJA 2JFMA 5DBXA 3WYXA 2BFXA 3AGMA 1Y57A 2GDOA 5CANA 2GS7A 4NKAA 5EOLA 5ANKA 4JL9A 4CZYB 4D2RA 4M67A 3FLYA 4BN1A 4O96A 4RX8A 3ORTA 5HCZA 4AU8A 1CKPA 1ZYLA 4C4FA 5IQDA 3DV3A 3BELA 2WO6A 3R7VA 2PK9A 1CMKE 4FKJA 4XRLA 2NP8A 4D9UA 2YDIA 3CC6A 3DZOA 3VAPA 3V01A 2C6OA 5JGBA 2WQEA 3MIAA 5F4NA 4ZJJA 1BI8A 2CCHA 1QMZA 3R8LA 4H05A 4DT9A 5L8LA 4E20A 3U55A 2WMVA 4FSMA 2QONA 3R7EA 4YSMA 2CPKE 1UNLA 3DS6A 4CKIA 2JGZA 2PMIA 1YDSE 2C68A 4I1ZA 4DH3A 3IQ7A 5KMJA 5E8UA 5LARA 4MD8E 2XA4A 2E9NA
chains in the Genus database with same CATH superfamily
2YZLA 4GVJA 2VAGA 4FZFB 4IB3A 5HHWA 1MQ4A 4RT7A 4KIQA 4O2PA 5A4TA 5K0XA 3EFWA 4GUEA 3ZFXA 4FTAA 4USFA 2ZB0A 3LFFA 4EL9A 2YCFA 1LR4A 3R6XA 1FPUA 5HOAA 1GNGA 2FSOX 2AYPA 4EH8A 2YM8A 4ERKA 2CKQA 4QMLA 4ASZA 3R8VA 3SRVB 4DFYA 3UQCA 4DT8A 2Y0AA 4HYSA 3LFNA 4OUCA 4EJNA 3W2PA 5I3OA 4EHEA 4YNEA 2ZFYA 3S95A 3ZZWA 1LUFA 4I6FA 5DA3A 3M1SA 5C8NA 3LPBA 4YTIA 1PXNA 3TIYA 1YWNA 4C02A 4I6BA 4FG8A 3G0FA 3CKXA 5F94A 3PSBA 2XF0A 4ITJA 3U9CA 4AGWA 4DEEA 4YJQA 4LI5A 5CS6A 2XNGA 2JLDA 3IOPA 1Q3WA 2I6LA 3VQHA 2NO3A 4IFCA 2W17A 4BYJA 4XJ0A 1T45A 5C8KA 5L6OA 1OL7A 3RHXA 2X2MA 4LDTA 3QQGA 4PNIA 3G5DA 4IB1A 4D5KA 2OJGA 2VTLA 2WMTA 5CVHA 3KVWA 2X7GA 3ZRKA 4FYOA 5AV0A 3IK3A 4LRJA 2WFYA 5EQYA 2PE0A 4QPAA 5IPJA 2BAJA 5KMMA 4AQCA 5EH0A 3BHUA 5C03A 2BR1A 4A4LA 1A06A 4QP7A 4YHFA 4ZK5A 4C4JA 4NFMA 4Z16A 1FQ1B 5LVPA 2FO0A 2J0JA 5FEDA 3RM7A 4QQJA 5JRSA 3KC3A 4ARKA 1PW2A 2V7OA 3FI2A 3QQJA 4QMXA 1YXXA 1H07A 4GFOA 1CSNA 5JT2A 3LCDA 5AWMA 5HG9A 5CALA 4XLIA 2OK1A 3GQIA 2XKEA 4QTDA 2GS2A 2UVYA 3HKOA 3MVMA 1P4OA 5IMXA 2JDSA 1CTPE 4JDIA 4KIOA 1JWHA 4IWDA 2BVAA 2UZDA 3OCTA 4WT6A 4ZY4A 3JVRA 3DLZA 4XP2A 1APME 3BPRA 2XK8A 4AACA 4HW7A 5K4IA 2PE1A 3HAVA 3BBTB 3OXTA 4I0RA 5FXSA 4KS7A 2QG7A 3MESA 4O38A 3DZQA 2R3FA 4Y46A 3BZ3A 4O7VA 3F9NA 4AS0A 5IDNA 3I0QA 3BU6A 1W98A 1PXLA 2PVKA 3HDMA 4ZTQA 3HV5A 4ALUA 3PY3A 3D5VA 1U59A 3GP0A 4Y85A 4F70A 5J5SA 3HV7A 5IKWA 1O6LA 4F9BA 1U54A 2BTRA 4FICA 4TYGA 4BCNA 3V5JA 3WF8A 5LVOA 1K3AA 5L2SA 3PDTA 5FTOA 5AM6A 4DTBA 3PXRA 3VWAA 3PIXA 4KBAA 3RWQA 4IADA 1OZ1A 3W2QA 3D15A 3MTFA 3WZKA 3POOA 3MH3A 3N9XA 4M69B 4WA9A 3W8QA 3AMBA 3QA8A 3RPYA 2YIRA 4Y5HA 4FGBA 4AFEA 4C58A 2OJ9A 3Q5IA 4OAVB 4AOIA 2IW9A 2JDOA 2DQ7X 3FLZA 3NW5A 3MPMA 3ZLWA 4BCKA 4JNWA 1BL7A 2W4OA 2WOTA 3QXPA 4J1RA 3WZUA 4MXXA 1J7IA 4IAFA 3OCSA 3OF0A 1YQJA 3AD5A 3V6RA 1OKZA 4NM0A 4BDCA 4ZLOA 4MQ1A 2WEIA 4DGOA 3EQRA 1XBAA 4O0XA 3DQXA 4N4SA 5K0KA 3CS9A 4I5CA 3G9LX 5BUIA 4DE4A 3OUKA 2C0TA 5T3QA 3A7GA 4APCA 4AT4A 3OWLA 2VX1A 3D5UA 3QTRA 4GH2A 1NA7A 2G15A 4O0RA 5CAVA 1IG1A 5BVKA 4F1OA 3OC1A 2NNWB 2B0QA 2IW6A 2XK9A 4O7SA 1VJYA 2I0VA 3QWJA 4LRKA 3TI1A 1Q8WA 2OIBA 1JQHA 3MA3A 4RJ6A 2RSVA 4USDA 3SGCA 3UNKA 4EUUA 4OBQA 4E4MA 2GTMA 3VO3A 2Z2WA 1ZOHA 3DFCB 3TIZA 5BUEA 2YZAA 4CMTA 2F7ZE 3CXWA 4APPA 3S0OA 3KU2A 3O8TA 3PG3A 4D4SA 3P7CA 2OH0E 5JFVA 2XAOA 4TWCA 4DEGA 2NRUA 2VTSA 3DBDA 5DNRA 3SOAA 4BYIA 5IQIA 4K2RA 1G5SA 4NWMA 5CVFA 5IH4A 3F69A 5AX3A 3QCSA 3JVSA 2BROA 3NCZA 3ATSA 2R3NA 3C0GA 4JAIA 4DFXE 1NVRA 2JD5A 1ZYCA 4LGHA 4EEVA 5BVNA 1ND4A 4AWIA 4M12A 5AM7A 1FBNA 5A54A 3RK5A 3V8TA 5E9EA 3GCUA 4WOVA 5BVFA 2XK7A 3DTWA 2PVNA 2W7XA 1XH7A 5E8WA 2R3OA 1CKJA 4XV3A 3QBNA 4AGCA 4ZAUA 5BX0A 5JFSA 2XALA 1Q62A 3H9RA 2F9GA 3IDPA 4IAYA 4QRCA 2C6TA 3CBLA 3ORXA 1AGWA 2JIVA 3GQLA 4MAOA 4MF0A 5AP1A 1H24A 3IW6A 3A62A 4UMTA 5TF9A 4CQEA 2R2PA 3BEGA 4MD7E 2QOBA 3M2WA 2G2IA 4WBBB 3VS3A 5FXQA 4FV6A 4PTCA 2C4GA 3R1NA 4LGDA 4PMPA 4FKOA 2XEZA 3LQ8A 4YJTA 3TTJA 1KV1A 4EZ5A 4IX6A 4RJ3A 5AP0A 3NMUF 3LLTA 2QOKA 2C6LA 3D2IA 4D58A 2PVYA 4LUEA 3K3JA 4O0YA 2QOFA 3ZDUA 4C38A 3PWYA 4OTIA 3IPHA 4K18A 4IZ7A 1JSVA 2X9FA 5BYYA 5LVNA 3LHJA 4FV3A 4AXEA 3OY1A 3OWPA 3QUDA 4HNIA 4XP3A 5CEMA 3PJ3A 3LFAA 4FSQA 3FPQA 2C5VA 2JBOA 4XV9A 4L44A 3PIYA 1FVVA 5ETFA 4CYJA 3Q96A 3NPCA 4PMSA 2X81A 3FEGA 3EQBA 4EH2A 1ZWSA 3QGYA 5EQPA 2FVDA 4D2TA 4IM2A 5HI2A 3PUPA 5EOBA 5HTCA 4NW6A 3PXYA 1IEPA 4AW0A 2GQRA 5M06A 4ZSGA 3E8DA 4GYIA 2UW8A 2YACA 4KABA 1R39A 1XJDA 3IONA 4AAAA 3I6UA 2VV9A 5KZIA 3LFQA 4RWKA 2B9HA 2GHMA 3T9IA 1FVRA 3LE6A 5M4UA 3GVUA 3E88A 2AEGA 1PMEA 2HYYA 3OW4A 4FKSA 4S32A 3BWJA 3KULA 4XYFA 5DT0A 4DCEA 4F6UA 4DEAA 4MD9E 4FV8A 5EKNA 3NSZA 3W0PA 4EOLA 4FV7A 3AQVA 5A14A 3QCYA 3UG1A 4FF8A 3LCOA 3IGOA 1RE8A 4YZNA 3NVMB 4BI1A 1HCKA 2R3HA 4KBKA 5F20A 3TZ8A 3O0GA 1B6CB 4U6RA 4CFMA 3MIYA 2X8EA 2OO8X 2A19B 3DAJA 3OS3A 3PTGA 4FIGA 4PP9A 2F57A 4CZUA 2WEVA 4YTFA 1H1WA 3HZTA 3LXLA 3CGOA 4BI0A 4NYEA 3TDWA 4U79A 5E90A 4EUTA 2H96A 3FLWA 3E8CA 4FEVA 5CLPA 4I0TA 2GFSA 4XV1A 3VRYA 4FVPA 1H8FA 4O86A 2IZUA 3BBWA 4FG7A 4LOOA 4AX8A 3QD0A 5K5NA 3MY0A 5AP4A 2QC6A 4H3QA 5D7VA 4NL0A 3ROCA 4FOCA 4CLJA 4RGJA 4G31A 4CRLA 4EZ7A 4I4EA 5JN2A 4C4EA 1GIHA 4FSTA 5CU6A 5AR5A 4FZAB 4AW5A 2Y4IC 4TZRA 2QI8A 4RIYB 3KXXA 4F9AA 3NUPA 5KBRA 1WZYA 4U3ZA 2XB7A 3F82A 4PDPA 5DRBA 2OF4A 1OKVA 3DFAA 2OJIA 4XEYA 5CEQA 3CJFA 3SAYA 4PWNA 5M09A 5J95A 3TJCA 3KL8A 4IHPA 4C61A 3DKGA 4FV0A 2XNBA 2XCHA 2XBJA 3TWJA 4ANLA 3NUUA 2B1PA 4EHVA 2Y7JA 2XJ1A 2Y4IB 3KF7A 1BMKA 2EXMA 2BIKB 4ZTRA 3QZFA 3WF7A 5IQBA 3A7IA 3KN6A 3LCTA 2ZYBA 5L6PA 5BVWA 5DEWA 1Z57A 3KKVA 2QOLA 5G6VA 4O81A 3MDYA 2H8HA 3DAKA 5ACKA 3WE8A 2HAKA 3QZGA 2R7IA 3HL7A 3AG9A 4MKCA 4JR7A 1TQIA 3A2CA 3I5ZA 2RIOA 3QD2B 5EW9A 2WMWA 2WMXA 2FA2A 2QODA 2BIYA 5CEOA 4C3RA 2QKWB 3W1FA 1U5RA 4R77A 2BRHA 3ZRLA 5ETAA 4EH6A 1M2QA 2G2HA 5EI2A 4PV0A 3VUIA 3D94A 2YDKA 4P4CA 1PXOA 2PPQA 5HQ0A 4J52A 2E9PA 3P7BA 5CU0A 3TZMA 4J8MA 3F2NA 1ZMWA 3BL9A 3PFQA 3AMYA 4R78A 4MH7A 4JIKA 4CCBA 2WKMA 1YHSA 4CT2A 3TM0A 4HVSA 3SA0A 4GJ2A 3DXPA 3V8SA 1YW2A 2PUPA 1MQBA 2G9XA 3NRMA 4HNFA 5C4LA 4PQNA 3Q53A 1O6KA 4EK5A 5E4HA 1W2DA 2R3GA 4RVKA 2YM6A 4AFJA 1JSTA 3KVXA 5ACBC 4YHTA 2E2BA 3I79A 1H1RA 4J97A 4AF3A 1F5QA 3UPZA 1XBBA 1KE8A 2W1HA 4C4IA 2ZB1A 2WU6A 5AA9A 1LPUA 3GC9A 3WOWA 2WIPA 3ET7A 4G6OA 4Y73A 3HAMA 1WAKA 3BHHA 4DGGA 3PJ1A 3VHEA 1YKRA 4DFLA 1NVQA 4DLJA 2JBPA 4HYUA 5HCYA 3UO6A 4C57A 3TUDA 3SKCA 3H9FA 2GTNA 4ANBA 2Q0NA 4EJ7A 3FPMA 4WRGA 5CSWA 5EI8A 3FQHA 4FIEA 5IA1A 3H0YA 3UC3A 1IASA 2YITA 3C4CA 3Q2MA 4QQCA 4QMOA 5BUJA 3H9OA 5FUTA 2YISA 1XH5A 4RPVA 3MPTA 1P5EA 5DHJA 4BIBA 4HGTA 3VUTA 1XO2B 4EOMA 2R3LA 4K8AA 4J98A 4NM7A 3LJ2A 2XNMA 4IE9A 5DT3A 4KSPA 4S34A 5HEZA 3RAWA 3JPVA 2WMAA 4FSWA 3NZ0A 4RMZA 1YOLA 3QWKA 3P1AA 4RFMA 2J90A 2HY0A 3RCDA 1ZY4A 2IVSA 3W16A 4FG9A 3VUHA 3O7LD 2QOIA 1YHWA 4TWNA 4JBPA 2QOHA 4ENYA 3MPAA 3JUHA 3UDZA 5E8TA 1URCA 4BDFA 3ZS5A 4ITHA 4CMUA 4HCUA 4ZMFA 3EKNA 3BV3A 4O6LA 4XBRA 4X2FA 1M7NA 3JY0A 4RQVA 5DRDA 5DOSA 3O7LB 3JY9A 5FBOA 3AKJA 3VS6A 4E3CA 4O84A 3PE1A 4OT6A 3HMMA 4AXAA 1REJA 5CY3A 1YDTE 4PPCA 5CNOA 3W33A 2RG5A 5JH6A 4XX9A 2XJ2A 5AAGA 4KRDA 4O0SA 2ITNA 4C3FA 3KB7A 4MBIA 4E73A 3F2AA 2O63A 3UDSA 3L9MA 5IMEA 1Y8GA 4BJJA 5BVDA 1KSWA 3F5XA 3NFFB 1OL6A 5M51A 2HIWA 3FZTA 3II5A 2EXEA 2UW9A 3C0IA 3IKAA 3NYNA 5DPVA 5BMSA 2XJ0A 4FTIA 4B7TA 4L46A 5LWNA 5JFWA 3LFSA 1KWPA 3D5XA 4R8QA 3VBTA 4E6QA 4BR3A 1LEWA 4FBXA 3VW8A 2W0JA 4IX5A 3RNYA 2A4LA 3EZVA 3FLQA 2FSTX 4I21A 5IEVA 4AQKA 4QTEA 1WVWA 4CTBA 3UC4A 1M2PA 3PE2A 4A4OA 2YM4A 1H1PA 4U5JA 3QGWA 3RKBA 1H01A 3F88A 4EH7A 2WNTA 4PP7A 5J79A 4BVUA 3BIZA 4WNPA 3A61A 4E8AA 4QYYA 3OWKA 4FTKA 2VTQA 3ZHPC 4QYHA 5A6OA 2XH5A 4BCOA 3TZ9A 4D28A 4AW1A 1ZRZA 2IZRA 3E63A 3EFJA 4X3FC 4BC6A 4C7TA 2UZOA 1R78A 3PJ2A 3TV4A 2PSQA 4RJ7A 3HMIA 2WB8A 4XRJA 3Q4ZA 3VS2A 3QCQA 1A48A 4N57A 5KX8A 2C6MA 4JG7A 4MXCA 4QNAA 2XMYA 3RJCA 4EK4A 4Z7GA 5KKRC 4FGRA 3NUXA 4GEOA 5CI6A 1H1SA 4F7SA 3AKKA 2OZAB 4CCUA 4L9IA 4EK3A 4H1JA 2J2IB 5AJQA 3I5NA 4U97A 4O7TA 4JS8A 4X3FB 4TTHB 4J71A 4DH1A 5HX8A 3EN6A 5B2MA 3W18A 2W9FB 4MF1A 5EG3A 5IDPA 5BMMA 2VNYA 2BTSA 5EDRA 4FJVA 4AOTA 4KIPA 5KKRB 3QCXA 1G8AA 5DYJA 1J1CA 2IWIA 3KA0A 3PRIA 4WUAA 4EH4A 3ML1A 4B6LA 4LRMA 4CKJA 1FGKA 3B2WA 4D1XA 5IUHA 5LQFA 2UW3A 3FXWA 2RFSA 4M0ZA 4D1ZA 4FTQA 5CQUA 4OTPA 3ZZEA 5AADA 3MN3A 3QQFA 2CCIA 2JFLA 4MNEB 2J7TA 4BGQA 3P08A 2GNHA 1P2AA 2CHLA 4EHGA 1OL2A 4YSJA 3FMLA 2XUUA 4LOQA 4DBXA 2WTWA 3JXWA 1W84A 4OTQA 5D41A 3TV7A 3DBEA 3UYSA 4YLKA 3MFTA 1GZNA 4TYHA 4QDVA 5E92A 4S30A 4M7IA 4FIHA 5FDPA 4WKQA 2R5TA 1U5QA 3C0HA 3QTQA 5HE0A 4YGAA 1RW8A 1YI4A 5I9VA 4F63A 2BPMA 5K5XA 2W1GA 4ANQA 4XG6A 2O3PA 4PNKA 4JVGA 2XEYA 3QQUA 4V05A 3V8WA 4EOIA 3HV6A 4FNZA 4LL0A 3RINA 3G51A 3ORNA 3F7WA 3PVWA 4BDJA 3OTVA 1F3MC 5CF6A 2PULA 4U45A 4QD6A 5DFPA 4MCVA 5KMOA 3OFMA 5FQDC 2VGPA 2O65A 4JIAA 1K9AA 2YJRA 4BBMA 3P4KA 4AE9A 5AA8A 1UKIA 4EOJA 1VYZA 2YFXA 2W9ZB 5AP5A 4N70A 3GC8A 2Z60A 5ICPA 2C5OA 4UMUA 3UP2A 2W1CA 4HZSA 1XMMA 4WBOA 4IEBA 3V5LA 3UVRA 3PG1A 3AMAA 4UALA 4HGLA 4FUXA 2W1DA 2XZSA 1HOWA 3FJQE 4FIFA 3V5TA 4CFUA 1SYKA 2BZIB 4ZZNA 2CGXA 3BQCA 5M55A 5LXMA 5D7AA 3E92A 3H3CA 3TUCA 2GS6A 1YI6A 5A46A 3PXFA 2VTNA 5L8KA 5IQEA 3FMHA 4F7JA 1I09A 4HVHA 4O82A 1H1QA 2J50A 2A2AA 4G3CA 4YP8A 1VYWA 4Y5QA 1J1BA 1U46A 3BYOA 2BFYA 4YO4A 2R64A 4O7WA 4IACA 2Y9QA 5GJDA 4DDIA 1PYXA 5IQAA 3TEIA 3LXKA 3G6GA 3C4WA 4IJPA 4TWOA 1GIIA 4X0MA 2VTJA 4D2PA 2HXQA 3R8PA 2ZVAA 3KCKA 2RKUA 3NW6A 4ZXTA 4PL3A 3EN4A 2ITYA 2YM7A 3HRFA 3I81A 4XS2A 2YIXA 3EQCA 5BYZA 3I6WA 2BDFA 3E8EA 4R1YA 4AA5A 2XIYA 5KE0A 3I7BA 1QPJA 3EQIA 4FT7A 3AC5A 3EN9A 4ONAA 4RIWB 5EM6A 5C1QB 3H4JA 3IDCA 4G16A 3VUMA 2Z02A 2PUIA 3ETAA 1WBSA 3ZH8A 4ZS0A 4AE6A 3QF9A 3NNWA 2XKDA 3B8RA 4RLKA 2C0IA 3ZLXA 4F0IA 3AC2A 3B8QA 4F9CA 5HZNA 4BDAA 5FGKA 5L2IA 1UWJA 2F7EE 4I41A 3U9NA 5IISA 1YXUA 2GHGA 3V04A 4DEHA 3BHTA 2ITZA 2Y4PA 1H28A 3Q3BA 2VO3A 4A4XA 1ZARA 1PXMA 2VWBA 2XRUA 2B7AA 2YLEA 3NYVA 3PSDA 3QC4A 3R63A 3BLRA 4QQ5A 3ZRMA 4FIIA 5JZNA 5A4CA 3C51A 3VQUA 1S9IA 3T3VA 5LMKA 4KB8A 4FL1A 4IX3A 3MYGA 4YJPA 3QRKA 2G01A 4WUNA 2B55A 4RJ8A 5CU4A 2PVRA 5J9ZA 4M84A 4BKYA 4AN9A 4FKQA 5J9YA 2YIQA 4G5JA 4IVCA 1SM2A 3JR1A 3F3ZA 4O7LA 3QTUA 4YZMA 1OIRA 1ZYDA 2W96B 1U54B 3DPKA 4WHZA 3AT4A 5JGAA 5CSPA 3AC3A 3DK3A 4DG3E 3MGYA 4MTAA 5EHYA 1PRYA 2R3JA 1PF8A 4HVDA 4WG4A 1V0OA 1CDKA 3S2PA 2RFEA 3C7QA 5IA0A 5HVJA 3ZBFA 3QUEA 2QG5A 4HCTA 3DKCA 2W1FA 2ZAZA 4DFUA 4BDEA 3FDNA 3COMA 5EM7A 5CZHA 3D7TB 3R8ZA 4AA0A 5HLPA 4QYFA 4JXFA 4MYGA 2EU9A 4PMTA 3IG7A 3EL7A 2KULA 3R73A 4JT3A 4U9AA 3W2CA 3UIXA 3D14A 4Q5EA 2CKEA 2OICA 2C47A 3FZSA 2I1MA 3FQEA 1JBPE 1WBOA 2QO7A 4O7RA 1H27A 3FUPA 4XG8A 3SDJA 1DAYA 3PFYA 2UW6A 2XRWA 4ASDA 4F7NA 2WTIA 3P5JC 1GOLA 2HXLA 3EFLA 4RLLA 4FZ6A 2FSMX 2H9VA 4G3EA 4OR5A 1O6YA 2P55A 5B7VA 2B4SB 3QD4A 4BGGA 3FXXA 4G17A 3W55A 2RL5A 3O2MA 1PHKA 4FC0A 4RWJA 1BUHA 1P4FA 4RWIA 2IVVA 5IQHA 2HZ4A 2XIXA 2YAAA 4FOBA 4A7CA 1KOBA 4C0TA 3BI6A 2JDTA 2FSLX 3BGZA 1BKXA 4EBWA 4K33A 2J6MA 3FZOA 1QL6A 5A3XA 4MNFA 3LMGA 1UU7A 4TKSA 3ZM4A 5CAUA 4NJ3A 3GU8A 4O4DA 3W8LA 5K3YA 5I9XA 3TUBA 4O83A 3C9WA 3TCPA 5CAOA 2GNIA 3TG1A 5KBQA 1OMWA 2J5EA 1B38A 2HOGA 5AAEA 3PWDA 3SXRA 5EDPA 3CKWA 4G3DA 3L8XA 1ZYSA 3BYMA 4R7BA 2UZLA 3W0QA 1MRVA 3P0MA 3K5UA 4EZ3A 5AFVA 2V22A 4M66A 3KIOC 1PMUA 2UV2A 4MHAA 4P5QA 1CKIA 1M7QA 4OBPA 3HVCA 4UX9A 4IWOA 3DLSA 4P5ZA 3DXQA 1W82A 4I24A 4PY1A 3LOKA 4FTUA 3EJ1A 4XH6A 1E1VA 3DGKA 1B39A 2C69A 3BYSA 5IA2A 5LJJA 3U87A 3FYKX 4K0YA 4E4NA 4UV0A 4I20A 2RFDA 2VD5A 1CM8A 4LUDA 4UB7A 4V0GB 4YC8A 5DH3A 4QP4A 3UNZA 3HRCA 2WQBA 3GUBA 4ZSLA 2P3GX 4KIKA 2J0IA 4ANNA 4DLIA 2OU7A 3QRTA 3O8PA 4IH8A 3TXOA 4Q9SA 4D4RA 5FLFA 2OXYA 2A1AB 4IVBA 4FTMA 1OPLA 5IEXA 4TNBA 3TT0A 2WXVA 3PZEA 2VWYA 4A9TA 2V0DA 1GY3A 2JKQA 2X9EA 4JR3A 5AUXA 4Z7HA 2W06A 3KMUA 1S9JA 3KF4A 2YIYA 2VO0A 3QRJA 4RBLA 5IU2A 1ATPE 3BHYA 2UZBA 1JOWB 3LFCA 3OROA 1M2RA 3QZIA 4F78A 3KRRA 4L3PA 2ZDTA 5HIDA 3VUKA 2GHLA 3KGAA 3RK9A 2PVMA 4YPSA 4EH3A 5EDQA 3QUPA 3FLNC 4LV5A 3U8WA 2XANA 3AC8A 3K54A 3OMVA 3HMOA 4II5A 3QQHA 4ASXA 3BLHA 4FKRA 2WGJA 4GYGA 3VONA 2ZM1A 3W0SA 1ZXEA 4PDSA 5HLWA 1PXKA 3W0NA 3R7UA 2CNQA 2X0QA 3F3UA 5J87A 4GL9A 1L8TA 3OOGA 3TKIA 3Q04A 3KK9A 2Y6MA 4RX7A 2JIUA 3FZPA 4FKUA 3I1AA 3Q4UA 3TYKA 3NVKI 5GINE 5HTIA 3CIKA 5C4KA 5A4QA 4JBOA 3L8SA 4DGMA 3P23A 3U54A 3TTIA 4EONA 3VHKA 5E8XA 3HUBA 2CGVA 4KA3A 4FTJA 4M8TA 3RPVA 2CGWA 2O64A 3WI6A 1UNHA 3ZSHA 3LKMA 3NUAA 1Q99A 3HP5A 3KRJA 2R3RA 2YA9A 2QQ7A 4L7SA 2PZRA 3ENHA 3UNJA 3ZSIA 1H4LA 2UVZA 3SHEA 5GHVA 1Y6AA 1JPAA 2VWIA 1ZZ2A 4V01A 4TN6A 3PPKA 1YWRA 3A4OX 3ATTA 4X2KA 4RC4A 3WZDA 1UU8A 2AC3A 1FMKA 4FSRA 2J51A 5H3QA 1EH4A 3OUNB 5FBNC 2VTRA 4WG5A 4HVGA 3NWWA 2BHHA 2ZV7A 4FVQA 4L00A 4UY9A 2R3IA 3UIMA 3PYYA 1KUTA 4M69A 1R3CA 3PVUA 2ESMA 2GSFA 4ITIA 4C62A 2AC5A 3GU4A 1ERKA 5L4QA 4QMTA 1GAGA 2BUJA 5G1XA 4LV8A 4Q5HA 5EM8A 4W9XA 3F66A 4Y95A 3PP1A 4KUJA 2VWVA 2QO9A 4DH7A 1AD5A 2WZJA 1DM2A 5CAQA 1M52A 2HELA 4C34A 3MVLA 4W8DA 4EHZA 2Z8CA 3ODZX 3R9DA 2ZV2A 3AT2A 1UA2A 1UV5A 4XCUA 4O0VA 4GT3A 4FTTA 2WQNA 4RA4A 3PY1A 3W10A 3A99A 4TT7A 4DG0E 3QTIA 3DNDA 4ZZOA 4FTCA 4O4FA 4X2NA 3DKOA 1HCLA 3PP0A 2XK3A 3QQLA 3QU0A 2IZTA 4IXPA 4BTFA 1L3RE 3ORKA 3ZO3A 4LG4A 3LFBA 2BAKA 3E7VA 4IVDA 2VUWA 4UWBA 4BCQA 4TRLA 4EKKA 3NR9A 4RFZA 3EHAA 4QQTA 2VWXA 3R30A 3HMNA 3QTZA 3NGAA 5HGIA 3AD4A 5I9UA 4A06A 4E1ZA 4N0SA 4GK2A 4RRVA 5A9UA 5F9EA 5KMIA 3GOKA 2HWPA 5BNJA 4M97A 3O96A 4CZTA 3LMIA 4ALWA 2C3LA 4YUQA 5CT0A 3NDMA 4GU6A 1VLRA 4M3QA 1Z9XA 2OWBA 3M11A 5HE1A 5JQ5A 4IM0A 3FQSA 3W0MA 5HIBA 3LQ3A 3EQHA 3QX2A 4X7QA 5DI1A 2JDVA 3AKLA 1KE7A 4YZ9A 4BTKA 4C4GA 2X4ZA 4F0FA 2G2FA 1RDQE 3D7ZA 2UZWE 4I22A 4MXOA 4BL1A 5M4IA 1FMOE 5E1SA 2X7FA 1YXVA 2XP2A 3WF9A 1W83A 4DTAA 1MRUA 4XG4A 3Q9XA 2WTDA 3QTSA 3VC4A 4EK8A 5EQEA 1DS5A 4I3ZA 4KKHA 3UQGA 4GMYA 4CFVA 3OVVA 3IO7A 4FEQA 3ORIA 4G1WA 4BB4A 4XG9A 1JVPP 3MA6A 4BZNA 3DU8A 4PL4A 5AR7A 5AV1A 3UO5A 4U42A 3TNIA 2GNGA 3CR0A 2R3KA 1GZ8A 4L52A 4D0XA 3A7HA 5HU9A 4JOAA 4EKLA 3FKLA 3UO4A 2ZMDA 3FSKA 3RM6A 4UWYA 3SV0A 3VJOA 3FZRA 3R2YA 2YCQA 3MJ2A 4UZHA 3WIGA 5LMBA 2YM3A 1XH8A 3F3TA 3GT8A 4AZFA 5CU2A 1OKYA 2XVDA 3ZFYA 4JX3A 3GI3A 3GCPA 4LFIA 4RSSA 3FZ1A 5AMNA 5HBHA 2HCKA 4FTLA 3M42A 3ORZA 3FKOA 3NCGA 4ZTNA 5TR6A 4X2GA 3VS7A 4MQ2A 5JRQA 2B9IA 3A8XA 2VTTA 5AX9A 4D4YA 4ZS4A 3F61A 4XG7A 3WF6A 5CWZA 5CT7A 2C6IA 5FP6A 3ZSGA 5AUZA 3OTUA 5E1EA 4Y72A 3LCKA 5FTGA 3NUNA 1XR1A 5JQ8A 4IM3A 3AC1A 2GNFA 4U43A 3WF5A 5LWMA 1JKTA 5IA5A 3G6HA 2JKOA 2Y6OA 4O2ZA 3NIZA 4FX3A 3ZXTA 4DC2A 3SOCA 4AXFA 1W2FA 3E93A 1ZOGA 4MWHA 2I7QA 3BU5A 4DH5A 5ANJA 3SX9A 3DBFA 3MVHA 3FL4A 3TV6A 1YVJA 5B0XA 4I93A 3UBDA 3R02A 3L8PA 2J5FA 3DKFA 3EWHA 5AR2A 4GSBA