3A7JA

Human mst3 kinase in complex with mnadp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
287
structure length
286
Chain Sequence
MQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine kinase 24 (STE20 homolog, yeast)
publication title Structures of human MST3 kinase in complex with adenine, ADP and Mn2+.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 286
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3a7jA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3a7jA01
2XKEA 2JIUA 2YACA 3DB8A 3OC1A 5A9UA 2XIYA 2PSQA 1OVEA 3RTPA 3FEGA 3IDBA 4PL5A 2W1IA 3LM0A 4CFWA 4LGHA 4QOXA 4D4SA 3N4TA 4YURA 5EM7A 3QAME 4F9CA 2UW8A 3BCEA 3Q96A 2IW9A 1NVRA 5C8MA 4I21A 1SVHA 4F08A 4QQTA 4WRGA 3GXLA 3QWJA 2ETRA 4CFMA 3ORZA 4Y5HA 4V01A 3ZBXA 2GNLA 3ZOSA 4KBAA 2VWBA 2B7AA 4C62A 3SG8A 1ZRZA 3ETAA 2HZ4A 5KKRB 2GNGA 4U80A 4IX6A 4GW8A 1XJDA 4BTFA 5IUHA 5J5SA 2QR7A 4ARKA 5CLPA 2PZYA 1Q8ZA 5JT2A 2XH5A 4FBXA 3TKUA 3UO6A 3NUUA 1EH4A 3NRMA 1H0VA 4MYGA 4D2WA 2Y6MA 1ZOEA 2JDTA 3F7ZA 1RDQE 5FGKA 5FRIA 1W0XC 2CNUA 2X8IA 4WD5A 3L8XA 4C3RA 4QYEA 3DV3A 3BWJA 3KRLA 3GVUA 1RW8A 5CXZA 3FXWA 4JRNA 3TIYA 3ZRLA 2XP2A 4C57A 4ZJIA 4C38A 3LFCA 4OLIA 3CTJA 3QQFA 4F70A 2JC6A 4YP8A 3F69A 5K4JA 4A9RA 4C4FA 2QD9A 3P1AA 5FXRA 5AEPA 3WYXA 2FB8A 3KKVA 4V05A 5AR2A 4DEHA 5AX9A 4FKWA 5CI6A 5HVJA 3L9PA 4PMTA 1YHSA 3WILA 2ITVA 3VS5A 5E8SA 2QU5A 3CPCA 3TV6A 3ZH8A 2PPQA 3UG2A 2WMTA 3MB7A 2EVAA 2VTNA 4DFBA 2ESMA 2NRYA 3BRBA 4M66A 4WSYA 5CZHA 4A9YA 2BKKA 4HGEA 2Y0AA 3CR0A 2ITXA 4EOLA 3RZBA 3ZEPA 4G3EA 2W5BA 4BKZA 5L6OA 3C7QA 3O51A 4J8MA 4N4SA 3HV5A 3HLLA 4PDPA 4ANOA 3RPYA 3VS7A 3F5XA 3BIZA 2YWPA 5CVFA 4F99A 3V5TA 4O2ZA 4C35A 1URWA 3AQVA 2CSNA 4QNAA 4XJ0A 5EG3A 4IFGA 4BZNA 5BVWA 2B54A 3ZXZA 4EHGA 3EFKA 2BROA 4YTCA 4Z7GA 5KMKA 3CLYA 3BYVA 4I1ZA 3VW6A 1ZYCA 2VTIA 5KMJA 2B55A 3TJCA 4MXAA 4AT4A 5CF4A 3UP2A 4O1OA 1FGKA 4U8ZA 5M56A 2EXCX 3WIKA 5HQ0A 4ACHA 2BIKB 5CAVA 3FXXA 4ANNA 4C4GA 1CSNA 2QO2A 5HNGA 1Y8YA 1GZNA 2R4BA 1QPEA 3W55A 2PVRA 5LQFA 1R39A 4PX6A 4YZCA 4MNEA 3GU6A 5AV1A 5A6OA 3KCKA 4PMMA 2GFCA 4C4HA 4JJRA 5LMKC 3BHTA 4DH1A 3LM5A 5AV3A 2R3GA 3O0GA 3PZHA 5I4NA 4AFEA 5AM7A 2XNEA 4E5BA 2PZ5A 2QOOA 4D4YA 5M4FA 4MD8E 4I5PA 4HCTA 4YSMA 5CT7A 4I41A 4ITHA 4E6QA 1MRVA 2P2HA 1BLXA 3R04A 4TXCA 2OI4X 4XNEA 3ZYAA 2VGPA 3DBQA 4KRDA 4BKYA 2ZM3A 5A4QA 4DGGA 2P4IA 3EL7A 4EOJA 3KVXA 4E4XA 2J2IB 3IW4A 4O0YA 4QMNA 5KUPA 5IQAA 3O17A 3NIZA 1CM8A 3CP9A 4DG2E 5HNBA 4DN5A 4WUAA 4TYHB 4IM3A 1IAJA 4DG0E 2ZV7A 4UN0C 3KK8A 3NUNA 5H9BA 4AS0A 4MD7E 4XV9A 3LQ3A 4DT9A 1BKXA 4A06A 4YHFA 4CLIA 3M1SA 3CD3A 2WAJA 3NWWA 5I3RA 3I4BA 1FMKA 3LXLA 4F0FA 1GNGA 3I81A 3QTXA 5AR5A 3R7VA 4CTBA 4F63A 4GYIA 4FSTA 3SA0A 4O86A 3MBLA 4X2KA 4IVAA 3CKXA 4PP9A 3QL8A 4KINA 5EKNA 3KL8A 3EZRA 5IEVA 3TDVA 1OUYA 4WBBB 2ITUA 3OEZA 2BRMA 3P78A 4Y95A 2OGVA 3HP2A 3Q52A 5CT0A 5DIAA 3RP9A 3ZLYA 5JEBA 3E8EA 4PDOA 4C3FA 4EH2A 4KSPA 3HZTA 3LZBA 3QQLA 4ZSGA 5KNJA 3BLRA 4R3RA 4JR7A 1NVSA 4FICA 3R9RA 3HDNA 1M2QA 4YBJA 5IKWA 4DGOA 4IB5A 3OUKA 1WFCA 4KAOA 2OXXA 1L3RE 4BRXA 4CMUA 3KXHA 4FKQA 3SW7A 3JVSA 3R2YA 3ZUVA 1U54A 2QHMA 3BE2A 1XBAA 3ZFXA 2XNMA 3VJOA 4ZY6A 3AD6A 2W99B 4TRLA 4CFUA 5HG9A 3QQGA 3RHKA 1CKJA 1H00A 3BU3A 3DKCA 1YDRE 3I1AA 2Q83A 4PTGA 4AA4A 4ZTLA 3R21A 4BDBA 2HWOA 5E91A 5T3QA 5FUTA 3EQBA 2R3QA 3COKA 5CENA 3LCSA 4RIXA 1H4LA 2C6MA 4H3BA 4J99A 3VUKA 3BHHA 4NJ3A 3K5UA 4M68A 1SZMA 4Z9LA 1HOWA 4U81A 1OECA 1J1CA 4EH6A 2Y4PA 1Z5MA 2FH9A 4MWHA 1YXTA 3LQ8A 3CC6A 3SKCA 5EHOA 5CQWA 2C5NA 1RQQA 3PY0A 4OBOA 5G6VA 5A6NA 1FBNA 3UMWA 1RJBA 2SRCA 3D2IA 3TDWA 4U3YA 2JAMA 5GJFA 4HOKA 4ZK5A 5HNIX 5CAOA 3AD5A 4YU2A 3FQEA 4DH7A 1O6LA 4EH4A 4ZXTA 2PUIA 4NU1A 4JS8A 4PDSA 3EB0A 4Z3VA 3TCPA 1NXKA 2PVFA 2QU6A 3QXPA 1R1WA 5C1QB 5ICPA 1UKIA 3MVLA 3UIXA 2BRBA 2PVMA 3PP1A 4O83A 5I9VA 4FV3A 3VHKA 2PMOX 5D9HA 4U97A 5CU2A 5CF5A 2YIRA 1UWHA 5CAUA 2JIIA 5BVKA 4O7TA 3FKNA 3HRBA 4O7RA 5JZJA 2JITA 3OD6X 3QC4A 4MVFA 2R64A 1Z57A 3NS9A 2VTSA 2JGZA 4L67A 5AP4A 3S1HA 5J7BA 2CGXA 2FSMX 4L52A 3DJ7A 3QXOA 5EDQA 2HZIA 2VWUA 3OW3A 3TV7A 3PDTA 1H26A 4GUEA 3OWPA 4CCUA 5BYYA 2CMWA 4M12A 3DLZA 2GDOA 3FMDA 3SXSA 4Q2AA 1OIUA 4EOSA 4X3FC 1H0WA 2QLQA 3LMHA 4II5A 4AW5A 3LMIA 4DINA 1PXJA 2WZJA 3RAIA 5AUVA 2QODA 3U4UA 2VX3A 3FZOA 4K0YA 3NUPA 2C1BA 4CZTA 2JLDA 5EOLA 4JX7A 4RLKA 3HMMA 2QCSA 1FVTA 2WKMA 4AT3A 2A1AB 3IPHA 4EL9A 3H9OA 2X39A 5JN2A 3MH0A 2C6OA 3EJ1A 3O7LD 4JBQA 4KBCA 4NJDA 4QTBA 5TKDA 2QONA 4ZY5A 4KA3A 1TQMA 1ZOHA 3HUCA 4R5YA 1MQBA 3KXXA 2GS7A 3EYHA 2W1EA 3F9NA 4IFCA 2OXYA 3OVVA 3BLQA 2BCJA 4OT6A 2I40A 3DAEA 1KE9A 1YOLA 3COIA 3RPRA 3VNTA 3EQDA 3AC8A 1JKLA 3QTQA 3GB2A 3G0EA 1ZYSA 3KMWA 2BFYA 4BGQA 4EZ5A 3P86A 5DVRA 4TWOA 4X7QA 2YJRA 3ORXA 4FT7A 3RWPA 4FZDB 3W2QA 5KHWA 5C03A 3G5DA 1P14A 2B52A 3EH9A 5IH6A 3UZPA 4EUTA 2YITA 2DWBA 5L2IA 5CSWA 3FZTA 1GIHA 2XZSA 3IW6A 4ZS4A 3NEWA 3FQHA 4EOPA 2GS2A 4UV0A 4UYNA 3FYJX 3FY2A 3E8CA 4S32A 4CMOA 2XB7A 3OWLA 2YJSA 3ZFMA 5AA9A 5EH0A 3WOWA 3CS9A 1FOTA 2BVAA 2F2CB 4IACA 5D7AA 1CMKE 2QNJA 2Y4IB 3ZSGA 3VRYA 4FVRA 3NW5A 5E8ZA 4NSTA 2UW9A 4FGBA 4RA4A 4OAVB 5A4EA 3AC3A 2BZHB 3Q6UA 4MEDA 4DCEA 5JGAA 3C0IA 3Q32A 4LGGA 4AN9A 4RFZA 2C6LA 4M13A 4NZWB 3BU6A 4APCA 4AAAA 4EK8A 4NL0A 3HV3A 4EHEA 4UX9A 2KTYA 4YZMA 4PDYA 3VO3A 1YKRA 5M4CA 4XV2A 2ZYBA 3LJ1A 2W1ZA 2W1CA 5DN3A 4XCUA 4YTHA 5ETFA 3BQRA 3QF9A 5E8YA 4F7JA 5JGDA 4AUAA 3UPZA 3UZTA 4IM2A 4IC7A 4DHFA 4NTTA 1KOBA 4FIFA 4QT1A 3QQKA 3CD8A 5HZNA 4WBOA 2CCHA 4F4PA 2OIQA 3QQJA 5ANOA 5ETIA 2NNWB 1YOJA 2WQEA 3UJGA 3ZEWA 5JRQA 5GINE 2YM7A 3CGOA 3W8QA 3I7BA 3TZ7A 3LFEA 3LW0A 3MH1A 3QD0A 3L8PA 4NT4A 1WBSA 3F82A 4A7CA 1LR4A 3GENA 2RG5A 2XIZA 4D2RA 1PY5A 1JSUA 3ZXTA 4FV1A 1YHWA 4XBRA 2I0EA 2PZPA 4JBVA 3VBQA 1MRUA 5IMEA 1WAKA 5AUTA 3MH3A 3RVGA 3N9XA 4HPTE 3WARA 2XCHA 3W2SA 3QQUA 5D10A 1ZMUA 4YHTA 4D4VA 2ZV2A 4FKJA 4JT3A 4LGDA 4XMOA 5JZNA 4K1BA 5EYMA 3NCGA 4ZJJA 4O0VA 1CKPA 2UZUE 2PZRA 4QP1A 2A27A 2J5EA 2QO7A 2V0DA 2BAQA 3GC7A 3G6HA 4QO9A 2WTIA 4ZP5A 4EWQA 5GZ9A 4HVIA 5FTOA 4QRCA 3FMLA 2R3OA 3OWJA 1PXLA 3PVUA 5DMZA 5LMAA 3HMNA 3C9WA 3QTSA 2BRNA 2ZJWA 3QGWA 4Y46A 3IW8A 1PJKA 4UXLA 4S31A 1STCE 4QYFA 4WKQA 5L4QA 2A19B 5HD4A 3I5NA 3NCZA 5AAFA 2WMSA 4G3GA 4XP0A 2I6LA 4BIBA 4RWJA 3NUXA 2J6MA 2J7TA 4CMTA 3IQ7A 5DNRA 4FT5A 5EHLA 3V8SA 4JL9A 3KF4A 4RIYA 4I94A 2OBJA 3CY2A 3F5GA 5CSXA 1KSWA 1J1BA 2R7IA 4QNYA 4XX9A 2QI8A 4QP2A 4W8DA 2OJGA 1FVVA 2HZ0A 2UZWE 4PPCA 5EYCA 3OBJA 3I6UA 3MB6A 3V3VA 3UIMA 5CANA 4BDGA 4FKTA 5GNKA 5HTBA 3A61A 2FSLX 2CGWA 2X7GA 3FL5A 3FSKA 3RJCA 1GY3A 4FT3A 4AW1A 1KV1A 4IE9A 4LM5A 4WO5A 3G9LX 5T6KA 2X6EA 4O0SA 4XRJA 4O7WA 2OFUA 3EWHA 4ZSEA 3TWJA 5GIOE 1LEWA 2YEXA 3LFQA 3NSZA 3FKLA 4F09A 1ZZLA 5HI2A 3ZM4A 3UPXA 2JD5A 3I79A 4RBLA 4M69A 3OCBA 3B2TA 4I0SA 3ORIA 4RIXB 4ALWA 4RX9A 4BTJA 3FZ1A 4NIFB 2ZMDA 4RFYA 5DWRA 4O7YA 2W4KA 3KVWA 2JBPA 2WXVA 4TYGA 5HESA 3Q53A 4JBPA 3GCUA 3JY9A 2WOUA 3P0MA 1ND4A 1OIQA 1VYWA 2P33A 4U43A 4LMNA 4Q5HA 3FI8A 4FI1A 2OZAA 4CFVA 5GHVA 2YIQA 3ZLSA 4YNOA 4FIEA 4YC8A 3CQEA 1JOWB 1QMZA 4Q9ZA 2ZDTA 3QX2A 1J91A 2YABA 3BLHA 1IA8A 1OL2A 2W17A 4P4CA 5HE2A 4EBVA 5A46A 4GIIA 5KMLA 1SYKA 2YDIA 3QZHA 1OL1A 2F7EE 5KX8A 1M7QA 4FIHA 3NAXA 5CNOA 4ID7A 3TNHA 3R7EA 4QPSA 2B53A 3OF0A 2JDSA 1W8CA 1YDTE 3QRJA 3DGKA 4D2PA 4CQEA 4L44A 2CKQA 2FYSA 2OF2A 3D7TB 2B0QA 3ALOA 3GU5A 1YWVA 3BYOA 5IDNA 3KN5A 1M7NA 2YLFA 3Q4CA 4I0RA 1WVYA 4RPVA 4L42A 2WMVA 3AC1A 1BL6A 3LVPA 1F0QA 2UZOA 2PK9A 3FL4A 4IC8A 4YNEA 3ZRKA 4ANLA 5BMSA 2PU8A 1Q62A 4FTAA 4YUQA 3GCQA 4V04A 3TG1A 4I3ZA 3K3IA 3SAYA 3UOJA 4FL3A 3ZZWA 4BIEA 4L3LA 3DK6A 1J3HA 3EFLA 3FC1X 3EN4A 4YLLA 4YZ9A 4EH7A 4FA2A 5CSPA 3I0OA 4EC9A 2W05A 3LAUA 4KIKA 2XRWA 3C0GA 3DAJA 4K77A 4XG9A 5DGZA 4ACDA 5A4CA 3A7FA 3MWUA 5EKOA 3MTLA 3QRTA 4OTDA 1H24A 4RMZA 1J7LA 3PVWA 3CPBA 4PNIA 4M67A 4AOJA 1NA7A 2ITZA 2H34A 3L8VA 5B0XA 4C2VA 1FMOE 2VV9A 4BDHA 2B9FA 5LWNA 3U6HA 1Q61A 3RPSA 4WNOA 4W4WA 4W8EA 1J7IA 4BF2A 2B1PA 2C1AA 3OXZA 4QP3A 5DR6A 4HYSA 3RNYA 3KF7A 3R7IA 3GC9A 4HZSA 4L6QA 5CEIA 4FUXA 3V5LA 3VS0A 4YO4A 3OMVA 4E7WA 1WVWA 3CXWA 3R7YA 3REPA 3KRRA 3BZ3A 1Q8YA 4IZ5A 2V5QA 3D5WA 1O6YA 4X2FA 5AAEA 2E9OA 4BBFA 3GOPA 3UP7A 3KFAA 3G9NA 5AA8A 5FWKK 2ITQA 4FSMA 3LFFA 3P7BA 4ACMA 3ZONA 4XHKB 1YDSE 4ITIA 4YBKA 3WZJA 5HORA 2PYWA 1JAMA 1PMVA 3VBTA 5M4IA 4DEEA 4G9RA 3NYOA 3ENMA 1P5EA 5B2LA 4UWYA 4WNKA 5EI8A 4O0WA 4KKGA 2IZRA 3PRFA 5HD7A 4FKVA 2GFSA 4WHZA 3JPVA 3B2WA 2QKRA 2O8YA 3FUPA 4RZVA 2ITNA 4BVUA 4FL1A 4FT0A 5DE2A 4JX3A 3TV4A 1OPLA 5CAPA 2VWIA 1OL5A 3DBEA 5FQDC 3SDJA 3PUPA 3I6WA 3PWDA 2VD5A 3A60A 1GIJA 2YAKA 4ZLOA 3UYTA 3UZRA 4D2SA 5DI1A 2XK3A 4HZRA 3R7GA 2VWYA 4PPBA 4FSNA 4AN3A 4E5WA 5CASA 2XM8A 4WRSA 2JIVA 3O71A 5KE0A 4AXAA 2YWVA 3SHEA 2QOQA 5KMMA 4N6ZA 3GC0A 4OTRA 5JFSA 4EZ7A 2YLEA 2JFLA 4IAKA 1IAHA 3A7HA 5J8IA 1CKIA 2Y7JA 4RLLA 2J0IA 4C61A 4FKPA 4BCMA 3C13A 4L68A 3ULZA 3VVHA 3DDQA 3PA4A 5M53A 3NR9A 1OGUA 5HO8A 2Z7SA 1JQHA 4CV9A 2CKPA 2O63A 3DBFA 2R3PA 4IWPA 4BYJA 4EORA 2CN8A 3VUGA 3C51A 4RGJA 2BDFA 2VTQA 3GGFA 4J98A 5HX8A 3MY5A 2UZTA 2R3HA 2UW4A 4BDAA 5E1EA 4AG8A 3Q9ZA 3KXZA 5E8TA 4FTRA 2FSOX 2XKCA 4FG9A 3IS5A 3R9DA 3TL8A 5JK3A 1OI9A 2F2UA 5CTPA 4AN2A 4F6SA 4ZZOA 3G51A 4X3FB 4AFJA 5HVYA 4GL9A 3FE3A 4MXXA 5D11A 1JKSA 4I20A 4H36A 3T3VA 3TACA 1ERKA 2VTAA 3TKIA 2GTMA 4QMOA 2BAKA 2UUEA 2WMAA 1GIIA 3G2FA 5CU3A 4RVLA 4QMSA 3SOCA 4I0TA 2R3LA 4ZSJA 2ZDUA 5FBOA 4W9WA 1QL6A 3D5UA 5EFQA 4FT9A 4LI5A 4RWLA 5EYKA 4EOKA 4FG8A 2I0HA 4X3JA 5FEQA 5L8KA 3MN3A 4IAZA 1XO2B 4Q5EA 5CU0A 5HO6A 1J7UA 3VS3A 1W84A 3EQPA 4PP7A 1FPUA 3GT8A 2XNBA 2GNFA 1PXNA 3H0ZA 4P5ZA 3TTJA 4A07A 3DKOA 4C02A 1JKTA 2NRUA 4IANA 1DI8A 1Z9XA 2XUUA 4RVTA 3VUMA 3ZS5A 4MNFA 4BBMA 2C3JA 3NUAA 3H4JA 5HX6A 1PMEA 2V55A 3VS2A 4O6LA 5IA4A 5EW3A 4C0TA 4ZEGA 4TW9A 3FMMA 4EEVA 4K8AA 5DH3A 4EQCA 4O7ZA 3SX9A 3WZUA 4MTAA 2BHHA 1K3AA 4YO6A 4IAFA 1GOLA 4IDVA 4B0GA 3V51A 3EL8A 3A62A 4FKSA 3I5ZA 3MVHA 3DJ5A 4JQ8A 1YI3A 3SRVA 4QD6A 4GRBA 2J4ZA 4GS6A 5J5TA 3MVMA 4CNHA 2FSTX 2W0JA 3U4WA 2P3GX 4DE4A 5AAGA 1JNKA 2WFYA 4KKHA 3F3UA 5LVMA 2OJ9A 3MSSA 4M0ZA 4BYIA 3RCDA 3R7UA 4FVQA 4KSQA 5KBQA 3PG3A 5AM6A 2PULA 5H3QA 4O0RA 4RQKA 5AR3A 3A7GA 2IVVA 4JXFA 1YHVA 3UC3A 4DEBA 4BFMA 1HCLA 3O2MA 4IM0A 4E73A 3G6GA 5EM5A 3TUBA 4IHPA 3C5IA 3KREA 1A06A 4UZDA 3TNQB 2P55A 3FMHA 3EZVA 1R0PA 3QYWA 5AP5A 2C5YA 3DA6A 3ZSIA 1WBVA 4BCGA 3FI4A 3LMGA 3G0FA 4QTDA 5CYIA 1JPAA 5FXQA 3D15A 4J71A 2PE1A 2PVHA 1ZYDA 3PSBA 2VTPA 4FKOA 2R5TA 1NW1A 4QMXA 2BFXA 4ZTNA 3ENHA 4HPUE 2RKUA 3OHTA 2ETKA 2FUMA 4CSVA 2WU7A 4D1ZA 4O81A 2WTWA 5CXHA 5I9YA 4FTJA 4EI4A 3BEGA 4B6LA 2EU9A 4CKJA 1F3MC 5JFVA 1ATPE 2EXEA 2CLQA 1PMNA 3GU8A 3QTRA 4L9IA 3OP5A 1VYZA 3MA3A 3WZEA 2IWIA 4EH9A 1FGIA 3QHWA 1Q41A 3ZFYA 3F6XA 4DFXE 2H6DA 3H9FA 1BYGA 3OTUA 5ANKA 4TKSA 3C4FA 4XG6A 2IVSA 4O96A 3RMFA 1K9AA 2NPQA 5CSHA 1V0PA 5L6WL 2WMBA 3E88A 4KIQA 2QOLA 3GOKA 2OG8A 3P79A 4PNKA 2F9GA 3AC2A 3ANQA 3R28A 4OTFA 4G31A 2OLCA 4O7SA 2BTSA 4IX4A 5KO1A 3NAYA 3NNUA 4G34A 5T68A 3GCPA 2HYYA 3K2LA 5A4TA 3U6JA 4DEGA 3R8MA 4GG5A 3RNIA 5E7RA 2R3NA 4DA5A 5KHXA 4BN1A 4BHNA 4CFXA 4ANQA 3ZO4A 5EYDA 4N57A 3DLSA 5CQUA 3P5KA 3CY3A 4U79A 2DUVA 4AACA 2UW3A 4CRSA 4TYIA 4AGDA 4EK5A 2QURA 5L2QA 4QP4A 5HGIA 5JMSA 2YM5A 3KU2A 2UZLA 3PIYA 3VF9A 4DFYA 5AADA 1JVPP 4G17A 1GJOA 2J0LA 3OY3A 3QD3A 4RJ4A 3BHYA 2IG7A 1UV5A 4R77A 3KA0A 3MPMA 3MIYA 1MUOA 2OO8X 2OSCA 5E1SA 3HUBA 5F20A 2QG7A 2F7ZE 2OIBA 2YHVA 3DKGA 4R1YA 4DBNA 2FA2A 1GAGA 3DFCB 2CNQA 2B9IA 3PPZA 4ALVA 1SNXA 3OUNB 4RX8A 4ASDA 1ZARA 4ZSAA 3PXRA 4QYHA 4MBJA 5DEWA 4GH2A 2DQ7X 1OL6A 3SC1A 3CIKA 3P7CA 3HV6A 1PYEA 5J9ZA 3MFUA 4GG7A 2O65A 3MFRA 3II5A 5AFVA 3PRIA 3KRJA 3O8PA 1XKKA 4MD9E 3S95A 4E6AA 4X2GA 3V5WA 4MX9A 4G6LA 4K2RA 4UALA 4P7EA 1TKIA 4I24A 3OG7A 3BYSA 4F1MA 4M0YA 4FSQA 4RIWB 2XNGA 5LVNA 3HEGA 4I6FA 5C8NA 4X0MA 3OTVA 3FLQA 4FSYA 2WTDA 3O50A 2BAJA 3PXKA 2X6DA 3GQLA 5EDRA 4IWDA 4AU8A 4QYYA 4XG2A 5HCXA 3FZRA 4XG8A 2VTRA 4YMJA 4F7LA 1XBBA 3KXGA 5FD2A 2VZ6A 2G2FA 3AMBA 4BTMA 3FLZA 3PLSA 2HY81 4U9AA 1H1PA 2ZM1A 4FV0A 4FL2A 3LJ2A 3PIXA 2PUPA 3K5VA 1JSVA 4JG6A 4DEIA 4CVAA 4RWKA 4FTIA 1ZY4A 4FTUA 4JQ7A 4BB4A 5I0BA 4R1VA 3NYXA 4YPDA 3MJ2A 4HJOA 5CZIA 5BQ0A 4IMYA 5HEZA 4PTCA 4CRLA 4KUJA 4YJVA 3OOGA 4XYFA 4XS2A 3CTHA 2YM8A 4RX5A 2JBOA 3NZ0A 3UNKA 4IX3A 4JDJA 5AR7A 3ORLA 2YIWA 5TE0A 2GQRA 1U5RA 4GYGA 4FTLA 3L8SA 3R2BA 3ERKA 1ZMWA 3F2NA 2WNTA 3TNWA 4ENXA 4CT1A 4FV9A 4GVAA 2OU7A 3HDMA 2UZNA 4G9CA 5BYZA 5M51A 3UNJA 4DT8A 4O7VA 4BDIA 5H8EA 3RHXA 5LVPA 5TO8A 2REIA 4XRLA 1OM1A 4M8TA 4D2VA 5A3XA 3DOGA 4EJ7A 1DS5A 4RIOA 1PXOA 2WGJA 4C36A 3QRUA 4IWOA 4WG4A 2Z7QA 4AX8A 3Q2MA 1SM2A 1XBCA 1H1RA 3TEIA 4EOMA 1I44A 2BDJA 4D55A 3QKLA 3LLTA 2QOCA 4GK3A 4NW5A 3Q9WA 1P4OA 4XBUA 3VW8A 2JKOA 1XR1A 1XQZA 4XLVA 4EK3A 1T45A 5AR4A 3RAWA 2X4FA 1LEZA 3MFTA 3AG9A 5J1WA 4LUDA 3BEAA 2YDJA 2B9JA 4B8MA 2QQ7A 2Z2WA 4IJ9A 3PA3A 4TWNA 1XH7A 2AYPA 1UU7A 3E3PA 3SLSA 4BCKA 2A4LA 1OPJA 4LOOA 4NK9A 1YW2A 2OJFE 3EOCA 3LXNA 3OXTA 4ZZMA 1KE7A 1Q8TA 4D1SA 4BDEA 2YERA 5EI6A 3E87A 3AMYA 4GJ2A 5BUJA 2J9MA 3V8WA 2YISA 5CNNA 2RFEA 2WMRA 2VNWA 4HW7A 4K9YA 2ZAZA 4I5MA 4WNPA 2KULA 4I22A 4E6CA 5HBJA 1Y6BA 2CHLA 5BVDA 2CCIA 5IU2A 4FX3A 4GIHA 3IW7A 3QZGA 2EB2A 2J51A 1U4DA 3GBZA 3FI2A 2C4GA 4FEWA 5CX9A 5ANEA 4LMUA 5C8KA 4FZ6A 1WBNA 3ZRMA 3OS3A 5GZAA 5TT7A 3RI1A 2WMQA 4FTTA 2ZV9A 4GU9A 4U42A 4EH8A 3OFMA 5C4LA 4FSUA 5JGBA 2GPHA 1G5SA 2UZBA 2E9VA 1H25A 4I6QA 4TTHB 5AUUA 3QZIA 2X8DA 1GZ8A 1OKYA 3QD2B 3TZ8A 2I1MA 3QYZA 5CEOA 2VWVA 1BI7A 4JNWA 2PY3A 4XV3A 3VUIA 2YDKA 1IA9A 5G1XA 2ZB1A 3W2CA 3MS9A 4GCJA 4FEVA 3CGFA 3IOPA 2X8EA 4DTKA 4BIDA 4F1OA 1SNUA 3ORNA 3KRXA 4I5CA 2YFXA 4K11A 4XV1A 5CF8A 3V5QA 1P2AA 3UIUA 3QKMA 2UW6A 4XG7A 3CBLA 2GTNA 3LKMA 4M97A 3Q6WA 3EIDA 4KABA 4DGLC 4FZ7A 4QMMA 1YXUA 1AQ1A 4FIGA 5M57A 1PRYA 3Q5ZA 3PY1A 4W4VA 2W5AA 3V6RA 3BV3A 3PE2A 3SXRA 3EQFA 4DAWA 5ACBC 3W10A 4MHAA 4E20A 3L9MA 5E9EA 4H39A 3UDBA 3JR1A 4RJ5A 4R3CA 4IBMA 2OF4A 3FMKA 4NCTA 4OTWA 3MESA 1OIRA 1GZKA 2YIYA 3LCOA 4PMSA 1H1SA 3CE3A 3IECA 4YJRA 4AW2A 1Q5KA 4LV5A 3PJ3A 5M4UA 2BUJA 4E6DA 4UMQA 2BMCA 4XH6A 1E1XA 3HNGA 5DR9A 2ERKA 5IF1A 4LYNA 3E3BX 2FGIA 4DH8A 5IDPA 2V7AA 4UWBA 4X6RA 3DCVA 5KMNA 3UGCA 5CS6A 2XJ0A 4E4LA 2BILB 4FV7A 3AMAA 4M15A 3UBDA 3ULIA 4MNEB 1B38A 3E5AA 3F3WA 2R0IA 3W8LA 3LFAA 3ITZA 2WU6A 4V0GA 4F7NA 5F95A 4CG9A 4ZMFA 3BBTB 2F7XE 3RALA 2XIRA 5GIPE 3FAAA 3PZEA 4FIJA 2QKWB 5A14A 5AIRA 2JDOA 1Y91A 3ET7A 3VS1A 4JIAA 3BE9A 5IA5A 5LVLA 2UW7A 3FLYA 4CFNA 4RVKA 2CKOA 3B8QA 3F3TA 3VUHA 3OT8A 4HYHA 3U8WA 4HVGA 4QTCA 3B8RA 2ITTA 3F61A 3SW4A 3HKOA 3BQCA 4NFNA 1X8BA 2VX1A 3JY0A 4FZFB 4AF3A 2X0GA 3VWAA 5L2WA 1YVJA 4MXYA 4N6YA 5E90A 4IB0A 4R7HA 3V5PA 4CEGA 5IPJA 3N4UA 4FEXA 2XNPA 3QTIA 5EM6A 2I0VA 2YAAA 3PE1A 2XKFA 4IX5A 4MAOA 3HL7A 5BVOA 1NT2A 5DRDA 1YI4A 3KULA 4EH5A 4NUSA 1BMKA 3LPBA 3UC4A 4ASZA 2JAVA 2QO9A 3N4VA 3MPTA 4P90A 4U0IA 4C7TA 2WMUA 2YCFA 2A2AA 3DZOA 1KE8A 4F7SA 5EM8A 1H1WA 5K5XA 4NTSA 2OFVA 1Q99A 1VZOA 3FLSA 4Z16A 4PUZA 3VHEA 2GHMA 4AZVA 2W9FB 4J7BA 2C68A 5ANGA 3ATTA 3CTQA 2G2HA 4ASXA 5E4HA 3ZDIA 2IZSA 2RL5A 3H10A 4KB8A 3VS4A 3BI6A 5C26A 2GMXA 3FQSA 3DBCA 5HBHA 4JDHA 4AOTA 2V7OA 4H05A 3UQGA 4E5AX 4FKRA 4MXOA 2NP8A 2W4JA 2PWLA 4MCVA 4A4OA 1WMKA 2VUWA 2W4OA 5JFXA 5DYJA 4USEA 3H3CA 1U54B 3NGAA 3ORTA 4QP9A 2OXDA 4LRKA 5IQGA 3ACJA 1QPJA 2W1HA 2HY0A 4AZEA 2C6KA 4OTIA 3I7CA 5AV2A 4O6EA 4C4JA 2FO0A 4YJPA 1ZMVA 4YJSA 1F5QA 3EKNA 2AUHA 2J0MB 4TPTA 2LAVA 4FKIA 2VWZA 2XK8A 4UB7A 1JLUE 3Q04A 2XJ2A 5JRSA 4YGAA 4CFFA 3D4QA 3FSFA 4EZ3A 5HU3A 4P5QA 4G6OA 1V0OA 4JIKA 5FDXA 4FNZA 4N0SA 3DB6A 3WE4A 5BYLA 4LL0A 4GFMA 3A8WA 4HNFA 3O96A 3ZUUA 2IZTA 3C4ZA 2VTHA 3OROA 3R9HA 3E8DA 3VC4A 3HECA 4ACGA 1R0EA 4FTOA 2AC3A 4QTEA 4FVPA 4TWPA 4O91A 3MY1A 5BUEA 3H30A 3TUCA 2YIXA 4WIHA 5M44A 2VX0A 3DNEA 1VJYA 2C47A 3PYYA 3GCVA 4G6NA 4F9BA 5CEPA 1UVRA 4F0GA 4EK6A 3HX4A 3POOA 5HG7A 4HGSA 4D5KA 2VN9A 4X21A 2WOTA 4TNBA 4O84A 2C69A 4L7FA 4RA5A 3DNDA 4XLIA 2Z02A 4IXPA 3OWKA 3UOLA 1BL7A 3CQWA 5IA0A 3C0HA 1M17A 2GCDA 2Z7RA 4TYJA 1Q8WA 3QUPA 4RZWA 5EQYA 3C4CA 2OJIA 4A9UA 5CALA 4JDKA 3FMEA 2XK6A 3FWQA 2ZV8A 4DG3E 4YR8A 4QQ5A 3NYNA 3G33A 3F3ZA 4FKLA 5AUZA 3FXZA 4EC8A 4PL4A 2PE2A 3PXQA 5CY3A 1Y6AA 4ZOGA 1JBPE 1OB3A 2XA4A 2Z7LA 4O7NA 4LRMA 2G9XA 3QCSA 2JEDA 3IO7A 5LCKA 4TNDA 3S3IA 1XH9A 3A7JA 4NKSA 2R0UA 4RX7A 4UXQA 5HLWA 4XG4A 5B7VA 4CXAA 4BCFA 5HICA 2JKQA 3ATSA 3BGZA 1A9UA 2J90A 5M08A 3D5XA 4IAIA 4FR4A 2W7XA 5FM2A 3S0OA 2ERZE 4ZTRA 3PJCA 2YCSA 2XRUA 4YZNA 1XH8A 3LLAA 2X1NA 2G15A 4Y8DA 5LXMA 2YCRA 4QP6A 4Y72A 2ZOQA 3WE8A 4AA5A 4R7IA 4I5HA 2I7QA 3FLNC 2I0YA 3KXNA 3KCFA 4Y73A 2YN8A 2RSVA 4BCOA 4DTAA 2VNYA 4TZRA 2BZJA 3O23A 5F9EA 5J9LA 3Q60A 3R73A 1GZOA 4BDFA 3FZPA 3A2CA 3C1XA 5I9ZA 4D0XA 4ZTQA 2J0JA 4PV0A 4KBKA 4J53A 2C0OA 3PJ2A 5TR6A 5ANDA 3ROCA 3V01A 4FIIA 4JAIA 4DFZE 2YM4A 4EOQA 4ERKA 4NYEA 2W9ZB 3QALE 4BKJA 2YZAA 1UA2A 3W16A 2XMYA 3DJ6A 4RJ7A 2O0UA 1O9UA 4Y83A 5AP2A 4BICA 2G2IA 4OAUC 4EQMA 1OPKA 3BGQA 3QCYA 2B9HA 4DH3A 2C5OA 3MTFA 3VN9A 1FINA 5IH5A 3DXPA 3EKKA 1Q3DA 2FVDA 3PJ1A 1KUTA 2UVXA 1P4FA 2R3RA 3TT0A 2G01A 3MDYA 3DQWA 3ZO1A 2LGCA 3EQRA 2E9PA 4MQ1A 5EDPA 4ZY4A 2PVYA 4C3PA 4J95A 2CN5A 4TYHA 4DGNA 3T9TA 5L3AA 5AUYA 3PSCA 1E1VA 1U46A 4BHZA 5M07A 3QHRA 3POZA 3SD0A 1H01A 2Z60A 3AT2A 3AT3A 4IAYA 3VBXA 4YTFA 3TUDA 4PWNA 3PLAE 2BKZA 4BCNA 3TZ9A 4PTEA 5FEEA 3WBLA 5IQHA 1AD5A 1W98A 2XM9A 4JAJA 4FGRA 3OCTA 3P08A 1APME 3OY1A 3P23A 3TTIA 3S00A 3QUEA 4BCHA 4DH5A 3U6IA 3VRZA 1M2RA 3TN8A 3ZC6A 2WPAA 2R3JA 4BCJA 4U6RA 3P9JA 4CV8A 4B4LA 4U45A 3HVCA 5KMOA 2UZEA 2O2UA 1K2PA 3EFWA 1PKGA 3F5UA 4G3CA 2XCKA 5DA3A 2J0KA 3R8PA 3EMGA 5ANIA 2X2LA 3RINA 5ITAA 5K9IA 5IUIA 3D14A 3VBVA 3QCQA 4H3QA 5EHYA 4UYAA 5IH4A 4I4EA 4QMVA 5JKGA 2YM3A 2YCQA 3KK9A 3CQUA 4JR3A 4FK6A 3I0QA 1IEPA 2C6EA 3LFSA 1DAYA 2WQMA 3NLBA 3LHJA 4O0TA 2R3MA 4JRVA 3C4WA 3BGPA 5AIKA 1QPCA 3TJDA 3A4PA 5E8VA 2E2BA 3GFWA 2QOFA 5AMNA 4BWXA 3UQFA 3CJFA 3C4EA 3NNVA 4RJ6A 5CVGA 4FK3A 2V22A 1V1KA 4G1WA 2C6DA 5AP7A 4YLJA 3A7IA 4TN6A 1KE6A 2HELA 3BYMA 3QD4A 3ZO3A 2YZLA 5E8XA 1Y57A 3KY2A 4FMQA 5CEMA 2IZUA 4TYEA 3OCSA 5DOSA 5E92A 3AC5A 3ODYX 2GQSA 1Q4LA 3KQ7A 1WBOA 5LJJA 3V04A 2VGOA 1PMUA 1H08A 4LV8A 4NM3A 4BDKA 1OKWA 2HXLA 3MH2A 2O64A 4DF3A 3AC4A 3PWYA 4ANMA 3LXPA 3IDCA 3EN6A 3QX4A 3D7ZA 3CCNA 4RJ3A 4A9TA 4C34A 2PVLA 3R1NA 4E8AA 3BPRA 4RIYB 4BY9E 1OITA 3R8VA 3JXWA 1B39A 3GCSA 4U7ZA 3FYKX 4O21A 3ZHPC 5HIBA 1FQ1B 4RC3A 4FTMA 2CPKE 2GNHA 2XK4A 3UMXA 1OKVA 1SVGA 3LXKA 2WMWA 3L1SA 4BI1A 4LOPA 2CJMA 4NWMA 3QTZA 4FNYA 3TM0A 3NDMA 2OICA 1PHKA 3C5UA 4UMTA 4RFMA 4WSQA 5FLFA 5K3YA 3NVKI 3W33A 3VBWA 4N70A 3PIZA 3PPJA 4OUCA 3R71A 3DK7A 4L43A 4GUBA 4YZBA 3QRKA 4MWIA 4GMYA 1SVEA 2OW3A 3HV4A 3Q4ZA 4CZYB 4EK4A 2DS1A 4F9AA 2PVJA 3F2AA 5FG8A 4M7IA 2RIOA 3PJ8A 5ETCA 3M11A 2WQBA 3JS2A 3FMJA 4G16A 5AX3A 4FTKA 3D2KA 4M69B 3AGMA 3QLFA 4IVCA 4RWIA 4JDIA 4R3PA 3VUTA 1YRPA 2YA9A 4L01A 4ZAUA 1LP4A 4QMYA 3W2RA 2R3IA 1OL7A 3RCJA 4IW0A 2WEVA 4IEBA 3MW1A 4LL5A 4MQ2A 3FDNA 3MPAA 2X2MA 3K3JA 2OZAB 4OTGA 4YJTA 3PY3A 4FYNA 5CSVA 2XEZA 3T8OA 4ZLYA 2WTCA 4QMPA 1PXKA 2JFMA 3HYHA 3QCXA 3NW6A 4ONAA 5IQFA 2ONLA 4HCUA 4M3QA 3F7WA 4DGMA 2CNVA 1XH4A 4RT7A 3ID6C 3PG1A 3DAKA 5I9WA 1ZWSA 4L45A 2R2PA 4GV1A 4HYUA 5DBXA 4AZSA 2F57A 3EQCA 3MJ1A 3RZFA 4IAAA 4AZTA 3E92A 4D4RA 3SQQA 3CSVA 4U5JA 2VO3A 3NPCA 3R02A 3GNIB 2X9FA 3VBYA 3IOKA 3ZTXA 4LG4A 2G1TA 5C01A 4BCPA 1R78A 1WZYA 3DU8A 4WG5A 5H8GA 3FKOA 4BI0A 1RE8A 2VO0A 2C3KA 4EOOA 1WCCA 1B6CB 4ALUA 4EBWA 3CEKA 3Q2JA 2XIKA 5HVKA 3KXMA 3KEXA 4E4MA 4ZJVA 3QZFA 3UOKA 2GSFA 4KIKB 4RG0A 3L9NA 4TL0A 5CU4A 4PMPA 2W06A 5I9UA 3MY0A 2PTKA 2CGUA 3RM6A 5HG8A 4MBLA 2IPXA 2QG5A 3UODA 4PY1A 5I5ZA 2QC6A 4O7LA 2HK5A 1BX6A 4UY9A 4TT7A 4RRVA 4S2ZA 2UW5A 3W32A 4B9DA 4KIPA 2QOKA 5BUIA 3R1QA 2VWXA 3OT3A 1XH5A 4UWCA 4JI9A 5HIEA 2P2IA 3K54A 1PXIA 4ZMEA 3WIGA 2E9UA 4EHVA 3ORMA 2E9NA 4GK2A 4H3PA 4PRJA 3BHUA 5DFPA 3FMNA 4ACCA 2BHEA 3QUDA 4H58A 4YLKA 4B99A 4CYIA 4QMWA 4K6ZA 5IZFA 4QQJA 3R83A 5K4IA 3F2RA 4FV5A 3BKBA 2QOBA 2QOHA 2WEIA 1M52A 2XIXA 2BR1A 2VTJA 2UVYA 3EN7A 3FHIA 4OR5A 3DTCA 5HKMA 5HE3A 1S9JA 4AZFA 5ETAA 4OTQA 4RC2A 5D12A 3ALNA 2OZOA 4HNIA 4A4LA 4CKRA 3QA8A 3R22A 3KMUA 3LFBA 5JQ5A 4I6BA 4NH1A 4U40A 4IZYA 4YC6A 4MH7A 5E8UA 5FP6A 3SXFA 5IQIA 1KOAA 5J79A 3ZM9A 2IO6A 2WTKB 3AGLA 3EN9A 4R78A 1ZY5A 3UG1A 3LQ5A 3SOAA 3BYUA 2EB3A 3FI3A 3BV2A 4GKHA 5HG5A 2EXMA 2C3IB 4CT2A 3OCGA 5J1VA 3RK5A 3S4QA 3LIJA 1YOMA 4I93A 3F66A 4AGWA 3ZUTA 3FLWA 1OIYA 4JQEA 4I4FA 4LUEA 4EYJA 3HAMA 3TXOA 5IUGA 4CKIA 3DPKA 4KD1A 2ZMCA 5DRBA 1XH6A 4I92A 5L2TA 4FEUA 3QTUA 3GQIA 4I6HA 4R7BA 2WB8A 2H9VA 2GHLA 3HRFA 5HE1A 2XNNA 5K5NA 5AV0A 3UVRA 3DFAA 1YWNA 3FHRA 5AP1A 4FV4A 2XS0A 3QGYA 2UZDA 3R7OA 3TZMA 5JFWA 3NIEA 3N51A 4L8MA 3DQXA 1IR3A 2XBAA 3DS6A 3WZDA 4ANSA 4ORKA 3MI9A 4AP7A 4K33A 5DR2A 3EQIA 4GT5A 3R1YA 4FTQA 2XEYA 4IADA 2ZM4A 5LVOA 2VTOA 1OZ1A 3U54A 1YXSA 3MYGA 2HXQA 5ACKA 4IVBA 1H1QA 1BI8A 4LFIA 4MBIA 3R0TA 5LCJA 1R3CA 3SG9A 4QP8A 3WI6A 3HA6A 4EH3A 4XEYA 2EUFB 3F5PA 1UU3A 4EUUA 3R9NA 2X7OA 4EQUA 2EWAA 4FKGA 4AW0A 4OGRA 4YTIA 4NM7A 4C2WA 4NCTC 5FBNC 4IDTA 3GC8A 1Q8UA 3Q9YA 4W4XA 3U55A 2GS6A 3EQGA 5I3OA 2F49A 2JDVA 3R30A 4JG7A 2ETMA 1JKKA 4RJ8A 4USFA 4YJOA 3ZDUA 3HP5A 2BIYA 4NIFA 4S33A 3ZSHA 3UNZA 3WZKA 1UKHA 3DXNA 4JBOA 3RBWA 2PMIA 4ERWA 1O6KA 4E26A 4NM0A 4EHZA 1REJA 2J5FA 3TI1A 5LOHA 5EQEA 3MVJA 3GU4A 4S34A 3W18A 4KRCA 3RK7A 1QPDA 2ITWA 5HCYA 3VULA 4QQCA 4A9SA 4HGTA 3DBDA 2JKKA 4GT3A 1PXPA 1NY3A 1SMHA 3FZSA 5I9XA 3UOHA 1A48A 3AXWA 3ANRA 5EOBA 4FUYA 4EONA 5LMKA 1MRYA 3Q4UA 3R1SA 4IB1A 5FTQA 4FTNA 4F65A 3CKWA 4AQCA 4HVSA 3SV0A 1U59A 4H1JA 3IDPA 3DDPA 3PP0A 4ZTSA 1CTPE 1QCFA 4X2NA 2XNOA 2PUUA 4B7TA 1FVRA 3ACKA 2BDWA 5BVNA 5BVFA 5L6PA 3VS6A 1LPUA 3GU7A 3MV5A 5DT3A 1U5QA 4NKAA 4AA0A 5LMBA 5GJDA 3PXZA 1DI9A 4O22A 4IZ7A 4U44A 2B4SB 3D7TA 3RPVA 4BGHA 3ZCLA 4XP3A 3UQCA 4GEOA 5CEQA 3TNPC 2ITOA 2OIDA 4JVGA 3SRVB 2QR8A 5K0XA 1REKA 4NM5A 5BMMA 4DFLA 1KE5A 2WQOA 2CKEA 4LRJA 5B2MA 3R01A 1OBDA 5AP6A 3QRIA 5FXSA 1OBGA 5CI7A 1IASA 3RWQA 3ROYA 4G5JA 3QKKA 4AOIA 5IMXA 5FM3A 1TQIA 5C27A 4A4XA 4ZTMA 3TNIA 5H2UA 3D5VA 3HA8A 2QLUA 4FODA 1IRKA 4QMTA 4WUNA 4PF4A 2J50A 3NNWA 3HGKA 5E8WA 1CDKA 4C59A 5IG1A 4EKKA 4YJNA 5C4KA 4GU6A 3KRWA 2IW8A 4E93A 2JKMA 3ZU7A 4MXZA 5JH6A 3VAPA 4XOYA 2XJ1A 4MXCA 3ZO2A 2HAKA 4KNBA 4M14A 5HTCA 2IVUA 2HWPA 5LARA 3VF8A 2WIPA 2XYNA 1T46A 4PQNA 4TWCA 3EYGA 3RAHA 4UMRA 3U9NA 4FSZA 3RPOA 4FE2A 5IQDA 4F1TA 4G2FA 4D1XA 3SGCA 3LOKA 1PKDA 5L8JA 5BVEA 4YJQA 3QA0A 2RGPA 5IQEA 2XKDA 1WBPA 1TQPA 2IN6A 3DK3A 4RVMA 3D0EA 4BCQA 3DKFA 3SVVA 3MIAA 3A4OX 3T3UA 4BL1A 3GP0A 5BPYA 4CTCA 4KKEA 3DXQA 4MF0A 2X81A 4G3DA 4O27B 3S2PA 3U9CA 1H28A 4L53A 3HAVA 4GFOA 4QPMA 4DTBA 4BC6A 3OEFX 4J8NA 3QBNA 5FDPA 4ZSLA 3Q5IA 5HCZA 4U41A 1ZAOA 3LFNA 3NUYA 1OMWA 5KKRC 1ZYLA 1MQ4A 1YI6A 2VU3A 3KMMA 3VJNA 5HLPA 4F6UA 5EI2A 5KCVA 4J97A 4J1RA 2OKRA 3E8NA 1OKZA 2QVSE 2C6IA 3WYYA 2WO6A 4DYMA 3RK9A 3GFEA 5DG5A 3NNXA 3W1FA 3R8UA 3VQUA 4C8BA 4UMPA 3FPQA 2GHGA 3BBWA 1W83A 3FV8A 4KWPA 1AGWA 5HTIA 4L00A 4XP2A 4DEAA 3OBGA 3OXIA 3IONA 4ZIMA 3EN5A 3NX8A 4EYMA 4APPA 4BZOA 3C4XA 2BRHA 4QMUA 4CG8A 3UTOA 4MF1A 2BTRA 2DYLA 2BALA 3V5JA 4AZWA 5KBRA 5L8LA 2IW6A 4CYJA 2X4ZA 1WBWA 4EKLA 4YZDA 2IVTA 2AC5A 3PPKA 5HHWA 5F1ZA 4XG3A 2PUNA 2HENA 2PZIA 3D83A 3LFDA 5KZIA 4C58A 4OBPA 5CU6A 5J7HA 5DT0A 4O82A 3TIZA 3BU5A 2Y6OA 5M06A 4O1PA 3IKAA 3E63A 4USDA 4FNXA 3Q3BA 3R00A 3PA5A 4GVJA 3HMOA 2OK1A 4OTHA 3PVBA 3AD4A 3QQHA 4AWIA 2C30A 4ITJA 3ZLWA 5HU9A 2NO3A 3JUHA 2VRXA 5IA1A 2WTJA 4L3JA 4GSBA 1Q97A 4X3FA 5IEYA 2RFSA 4B8LA 2VWWA 1IG1A 2IJMA 4U3ZA 4BDDA 2HOGA 3W2PA 3UO5A 4CZUA 1UU8A 4BI2A 5KMIA 1WVXA 2W1DA 1TVOA 2VTLA 5AR8A 4IZAA 3UVQA 2PVKA 1G3NA 4YPSA 2HW6A 1OUKA 3M42A 5CEKA 2CGVA 4GK4A 4JG8A 4KS8A 4PPAA 2W5HA 3MA6A 5HOAA 4H1MA 3WF7A 4G5PA 3ZZEA 3GI3A 2Q0BA 3AOXA 4NEUA 4PL3A 4L46A 2YM6A 4JOAA 5J9YA 2QHNA 2PE0A 4CCBA 1M14A 2JDRA 3ORPA 2HCKA 4AGCA 4DITA 4DLIA 1ZYJA 4JLCA 1KV2A 5DHJA 5GJGA 2O5KA 2ZVAA 5A54A 4BZDA 3NYVA 3E93A 4YC3A 3Q4TA 3JYAA 2W96B 5FTGA 4FOBA 4YHJA 2O3PA 2XYUA 3I60A 2PMLX 5EW8A 4I23A 2P0CA 5HBEA 1Q3WA 3CJGA 3E62A 2BZKB 1Y8GA 2WMXA 4E3CA 2GNJA 4CQGA 4E4NA 3GUBA 4DC2A 5KZ0A 3G90X 4WOVA 3BELA 5C9CA 1ZZ2A 3F88A 2WTKC 5AP0A 5AWMA 5IQCA 2C0TA 2BZIB 4FKUA 4FZAB 4E1ZA 4D9TA 3IGGA 4IB3A 3UYSA 4WNMA 1XWSA 2UV2A 2X7FA 3H0YA 3EQHA 4Z55A 2C5VA 4O38A 3BX5A 3PXYA 3T9IA 3VQHA 5FP5A 5EQPA 4BR3A 2R3KA 3EHAA 4J96A 4EOIA 3U87A 2GU8A 1PF8A 1PW2A 2QOIA 4D28A 5EW9A 2WTVA 4BBEA 3FJQE 3UO4A 3WF8A 2WQNA 5EK7A 3O7LB 3E7OA 5HIDA 4C33A 2WHBA 4DCAA 2R7BA 2VAGA 3FY0A 3IGOA 1W7HA 3COHA 3QU0A 4RQVA 2WD1A 3QC9A 3DT1A 4G3FA 5IEXA 4UBAA 2OWBA 5D7VA 5F4NA 2RFDA 1ZLTA 1HCKA 2C3LA 2UZVA 2Y9QA 3R6XA 3EFJA 2ACXA 3DZQA 5CWZA 3V8TA 3FC2A 4OT5A 3E64A 5TOZA 2OH0E 1I09A 3GEQA 4GT4A 4R6VA 5IISA 3NVMB 4LOQA 4MK0A 1H27A 2RF9A 3ZLXA 4Q9SA 2WELA 4AE9A 5CVHA 2ITYA 1UNLA 3R63A 4AE6A 4FYOA 4F64A 4CD0A 3HMPA 4WA9A 4BWPA 1JSTA 3A99A 5CF6A 4CLJA 2PMNX 4Y5QA 4DBXA 3LCTA 3RKBA 4D2TA 1UWJA 3KGAA 4FEQA 3MGYA 4AGUA 2CLXA 2HW7A 1MP8A 2RG6A 4S30A 5HLNA 4OBQA 2VTTA 1YXVA 5AP3A 5AUWA 4F0IA 3E7VA 3QTWA 4HVDA 4DLJA 2GQGA 3LCDA 3LJ0A 3OOMA 4QYGA 3P7AA 3COMA 1Q24A 1XHAA 3DTWA 3FPMA 4FF8A 4D9UA 4HCVA 4F6WA 4L7SA 2GNIA 3R8LA 3MFSA 4LQMA 4ZTHA 3W2OA 3PFQA 2XK9A 4GFGA 2ITPA 5K0KA 4RSSA 2H96A 3KB7A 1VEBA 3L9LA 4FTCA 4FV6A 4W4YA 1JWHA 4X6QC 2CDZA 4YJUA 5J87A 4O0XA 2HIWA 4NW6A 4Z7HA 4C37A 2WIHA 4EWHA 3M2WA 5BNJA 4HGLA 3VIDA 4O0UA 1G8SA 2XBJA 5M55A 3OW4A 5DPVA 1S9IA 4ASEA 2X2KA 2Q0NA 2OJJA 3QFVA 1BUHA 4OTPA 4QTAA 3R9OA 4ZLZA 3PVGA 5DEYA 2A0CX 1URCA 5BX0A 3RM7A 3FBVA 5ANJA 4P2KA 3PSDA 4MKCA 5DT4A 4AT5A 4BWKA 4DFNA 5J95A 3ZBFA 4C4IA 2VTMA 1W82A 2R3FA 3HMIA 4DFUA 3IW5A 4QPAA 5B2KA 3PXFA 3UIBA 2PL0A 2R9SA 4ZZNA 5L2SA 3UE4A 2BRGA 4ANBA 5TF9A 1ZOGA 5A4LA 3WF5A 3R8ZA 5IA2A 4BCIA 1UU9A 3O8TA 4RC4A 4GJ3A 4QMLA 5H8BA 3WF9A 3BWFA 3OZ6A 1PYXA 5M09A 1YXXA 2UVZA 3KN6A 4GKIA 4XOZA 4BTKA 4QMQA 1LUFA 3HV7A 5AV4A 3Q9XA 2W1FA 4RIWA 2BPMA 3QLGA 4BDCA 5GZ8A 5CAQA 2C6TA 3LCKA 1WBTA 3V6SA 4BGGA 2C5XA 2HZNA 2RFNA 2ZB0A 4C4EA 2H8HA 1M2PA 2Z8CA 2PHKA 4NFMA 4M84A 3HRCA 1DM2A 2VO6A 2XVDA 3PTGA 4CGAA 3ELJA 3U51A 3D9VA 5LWMA 3DY7A 2PVNA 3QWKA 4KS7A 4V0GB 5HE0A 4FV8A 2ONLC 1ZXEA 3RGFA 4R5SA 1E9HA 4FV2A 2UW0A 4O2PA 3C50A 3KC3A 1VR2A 3P4KA 3NMUF 1V0BA 1KWPA 3RAKA 1YQJA 4IJPA 5FEDA 4EJNA 4XUFA 3WF6A 5AUXA 4K18A 4WT6A 5JSMA 3ZMMA 1UNHA 4DEDA 1H07A 3G15A 3IG7A 2V62A 4D5HA 4ZS0A 4D0WA 4YSJA 4Y85A 4FC0A 3ORKA 3H9RA 3LE6A 4IQ6A 1YWRA 3D94A 3TKHA 4QMZA 2X9EA 4HVHA 4UEUA 5AJQA 3UVPA 4BDJA 2W1GA 3VUDA 3KULB 4F9YA 5HO7A 4IWQA 2Y8OA 2XF0A 2Y4IC 5D41A 4FNWA 4FSRA 1L8TA 4UMUA 4UZHA 4HYIA 5D1JA 4X2JA 2XK7A 4D58A 3AT4A 4ENYA 1H8FA 4FSWA 2F4JA 4J52A 2VO7A 3A8XA 4F9WA 4WG3A 4IIRA 4W9XA 4IVDA 3THBA 1PXMA 4QP7A 3IK3A 3F3VA 2C0IA 3ODZX 4OW8A 5DLSA 1UNGA 4L3PA 4TY1A 4FG7A 5IA3A 5JQ8A 5IQBA 2OH4A 3O8UA 1G8AA 3NUSA 4KIOA 1NVQA 5F94A 3BHVA 4FOCA 3ZC5A 1DAWA 4R8QA 4IH8A 3JVRA 3NW7A
chains in the Genus database with same CATH superfamily
2XKEA 2JIUA 2YACA 3DB8A 3OC1A 5A9UA 2XIYA 2PSQA 1OVEA 3RTPA 3FEGA 3IDBA 4PL5A 2W1IA 3LM0A 4CFWA 4LGHA 4QOXA 4D4SA 3N4TA 4YURA 3NFFB 5EM7A 3QAME 4F9CA 2UW8A 3BCEA 3Q96A 2IW9A 1NVRA 5C8MA 4I21A 1SVHA 4F08A 4QQTA 4WRGA 4DHIB 3GXLA 3QWJA 2ETRA 4CFMA 3ORZA 4Y5HA 4V01A 3ZBXA 2GNLA 3ZOSA 4KBAA 2VWBA 2B7AA 4C62A 3SG8A 2XARA 1ZRZA 3ETAA 2HZ4A 5KKRB 2GNGA 4U80A 4IX6A 4GW8A 1XJDA 4BTFA 5IUHA 5J5SA 2QR7A 2IF8A 5CLPA 4ARKA 2PZYA 1Q8ZA 5JT2A 2XH5A 4FBXA 3TKUA 3UO6A 3NUUA 1EH4A 3NRMA 1H0VA 4MYGA 4D2WA 2Y6MA 1ZOEA 2JDTA 3F7ZA 1RDQE 5FGKA 5FRIA 1W0XC 2CNUA 2X8IA 4WD5A 3L8XA 4C3RA 4QYEA 3VONA 3DV3A 3BWJA 3KRLA 3GVUA 1RW8A 5CXZA 3FXWA 4JRNA 3TIYA 3ZRLA 2XP2A 4C57A 4ZJIA 4C38A 3LFCA 4OLIA 3CTJA 3QQFA 4F70A 2JC6A 4YP8A 3F69A 5K4JA 4A9RA 4C4FA 2QD9A 3P1AA 5FXRA 5AEPA 3WYXA 2FB8A 3KKVA 4V05A 5AR2A 4DEHA 5AX9A 4FKWA 5CI6A 5HVJA 3L9PA 4PMTA 1YHSA 3WILA 2ITVA 3VS5A 5E8SA 2QU5A 3CPCA 3TV6A 2XALA 3ZH8A 2PPQA 3UG2A 2WMTA 3MB7A 2EVAA 2VTNA 4DFBA 2ESMA 2NRYA 3BRBA 4M66A 4WSYA 5CZHA 4A9YA 2BKKA 4HGEA 2Y0AA 3CR0A 2ITXA 4EOLA 3RZBA 3ZEPA 4G3EA 2W5BA 4BKZA 5L6OA 3C7QA 3O51A 4J8MA 4N4SA 3HV5A 3HLLA 4PDPA 4ANOA 3RPYA 3VS7A 3F5XA 3BIZA 2YWPA 5CVFA 4F99A 3V5TA 4O2ZA 4C35A 1URWA 3AQVA 2CSNA 4QNAA 4XJ0A 5EG3A 4IFGA 4BZNA 5BVWA 2B54A 3ZXZA 4EHGA 3EFKA 2BROA 4YTCA 4Z7GA 5KMKA 3CLYA 3BYVA 4I1ZA 3VW6A 1ZYCA 2VTIA 5KMJA 2B55A 3TJCA 4MXAA 4AT4A 5CF4A 3UP2A 4O1OA 1FGKA 4U8ZA 5M56A 2EXCX 3WIKA 5HQ0A 4ACHA 2BIKB 5CAVA 3FXXA 4ANNA 4C4GA 1CSNA 2QO2A 5HNGA 1Y8YA 1GZNA 2R4BA 1QPEA 3W55A 2PVRA 4O4EA 5LQFA 1R39A 4PX6A 4YZCA 4MNEA 3AKJA 3GU6A 5AV1A 5A6OA 3KCKA 4PMMA 2GFCA 4C4HA 4JJRA 5LMKC 3BHTA 4DH1A 3LM5A 5AV3A 2R3GA 3O0GA 3PZHA 5I4NA 4AFEA 5AM7A 2XNEA 4E5BA 2PZ5A 2QOOA 4D4YA 5M4FA 4MD8E 4I5PA 4HCTA 4YSMA 5CT7A 4I41A 4ITHA 4E6QA 1MRVA 2P2HA 1BLXA 3R04A 4TXCA 2OI4X 4XNEA 3ZYAA 2VGPA 3DBQA 4KRDA 4BKYA 2ZM3A 5A4QA 4DGGA 2P4IA 3EL7A 4EOJA 3KVXA 4E4XA 2J2IB 3IW4A 4O0YA 4QMNA 5KUPA 5IQAA 3O17A 3NIZA 1CM8A 3CP9A 4DG2E 5HNBA 4DN5A 4WUAA 4TYHB 4IM3A 1IAJA 4DG0E 2ZV7A 4UN0C 3KK8A 3NUNA 5H9BA 4AS0A 4MD7E 4XV9A 3LQ3A 4DT9A 1BKXA 4A06A 4YHFA 4CLIA 3M1SA 3CD3A 2WAJA 3NWWA 5I3RA 3I4BA 1FMKA 3LXLA 4F0FA 1GNGA 3I81A 3QTXA 5AR5A 3R7VA 4CTBA 4F63A 4GYIA 4FSTA 3SA0A 4O86A 3MBLA 4X2KA 4IVAA 3CKXA 4PP9A 3QL8A 4KINA 5EKNA 3KL8A 3EZRA 5IEVA 3TDVA 1OUYA 4WBBB 2ITUA 3OEZA 2BRMA 3P78A 4Y95A 2OGVA 3HP2A 3Q52A 5CT0A 5DIAA 3RP9A 3ZLYA 5JEBA 3E8EA 4PDOA 4C3FA 4EH2A 4KSPA 3HZTA 3LZBA 3QQLA 4ZSGA 5KNJA 3BLRA 4R3RA 4JR7A 1NVSA 4FICA 3R9RA 3HDNA 1M2QA 4YBJA 5IKWA 4DGOA 4IB5A 3OUKA 1WFCA 4KAOA 2OXXA 1L3RE 4BRXA 4CMUA 3KXHA 4FKQA 3SW7A 3JVSA 3R2YA 3ZUVA 1U54A 2QHMA 3BE2A 1XBAA 3ZFXA 2XNMA 3VJOA 4ZY6A 3AD6A 2W99B 4TRLA 4CFUA 5HG9A 4BJJB 3QQGA 3RHKA 1CKJA 1H00A 3BU3A 3DKCA 1YDRE 3I1AA 2Q83A 4PTGA 4AA4A 4ZTLA 3R21A 4BDBA 2HWOA 5E91A 5T3QA 5FUTA 3EQBA 2R3QA 3COKA 5CENA 3LCSA 4RIXA 1H4LA 2C6MA 4H3BA 4J99A 3VUKA 3W0PA 3BHHA 4NJ3A 3K5UA 4M68A 1SZMA 4Z9LA 1HOWA 4U81A 1OECA 1J1CA 4EH6A 2Y4PA 1Z5MA 2FH9A 4MWHA 1YXTA 3LQ8A 3CC6A 3SKCA 5EHOA 5CQWA 2C5NA 1RQQA 3PY0A 4OBOA 5G6VA 5A6NA 1FBNA 3UMWA 1RJBA 2SRCA 3D2IA 3TDWA 4U3YA 2JAMA 5GJFA 4HOKA 4ZK5A 5HNIX 5CAOA 3AD5A 4YU2A 3FQEA 4DH7A 1O6LA 4EH4A 4F78A 4ZXTA 2PUIA 4NU1A 4JS8A 4PDSA 3EB0A 4Z3VA 3TCPA 1NXKA 2PVFA 2QU6A 3QXPA 3W0QA 1R1WA 5C1QB 5ICPA 1UKIA 3MVLA 3UIXA 2BRBA 2PVMA 3PP1A 4O83A 5I9VA 4FV3A 3VHKA 2PMOX 5D9HA 4U97A 5CU2A 5CF5A 2YIRA 1UWHA 5CAUA 2JIIA 5BVKA 4O7TA 3FKNA 3HRBA 4O7RA 5JZJA 2JITA 3OD6X 3QC4A 4MVFA 2R64A 1Z57A 3NS9A 2VTSA 2JGZA 4L67A 5AP4A 3S1HA 5J7BA 2CGXA 2FSMX 4L52A 3DJ7A 3QXOA 5EDQA 2HZIA 2VWUA 3OW3A 3TV7A 3PDTA 1H26A 4GUEA 3OWPA 4CCUA 5BYYA 2CMWA 3TYKA 4M12A 3DLZA 2GDOA 3FMDA 3SXSA 4Q2AA 1OIUA 4EOSA 4X3FC 1H0WA 2QLQA 1TFFA 4II5A 4AW5A 3LMHA 3LMIA 4DINA 3BL7A 1PXJA 2WZJA 3RAIA 5AUVA 2QODA 3U4UA 2VX3A 3FZOA 4K0YA 3NUPA 2C1BA 4CZTA 2JLDA 5EOLA 4JX7A 4RLKA 3HMMA 2QCSA 1FVTA 2WKMA 4AT3A 2A1AB 3IPHA 4EL9A 3H9OA 2X39A 5JN2A 3MH0A 2C6OA 3EJ1A 3O7LD 4JBQA 4KBCA 4NJDA 4QTBA 5TKDA 2QONA 4ZY5A 4KA3A 1TQMA 1ZOHA 3HUCA 4R5YA 1MQBA 3KXXA 2GS7A 3EYHA 2W1EA 3F9NA 4IFCA 2OXYA 3OVVA 3BLQA 2BCJA 4OT6A 2I40A 3DAEA 1KE9A 1YOLA 3COIA 3RPRA 3VNTA 3EQDA 3AC8A 1JKLA 3QTQA 3GB2A 3G0EA 1ZYSA 3KMWA 2BFYA 4BGQA 4EZ5A 3P86A 5DVRA 4TWOA 4X7QA 2YJRA 3ORXA 4FT7A 3RWPA 4FZDB 3W2QA 5KHWA 5C03A 3G5DA 1P14A 2B52A 3EH9A 5IH6A 3UZPA 4EUTA 2YITA 2DWBA 5L2IA 5CSWA 3FZTA 1GIHA 2XZSA 3IW6A 4ZS4A 3NEWA 3UDSA 3FQHA 4EOPA 2GS2A 4UV0A 4UYNA 3FYJX 3FY2A 3E8CA 4S32A 4CMOA 2XB7A 3OWLA 2YJSA 3ZFMA 5AA9A 5EH0A 3WOWA 3CS9A 1FOTA 2BVAA 2F2CB 4IACA 5D7AA 1CMKE 2QNJA 2Y4IB 3ZSGA 3VRYA 4FVRA 3NW5A 5E8ZA 4NSTA 2UW9A 4FGBA 4RA4A 4OAVB 5A4EA 3AC3A 2BZHB 3Q6UA 4MEDA 4DCEA 5JGAA 3C0IA 3Q32A 4LGGA 4AN9A 4RFZA 2C6LA 4M13A 4NZWB 3BU6A 4APCA 4AAAA 4EK8A 4NL0A 3HV3A 4EHEA 4UX9A 2KTYA 4YZMA 4PDYA 3VO3A 1YKRA 5M4CA 4XV2A 2ZYBA 3LJ1A 2W1ZA 2W1CA 5DN3A 4XCUA 4YTHA 5ETFA 3BQRA 3QF9A 5E8YA 4F7JA 5JGDA 4AUAA 3UPZA 3UZTA 4IM2A 4IC7A 4DHFA 4NTTA 1KOBA 4FIFA 4QT1A 3QQKA 3CD8A 5HZNA 4WBOA 2CCHA 4F4PA 2OIQA 3QQJA 5ANOA 5ETIA 2NNWB 1YOJA 2WQEA 3UJGA 3ZEWA 5JRQA 5GINE 2YM7A 3CGOA 3W8QA 3I7BA 3TZ7A 3LFEA 3LW0A 3MH1A 3QD0A 3L8PA 4NT4A 1WBSA 3F82A 4A7CA 1LR4A 3GENA 2RG5A 2XIZA 4D2RA 1PY5A 1JSUA 3ZXTA 4FV1A 1YHWA 4XBRA 2I0EA 2PZPA 2IEWA 4JBVA 3VBQA 1MRUA 4QEBA 5IMEA 1WAKA 5AUTA 3MH3A 3RVGA 3N9XA 4HPTE 3WARA 2XCHA 3W2SA 3QQUA 5D10A 1ZMUA 4YHTA 4D4VA 2ZV2A 4FKJA 4JT3A 4LGDA 4XMOA 5JZNA 4K1BA 5EYMA 3NCGA 4ZJJA 4O0VA 1CKPA 2UZUE 2PZRA 4QP1A 2A27A 2J5EA 2QO7A 2V0DA 2BAQA 3GC7A 3G6HA 4QO9A 2WTIA 4ZP5A 4EWQA 5GZ9A 4HVIA 5FTOA 4QRCA 3FMLA 2R3OA 3OWJA 1PXLA 3PVUA 5DMZA 5LMAA 3HMNA 3C9WA 3QTSA 2BRNA 2ZJWA 3QGWA 4Y46A 3IW8A 1PJKA 4UXLA 4S31A 1STCE 4QYFA 4WKQA 5L4QA 2A19B 5HD4A 3I5NA 3NCZA 5AAFA 2WMSA 4G3GA 4XP0A 2I6LA 4BIBA 4RWJA 3NUXA 2J6MA 2J7TA 4CMTA 3IQ7A 5DNRA 4FT5A 5EHLA 3V8SA 4JL9A 3KF4A 4RIYA 4I94A 2OBJA 3CY2A 3F5GA 5CSXA 1KSWA 1J1BA 2R7IA 4QNYA 4XX9A 2QI8A 4QP2A 4W8DA 2OJGA 1FVVA 2HZ0A 2UZWE 4PPCA 5EYCA 3OBJA 3I6UA 3MB6A 3V3VA 3UIMA 5CANA 1VLRA 4BDGA 4FKTA 5GNKA 5HTBA 3A61A 2FSLX 2CGWA 2X7GA 3FL5A 3FSKA 3RJCA 1GY3A 4FT3A 4AW1A 1KV1A 4IE9A 4LM5A 4WO5A 3G9LX 5T6KA 2X6EA 4O0SA 4XRJA 4O7WA 2OFUA 3EWHA 4ZSEA 3TWJA 5GIOE 1LEWA 2YEXA 3LFQA 3NSZA 3FKLA 4F09A 1ZZLA 5HI2A 3ZM4A 3UPXA 2JD5A 3I79A 4RBLA 4M69A 3OCBA 3B2TA 4I0SA 3ORIA 4RIXB 4ALWA 4RX9A 4BTJA 3FZ1A 4NIFB 2ZMDA 4RFYA 5DWRA 4O7YA 2W4KA 3KVWA 2JBPA 2WXVA 4TYGA 5HESA 3Q53A 4JBPA 3GCUA 3JY9A 2WOUA 3P0MA 1ND4A 1OIQA 1VYWA 2P33A 4U43A 4LMNA 4Q5HA 3FI8A 4FI1A 2OZAA 4CFVA 5GHVA 2YIQA 3ZLSA 4YNOA 4FIEA 4YC8A 3CQEA 1JOWB 1QMZA 4Q9ZA 2ZDTA 3QX2A 1J91A 2YABA 3BLHA 1IA8A 1OL2A 2W17A 4P4CA 5HE2A 4EBVA 5A46A 4GIIA 5KMLA 1SYKA 2YDIA 3QZHA 1OL1A 2F7EE 5KX8A 1M7QA 4FIHA 3NAXA 5CNOA 4ID7A 3TNHA 3R7EA 4QPSA 2B53A 3OF0A 2JDSA 1W8CA 1YDTE 3QRJA 3DGKA 4D2PA 4CQEA 1XMMA 4L44A 2CKQA 2FYSA 2OF2A 3D7TB 2B0QA 3ALOA 3GU5A 4DDIA 1YWVA 3BYOA 5IDNA 3KN5A 1M7NA 2YLFA 3Q4CA 4I0RA 1WVYA 4RPVA 4L42A 2WMVA 3AC1A 1BL6A 3LVPA 1F0QA 2UZOA 2PK9A 3FL4A 4IC8A 4YNEA 3ZRKA 4ANLA 5BMSA 1ST0A 1Q62A 4FTAA 4YUQA 2PU8A 3GCQA 4V04A 3TG1A 4I3ZA 3K3IA 3SAYA 3UOJA 4FL3A 3ZZWA 4BIEA 4L3LA 3DK6A 1J3HA 3EFLA 3FC1X 3EN4A 4YLLA 4YZ9A 4EH7A 4FA2A 5CSPA 3I0OA 4EC9A 2W05A 3LAUA 4KIKA 2XRWA 3C0GA 3DAJA 4K77A 4XG9A 5DGZA 4ACDA 5A4CA 3A7FA 3MWUA 5EKOA 3MTLA 3QRTA 4OTDA 1H24A 4RMZA 1J7LA 3PVWA 4AXFA 3CPBA 4PNIA 4M67A 4AOJA 1NA7A 2ITZA 2H34A 3L8VA 5B0XA 4C2VA 1FMOE 2VV9A 4BDHA 2B9FA 5LWNA 3U6HA 1Q61A 3RPSA 4WNOA 4W4WA 4W8EA 1J7IA 4BF2A 2B1PA 2C1AA 3OXZA 4QP3A 5DR6A 4HYSA 3RNYA 3KF7A 3R7IA 3GC9A 4HZSA 4L6QA 5CEIA 4FUXA 3V5LA 3VS0A 4YO4A 3OMVA 4E7WA 1WVWA 3CXWA 3R7YA 3REPA 3KRRA 3BZ3A 1Q8YA 4IZ5A 2V5QA 3D5WA 1O6YA 4X2FA 5AAEA 2E9OA 4BBFA 3GOPA 3UP7A 3KFAA 3G9NA 5AA8A 5FWKK 2ITQA 4FSMA 3LFFA 3P7BA 4ACMA 3ZONA 2X0PA 1YDSE 4ITIA 4XHKB 4YBKA 3WZJA 5HORA 2PYWA 1JAMA 1PMVA 3VBTA 5M4IA 4DEEA 4G9RA 3NYOA 3ENMA 1P5EA 5B2LA 4UWYA 4WNKA 5EI8A 4O0WA 4KKGA 2IZRA 3PRFA 5HD7A 4FKVA 2GFSA 4WHZA 3JPVA 3B2WA 2QKRA 2O8YA 3FUPA 4RZVA 2ITNA 4BVUA 4FL1A 4FT0A 2A98A 5DE2A 4JX3A 3TV4A 2XANA 1OPLA 5CAPA 2VWIA 1OL5A 3DBEA 5FQDC 3SDJA 3PUPA 3I6WA 3PWDA 2VD5A 3A60A 1GIJA 2YAKA 4ZLOA 3UYTA 3UZRA 4D2SA 5DI1A 2XK3A 4HZRA 3R7GA 2VWYA 4PPBA 4FSNA 4AN3A 4E5WA 5CASA 2XM8A 4WRSA 2JIVA 3O71A 5KE0A 4AXAA 2YWVA 3SHEA 2QOQA 5KMMA 4N6ZA 3GC0A 4OTRA 5JFSA 4EZ7A 2YLEA 2JFLA 4IAKA 1IAHA 3A7HA 5J8IA 1CKIA 2Y7JA 4RLLA 2J0IA 4C61A 4FKPA 4BCMA 3C13A 4L68A 3ULZA 3VVHA 3DDQA 3PA4A 5M53A 3NR9A 1OGUA 5HO8A 2Z7SA 1JQHA 4CV9A 2CKPA 2O63A 3DBFA 2R3PA 4IWPA 4BYJA 4EORA 2CN8A 3VUGA 3C51A 4RGJA 2BDFA 2VTQA 3GGFA 4J98A 5HX8A 3MY5A 2UZTA 2R3HA 2UW4A 4BDAA 5E1EA 4AG8A 3Q9ZA 3KXZA 5E8TA 4FTRA 2FSOX 2XKCA 4FG9A 3IS5A 3R9DA 3TL8A 5JK3A 1OI9A 2F2UA 5CTPA 4AN2A 4F6SA 4ZZOA 4QDVA 3G51A 4X3FB 4AFJA 5HVYA 4GL9A 3FE3A 4MXXA 5D11A 1JKSA 4I20A 4H36A 3T3VA 3TACA 1XMLA 1ERKA 2VTAA 3TKIA 2GTMA 4QMOA 2BAKA 2UUEA 2WMAA 1GIIA 3G2FA 5CU3A 4RVLA 4QMSA 3SOCA 4I0TA 2R3LA 4ZSJA 2ZDUA 5FBOA 2XAOA 4W9WA 1QL6A 3D5UA 5EFQA 4FT9A 4LI5A 4RWLA 5EYKA 4EOKA 4FG8A 2I0HA 4X3JA 5FEQA 5L8KA 3MN3A 4IAZA 1XO2B 4Q5EA 5CU0A 5HO6A 1J7UA 3VS3A 1W84A 3EQPA 4PP7A 1FPUA 3GT8A 2XNBA 2GNFA 1PXNA 3H0ZA 4P5ZA 3TTJA 4A07A 3DKOA 4C02A 1JKTA 2NRUA 4IANA 1DI8A 1Z9XA 2XUUA 4RVTA 3VUMA 3ZS5A 4MNFA 4BBMA 2C3JA 3NUAA 3H4JA 5HX6A 1PMEA 2V55A 3VS2A 4O6LA 5IA4A 5EW3A 4C0TA 4ZEGA 4TW9A 3FMMA 4EEVA 4K8AA 5DH3A 4EQCA 4O7ZA 3SX9A 3WZUA 4MTAA 2BHHA 1K3AA 4YO6A 4IAFA 1GOLA 4IDVA 4B0GA 3V51A 3EL8A 3A62A 4FKSA 3I5ZA 3MVHA 3DJ5A 4JQ8A 1YI3A 3SRVA 4QD6A 4GRBA 2J4ZA 4GS6A 5J5TA 3MVMA 4CNHA 2FSTX 2W0JA 3PFYA 3U4WA 2P3GX 4DE4A 5AAGA 1JNKA 2WFYA 4KKHA 3F3UA 5LVMA 2OJ9A 3MSSA 4M0ZA 4BYIA 3RCDA 3R7UA 4FVQA 4KSQA 5KBQA 3PG3A 5AM6A 2PULA 5H3QA 4O0RA 4RQKA 5AR3A 3A7GA 2IVVA 4JXFA 1YHVA 3UC3A 4DEBA 4BFMA 1HCLA 3O2MA 4IM0A 4E73A 3G6GA 5EM5A 3TUBA 4IHPA 3C5IA 3KREA 1A06A 4UZDA 3TNQB 2P55A 3FMHA 3EZVA 1R0PA 3QYWA 5AP5A 2C5YA 3DA6A 3ZSIA 1WBVA 4BCGA 3FI4A 3LMGA 3G0FA 4QTDA 5CYIA 1JPAA 5FXQA 3D15A 4J71A 2PE1A 2PVHA 1ZYDA 3PSBA 2VTPA 4FKOA 2R5TA 1W2FA 1NW1A 4QMXA 2BFXA 4ZTNA 3ENHA 4HPUE 2RKUA 3OHTA 2ETKA 2FUMA 4CSVA 2WU7A 4D1ZA 4O81A 2WTWA 5CXHA 5I9YA 4FTJA 4EI4A 3BEGA 4B6LA 2EU9A 4CKJA 1F3MC 5JFVA 1ATPE 2EXEA 2CLQA 1PMNA 3GU8A 3QTRA 4L9IA 3OP5A 1VYZA 3MA3A 3WZEA 2IWIA 4EH9A 1FGIA 3QHWA 1Q41A 3ZFYA 3F6XA 4DFXE 2H6DA 3H9FA 1BYGA 3OTUA 5ANKA 4TKSA 3C4FA 4XG6A 2IVSA 4O96A 3RMFA 1K9AA 2NPQA 5CSHA 1V0PA 5L6WL 2WMBA 3E88A 4KIQA 2QOLA 3GOKA 2OG8A 3P79A 4PNKA 2F9GA 3AC2A 3ANQA 3R28A 4OTFA 4G31A 2OLCA 3BLAA 2BTSA 4IX4A 4O4FA 5KO1A 3NAYA 3NNUA 4O7SA 4G34A 5T68A 3GCPA 2HYYA 3K2LA 5A4TA 3U6JA 4DEGA 3R8MA 4GG5A 3RNIA 5E7RA 2R3NA 4DA5A 5KHXA 4BN1A 4BHNA 4CFXA 4ANQA 3ZO4A 5EYDA 4N57A 3DLSA 5CQUA 3P5KA 3CY3A 4U79A 2DUVA 4AACA 2UW3A 4CRSA 4TYIA 4AGDA 4EK5A 2QURA 5L2QA 4QP4A 5HGIA 5JMSA 2YM5A 3KU2A 2UZLA 3PIYA 3VF9A 4DFYA 5AADA 1JVPP 4G17A 1GJOA 2J0LA 3OY3A 3QD3A 4RJ4A 3BHYA 2IG7A 1UV5A 4R77A 3KA0A 3MPMA 3MIYA 1MUOA 2OO8X 2OSCA 5E1SA 3HUBA 5F20A 2QG7A 2F7ZE 2OIBA 2YHVA 3DKGA 4R1YA 4DBNA 4AXDA 2FA2A 1GAGA 3DFCB 2CNQA 2B9IA 3W0MA 3PPZA 4ALVA 1SNXA 3OUNB 4RX8A 4ASDA 1ZARA 4ZSAA 3PXRA 4QYHA 4MBJA 5DEWA 4GH2A 2DQ7X 1OL6A 3SC1A 3CIKA 3P7CA 2XAMA 3HV6A 1PYEA 5J9ZA 3MFUA 4GG7A 2O65A 3MFRA 3II5A 5AFVA 3PRIA 3KRJA 3O8PA 1XKKA 4MD9E 3S95A 4E6AA 4X2GA 3V5WA 4MX9A 4G6LA 4K2RA 4UALA 4P7EA 1TKIA 4I24A 3OG7A 3BYSA 4F1MA 4M0YA 4FSQA 4RIWB 2XNGA 5LVNA 3HEGA 4I6FA 5C8NA 4X0MA 3OTVA 3FLQA 4FSYA 3TMOA 2WTDA 3O50A 2BAJA 3PXKA 2X6DA 3GQLA 5EDRA 4IWDA 4AU8A 4QYYA 4XG2A 5HCXA 4AQKA 3FZRA 4XG8A 2VTRA 4YMJA 4F7LA 1XBBA 3KXGA 5FD2A 2VZ6A 2G2FA 3AMBA 4BTMA 1OGYA 3P5JC 3FLZA 3PLSA 2HY81 4U9AA 1H1PA 2ZM1A 4FV0A 3W0RA 4FL2A 3LJ2A 3PIXA 2PUPA 3K5VA 1JSVA 4JG6A 4DEIA 4CVAA 4RWKA 4FTIA 1ZY4A 4FTUA 4JQ7A 4BB4A 5I0BA 4R1VA 3NYXA 4YPDA 3MJ2A 4HJOA 5CZIA 5BQ0A 4IMYA 5HEZA 4PTCA 4CRLA 4KUJA 4YJVA 3OOGA 4XYFA 4XS2A 3CTHA 2YM8A 4RX5A 2JBOA 3NZ0A 3UNKA 4IX3A 4JDJA 5AR7A 3ORLA 2YIWA 5TE0A 2GQRA 1U5RA 4GYGA 4FTLA 3L8SA 3R2BA 3ERKA 1ZMWA 3F2NA 2WNTA 3TNWA 4ENXA 4CT1A 4FV9A 4GVAA 2OU7A 3HDMA 2UZNA 4G9CA 5BYZA 5M51A 3UNJA 4DT8A 4O7VA 4BDIA 5H8EA 3RHXA 5LVPA 5TO8A 2REIA 4XRLA 1OM1A 4M8TA 4D2VA 5A3XA 3DOGA 3AKKA 4EJ7A 1DS5A 4RIOA 1PXOA 2WGJA 4C36A 3QRUA 4IWOA 4WG4A 2Z7QA 4AX8A 3Q2MA 1SM2A 1XBCA 1H1RA 3TEIA 4EOMA 1I44A 2BDJA 4D55A 3QKLA 3LLTA 2QOCA 4GK3A 4NW5A 3Q9WA 1P4OA 4XBUA 3VW8A 2JKOA 1XR1A 1XQZA 4XLVA 4EK3A 1T45A 5AR4A 3RAWA 2X4FA 1LEZA 3MFTA 3AG9A 5J1WA 4LUDA 3BEAA 2YDJA 2B9JA 4B8MA 2QQ7A 2Z2WA 4IJ9A 3PA3A 4TWNA 1XH7A 2AYPA 1UU7A 3E3PA 3SLSA 4BCKA 2A4LA 1OPJA 4LOOA 4NK9A 1YW2A 2OJFE 3EOCA 3LXNA 3OXTA 4ZZMA 1KE7A 1Q8TA 4D1SA 4BDEA 2YERA 5EI6A 3E87A 3AMYA 4GJ2A 5BUJA 2J9MA 3V8WA 2YISA 5CNNA 2RFEA 2WMRA 2VNWA 4HW7A 4K9YA 2ZAZA 4I5MA 4WNPA 2KULA 4I22A 4E6CA 5HBJA 1Y6BA 2CHLA 5BVDA 2CCIA 5IU2A 4FX3A 4GIHA 3IW7A 3QZGA 2EB2A 2J51A 1U4DA 3GBZA 3FI2A 2C4GA 4FEWA 5CX9A 5ANEA 4LMUA 5C8KA 4FZ6A 1WBNA 3ZRMA 3OS3A 5GZAA 5TT7A 3RI1A 2WMQA 4FTTA 2ZV9A 4GU9A 4U42A 4EH8A 3OFMA 5C4LA 4FSUA 5JGBA 2GPHA 1G5SA 2UZBA 2E9VA 1H25A 4I6QA 4TTHB 5AUUA 3QZIA 2X8DA 1GZ8A 1OKYA 3QD2B 3TZ8A 2I1MA 3QYZA 5CEOA 2VWVA 1BI7A 4JNWA 2PY3A 4XV3A 3VUIA 2YDKA 1IA9A 5G1XA 2ZB1A 3W2CA 3MS9A 4GCJA 4FEVA 3CGFA 3IOPA 2X8EA 4DTKA 4BIDA 4F1OA 1SNUA 3ORNA 3KRXA 4I5CA 2YFXA 4K11A 4XV1A 5CF8A 3V5QA 1P2AA 3UIUA 3QKMA 2UW6A 4XG7A 3CBLA 2GTNA 3LKMA 4M97A 3Q6WA 3EIDA 4KABA 4DGLC 4FZ7A 4QMMA 1YXUA 1AQ1A 4FIGA 5M57A 1PRYA 1W2CA 3Q5ZA 3PY1A 4W4VA 2W5AA 3V6RA 3BV3A 3PE2A 3SXRA 3EQFA 4DAWA 5ACBC 3W10A 4MHAA 4E20A 3L9MA 4O4DA 5E9EA 4H39A 3UDBA 3JR1A 4RJ5A 4R3CA 4IBMA 2OF4A 3FMKA 4NCTA 4OTWA 3MESA 1OIRA 1GZKA