4FZFB

Crystal structure of mst4-mo25 complex with dki
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
281
structure length
279
Chain Sequence
b'MADPEELFTKLERIGKGGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLAAFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding protein 39
publication title Structure of the MST4 in Complex with MO25 Provides Insights into Its Activation Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transferase/inhibitor
total genus 77
structure length 279
sequence length 281
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fzfB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fzfB01
3U87A 1WCCA 1YVJA 3R22A 2J0IA 2F7ZE 4JOAA 1RW8A 2FGIA 5FXRA 5L2SA 3LJ1A 2R64A 4XUFA 3LW0A 4ID7A 4YSMA 3QGYA 2YM8A 2UW8A 2VWYA 3QGWA 4FTOA 4QMOA 4YZMA 3RPYA 3KRLA 4G34A 4C58A 4GJ3A 2IZRA 3ZM4A 4K33A 4CCBA 2HZ4A 2QLQA 3C4EA 1Y91A 3Q5ZA 4IAIA 4D4SA 1IAJA 2I7QA 1AD5A 3SKCA 4BWXA 3ZCLA 5BVWA 1IR3A 3O71A 2JIVA 3B2WA 1U5QA 3UPZA 3BHTA 5CT0A 3OT8A 3CTQA 2CGWA 4U7ZA 5AV4A 4R1YA 3LFAA 3BI6A 4ZAUA 3A99A 3O8PA 2BFYA 2XK8A 3PXZA 4U43A 5ETFA 3CPBA 5HD7A 3SOCA 3PLSA 4DH8A 3A7HA 3CY3A 3EQGA 4CFXA 4O91A 3EZVA 4S2ZA 5GIOE 3PPKA 4PV0A 1Y6AA 3PVBA 4L68A 4GFMA 3CQEA 4RJ5A 2XBAA 4WSYA 2UW3A 3UO5A 1E9HA 1GAGA 1YHWA 5CEMA 2IVSA 2WMSA 2R3GA 3PY1A 4N4SA 3U4UA 2CCHA 2R5TA 4E5AX 4MXXA 5FBNC 1QMZA 3II5A 3DA6A 5HIEA 4F0FA 2JKMA 4N57A 2VWWA 2J4ZA 4IMYA 4L44A 3D9VA 1URCA 4D9UA 1OIQA 2R3IA 1YRPA 2WQEA 4BDCA 3HRBA 2C6MA 3QHWA 3L8VA 3RPRA 3QTZA 2CNVA 4G3CA 2VTOA 4X2JA 4PTGA 1R0EA 4R6VA 3UMWA 4IW0A 3SOAA 1XBCA 3FUPA 3HYHA 3IW8A 1WVYA 1KOAA 2R3HA 3FKNA 3ENHA 4I5HA 4NTSA 3TG1A 3T8OA 3PPJA 4FEXA 2FSTX 2VWIA 3W2PA 4C36A 5HQ0A 4D0XA 4DT8A 4C4GA 3C4WA 4FSNA 2XNMA 1ZOHA 3AXWA 2A1AB 4NM0A 4L00A 2GTNA 4O0SA 3MV5A 4FIGA 4N6YA 5FGKA 3KULB 2NP8A 3W2QA 4QOXA 4G2FA 5IISA 4OBOA 3B8RA 2PTKA 1R1WA 3FZPA 1XBBA 2X6EA 4OTDA 4WD5A 3G0EA 2WTJA 2VTSA 3IG7A 1NXKA 4YZBA 2WZJA 3ZXTA 4DF3A 1CSNA 4EC8A 3EMGA 2WMWA 2BRHA 4U5JA 4FKSA 4XV3A 1NVRA 3VBVA 4TKSA 5E8VA 4C3PA 3WARA 3R28A 3KMWA 2WQOA 5HVJA 3R9NA 2J0JA 5HKMA 2FYSA 4MWIA 5CF4A 2R2PA 4KIPA 3FMEA 4CQEA 4LRKA 5M4CA 5IQHA 3GU5A 4ZSGA 1H1PA 2VTRA 4JG8A 4NW6A 3FSFA 4UMUA 4JIKA 4YO6A 4NSTA 5CSWA 3WILA 3EQDA 3FL4A 3UBDA 4IB1A 1Q62A 2RL5A 5L6OA 3MIAA 4OTIA 1Q41A 2RG6A 4QYEA 5I9UA 4RLKA 2JKKA 3SQQA 3QC4A 4XHKB 3DJ7A 4CYIA 3D0EA 1Y6BA 3BLQA 3V6SA 3LLAA 3KKVA 2EVAA 1PMUA 3HGKA 2BKKA 3BCEA 3CQUA 1M2PA 2GHLA 4ZMFA 3KU2A 4ZMEA 5L2QA 4TT7A 3MFUA 2YDJA 3QX2A 3N4VA 5GINE 4GH2A 4CZTA 4F4PA 3A2CA 3R9DA 3R30A 4NJDA 2WO6A 4KBCA 3CJFA 4LV8A 3D5VA 3ZSGA 3HDMA 3VUDA 4DTAA 4AF3A 5ANGA 5AUZA 5EM7A 2PULA 2WGJA 3QZGA 4X2GA 4LMUA 3HL7A 3K5UA 3LOKA 3HX4A 3M11A 3QZFA 3CPCA 5L8JA 1OITA 3VW8A 2WD1A 4DBXA 4BCKA 5LJJA 4EJ7A 4EI4A 3SG9A 3FE3A 4Y72A 2HENA 2HOGA 2XP2A 4IAKA 4EH3A 3AC4A 5BNJA 2HY81 2WU7A 3UP2A 2QOCA 2XNPA 2Y6OA 4I0RA 1S9JA 3DKGA 4FL2A 3LFEA 4YJVA 3HNGA 4JXFA 4D1ZA 5HTBA 5ANIA 4N70A 4FT0A 3PP0A 4NWMA 1JSVA 5CY3A 5FEDA 2X4ZA 4L8MA 4HVHA 3MTFA 2R3FA 4YR8A 5FWKK 3S4QA 2OXYA 4EK5A 5LVMA 5D12A 2BRGA 4BF2A 3VJNA 1OECA 1TKIA 2HW7A 2HELA 3EFWA 3I6UA 3QBNA 4QTCA 3TZ9A 4DFLA 3V5WA 4MCVA 2FB8A 3EL7A 5EQPA 1QPEA 2GCDA 2RF9A 2VTHA 3KRXA 4KABA 3A7JA 4R7HA 3H9FA 4AGDA 2QOOA 4IQ6A 4ANNA 4YBKA 3HV7A 4EOPA 4ACCA 5AV1A 4U3YA 5IDPA 5EYCA 2P55A 4G5JA 4UV0A 5A3XA 1O6YA 1U54B 5AAFA 3LCOA 2WMTA 4CFFA 1O6LA 4JRVA 3O8TA 1H1RA 4EK4A 3N4TA 2GS6A 3COMA 2WTIA 5L8LA 4FC0A 3UP7A 2ZDTA 4MNEB 4BCQA 4AW2A 3TNHA 1KSWA 4JT3A 2GNLA 3HKOA 3R83A 4KB8A 4QD6A 1A06A 3TIYA 3ZC6A 4AGWA 4DEHA 1H4LA 2BZKB 3V3VA 4BC6A 5LWMA 3EQRA 5BVOA 2R0IA 3QYWA 4U42A 3ACKA 4NKAA 4TYIA 4CG8A 2ZV2A 4FKIA 4OTWA 2J50A 4BDAA 1LEWA 4CFVA 4I93A 3MTLA 3PXRA 5EKOA 3UVPA 4B4LA 5H2UA 4EOIA 3RAHA 3NUSA 3WZJA 4XRJA 5LWNA 5IA1A 4PY1A 3S00A 3OW4A 1E1VA 2WAJA 3OOGA 4YJQA 5LOHA 3OT3A 3NYOA 4QQ5A 4F9BA 5CAQA 2VTQA 4ZEGA 3LPBA 2C68A 3DBQA 4I5CA 4U97A 2C6DA 2QCSA 3DAKA 3PY0A 4ZTNA 4FEWA 2JITA 1SVGA 2XJ2A 3L1SA 4IVCA 5LVLA 4E26A 3OFMA 4FV3A 1JVPP 4D2PA 4E1ZA 4UEUA 3NW7A 4H1MA 4XV2A 3CQWA 4CZUA 3MH0A 4JR7A 3ZYAA 4W9XA 3Q6UA 2YM6A 2YABA 4BKYA 5IQIA 2C0TA 3KRWA 3PRIA 3DQWA 3ET7A 4E20A 2HXQA 5A14A 3OS3A 5CALA 3WF6A 3RHXA 3QALE 1Z9XA 3P1AA 1PXJA 2QNJA 5IUIA 4NW5A 3CEKA 3SW4A 5DEYA 4G5PA 2I6LA 2UZUE 2JC6A 4JL9A 3PFQA 4FT7A 4FYNA 3GNIB 3K2LA 4EK3A 3EYGA 1IRKA 4FODA 5JSMA 5ICPA 4C4EA 4BTFA 5CZIA 1J7LA 2WHBA 2ZAZA 4U0IA 5JKGA 2AC3A 3KGAA 5K3YA 4A9RA 4WIHA 4DGLC 5K0XA 3EHAA 3NNXA 2B9FA 4O21A 5CQUA 5AIRA 3R21A 2ZMCA 2J5FA 4IJ9A 2RIOA 1LP4A 4WG3A 5BVDA 4AX8A 4RJ6A 3DB8A 4AT4A 3ZFXA 4EH8A 5ITAA 3PZHA 2YAKA 4XLVA 2WTDA 4JX7A 3EN4A 4NM7A 4EH4A 3ZSHA 5JZNA 2PUIA 3LFNA 3L9PA 3AGMA 4D5HA 3O51A 4H3BA 3LFCA 5M4UA 4O83A 3QWKA 3LCKA 1OL5A 1JKKA 4QMQA 1Q8YA 5J8IA 4EEVA 3ZSIA 4LOQA 2W7XA 4ZSJA 3ZEPA 4D9TA 3QRIA 5DR9A 3CKWA 4F0GA 5CAPA 1BUHA 1FGIA 3L9MA 4IHPA 1FVRA 5H8EA 3KB7A 3C5UA 2CN8A 4JQ7A 2XKEA 4FKPA 3VF9A 2PUPA 5A46A 4M67A 2PY3A 2Z7RA 3IPHA 4ZZMA 4OT6A 5FTOA 4ACGA 3P78A 5D7VA 4AWIA 3PG3A 4O0TA 1SZMA 4AZEA 4F0IA 3E3BX 1H1SA 1G8AA 4IZ7A 4MWHA 4PMTA 5JH6A 4A9YA 3IKAA 3KXXA 4AE6A 3HZTA 4FIFA 4GVAA 3A4PA 2OXXA 4YZDA 3WBLA 5KO1A 4U79A 3D83A 2CJMA 1KE8A 2Y4PA 2GHGA 2XKCA 4PMMA 2DUVA 3FYKX 2W1FA 3LFBA 4HJOA 4IADA 5HTCA 3S95A 3DGKA 2R3PA 2ZM4A 4Z9LA 3OD6X 3MJ1A 3F3ZA 2VTJA 4Z7GA 2JGZA 3N4UA 3JR1A 3GQIA 4O0RA 3HVCA 2I1MA 2YIRA 3OWLA 1AQ1A 3UZRA 2QO2A 3F3WA 1YKRA 4PQNA 5K4IA 3F66A 3D5XA 4FE2A 2WEVA 2WB8A 4E8AA 4R3CA 2IZTA 3ZLSA 3OW3A 2Z7SA 3VBYA 3ZUVA 3AC2A 2BKZA 2C5VA 1VJYA 2XA4A 4YC6A 4ENYA 4WBBB 3WZEA 4OAVB 2ITVA 4BFMA 3U6HA 3S3IA 3TDWA 4RPVA 1MQ4A 2W9FB 2QHMA 2P33A 2W17A 3OCBA 2C5XA 2SRCA 1UV5A 2BDJA 5EDPA 1H0WA 1IAHA 2OICA 2R3MA 4TW9A 1RQQA 4YTIA 1M14A 4FV1A 1DI8A 5AUXA 2WIHA 3BIZA 5HVYA 2GHMA 3C13A 4IM0A 3FV8A 4FKVA 4JDKA 4BY9E 3NWWA 5AUUA 5KMJA 4LOPA 2PE2A 4BKJA 1BLXA 2BZJA 4AAAA 3NUPA 4FF8A 2VTPA 3NR9A 2QC6A 4X7QA 3NW6A 2OW3A 4OR5A 2JAMA 4FK3A 4XG9A 4ZS4A 3GP0A 4RC3A 3R7VA 5J87A 1W83A 3WZKA 5HIBA 2EXMA 3QD4A 5AP0A 4ALVA 1YDSE 2UZLA 3ATTA 2OZOA 4NFMA 4U81A 4EK6A 3ODYX 3ORXA 5EKNA 4R5SA 3UDBA 3HMMA 4FZ6A 1BX6A 1MQBA 5EG3A 5DT3A 4EOSA 1CM8A 4KS7A 2JFLA 1OBDA 4PPCA 5IQGA 3O23A 3RCJA 3ULIA 5HHWA 4O7NA 3COKA 3RWPA 3ANQA 1OKYA 4Q9SA 3AC1A 4G9CA 3VUHA 5BX0A 3I6WA 3R8MA 2YERA 2UZDA 4HPTE 4HPUE 4NCTC 5BQ0A 2Y7JA 3LVPA 5DHJA 5J7HA 4O38A 4ZSAA 4AOTA 1H07A 3PA5A 1H8FA 3FYJX 2C5YA 2QHNA 3BX5A 1YOMA 2WTCA 5FP5A 4ASZA 1J3HA 2VX0A 5AR3A 1JNKA 2BIKB 4TN6A 5KMLA 2C0IA 5HVKA 5L2WA 4WBOA 4JBVA 1DAWA 3DTCA 4Y5QA 2ITPA 3V5LA 4B0GA 4D4VA 3LM5A 4MD7E 1LR4A 5IKWA 3R9HA 2XMYA 4AN3A 2EUFB 5JFXA 4J7BA 4C8BA 5TF9A 3ZH8A 3Q9YA 5E8XA 2B7AA 3UO4A 3VS4A 3E87A 4QMTA 2UZWE 3LMGA 2ZV9A 1B6CB 3DTWA 2GNJA 1PMEA 4XP2A 4RX5A 2J0MB 4Q5HA 4BBEA 3A4OX 5DG5A 2V0DA 3MDYA 3W2OA 2P2IA 5K9IA 4JG6A 5LCJA 3BPRA 4ZSLA 3KMUA 2J5EA 1WBPA 2QLUA 2ZB1A 5C4LA 3PXKA 4AA4A 4EOMA 1XHAA 2ITNA 2UZNA 2BR1A 4P2KA 4X2KA 4WRGA 4QP7A 5HO6A 4KD1A 3LFQA 4ZTSA 1OL2A 3P7AA 5ANJA 3TKIA 5EW8A 5G6VA 4IX5A 3UYSA 4CXAA 1H25A 4I21A 4O7ZA 4B9DA 2YLFA 1V0OA 4H58A 4C2WA 2X4FA 1BL6A 5HBJA 4E6CA 4AN9A 1JQHA 3GC7A 4TXCA 2IW6A 5BVKA 3P08A 4C37A 4IM3A 4PP7A 3OXZA 2O63A 2IO6A 3CJGA 4RX8A 4Y46A 4F7LA 1UWJA 3WOWA 4NFNA 4AZWA 1LUFA 4K77A 2XNNA 4I0TA 1OMWA 4QYFA 4C38A 1Q99A 3BHHA 4QQTA 3ZLXA 2XIZA 1GZOA 3PSCA 4PL5A 4LL5A 4WG4A 4PDPA 4PNKA 1YDTE 4PRJA 1YHSA 3DU8A 5BMMA 4EZ3A 4UWYA 4BIEA 4EHZA 4QP3A 1ZY4A 3TN8A 4LGHA 3ZMMA 3DJ5A 4PDOA 3TWJA 3GCVA 4GS6A 3R8PA 4PTCA 3UC4A 3MVJA 4FIJA 1PW2A 1CDKA 1YOLA 2RFNA 1KE6A 4EKLA 2WTWA 4G31A 3OTUA 3C4CA 4RG0A 1CKPA 2GQGA 3FMKA 3HA6A 4U6RA 5F9EA 3LJ2A 3EKKA 2VNWA 3HP5A 2C6LA 3JY9A 3QYZA 4HCVA 4DG3E 5T3QA 5J1WA 5EK7A 3COHA 1OIYA 3BGPA 4I24A 4GVJA 2UVZA 1KE7A 3MS9A 3PIYA 3NGAA 4AGCA 2C6EA 3VS6A 3QKKA 4J53A 4AS0A 4E6QA 2W1DA 4LRJA 3BHVA 3Q5IA 4FZDB 4V0GB 2Y9QA 4LFIA 2YJSA 5I9VA 5EQYA 4F6SA 3KVXA 2VAGA 1H27A 3LXPA 4C3FA 2IVVA 3U54A 3H4JA 1H08A 4G9RA 4EOOA 1Q8TA 4GJ2A 4DA5A 4FL1A 5GJFA 4O96A 1XH7A 3PVGA 3I60A 3ZBFA 4DFYA 4JI9A 4XG4A 2EWAA 4KBKA 4UALA 4OGRA 4USDA 4PX6A 4FOBA 3H9OA 3HV4A 4FL3A 2B9JA 4KIQA 2OH4A 2ESMA 4NIFA 4HZRA 4PL3A 3U51A 2XCKA 5CEIA 2VX1A 3T3VA 4E7WA 2V55A 4DTBA 5J7BA 5DMZA 4DGNA 2B9IA 1PXNA 3TKHA 5HO8A 5IU2A 4QMUA 3DBEA 4XOYA 5HNIX 3QUPA 3H10A 4M97A 3TIZA 1URWA 4DLJA 5M09A 4GUEA 3R00A 3OY3A 2AUHA 3U9CA 4LV5A 1AGWA 2I0VA 2C6IA 4V01A 2X0GA 1PJKA 3R8VA 4BCOA 5A4LA 5IDNA 4UN0C 1SNXA 3DT1A 3G51A 3KF4A 4U3ZA 3VNTA 1HCKA 3UOKA 1OM1A 1WVWA 4FTNA 4LYNA 3W2SA 4AT5A 4BI0A 4E73A 2Z7QA 4FSTA 4FGRA 2G15A 4TNDA 4OTFA 5DI1A 2QOKA 3O96A 2XIKA 3R7GA 3ZRKA 3L8SA 4AXAA 5AP7A 5HORA 1X8BA 4MXOA 3TUCA 1L8TA 3IK3A 2OXDA 4ZY6A 4MQ2A 4UYNA 4MVFA 4HNIA 4AZVA 4EZ5A 4XLIA 3I5ZA 3UIUA 4GYIA 1KV2A 1I09A 3HDNA 4XG8A 3VS1A 3PSBA 4ZTQA 1PXPA 5EM5A 3W10A 4Z3VA 3ORLA 5A9UA 1R3CA 5LXMA 3Q60A 3KXHA 3Q52A 5M51A 3NVMB 5E91A 2WPAA 4AW0A 5G1XA 3Q4UA 1NVQA 4PPBA 3EQBA 3UG2A 2X6DA 2W99B 4KWPA 1XQZA 4NCTA 4CFWA 4TY1A 5GZ8A 5IEVA 1NT2A 3FEGA 3BLHA 4JDHA 3FMLA 2B9HA 4FI1A 5CEQA 1XKKA 4FICA 4KNBA 3CIKA 3CSVA 2F2UA 3BQCA 5AUWA 2PE1A 4HYHA 4EQUA 3IONA 4FNYA 3NZ0A 3W32A 4ACDA 4QMNA 3MH3A 3VF8A 3FKOA 2NRYA 3GGFA 3QD3A 4R7BA 5FUTA 3QHRA 3QTUA 1REJA 2VGOA 3PXFA 3PWYA 3MVLA 3DXQA 5BVEA 5A6NA 3KULA 3FHIA 3VIDA 1GIJA 3GENA 1QPCA 2BILB 3AC8A 3PPZA 1KE9A 2F7EE 2XBJA 4FSQA 1GIHA 3RJCA 4F7NA 1KE5A 3KQ7A 4YGAA 3N51A 4I6FA 4RX9A 5TO8A 4DINA 4GIIA 5FTGA 2O2UA 3G90X 1TVOA 4TWCA 1ZMWA 5HU3A 2C47A 2BVAA 5IUHA 4DFXE 3G6GA 4EK8A 3POOA 4IC8A 4TPTA 2WTKB 3KREA 4L45A 3HUBA 4N6ZA 4WO5A 5AUTA 2HWOA 2BRMA 3RZBA 5AP3A 1OVEA 4CMTA 5KMNA 1OPJA 3GU8A 3H0YA 1KOBA 4FV9A 4GK4A 3RP9A 3HMOA 4HCTA 5M44A 4USFA 2ZV8A 2JDVA 3FL5A 3NAYA 2XCHA 1FQ1B 5ANEA 5KHWA 1CTPE 1PXLA 1R39A 3FI3A 2OJGA 5C9CA 2IN6A 3I5NA 3R63A 4ACMA 3VBQA 4J98A 2IZUA 3R0TA 3QTQA 5JRQA 2J7TA 3R2BA 2WOUA 4HGEA 5AP2A 3D7TB 2BAQA 4ITHA 4V05A 3SHEA 2C30A 2PK9A 4QMYA 5I9ZA 5BYLA 2E2BA 4FSUA 4C4IA 5HLNA 2E9VA 2G9XA 3FMDA 3S0OA 1OZ1A 1SYKA 3PVUA 1Q24A 4I6HA 3VQHA 1WBNA 4F70A 4YBJA 3F9NA 2OF2A 3NCGA 3GFEA 5CZHA 3O7LB 4N0SA 4M15A 3FI4A 3NS9A 4QMWA 2G2HA 2X7FA 3WI6A 3PJ1A 3QQFA 3BE9A 3R01A 3RNYA 5LVNA 3F2NA 2OIQA 5CSHA 2ZOQA 5I9WA 1MUOA 2WMXA 3FMHA 3C0IA 4IWOA 4LG4A 2HCKA 5FD2A 5IH4A 3UQGA 2E9UA 3GVUA 3RAWA 4O0VA 2OF4A 3EN6A 4S30A 4UWBA 5M56A 2YITA 5EYMA 3O17A 5EOLA 3LQ5A 5GJGA 5IEXA 2FSLX 3R73A 3WE8A 1KV1A 2YCSA 4QMMA 4F08A 2W4KA 3R1SA 3SXRA 1FPUA 3IDCA 4FTJA 2JIIA 4I94A 2C6TA 2C3IB 5C01A 5IUGA 3UJGA 1Q3DA 3RNIA 3GBZA 3DOGA 2J6MA 5I0BA 3LMIA 2VTNA 4CKIA 4EYJA 3DBDA 5E8WA 3Q96A 1WFCA 3EFKA 5AAGA 5TE0A 3VW6A 4IAAA 1GOLA 3EN5A 4BDGA 4BZNA 4O7LA 3U6IA 3F7WA 4D5KA 1YWRA 5KZ0A 3UTOA 4EHGA 4FTRA 4LUEA 2CCIA 5CU3A 5CVHA 4IH8A 3LMHA 3TM0A 4W9WA 3V01A 4XJ0A 2JKQA 4DH5A 5AR8A 4BICA 3W2RA 3QKLA 2ERKA 4IZAA 2F2CB 3I0QA 2PVKA 2XK3A 2ITZA 4QT1A 4RBLA 1PY5A 5EFQA 5T68A 4F9YA 2ITOA 4X3JA 3R7IA 4BBMA 5IZFA 5IEYA 4FKRA 1J7UA 4GU9A 4NUSA 4GKHA 1U54A 4EBWA 4DFBA 4P90A 1BI8A 2IG7A 3QCYA 4W4VA 4RQKA 3A61A 4RRVA 4E4XA 4YLKA 5EHYA 1Q8WA 3LFFA 4AQCA 1B39A 3QQJA 1H26A 4MNEA 4D58A 4EC9A 3VRZA 1U59A 3MB6A 4JX3A 3NLBA 4OTQA 4ZOGA 3VS7A 4IVBA 3KY2A 4ZLYA 2OG8A 3C0HA 4FZFB 4RFZA 3VS2A 5AJQA 3U9NA 4HOKA 2AC5A 4YPSA 4D28A 4RIYB 4C2VA 3TNPC 5DN3A 3TNQB 5HICA 4L43A 3ROYA 4AU8A 5JQ8A 3QTSA 2EB2A 4UBAA 3PG1A 3FY2A 2GNGA 2PZRA 4I5PA 3EJ1A 3PP1A 3BKBA 1WMKA 3QCSA 3VBTA 5HLPA 3R1NA 4WNOA 5I5ZA 4OT5A 3PJ3A 5IA4A 5CQWA 3W2CA 4MYGA 4J96A 1ZARA 5IG1A 4GU6A 1J1BA 2UZTA 2PWLA 3CP9A 3V5QA 3FQHA 1Q5KA 3FLSA 3OBGA 4P4CA 4WA9A 2IW9A 4DGGA 1NY3A 1ZYSA 3E8EA 4YC8A 2WQBA 3FWQA 2YHVA 5CU2A 5F1ZA 5JFWA 3GU6A 4I4EA 3NIZA 3HP2A 3EH9A 2YACA 3AT2A 3F82A 4QRCA 4JLCA 3ZONA 4ASXA 2O3PA 1TQMA 4ASDA 4ZY4A 4FKJA 3QUDA 4BCIA 4PWNA 4F9WA 5EI8A 3DFAA 2XJ1A 3KCFA 1IA9A 1GJOA 4QNAA 5CYIA 4BHZA 4QTDA 1SNUA 5CANA 1JWHA 1V0PA 5D7AA 3KL8A 4QP2A 2Q0NA 3ZU7A 1ZXEA 2PUUA 4O0YA 3BE2A 3OCGA 4RMZA 4DT9A 3ZZWA 3MYGA 4ZLZA 5DH3A 4F6UA 5C4KA 4BCHA 4UB7A 2GMXA 3U4WA 5E90A 4TNBA 4IIRA 4O7YA 3RK9A 3OY1A 2KTYA 3Q9ZA 3TZ8A 2W1ZA 2Y4IB 2IZSA 3E64A 2JIUA 4E3CA 4FTCA 4EOKA 2YN8A 3RGFA 4BTKA 3MIYA 3F69A 3TEIA 4L3PA 3H0ZA 2UW0A 1Y8YA 3D2KA 2ZJWA 4MKCA 4M69B 2QVSE 3TV7A 1NVSA 2R3NA 2JAVA 4RQVA 5AIKA 3RVGA 5JN2A 1UKHA 1XWSA 5GZ9A 1RE8A 4PMSA 3OUNB 4CLJA 2UZOA 3Q2MA 3AG9A 1GNGA 2QG5A 2REIA 2VO7A 2V22A 3AC5A 2YIQA 4Z55A 1APME 5IH6A 1B38A 2IWIA 4GRBA 5LMKC 4RJ7A 4NYEA 4EH9A 4EUUA 2VWUA 2X2LA 4TYGA 4D55A 4ENXA 4G6NA 3GB2A 4BN1A 4QQJA 3HA8A 2YM7A 3MSSA 5L2IA 5CAUA 3R8UA 3JY0A 2W5AA 3E5AA 3M2WA 4DYMA 5AA9A 3U55A 3OCSA 4IWPA 1ZYLA 3MFSA 3ORIA 3FMJA 2CLQA 4J8MA 3QRJA 4FG7A 3MVMA 5M55A 4FSMA 3O50A 4YURA 4CRLA 4OTPA 5LCKA 3OOMA 4AZSA 4AT3A 2PVYA 3KF7A 2Y6MA 4FYOA 4QYHA 5M06A 1PYEA 3VAPA 4M12A 2LAVA 4YLJA 5AP1A 2YEXA 2YIYA 2ZMDA 4IJPA 5DA3A 1H1QA 3K5VA 4U80A 4LUDA 4AACA 2OU7A 3FPMA 4YJRA 3I4BA 5IMEA 1XO2B 3MI9A 3PIZA 3AMAA 3FLWA 3LLTA 4M68A 5DBXA 2XIXA 4U8ZA 3NNUA 1STCE 3R71A 4WNKA 4C62A 4EOQA 2PMLX 4IANA 2PVFA 5J5TA 2C0OA 4MXAA 2JKOA 2I0HA 3UOJA 2NRUA 4R8QA 5B2LA 3FMMA 3HV6A 3ZXZA 3ALOA 2XJ0A 4OUCA 4A07A 3FZSA 5EYDA 4CFNA 2ONLC 4EWHA 3QFVA 2QU5A 2X9FA 1A9UA 3LFSA 4RIXB 4HVIA 1OUKA 3WF7A 1XH8A 3OUKA 4GFGA 2GTMA 3GC0A 3NUYA 4UMPA 2QU6A 4DCAA 3ZFYA 3E8DA 3F3VA 4KKGA 4F09A 4O7SA 3Q2JA 4QMSA 4DBNA 1JSUA 5HE1A 1H28A 3RK5A 4X0MA 1OIUA 2BRBA 4FEQA 4HGSA 3R7YA 4IE9A 4DEEA 4O27B 3Q9WA 4RLLA 4FOCA 2E9NA 5L6PA 4DC2A 1L3RE 3QC9A 3C50A 4XP0A 3MFTA 4M8TA 3UNZA 3GT8A 3NAXA 4KSQA 2CN5A 3ZO4A 3FLNC 4WRSA 3CXWA 1BI7A 4TL0A 3S1HA 2CLXA 3LE6A 4BDJA 5EQEA 2GFCA 4FV2A 2BHEA 4NK9A 2BCJA 4AE9A 3ELJA 2YM5A 4HGLA 4ZJIA 5AA8A 1ZZ2A 1KWPA 4AW5A 3RKBA 2BRNA 4CMOA 2E9PA 4AN2A 3C1XA 3PTGA 4GW8A 1JOWB 2PL0A 4I4FA 2J2IB 4FSRA 4M14A 1YI3A 3ORKA 4L9IA 2BDWA 4UZHA 2X8DA 5FTQA 4ZJJA 4CTCA 4B99A 4FA2A 2OFUA 2VTTA 4YTFA 4MD9E 3AMYA 4F64A 5L8KA 2VWBA 4PP9A 4EHVA 4FT3A 3ETAA 3VJOA 3W55A 4UY9A 4WUNA 1O6KA 5IMXA 3UQCA 3GOPA 1P2AA 3R7EA 3NRMA 4TYEA 2YDKA 1WAKA 5IA2A 2HY0A 5CVGA 4M0ZA 2C3LA 3ZOSA 4GCJA 4ZLOA 4K18A 4IFCA 3UVRA 3NPCA 2P0CA 3VO3A 2J0KA 2PVNA 4FVQA 5ETAA 4KIOA 3A7GA 3HECA 4RVLA 3EN7A 3ZO3A 2XM9A 3VS0A 3D14A 3QF9A 3BHUA 2WTKC 4I92A 5J79A 3K3IA 3QTWA 3NUAA 3QZHA 5IA3A 1XH9A 2YISA 2B1PA 4JBQA 3BEAA 4PDSA 1UU8A 4MBLA 4NZWB 4DH1A 5M57A 3QRTA 1YXSA 4I41A 2HAKA 2YDIA 2G1TA 2ZB0A 4RFYA 3E88A 5HX6A 2Z7LA 5HOAA 2JD5A 5EHLA 4DEAA 5CENA 4JS8A 1SVHA 4FKTA 4JJRA 3TL8A 2XK4A 5KMMA 2BTRA 2O8YA 3JXWA 1UNLA 2GNFA 5FP6A 5F95A 3NX8A 4ONAA 4MF0A 2CMWA 3T3UA 3TI1A 2R3RA 3EN9A 4BZOA 2HK5A 1ZOEA 3OC1A 4HVSA 2RSVA 5B7VA 2QR8A 2B4SB 4YJSA 2R9SA 4UYAA 1BL7A 2VWXA 5DWRA 5C1QB 2UW9A 3AOXA 4L67A 5BUIA 5C26A 4FV4A 4EL9A 4EKKA 4P5ZA 2VTMA 3F5GA 5AR7A 4FV6A 5DRBA 3W8QA 5CU0A 2X7GA 5JGBA 1QPDA 4XYFA 5HNBA 4F6WA 2ETMA 5DEWA 1M17A 2UZVA 4MXYA 2ZDUA 5FXQA 3RM7A 3CKXA 3O8UA 3ZLWA 4EH6A 5LMKA 3LCTA 5DR2A 3B8QA 5H8BA 4RZVA 4EYMA 1XH6A 4BGQA 4XS2A 3KXZA 4EOJA 4D2WA 2UVYA 3I7CA 3MGYA 1YOJA 1O9UA 4RJ4A 5DNRA 4DFNA 3D94A 4KIKA 4FUYA 1GY3A 4YZCA 5BPYA 1K9AA 5EH0A 5DRDA 4V0GA 4XG6A 4F1OA 1R78A 2VU3A 5JK3A 2QR7A 4TYHA 2B52A 1MRUA 1QCFA 2CKEA 3R7UA 2VTLA 2XF0A 3Q3BA 2BALA 4QMLA 4UWCA 3ATSA 3OZ6A 4ANSA 3QQLA 3PRFA 3EFJA 3KN5A 1WBVA 2XKFA 4EHEA 2BZHB 2ITTA 4KINA 2R3JA 1ZOGA 4BBFA 1ZAOA 5K5NA 4DLIA 2WNTA 2C6KA 2PVRA 3C9WA 2O65A 4ZK5A 3ZUUA 1W84A 4IX6A 4ZZOA 2X8EA 4UZDA 1PKGA 4MEDA 2W1EA 3LM0A 4AP7A 3JYAA 4BTJA 5KMIA 2CHLA 5AR2A 5GHVA 4OTRA 5JFSA 3R9RA 3AD5A 3F5XA 3G9LX 2VD5A 3PWDA 5KBQA 4FV7A 3GU4A 4QMPA 3NW5A 4PDYA 3BV2A 4R78A 2W1HA 5J5SA 3LCDA 4XOZA 1CKJA 5LARA 3R7OA 3RWQA 4OLIA 2R3LA 2W1CA 2EXEA 4IWQA 1JBPE 3ENMA 1J91A 2PZYA 3LXLA 1PMVA 2FSOX 3NSZA 4GK2A 4I5MA 4S32A 3UIXA 3C51A 4C3RA 2F57A 1PXIA 3MJ2A 5CSPA 3ORTA 4G6OA 2OIBA 4M0YA 2ETRA 4II5A 4IDVA 4KBAA 4BDIA 3Q04A 1K2PA 4QTEA 5E9EA 4YP8A 3VS3A 2GS7A 3VVHA 3RAKA 4ZTMA 4A7CA 3ZHPC 1WBWA 5A54A 4USEA 4YJUA 4R3PA 2WU6A 2WMAA 3REPA 1G8SA 4QP4A 3RTPA 3PDTA 3TZ7A 2PVLA 4EH7A 3TDVA 2W96B 4JAJA 4CZYB 3SRVA 3QU0A 4YJPA 3GC8A 5CF6A 2CKPA 4C4FA 4PUZA 4DGOA 3DLZA 3ZFMA 3VN9A 3P79A 4EUTA 3IW7A 2YFXA 3TACA 4FTMA 5DR6A 2W06A 5C27A 3EQIA 4BDBA 2VGPA 4CT1A 2A27A 4A4XA 5CU4A 2H6DA 4ZIMA 2VTIA 3ORZA 2B54A 1F5QA 3OWKA 5HCZA 3UC3A 2JDSA 2WEIA 5H9BA 3CC6A 3BBWA 4JR3A 3VUMA 2QI8A 3QRKA 3DK7A 4E4NA 1J1CA 4AW1A 5CAVA 4KUJA 5HIDA 2R3KA 3Q32A 2JEDA 4WNMA 3F2AA 3PIXA 3D4QA 4GYGA 5CWZA 5CLPA 1V1KA 2XRWA 2BPMA 5CSXA 4F9AA 2OJFE 3FC2A 1EH4A 4K9YA 5HO7A 1WBSA 4OW8A 5AUYA 4O0UA 3DPKA 2WMRA 3IQ7A 2CGVA 3LQ8A 3MPMA 3UG1A 4YU2A 2R4BA 5C8MA 2DQ7X 3I7BA 3KXMA 3QD2B 2GSFA 3R02A 2YM4A 4FTLA 3OMVA 4RJ8A 3OEFX 2QURA 3PJ8A 3QCXA 2PMNX 4XG2A 4ANOA 5GZAA 4WKQA 2R7IA 3R04A 4XP3A 4FV5A 4YZ9A 3NIEA 1W98A 2GFSA 2AYPA 3MPAA 3Q4ZA 4ITIA 4MBJA 4BDDA 3WZDA 4QP9A 4ANLA 4U41A 3JS2A 4HW7A 4CVAA 4CGAA 1LPUA 3IDPA 4LM5A 4OTGA 5C03A 3DDPA 4GIHA 5FQDC 5M4FA 1R0PA 2JLDA 3HUCA 4F7JA 5LVPA 2H8HA 2HZNA 1H1WA 3EKNA 3ORNA 4O0XA 4DEDA 5IQDA 4ERKA 3HAVA 2Y4IC 1JSTA 3KFAA 4G6LA 4I22A 2I0YA 4L3JA 4BTMA 5EDQA 3LAUA 1JPAA 2H9VA 3A7FA 3DXNA 3Q53A 2R7BA 4F7SA 4IACA 3CS9A 3PXYA 3H30A 4O1OA 4UMRA 3FJQE 2VO0A 3C5IA 4DHFA 1UWHA 2PMIA 1UU3A 2A0CX 3DLSA 3TUDA 3BWJA 3CBLA 4JBPA 3IS5A 4KAOA 3M42A 1OIRA 2BAJA 4IXPA 5KMOA 2Z02A 4HVGA 3F5UA 3OVVA 3DKCA 4I23A 4IAYA 3M1SA 3VUGA 4WOVA 3UQFA 5DOSA 4IB0A 3D15A 3FZOA 4GL9A 4BCGA 1A48A 4RWKA 2OJIA 3RPSA 3DXPA 4J71A 4JNWA 5KNJA 5LQFA 5EI2A 2J9MA 3LCSA 3UMXA 3ULZA 1IG1A 3GEQA 5ANKA 1ZMVA 3TTJA 3ROCA 4K11A 1Y8GA 5CNOA 2W0JA 3PA4A 2EB3A 5FDPA 5JGDA 4O82A 1UU9A 4G1WA 2PZPA 3E8NA 3QWJA 3HEGA 4L7FA 2Z8CA 5E8ZA 1I44A 3IOPA 3P5KA 4GT3A 4C0TA 4RA4A 3LXNA 3W33A 3ZM9A 3COIA 5FXSA 2WMUA 3CD3A 2XYNA 4DE4A 4BDEA 1F3MC 4LRMA 4IWDA 4Y85A 4E4MA 3TJDA 4M3QA 3PZEA 4PL4A 4W8EA 4JRNA 3CGFA 4GEOA 4YJNA 3O2MA 2VN9A 1G5SA 4H3QA 3VUIA 1PXKA 3GFWA 2UW4A 2XKDA 2RFSA 3DK3A 1H24A 3DKOA 4JBOA 3MW1A 4I0SA 3TT0A 4BDHA 3VS5A 3E93A 1HCLA 4IVAA 5E8TA 5J95A 2QOIA 4JQEA 4G3EA 4X6QC 4K6ZA 1M7QA 3AMBA 5JGAA 2GU8A 2WXVA 4O22A 3QQGA 2VX3A 4UMTA 3UGCA 2G2IA 4ASEA 4D2RA 4E6DA 3A7IA 5AX3A 2XS0A 4LOOA 5IQCA 4L7SA 4TTHB 3QD0A 3DB6A 2V7OA 4I3ZA 2R3OA 1W7HA 4GK3A 5IF1A 2LGCA 4QYGA 5GJDA 3F2RA 4LI5A 3FQEA 4NKSA 1ZY5A 5AP4A 5CS6A 3FY0A 5AWMA 4O2PA 5JRSA 3VQUA 4FEUA 2P2HA 2BUJA 4FMQA 4G3DA 2UW5A 3P4KA 3BWFA 3WZUA 4KKEA 4ZS0A 2IPXA 4B8LA 5HE3A 2UZEA 1SMHA 3QAME 3THBA 2BTSA 2H96A 3VHKA 4XX9A 4H05A 3R2YA 4HCUA 3I79A 1UA2A 3MVHA 5EHOA 3DV3A 3CE3A 3OF0A 3VBWA 1OPLA 1YWVA 4MAOA 3UVQA 3RINA 4L42A 3A8WA 2OZAB 4BCFA 3C4XA 4FNZA 1BMKA 4BCPA 4NT4A 3WIKA 4FKWA 4Y8DA 1OGUA 3KA0A 5BYYA 5HX8A 1W8CA 4EQCA 4FSZA 3FMNA 4CG9A 3MWUA 3ZO1A 5E8UA 5DYJA 4K1BA 3F3TA 3KC3A 3AGLA 4ITJA 4FT5A 5EM8A 3U8WA 4LGGA 4D2SA 3G15A 5CEKA 4C7TA 5J9YA 3GI3A 5A4QA 4RIYA 4YNEA 4CFUA 3FI8A 3CTHA 3FZRA 2X9EA 2BAKA 2XNGA 3BLRA 3DCVA 1ZYCA 4D1SA 4DFZE 4AA0A 3UZTA 4ALWA 4X21A 1REKA 4X3FB 3PUPA 4DITA 4J8NA 4BR3A 4Y95A 5BVNA 3NUUA 1OI9A 2PVMA 3E3PA 4JDJA 1OBGA 3AD4A 4RA5A 5KZIA 4B6LA 2CNUA 1Z5MA 1FMKA 4QMVA 2QO7A 1OL6A 2UV2A 1IA8A 3PA3A 2C3JA 3MPTA 5FLFA 5AFVA 4FX3A 3ZEWA 5A4CA 2X7OA 1H00A 1SM2A 3MN3A 5HI2A 3ACJA 3P7BA 4BZDA 1ND4A 2X1NA 2C5NA 3V5TA 3DZQA 3JVRA 3W1FA 1Q8ZA 1JKSA 2C4GA 3EOCA 2HZ0A 3O0GA 4S34A 4C57A 5CF5A 4RVMA 3VBXA 4DGMA 3E7OA 1KUTA 4NM3A 2JDRA 3E62A 1WBOA 3PVWA 4FG9A 4KRDA 3FXWA 3MESA 3SLSA 1H0VA 3TV6A 3V5PA 4AA5A 3VUTA 4M13A 3OWJA 4HYSA 3MB7A 3UIMA 4APPA 3PY3A 4IEBA 1ZWSA 3V5JA 4E93A 3K54A 2ZYBA 1YQJA 4ZTHA 5AV0A 1LEZA 1VYZA 2ITQA 4YSJA 2WMQA 3HV5A 2VWVA 2QD9A 1ERKA 4KS8A 4RJ3A 3UPXA 4BB4A 3PSDA 5IQFA 2ITWA 1JKTA 3D2IA 4C59A 5KBRA 2BZIB 2QO9A 3PLAE 3SC1A 3QTIA 1XH5A 2J90A 4EONA 2W9ZB 3DFCB 3BYVA 4XBUA 4D4RA 4RIWB 3QQHA 2UUEA 3F3UA 4J95A 5FM3A 5IA5A 1QL6A 4FKGA 1TQIA 1P4OA 2PVHA 5FEEA 4Y5HA 4XCUA 5FBOA 3G6HA 4AZFA 1T45A 4M69A 2XNBA 5K5XA 3ZRMA 1DS5A 3EWHA 5E8SA 3BYSA 1TQPA 2YZAA 5EI6A 5AX9A 3DQXA 3IW6A 2OBJA 4O0WA 2YIXA 5ETCA 3ID6C 1CKIA 3QXPA 2YM3A 4C4JA 4YO4A 1W0XC 3UZPA 2PZ5A 4MHAA 5I4NA 1U4DA 3SVVA 5HU9A 2XVDA 1YHVA 4CV8A 3JVSA 4EZ7A 2G2FA 2OI4X 3DDQA 2VO6A 2O0UA 1BKXA 2F7XE 4I1ZA 4CQGA 5I9XA 4DEGA 4NM5A 4QP8A 1UNGA 2YWVA 1JLUE 3E7VA 3FLYA 3R1QA 2ZM3A 1Q61A 4FKUA 2FSMX 3ODZX 4QO9A 4HVDA 3GU7A 4BVUA 4NH1A 4D4YA 4DEBA 4QYYA 2YLEA 4AFEA 4CLIA 4R3RA 4FSWA 3IGOA 5FM2A 4PNIA 2DYLA 3ZC5A 4DEIA 2YA9A 5KKRB 3QUEA 3GCSA 4CCUA 3NUXA 4BHNA 5CX9A 3A62A 1FVVA 3EZRA 3NUNA 3QLGA 2F49A 5AP5A 5C8KA 3TUBA 4F99A 4IX4A 3FDNA 5DT0A 3BBTB 4Z16A 2ACXA 3W8LA 4C35A 4OAUC 5D1JA 5J9LA 2XEZA 5A4EA 3UNJA 2V7AA 3R9OA 2XB7A 4ANQA 2FVDA 5TR6A 4ARKA 4FZAB 3LQ3A 4QP6A 4FEVA 2O64A 5IQBA 4XH6A 2WQNA 4PF4A 4Q9ZA 5B2MA 1Q8UA 3BYOA 3I0OA 1GZNA 4JG7A 5DGZA 2CKOA 3HV3A 2FA2A 3EQFA 4IAZA 4RIXA 4H1JA 3OWPA 4FZ7A 4IBMA 1BYGA 3RMFA 4YJOA 3TTIA 3GC9A 4FUXA 4WT6A 4O84A 3NDMA 3LXKA 3E92A 4MF1A 4L53A 1H01A 3UYTA 2HW6A 3GXLA 4FVPA 1UU7A 3QZIA 3IDBA 5ETIA 2IVUA 3EIDA 4DG2E 4ALUA 2C6OA 5KCVA 3I1AA 1MRVA 3FLZA 3QLFA 2GNHA 3OROA 2YIWA 3GCUA 2QONA 4D1XA 1PXMA 2V5QA 2JBOA 4F63A 5KUPA 2WELA 2X8IA 3DBCA 3GOKA 5E7RA 3F5PA 2WOTA 1WBTA 1ZYDA 2PVJA 4RFMA 3QCQA 5I3RA 4QPSA 2QOLA 4BDKA 1Q3WA 5CAOA 1IEPA 1YXVA 5HG8A 3P86A 2IVTA 5JEBA 3R1YA 5L3AA 5M53A 3QL8A 4I6BA 5M08A 4UMQA 5E4HA 3JPVA 1GZ8A 4CD0A 2W5BA 2Y8OA 4E4LA 5JZJA 3WYXA 1OL1A 4O2ZA 3OP5A 3ITZA 4CFMA 2B0QA 2GNIA 3UOHA 4XV9A 3HLLA 2GQSA 2PYWA 4IX3A 1ZLTA 2X2MA 4ZTLA 4D0WA 3DNDA 3MA6A 3AT3A 1ZMUA 4X2NA 3BGZA 1ATPE 4FVRA 4Y73A 3K3JA 2XIRA 2XZSA 4WG5A 5D9HA 1Y57A 4MK0A 4FTIA 2A2AA 5AV2A 4IFGA 4JIAA 4KSPA 3QXOA 4A4LA 4B8MA 2XNOA 1ZRZA 1PKDA 1XH4A 3H9RA 3TNIA 2C1BA 3R6XA 5HZNA 4C02A 4CRSA 2E9OA 4RWLA 4FTQA 4W4XA 3G9NA 5J1VA 1YI6A 2XUUA 3FZTA 2UVXA 3KCKA 5DLSA 3ZRLA 3V8TA 4B7TA 4E5BA 3Q6WA 4CYJA 2OJJA 5H3QA 2ZM1A 3CCNA 3ZDIA 2NPQA 5IPJA 2RFEA 2HYYA 3OG7A 1UVRA 3ZO2A 3FXZA 4YHTA 5AEPA 2HXLA 5DFPA 4XV1A 4ZY5A 4FTKA 2YCFA 2YAAA 3CGOA 2W1GA 3V8WA 2ITXA 5M07A 3IOKA 4FT9A 3RALA 2CDZA 4GT5A 3ZLYA 3VUKA 3HMPA 3VHEA 2XK9A 3VRYA 3V8SA 4H36A 4G17A 4FIIA 1S9IA 1YDRE 4XBRA 4EBVA 4BKZA 3BYMA 3HMIA 3WYYA 1XBAA 2ITUA 3SAYA 2NNWB 4QMZA 5ACBC 1FGKA 4CMUA 4IC7A 4E6AA 4MNFA 4K0YA 3BU5A 1MRYA 4WUAA 5CASA 1NA7A 2ETKA 4A9UA 5AMNA 2XIYA 4RSSA 3U6JA 2QG7A 2A4LA 4LQMA 3ZBXA 4LGDA 3TJCA 5C8NA 4CV9A 3SX9A 4FNXA 2WMVA 3MA3A 1YXTA 4RVTA 5HE2A 1XJDA 4CTBA 4G16A 2X2KA 4QTAA 2OFVA 3BYUA 2QOQA 5BVFA 4IZ5A 2PUNA 2PU8A 3F7ZA 3F88A 4FIEA 1JKLA 4FTAA 3O7LD 5H8GA 5LMBA 5E92A 3UODA 4O7VA 4W8DA 4CKJA 1Q4LA 2A19B 2NO3A 2XM8A 3DKFA 4L01A 4MD8E 5EYKA 3QQKA 3RI1A 2YCRA 3IW4A 3W16A 3P0MA 4R7IA 5FG8A 1VZOA 3KK9A 1MP8A 3ZDUA 3PE2A 2FUMA 4YPDA 3F6XA 5GIPE 4XMOA 1OB3A 2Q83A 3NVKI 4RX7A 2P3GX 2OJ9A 4L46A 4C33A 4F1MA 4TZRA 2WTVA 5TT7A 3OHTA 4A9SA 5B2KA 3G0FA 3CD8A 3ZS5A 4CT2A 4YZNA 2VZ6A 4RT7A 4KRCA 4IDTA 3JUHA 5L6WL 5KHXA 4O7WA 2R3QA 1FOTA 4Y83A 1ZZLA 4A4OA 1P5EA 3FLQA 4R1VA 4FTTA 3I81A 2VV9A 4BGHA 3R8ZA 5CT7A 5CSVA 2C3KA 2OKRA 1YXUA 3KXGA 4YC3A 4GUBA 4ZP5A 1G3NA 4GG7A 4ANBA 5ACKA 2J51A 3ZTXA 2P4IA 3IO7A 4QP1A 4G3FA 3BU6A 3QX4A 4J99A 3W18A 2RGPA 3A8XA 5L2TA 1XR1A 1M2QA 3FHRA 4L52A 1M2RA 3NCZA 2I40A 5HCYA 3G33A 2KULA 1OPKA 5CNNA 3V51A 2VO3A 5EM6A 5EW9A 4J97A 3D7ZA 4M7IA 3AT4A 3Q4TA 4FSYA 3V6RA 4YLLA 3KEXA 3GCPA 5AAEA 1PXOA 3AQVA 3PJCA 3MFRA 4D2TA 3DJ6A 5F20A 3D5WA 3SGCA 5A4TA 2I0EA 4WHZA 4BIBA 3SA0A 3OTVA 4O6EA 4AOJA 4GKIA 1PMNA 2FO0A 2OWBA 2R0UA 3KRJA 5F4NA 3WF5A 4BGGA 5IA0A 2DWBA 3NMUF 2C69A 3ORPA 4AG8A 3QA8A 2X39A 4FR4A 4HYIA 5HG7A 4P7EA 4UXQA 4APCA 5HESA 3NEWA 1PHKA 5HD4A 5AR5A 3ERKA 5TKDA 5L4QA 3RBWA 3C4ZA 4X3FC 1QPJA 5IH5A 2JDOA 3QKMA 3DY7A 4RZWA 4BYJA 3KK8A 5LVOA 1DAYA 1IASA 2OGVA 4NL0A 5CI7A 1K3AA 2XEYA 3UIBA 4CSVA 2OSCA 3C4FA 5CEPA 4TWPA 4RGJA 4UXLA 4ZZNA 4FKQA 2Q0BA 2YZLA 4YHFA 5D11A 2PSQA 1W82A 4O86A 3QTXA 4FBXA 4MH7A 3AC3A 4DCEA 3QQUA 4QPMA 5K4JA 4CNHA 5BYZA 3RHKA 3VULA 3WIGA 5AM6A 3BQRA 2OO8X 3S2PA 2BMCA 3TNWA 5J9ZA 3TCPA 1VEBA 2HIWA 2RG5A 3LHJA 4MQ1A 3NYXA 4NU1A 4A06A 3FC1X 4XNEA 3IW5A 5JT2A 4FTUA 4IZYA 4R77A 4QTBA 3EQCA 3RPVA 2CPKE 5D10A 3DK6A 5CI6A 2CGXA 3MY0A 4U9AA 2QQ7A 3VC4A 4BCMA 2EU9A 2X81A 4YTHA 3FZ1A 4BYIA 3TXOA 3RZFA 4FK6A 2GS2A 1PRYA 3HRFA 4TRLA 4EH5A 5ANOA 2XK6A 3KXNA 4HYUA 2XK7A 4Q2AA 5M4IA 5DVRA 3CY2A 1FMOE 3UO6A 2GQRA 3HAMA 1FINA 4KA3A 3Q4CA 4HZSA 5K0KA 3BU3A 2F9GA 4AOIA 1E1XA 2W4JA 3L9NA 3OXTA 2ZVAA 3DAJA 4M84A 4XRLA 5EOBA 4LL0A 4ZXTA 2J0LA 4MXZA 3SDJA 5BUEA 3FKLA 3CTJA 3BZ3A 3E8CA 2BIYA 2F4JA 2ONLA 3LJ0A 4G3GA 2JFMA 2UZBA 3IECA 5F94A 2QKWB 5AV3A 5KX8A 2Z60A 4JVGA 3CR0A 1YI4A 5I3OA 1PYXA 1OKWA 2B55A 2W4OA 3TV4A 4EOLA 3GUBA 4BI2A 3MH2A 4M66A 4YHJA 5HCXA 4DN5A 5T6KA 3BV3A 4AZTA 2B53A 2QODA 4TYJA 2QOBA 3PXQA 4K2RA 5HNGA 1UNHA 2BROA 3N9XA 4GMYA 3SXSA 4RIOA 3ALNA 2BHHA 3LFDA 4NTTA 2G01A 4JQ8A 4TWNA 3E63A 5E8YA 2OLCA 5CEOA 3L8PA 4P5QA 5IQAA 2JDTA 3FBVA 4C34A 2ITYA 3Q9XA 3H3CA 3RAIA 4J1RA 4RVKA 3KVWA 3VWAA 2ERZE 5ANDA 3UE4A 4F9CA 2PPQA 4HGTA 4QNYA 4F65A 4O7TA 5DPVA 2VUWA 3G5DA 1Q97A 3RK7A 2PHKA 5FRIA 4Z7HA 3TZMA 3TKUA 3KN6A 1U46A 3BEGA 4GG5A 5FEQA 1ZYJA 1OKVA 5KKRC 1VYWA 3T9IA 4A9TA 4WSQA 2WFYA 4AUAA 2QOFA 4DG0E 5A6OA 3ANRA 3R8LA 5LMAA 4CKRA 4UX9A 3HRCA 4RWJA 4DH7A 5KMKA 3V04A 4IB5A 3PJ2A 2HZIA 2YCQA 2CNQA 4FG8A 2H34A 1VR2A 2GDOA 3DNEA 5BMSA 2QKRA 4HNFA 3DBFA 3ZZEA 5JFVA 3FPQA 3GQLA 4OBQA 4IVDA 4J52A 5AADA 2RKUA 3MH1A 1OKZA 3OCTA 4C4HA 3FI2A 5AR4A 5I9YA 4KKHA 4RC4A 3P23A 5DIAA 3MY5A 3A60A 5HG5A 5HTIA 4U45A 4DAWA 4ERWA 1M7NA 4NJ3A 1GIIA 3NYVA 3RPOA 1CMKE 4FNWA 4ORKA 1F0QA 1FVTA 2PMOX 5HEZA 3PE1A 2YJRA 2YWPA 4O1PA 4YMJA 5FDXA 4YTCA 2VWZA 2RFDA 2WMBA 4YJTA 1GZKA 4KIKB 3CLYA 4DTKA 4V04A 4Q5EA 3FQSA 2WKMA 5EDRA 2DS1A 2WIPA 4NEUA 5DT4A 5EW3A 4TYHB 2OIDA 5HLWA 2CKQA 3OBJA 3DS6A 4IB3A 2OK1A 2W05A 4CEGA 2OZAA 2VNYA 3B2TA 4FKLA 5AP6A 3NNWA 4BIDA 4XG7A 1Z57A 1P14A 2O5KA 2XH5A 2Y0AA 3POZA 4PTEA 4U44A 5CXHA 3P9JA 3QA0A 3NNVA 3SW7A 4F1TA 3BGQA 3WF9A 1J7IA 1FBNA 1JAMA 3BHYA 3DAEA 1M52A 4BWKA 3D7TA 1OL7A 4XG3A 4K8AA 4ZTRA 3L8XA 3C7QA 4O6LA 4JAIA 2XYUA 3LIJA 3D5UA 2PZIA 3F61A 4QQCA 4TWOA 4C61A 5B0XA 2OH0E 3EYHA 2V62A 3EFLA 4FIHA 2VRXA 4LMNA 5AM7A 4OBPA 2UW7A 2ZV7A 3NYNA 3QTRA 4GSBA 4JDIA 4RWIA 4X3FA 5E1EA 3IGGA 4BCNA 4GV1A 3SV0A 3P7CA 1YWNA 4BRXA 2CSNA 5HGIA 4ZJVA 2HWPA 1P4FA 2PE0A 4FGBA 3KRRA 3C0GA 4I6QA 5D41A 4FV8A 4H3PA 5JMSA 5IQEA 4IM2A 4E5WA 4YUQA 3EQHA 3PYYA 3FSKA 4EORA 4MTAA 4MX9A 4O7RA 2BDFA 3SD0A 1DI9A 4EJNA 3T9TA 2CGUA 3SXFA 4DFUA 1OUYA 3DZOA 3SRVB 5GNKA 5HBEA 3WF8A 1UKIA 2EXCX 3KMMA 1RDQE 4DH3A 3UNKA 4AFJA 4BDFA 5TOZA 1NW1A 3BRBA 2W1IA 3ORMA 4PMPA 2UW6A 2XRUA 3BELA 4AGUA 1YW2A 5CTPA 4I20A 2JBPA 2QOHA 2W5HA 3EQPA 4PPAA 4S33A 4BWPA 5BUJA 3HMNA 4RC2A 5CU6A 2C1AA 1U5RA 4D2VA 4FKOA 2BFXA 3WE4A 1RJBA 5HE0A 1YXXA 2Z2WA 1HOWA 3SG8A 4GFOA 1DM2A 4BI1A 1V0BA 5CVFA 3EL8A 3AD6A 3EB0A 2IJMA 4IAFA 4MBIA 2XNEA 3QRUA 4H39A 3UOLA 3L9LA 3OEZA 4L6QA 4BL1A 5KE0A 3RCDA 1T46A 4X6RA 4OTHA 4U40A 4EH2A 4FV0A 1WZYA 2VTAA 4WNPA 5CXZA 4L3LA 4BCJA 3MY1A 4QPAA 5HBHA 3FAAA 3RM6A 4ANMA 1SVEA 1WVXA 4EQMA 4O81A 4RIWA 2WQMA 4GT4A 4QMXA 3OXIA 3MBLA 5AUVA 3FXXA 3ZUTA 3LKMA 3LZBA 2FH9A 1PF8A 4W4WA 5HG9A 4ACHA 4YNOA 4EWQA 4X2FA 5CF8A 4MXCA 4ZSEA 4W4YA 4R5YA 5JQ5A 2GPHA 5DE2A 5E1SA 3GCQA 4NIFB 2C5OA 4XEYA 3G2FA 2IW8A 4S31A
chains in the Genus database with same CATH superfamily
3U87A 1WCCA 1YVJA 3R22A 2J0IA 2F7ZE 4JOAA 1RW8A 2FGIA 5FXRA 5L2SA 3LJ1A 2R64A 4XUFA 3LW0A 4ID7A 4YSMA 3QGYA 2YM8A 2UW8A 2VWYA 3QGWA 4FTOA 4QMOA 4YZMA 3RPYA 3AKLA 3KRLA 4G34A 4C58A 4GJ3A 2IZRA 3ZM4A 4K33A 4CCBA 2HZ4A 2QLQA 3C4EA 1Y91A 3Q5ZA 4IAIA 4D4SA 1IAJA 2I7QA 1AD5A 3SKCA 4BWXA 4BJJA 3ZCLA 5BVWA 1IR3A 3O71A 2JIVA 3B2WA 1U5QA 3UPZA 3BHTA 5CT0A 3OT8A 3CTQA 2CGWA 4U7ZA 5AV4A 4R1YA 3LFAA 3BI6A 4ZAUA 3A99A 3O8PA 2BFYA 2XK8A 3PXZA 4U43A 5ETFA 3CPBA 5HD7A 3SOCA 3PLSA 4DH8A 3A7HA 3CY3A 3EQGA 4CFXA 4O91A 3EZVA 4S2ZA 5GIOE 3PPKA 4PV0A 1Y6AA 3PVBA 4L68A 4GFMA 3CQEA 4RJ5A 2XBAA 4WSYA 2UW3A 3UO5A 1E9HA 1GAGA 1YHWA 5CEMA 2IVSA 2WMSA 2R3GA 3PY1A 4N4SA 3U4UA 2CCHA 2R5TA 4E5AX 4MXXA 5FBNC 1QMZA 3II5A 3DA6A 5HIEA 4F0FA 2JKMA 4N57A 2VWWA 2J4ZA 4IMYA 4L44A 3D9VA 1URCA 4D9UA 1OIQA 2R3IA 1YRPA 2WQEA 4BDCA 3HRBA 2C6MA 3QHWA 3L8VA 3RPRA 3QTZA 2CNVA 4G3CA 2VTOA 4X2JA 4PTGA 4AQKA 1R0EA 4R6VA 3UMWA 4IW0A 1ST0A 3SOAA 1XBCA 3FUPA 3HYHA 3IW8A 1WVYA 1KOAA 2R3HA 3FKNA 3ENHA 4I5HA 4NTSA 3TG1A 3T8OA 3PPJA 4FEXA 2FSTX 2VWIA 3W2PA 4C36A 5HQ0A 4D0XA 4DT8A 4C4GA 3C4WA 4FSNA 2XNMA 1ZOHA 3AXWA 2A1AB 4NM0A 4L00A 2GTNA 4O0SA 3MV5A 4FIGA 4N6YA 5FGKA 3KULB 2NP8A 3W2QA 4QOXA 4G2FA 5IISA 4OBOA 3B8RA 2PTKA 1R1WA 3FZPA 1XBBA 2X6EA 4OTDA 4WD5A 3G0EA 2WTJA 2VTSA 3IG7A 1NXKA 4YZBA 2WZJA 3ZXTA 4DF3A 1CSNA 4EC8A 3EMGA 2WMWA 2BRHA 4U5JA 4FKSA 4XV3A 1NVRA 3VBVA 4TKSA 5E8VA 4C3PA 3WARA 3R28A 3KMWA 2WQOA 5HVJA 3R9NA 2J0JA 5HKMA 2FYSA 4MWIA 5CF4A 2R2PA 4KIPA 3FMEA 4CQEA 4LRKA 5M4CA 5IQHA 3GU5A 4ZSGA 1H1PA 2VTRA 4JG8A 4NW6A 3FSFA 4UMUA 4JIKA 4YO6A 4NSTA 5CSWA 3WILA 3EQDA 3FL4A 3UBDA 4DHIB 4IB1A 1Q62A 2RL5A 5L6OA 1TZDA 3MIAA 4OTIA 1Q41A 2RG6A 4QYEA 5I9UA 4RLKA 2JKKA 3SQQA 3QC4A 4XHKB 3DJ7A 4CYIA 3D0EA 1Y6BA 3BLQA 3V6SA 3LLAA 3KKVA 2EVAA 1PMUA 3HGKA 2BKKA 3BCEA 3CQUA 1M2PA 2GHLA 4ZMFA 3KU2A 4ZMEA 5L2QA 4TT7A 3MFUA 2X0PA 2YDJA 3QX2A 3N4VA 5GINE 4GH2A 4CZTA 4F4PA 3A2CA 3R9DA 3R30A 4NJDA 2WO6A 4KBCA 3CJFA 4LV8A 3D5VA 3ZSGA 3HDMA 3VUDA 4DTAA 4AF3A 5ANGA 5AUZA 5EM7A 2PULA 2WGJA 3QZGA 4X2GA 4LMUA 3HL7A 3K5UA 3LOKA 3HX4A 3M11A 3QZFA 3CPCA 5L8JA 1OITA 3VW8A 2WD1A 4DBXA 4BCKA 5LJJA 4EJ7A 4EI4A 3SG9A 3FE3A 4Y72A 2HENA 2HOGA 2XP2A 4IAKA 4EH3A 3AC4A 5BNJA 2HY81 2WU7A 3UP2A 2QOCA 2XNPA 2Y6OA 4I0RA 1S9JA 3DKGA 4FL2A 3LFEA 4YJVA 3HNGA 4JXFA 4D1ZA 5HTBA 5ANIA 4N70A 4FT0A 3PP0A 4NWMA 1JSVA 5CY3A 5FEDA 2X4ZA 4L8MA 4HVHA 3MTFA 2R3FA 4YR8A 5FWKK 3S4QA 2OXYA 4EK5A 5LVMA 5D12A 2BRGA 4BF2A 3VJNA 1OECA 1TKIA 2HW7A 2HELA 3EFWA 3I6UA 3QBNA 4QTCA 3TZ9A 4DFLA 3V5WA 4MCVA 2FB8A 3EL7A 5EQPA 1QPEA 2GCDA 2RF9A 2VTHA 3KRXA 4KABA 3A7JA 4R7HA 3H9FA 4AGDA 2QOOA 4IQ6A 4ANNA 4YBKA 3HV7A 4EOPA 4ACCA 2XAOA 5AV1A 4U3YA 5IDPA 5EYCA 2P55A 4G5JA 4UV0A 5A3XA 1O6YA 1U54B 5AAFA 3LCOA 2WMTA 4CFFA 1O6LA 4JRVA 3O8TA 3VONA 1H1RA 4EK4A 3N4TA 2GS6A 3COMA 2WTIA 5L8LA 4FC0A 3UP7A 2ZDTA 4MNEB 4BCQA 4AW2A 3TNHA 1KSWA 4JT3A 2GNLA 3HKOA 3R83A 4KB8A 4QD6A 1A06A 3TIYA 3ZC6A 4AGWA 4DEHA 1H4LA 2BZKB 3V3VA 4BC6A 5LWMA 3EQRA 5BVOA 2R0IA 3QYWA 4U42A 3ACKA 4NKAA 4TYIA 4CG8A 2ZV2A 4FKIA 4OTWA 2J50A 4BDAA 1LEWA 4CFVA 4I93A 3MTLA 3PXRA 5EKOA 3UVPA 4B4LA 5H2UA 4EOIA 3RAHA 3NUSA 3WZJA 4XRJA 3TMOA 5LWNA 5IA1A 4PY1A 3S00A 3OW4A 1E1VA 2WAJA 3OOGA 4YJQA 5LOHA 3OT3A 3NYOA 4QQ5A 4F9BA 5CAQA 2VTQA 4ZEGA 3LPBA 2C68A 3DBQA 4I5CA 4U97A 2C6DA 2QCSA 3DAKA 3PY0A 4ZTNA 4FEWA 2JITA 1SVGA 2XJ2A 3L1SA 4IVCA 5LVLA 4E26A 3OFMA 4FV3A 1JVPP 4D2PA 4E1ZA 4UEUA 3NW7A 4H1MA 4XV2A 3CQWA 4CZUA 3MH0A 4JR7A 3ZYAA 4W9XA 3Q6UA 2YM6A 2YABA 4BKYA 5IQIA 2C0TA 3KRWA 3PRIA 3DQWA 3ET7A 4E20A 2HXQA 5A14A 3OS3A 5CALA 3WF6A 3RHXA 3QALE 1Z9XA 3P1AA 1PXJA 2QNJA 5IUIA 4NW5A 3CEKA 3SW4A 5DEYA 4G5PA 2I6LA 2UZUE 2JC6A 4JL9A 3PFQA 4FT7A 4FYNA 3GNIB 3K2LA 4EK3A 3EYGA 1IRKA 4FODA 5JSMA 5ICPA 4C4EA 4BTFA 5CZIA 1J7LA 2WHBA 2ZAZA 4U0IA 5JKGA 2AC3A 3KGAA 5K3YA 4A9RA 4WIHA 4DGLC 5K0XA 3EHAA 3NNXA 2B9FA 4O21A 5CQUA 5AIRA 3R21A 2ZMCA 2J5FA 4IJ9A 2RIOA 1LP4A 4WG3A 5BVDA 4AX8A 4RJ6A 3DB8A 4AT4A 3ZFXA 4EH8A 5ITAA 3PZHA 2YAKA 4XLVA 2WTDA 4JX7A 3EN4A 4NM7A 4EH4A 3ZSHA 5JZNA 2PUIA 3LFNA 3L9PA 3AGMA 4D5HA 3O51A 4H3BA 3LFCA 5M4UA 4O83A 3QWKA 3LCKA 1OL5A 1JKKA 4QMQA 1Q8YA 5J8IA 4EEVA 3ZSIA 4LOQA 2W7XA 4ZSJA 3ZEPA 4D9TA 3QRIA 5DR9A 4AXEA 3CKWA 4F0GA 5CAPA 1BUHA 1FGIA 3L9MA 4IHPA 1FVRA 5H8EA 3KB7A 3C5UA 1W2FA 2CN8A 2XKEA 4FKPA 4JQ7A 3VF9A 5A46A 4M67A 2PUPA 2PY3A 2Z7RA 3IPHA 4ZZMA 4OT6A 5FTOA 4ACGA 3P78A 5D7VA 4AWIA 3PG3A 4O0TA 1SZMA 4AZEA 4F0IA 3E3BX 1H1SA 1G8AA 4IZ7A 4MWHA 4PMTA 5JH6A 4A9YA 3IKAA 3KXXA 4AE6A 3HZTA 4FIFA 4GVAA 3A4PA 2OXXA 4YZDA 3WBLA 5KO1A 4U79A 3D83A 2CJMA 1KE8A 2Y4PA 2GHGA 2XKCA 4PMMA 2DUVA 3FYKX 2W1FA 3LFBA 4HJOA 4IADA 5HTCA 3S95A 3DGKA 2R3PA 2ZM4A 4Z9LA 3OD6X 3MJ1A 3F3ZA 2VTJA 4Z7GA 2JGZA 3N4UA 3JR1A 3GQIA 4O0RA 3HVCA 2I1MA 2YIRA 3OWLA 1AQ1A 3UZRA 2QO2A 3F3WA 1YKRA 4PQNA 5K4IA 3F66A 3D5XA 4FE2A 2WEVA 2WB8A 4E8AA 4R3CA 2IZTA 3ZLSA 3OW3A 2Z7SA 3VBYA 3ZUVA 3AC2A 2BKZA 2C5VA 1VJYA 2XA4A 4YC6A 4ENYA 4WBBB 3WZEA 4OAVB 2ITVA 4BFMA 3U6HA 3S3IA 3TDWA 4RPVA 1MQ4A 2W9FB 2QHMA 2P33A 2W17A 3OCBA 2C5XA 2SRCA 1UV5A 2BDJA 5EDPA 1H0WA 1IAHA 2OICA 2R3MA 4TW9A 3W0QA 1RQQA 4YTIA 1M14A 4FV1A 1DI8A 5AUXA 2WIHA 3BIZA 5HVYA 2GHMA 3C13A 4IM0A 3FV8A 4FKVA 4JDKA 4BY9E 3NWWA 5AUUA 5KMJA 4LOPA 2PE2A 4BKJA 1BLXA 2BZJA 4AAAA 3NUPA 3W0MA 4FF8A 2VTPA 3NR9A 2QC6A 4X7QA 3NW6A 2OW3A 4OR5A 2JAMA 4FK3A 4XG9A 4ZS4A 3GP0A 4RC3A 3R7VA 5J87A 1W83A 3WZKA 5HIBA 2EXMA 3QD4A 5AP0A 4ALVA 1YDSE 2UZLA 3ATTA 2OZOA 4NFMA 4U81A 4EK6A 3ODYX 3ORXA 5EKNA 4R5SA 3UDBA 3HMMA 4FZ6A 1BX6A 1MQBA 5EG3A 5DT3A 4EOSA 1CM8A 4KS7A 2JFLA 1OBDA 4PPCA 5IQGA 3O23A 3RCJA 3ULIA 5HHWA 4O7NA 3COKA 3RWPA 3ANQA 1OKYA 4Q9SA 3AC1A 4G9CA 3VUHA 5BX0A 3I6WA 3R8MA 2YERA 2UZDA 4HPTE 4HPUE 4NCTC 5BQ0A 2Y7JA 3LVPA 5DHJA 5J7HA 4O38A 4ZSAA 4AOTA 1H07A 3PA5A 1H8FA 3FYJX 2C5YA 2QHNA 3BX5A 1YOMA 2WTCA 5FP5A 4ASZA 1J3HA 2VX0A 5AR3A 1JNKA 2BIKB 4TN6A 5KMLA 4F78A 2C0IA 5HVKA 5L2WA 4WBOA 4JBVA 1DAWA 3DTCA 4Y5QA 2ITPA 3V5LA 4B0GA 4D4VA 3LM5A 4MD7E 1LR4A 5IKWA 3R9HA 2XMYA 4AN3A 2EUFB 5JFXA 4J7BA 4C8BA 5TF9A 3ZH8A 3Q9YA 5E8XA 2B7AA 3UO4A 3VS4A 3E87A 4QMTA 2UZWE 3LMGA 2ZV9A 1B6CB 3DTWA 2GNJA 1PMEA 4XP2A 4RX5A 2J0MB 4Q5HA 2A98A 4BBEA 3A4OX 5DG5A 2V0DA 3MDYA 3W2OA 2P2IA 5K9IA 4JG6A 5LCJA 4QDEA 3BPRA 4ZSLA 3KMUA 2J5EA 1WBPA 2QLUA 2ZB1A 5C4LA 3PXKA 4AA4A 4EOMA 1XHAA 2ITNA 2UZNA 2BR1A 4P2KA 4X2KA 4WRGA 4QP7A 5HO6A 4KD1A 3LFQA 4ZTSA 1OL2A 3P7AA 5ANJA 3TKIA 5EW8A 5G6VA 4IX5A 3UYSA 4CXAA 1H25A 4I21A 4O7ZA 4B9DA 2YLFA 1V0OA 4H58A 4C2WA 2X4FA 1BL6A 5HBJA 4E6CA 4AN9A 1JQHA 3GC7A 4TXCA 2IW6A 5BVKA 3P08A 4C37A 4IM3A 4PP7A 3OXZA 4DHZA 2O63A 2IO6A 3CJGA 4RX8A 4Y46A 4F7LA 1UWJA 3WOWA 4NFNA 4AZWA 1LUFA 4K77A 2XNNA 4I0TA 1OMWA 4QYFA 4C38A 1Q99A 3BHHA 4QQTA 3ZLXA 2XIZA 3P5JC 1GZOA 3PSCA 4PL5A 4LL5A 4WG4A 4PDPA 4PNKA 1YDTE 4PRJA 4DDIA 3AKJA 1YHSA 3DU8A 5BMMA 4EZ3A 4UWYA 4BIEA 4EHZA 4QP3A 1ZY4A 3TN8A 4LGHA 3ZMMA 3DJ5A 4PDOA 3TWJA 3GCVA 4GS6A 3R8PA 4PTCA 3UC4A 3MVJA 4FIJA 1PW2A 1CDKA 1YOLA 2RFNA 1KE6A 4EKLA 2WTWA 4G31A 3OTUA 3C4CA 4RG0A 1CKPA 2GQGA 3FMKA 3HA6A 4U6RA 5F9EA 3LJ2A 3EKKA 2VNWA 3HP5A 2C6LA 3JY9A 3QYZA 4HCVA 4DG3E 5T3QA 5J1WA 5EK7A 3COHA 1OIYA 3BGPA 4I24A 4GVJA 2UVZA 1KE7A 3MS9A 3PIYA 3NGAA 4AGCA 2C6EA 3VS6A 3QKKA 4J53A 4AS0A 4E6QA 2W1DA 4AXDA 4LRJA 3BHVA 3Q5IA 4FZDB 4V0GB 2Y9QA 4LFIA 2YJSA 5I9VA 5EQYA 4F6SA 3KVXA 2VAGA 1H27A 3LXPA 4C3FA 2IVVA 3U54A 3H4JA 1H08A 4G9RA 2AEGA 4EOOA 1Q8TA 4GJ2A 4DA5A 4FL1A 5GJFA 4O96A 1XH7A 3PVGA 3I60A 3ZBFA 4DFYA 4JI9A 4XG4A 2EWAA 4KBKA 4UALA 4OGRA 4USDA 4PX6A 4FOBA 3H9OA 3HV4A 4FL3A 2B9JA 4KIQA 2OH4A 2ESMA 4NIFA 4HZRA 4PL3A 3U51A 2XCKA 5CEIA 2VX1A 3T3VA 4E7WA 2V55A 4DTBA 5J7BA 5DMZA 4DGNA 2B9IA 1PXNA 3TKHA 5HO8A 5IU2A 4QMUA 3DBEA 4XOYA 5HNIX 3QUPA 3H10A 4M97A 3TIZA 1URWA 4DLJA 5M09A 4GUEA 3R00A 3OY3A 2AUHA 3U9CA 4LV5A 1AGWA 2I0VA 2C6IA 4V01A 2X0GA 1PJKA 3R8VA 4BCOA 5A4LA 5IDNA 4UN0C 1SNXA 3DT1A 3G51A 3KF4A 4U3ZA 3VNTA 1HCKA 3UOKA 1OM1A 1WVWA 4FTNA 4LYNA 3W2SA 4AT5A 4BI0A 4E73A 2Z7QA 4FSTA 4FGRA 2G15A 4TNDA 4OTFA 5DI1A 2QOKA 3O96A 2XIKA 3R7GA 3ZRKA 3L8SA 4AXAA 5AP7A 5HORA 1X8BA 4MXOA 3TUCA 1L8TA 3IK3A 2OXDA 4ZY6A 4MQ2A 4UYNA 4MVFA 4HNIA 4AZVA 4EZ5A 4XLIA 3I5ZA 3UIUA 4GYIA 1KV2A 1I09A 3HDNA 4XG8A 3VS1A 3PSBA 4ZTQA 1PXPA 5EM5A 3W10A 4Z3VA 3ORLA 5A9UA 1R3CA 5LXMA 3Q60A 3KXHA 3Q52A 5M51A 3NVMB 5E91A 2WPAA 4AW0A 5G1XA 3Q4UA 1NVQA 4PPBA 3EQBA 3UG2A 2X6DA 2W99B 4KWPA 1XQZA 4NCTA 4CFWA 4TY1A 5GZ8A 5IEVA 1NT2A 3FEGA 3BLHA 4JDHA 3FMLA 2B9HA 4FI1A 5CEQA 1XKKA 4FICA 4KNBA 3CIKA 3CSVA 2F2UA 3BQCA 5AUWA 2PE1A 4HYHA 4EQUA 3IONA 4FNYA 3NZ0A 3W32A 4ACDA 4QMNA 3MH3A 3VF8A 3FKOA 2NRYA 3GGFA 3QD3A 1XMMA 4R7BA 5FUTA 3QHRA 3QTUA 1REJA 2VGOA 3PXFA 3PWYA 3MVLA 3DXQA 5BVEA 5A6NA 3KULA 3FHIA 3VIDA 1GIJA 3GENA 1QPCA 2BILB 3AC8A 3PPZA 1KE9A 2F7EE 2XBJA 4FSQA 1GIHA 3RJCA 4F7NA 1KE5A 3KQ7A 4YGAA 3N51A 4I6FA 4RX9A 5TO8A 4DINA 4GIIA 5FTGA 2O2UA 3G90X 1TVOA 4TWCA 1ZMWA 5HU3A 2C47A 2BVAA 5IUHA 4DFXE 3G6GA 4EK8A 3POOA 4IC8A 4TPTA 2WTKB 3KREA 4L45A 3HUBA 4N6ZA 4WO5A 5AUTA 2HWOA 2BRMA 3RZBA 5AP3A 1OVEA 4CMTA 5KMNA 1OPJA 3GU8A 3H0YA 1KOBA 4FV9A 4GK4A 3RP9A 4LV7A 3HMOA 4HCTA 5M44A 4USFA 2ZV8A 2JDVA 3FL5A 3NAYA 2XCHA 1FQ1B 5ANEA 5KHWA 1CTPE 1PXLA 1R39A 3FI3A 2OJGA 5C9CA 2IN6A 3I5NA 3R63A 4ACMA 3VBQA 4J98A 2IZUA 3R0TA 3QTQA 5JRQA 2J7TA 3R2BA 2WOUA 4HGEA 5AP2A 3D7TB 2BAQA 4ITHA 4V05A 3SHEA 2C30A 2PK9A 4QMYA 5I9ZA 5BYLA 2E2BA 4FSUA 4C4IA 5HLNA 2E9VA 2G9XA 3FMDA 3S0OA 1OZ1A 1SYKA 3PVUA 1Q24A 4I6HA 3VQHA 1WBNA 4F70A 4YBJA 3F9NA 2OF2A 3NCGA 3GFEA 5CZHA 3O7LB 4N0SA 4M15A 3FI4A 3NS9A 4QMWA 2G2HA 2X7FA 3WI6A 3PJ1A 3QQFA 3BE9A 3R01A 3RNYA 5LVNA 3F2NA 2OIQA 5CSHA 2ZOQA 5I9WA 1MUOA 2WMXA 3FMHA 3C0IA 4IWOA 4LG4A 2HCKA 5FD2A 5IH4A 3UQGA 2E9UA 3GVUA 3RAWA 4O0VA 2OF4A 3EN6A 4S30A 4UWBA 5M56A 2YITA 5EYMA 4DDGA 3O17A 5EOLA 3LQ5A 5GJGA 5IEXA 2FSLX 3R73A 3WE8A 1KV1A 2YCSA 4QMMA 4F08A 2W4KA 3R1SA 3SXRA 1FPUA 3IDCA 4FTJA 5BV3A 2JIIA 3O5AA 4I94A 2C6TA 2C3IB 5C01A 5IUGA 3UJGA 1Q3DA 3RNIA 3GBZA 3DOGA 2J6MA 5I0BA 3LMIA 2VTNA 4CKIA 4EYJA 3DBDA 5E8WA 3Q96A 1WFCA 3EFKA 5AAGA 5TE0A 3VW6A 4IAAA 1GOLA 3EN5A 4BDGA 4BZNA 4O7LA 3U6IA 3F7WA 4D5KA 1YWRA 5KZ0A 3UTOA 4EHGA 4FTRA 4LUEA 2CCIA 5CU3A 5CVHA 4IH8A 3LMHA 3TM0A 4W9WA 3V01A 4XJ0A 2JKQA 4DH5A 5AR8A 4BICA 3W2RA 3QKLA 2ERKA 4IZAA 2F2CB 3I0QA 2PVKA 2XK3A 2ITZA 4QT1A 4RBLA 1PY5A 5EFQA 5T68A 4F9YA 2ITOA 4X3JA 3R7IA 4BBMA 5IZFA 5IEYA 4FKRA 1J7UA 4GU9A 4NUSA 4GKHA 1U54A 4EBWA 4DFBA 4P90A 1BI8A 2IG7A 3QCYA 4W4VA 4RQKA 3A61A 4RRVA 4E4XA 4YLKA 5EHYA 2XALA 1Q8WA 3LFFA 4AQCA 1B39A 3QQJA 1H26A 4MNEA 4D58A 4EC9A 3VRZA 1U59A 3MB6A 4JX3A 3NLBA 4OTQA 4ZOGA 3VS7A 4IVBA 3KY2A 4ZLYA 2OG8A 3C0HA 4FZFB 4RFZA 3VS2A 5AJQA 3U9NA 3BL9A 4HOKA 2AC5A 4YPSA 4D28A 4RIYB 4C2VA 3TNPC 5DN3A 3TNQB 5HICA 4L43A 3ROYA 4AU8A 5JQ8A 3QTSA 2EB2A 4O4BB 4UBAA 3PG1A 3FY2A 4QDVA 2GNGA 2PZRA 4I5PA 3EJ1A 3PP1A 3BKBA 1WMKA 3QCSA 3VBTA 5HLPA 3R1NA 4WNOA 5I5ZA 4OT5A 3PJ3A 5IA4A 5CQWA 3W2CA 4MYGA 4J96A 1ZARA 5IG1A 4GU6A 1J1BA 2UZTA 2PWLA 3CP9A 3V5QA 3FQHA 1Q5KA 3FLSA 3OBGA 4P4CA 4WA9A 2IW9A 4DGGA 1NY3A 1ZYSA 3E8EA 4YC8A 2WQBA 3FWQA 2YHVA 5CU2A 5F1ZA 5JFWA 3GU6A 4I4EA 3NIZA 3HP2A 3EH9A 2YACA 3AT2A 3F82A 4QRCA 4JLCA 3ZONA 4ASXA 2O3PA 1TQMA 4ASDA 4ZY4A 4FKJA 3QUDA 4BCIA 4PWNA 4F9WA 5EI8A 3DFAA 2XJ1A 3KCFA 1IA9A 1GJOA 4QNAA 5CYIA 4BHZA 4QTDA 1SNUA 5CANA 1JWHA 1V0PA 5D7AA 3KL8A 4QP2A 2Q0NA 3ZU7A 1ZXEA 2PUUA 4FJVA 4O0YA 3BE2A 3OCGA 4RMZA 4DT9A 3ZZWA 3MYGA 4ZLZA 5DH3A 4F6UA 5C4KA 4BCHA 4UB7A 2GMXA 3U4WA 5E90A 4TNBA 4IIRA 4O7YA 3RK9A 3OY1A 2KTYA 3Q9ZA 3TZ8A 2W1ZA 2Y4IB 2IZSA 3E64A 2JIUA 4E3CA 4FTCA 4EOKA 2YN8A 3RGFA 4BTKA 3MIYA 3F69A 3TEIA 4L3PA 3H0ZA 2UW0A 1Y8YA 3D2KA 2ZJWA 4MKCA 4M69B 2QVSE 3TV7A 1NVSA 2R3NA 2JAVA 4RQVA 5AIKA 3RVGA 5JN2A 1UKHA 1XWSA 5GZ9A 1RE8A 4PMSA 3OUNB 4CLJA 2UZOA 3Q2MA 3AG9A 1GNGA 2QG5A 2REIA 2VO7A 2V22A 3AC5A 2YIQA 4Z55A 1APME 5IH6A 1B38A 2IWIA 4GRBA 5LMKC 4RJ7A 4NYEA 4EH9A 4EUUA 2VWUA 2X2LA 4TYGA 4D55A 4ENXA 4G6NA 3GB2A 4BN1A 4QQJA 3HA8A 2YM7A 3MSSA 5L2IA 5CAUA 3R8UA 3JY0A 2W5AA 3E5AA 3M2WA 4DYMA 5AA9A 3U55A 3OCSA 4IWPA 1ZYLA 3MFSA 3ORIA 3FMJA 2CLQA 4J8MA 3QRJA 4FG7A 3MVMA 5M55A 4FSMA 3O50A 4YURA 4CRLA 4OTPA 5LCKA 2ZFYA 3OOMA 4AZSA 4AT3A 2PVYA 3KF7A 2Y6MA 4FYOA 4QYHA 5M06A 1PYEA 3VAPA 4M12A 2LAVA 4YLJA 5AP1A 2YEXA 2YIYA 2ZMDA 4IJPA 5DA3A 3ML1A 1H1QA 3K5VA 4U80A 4LUDA 4AACA 2OU7A 3FPMA 4YJRA 3I4BA 5IMEA 1XO2B 3MI9A 3PIZA 3AMAA 3FLWA 3LLTA 4M68A 5DBXA 2XIXA 4U8ZA 3NNUA 1STCE 3R71A 4WNKA 4C62A 4EOQA 2PMLX 4IANA 2PVFA 5J5TA 2C0OA 4MXAA 2JKOA 2I0HA 3UOJA 2NRUA 4R8QA 5B2LA 3FMMA 3HV6A 3ZXZA 3ALOA 2XJ0A 4OUCA 4A07A 3FZSA 5EYDA 4CFNA 2ONLC 4EWHA 3QFVA 2QU5A 2X9FA 1A9UA 3LFSA 4RIXB 4HVIA 1OUKA 3WF7A 1XH8A 3OUKA 4GFGA 2GTMA 3GC0A 3NUYA 4UMPA 2QU6A 4DCAA 3ZFYA 3E8DA 3F3VA 4KKGA 4F09A 4O7SA 3Q2JA 4QMSA 4DBNA 1JSUA 5HE1A 1H28A 3RK5A 4X0MA 1OIUA 2BRBA 4FEQA 4HGSA 3R7YA 4IE9A 4DEEA 4O27B 3Q9WA 4RLLA 4FOCA 2E9NA 5L6PA 4DC2A 1L3RE 3QC9A 3C50A 4XP0A 3MFTA 4M8TA 3UNZA 3GT8A 3NAXA 4KSQA 2CN5A 3ZO4A 3FLNC 4WRSA 3CXWA 1BI7A 4TL0A 3KIOC 3S1HA 2CLXA 3LE6A 4BDJA 5EQEA 2GFCA 4FV2A 2BHEA 4NK9A 2BCJA 4AE9A 3ELJA 2YM5A 4HGLA 4ZJIA 5AA8A 1ZZ2A 1KWPA 4AW5A 3RKBA 2BRNA 4CMOA 2E9PA 4AN2A 3C1XA 3PTGA 4GW8A 1JOWB 2PL0A 4I4FA 2J2IB 4FSRA 4M14A 1YI3A 3ORKA 4L9IA 2BDWA 4UZHA 2X8DA 5FTQA 4ZJJA 4CTCA 4B99A 4FA2A 2OFUA 2VTTA 4YTFA 4MD9E 3AMYA 4F64A 5L8KA 2VWBA 4PP9A 4EHVA 4FT3A 3ETAA 3VJOA 3W55A 4UY9A 4WUNA 1O6KA 5IMXA 3UQCA 3GOPA 1P2AA 2X0QA 3NRMA 4TYEA 2YDKA 3R7EA 1WAKA 5IA2A 2HY0A 5CVGA 4M0ZA 2C3LA 3ZOSA 4GCJA 4ZLOA 4K18A 4IFCA 3UVRA 3NPCA 4AAYA 2P0CA 3VO3A 2J0KA 2PVNA 4FVQA 5ETAA 4KIOA 3A7GA 3HECA 4RVLA 3EN7A 3ZO3A 2XM9A 3VS0A 3D14A 3QF9A 3BHUA 2WTKC