4HGEA

Jak2 kinase (jh1 domain) in complex with compound 8
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
290
structure length
284
Chain Sequence
QFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Discovery of potent and selective pyrazolopyrimidine janus kinase 2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 92
structure length 284
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4hgeA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4hgeA01
4HCUA 3BGZA 4ID7A 4KRCA 3AGLA 2GHLA 3W2QA 4CZTA 5HG8A 2QR8A 4JG8A 5AP7A 4ZSLA 2Y0AA 3F5GA 2YAKA 3CP9A 3F9NA 4FNZA 4FZ6A 4BN1A 4BTKA 4BVUA 4CD0A 2UZTA 3MPMA 3DXQA 3E7VA 3SXFA 3I5NA 4EZ5A 2W1EA 4XCUA 4BHNA 3QA0A 1H8FA 3UVQA 2F2UA 1UU9A 3O17A 4ALVA 3EYHA 2W1DA 4G3FA 3CXWA 4ZEGA 3HRFA 3BWFA 3S4QA 3V5TA 5F95A 3R9NA 3EKNA 1NVQA 3ATSA 1PMEA 3GOPA 3MB6A 4GIHA 4EUTA 4C37A 5JGDA 5AAFA 5CASA 2FA2A 2R3HA 3EMGA 3CSVA 4RFMA 2YIQA 2JKMA 3VBVA 2QD9A 4M3QA 2C6EA 1FVVA 2JGZA 3VJNA 4KUJA 3SXRA 4RWLA 4MQ1A 3CPBA 4FIJA 4D2WA 4FKPA 4BF2A 3ZUVA 1M52A 4FNWA 4XV3A 5HESA 3AT4A 3QQUA 4H3PA 4YSMA 1V0OA 4IFCA 5LARA 1XBAA 5TR6A 3BQRA 5AUUA 4E3CA 4ACDA 1H25A 3PG1A 5FDPA 4BKJA 5I0BA 3OD6X 2YN8A 4XJ0A 4JDJA 5E7RA 3EWHA 2WQMA 3TNQB 2W96B 3BYUA 3H4JA 3P9JA 3NIEA 5BYZA 1BMKA 2VTQA 3KK8A 4O96A 4TKSA 4X6QC 2JDVA 4BI1A 2H8HA 2JC6A 1WFCA 2XS0A 3A99A 3LCTA 4BKYA 5IQHA 3TJDA 4EOOA 4AGUA 3UPZA 3GXLA 4FKSA 4FI1A 1E1XA 4FTLA 2C6DA 3SRVB 5B2KA 3QTWA 5AM6A 4EH8A 4PY1A 5CEKA 3D5UA 2Y8OA 3VIDA 3OC1A 2QHNA 4AXAA 4UYAA 4HYSA 4O83A 4D0XA 4C38A 4DBNA 4Y85A 4AT4A 4G6NA 4ZTNA 1JPAA 2WIHA 3PXKA 3Q60A 3M2WA 1H0VA 4J95A 4U81A 5ANDA 5ACKA 2ZJWA 4J53A 4XV1A 5E8YA 4FTOA 5HTCA 4DTAA 3B8QA 1VJYA 2R0IA 3Q9YA 2X7GA 4QT1A 4FIEA 3JS2A 2ITZA 3NNVA 3ETAA 2X2KA 2BDFA 3QZGA 4MEDA 4H1MA 4UALA 3R83A 3TACA 5CF4A 3E62A 3B2TA 4MD8E 3I60A 2DQ7X 3K5VA 4W9WA 4X2FA 4I0RA 5KBQA 5E92A 3M42A 3EQPA 3NCGA 4FV1A 3QQFA 4FG9A 4EWQA 5B7VA 3QLFA 4FTMA 3R9OA 4O0YA 3RINA 3TNWA 2WTKC 3CJFA 3FI8A 1KE9A 1NA7A 3LFBA 5K4IA 4FV9A 4DC2A 1ZYLA 3EFKA 4QYYA 3UP7A 3WILA 2CN5A 1GIIA 2KTYA 4OTQA 4AF3A 3OS3A 4CFNA 5TKDA 4P2KA 4JJRA 3U6HA 3FZRA 4GT5A 3R02A 4NCTA 3D4QA 3ZSGA 3IW7A 3FZPA 2HWPA 1BX6A 4H36A 1GZKA 2FSMX 3KA0A 2BILB 4J71A 1M2QA 2WD1A 2PE2A 4FSRA 4TZRA 2J0KA 3R28A 3FPQA 4LMNA 3MSSA 5TF9A 4F6WA 3ALNA 4IM0A 1PF8A 2GQSA 3O96A 4ITJA 5EYMA 2OU7A 2R4BA 4DEEA 4WNKA 3BHTA 1Q3WA 3GFWA 1SNXA 2C68A 4NIFB 4Z7GA 4EOQA 4U7ZA 2E9VA 4Y5HA 5IQGA 2WTKB 4YZ9A 5TT7A 3ZZEA 2BZHB 5KUPA 3GC8A 2C30A 1ZZ2A 4FUXA 3C51A 4CNHA 4E4NA 5AFVA 5JZNA 2UW0A 2EXCX 4BI2A 3TDWA 3PXQA 4PP7A 4EH3A 5EH0A 5AIKA 2XCHA 3BE2A 3NUNA 4QP3A 2UW5A 4PL5A 3SX9A 5KMKA 5CVHA 4AGWA 1OIYA 2Y4IC 2ZV8A 3B2WA 2R3QA 4WRGA 2JDRA 5A4EA 2WMVA 3EQFA 2BIYA 3A4OX 4APPA 2UW6A 1VEBA 3R7EA 2F2CB 3D2IA 5K5XA 3QKLA 2C6OA 4JX3A 4QMVA 2WHBA 4BCMA 1QMZA 3UIUA 4ACGA 4CRLA 2IVUA 4E6AA 3UYTA 4YTFA 1YHSA 2VX0A 1R78A 3NX8A 5D7VA 2UVXA 3F2AA 1F3MC 4IWOA 5AV3A 1JLUE 3LFNA 3PIZA 5CSXA 4PTCA 3I81A 3DLZA 3JY9A 3E87A 4BZDA 3PA4A 5C03A 2NNWB 5CS6A 4ZSEA 3Q5IA 4D0WA 4WUAA 3R73A 5DVRA 3KC3A 5BUEA 4FL1A 2CKEA 3KCKA 3ID6C 4DFBA 3UGCA 3EZRA 2Y4IB 4WNOA 3IKAA 4XLVA 3MFTA 2YACA 2C5NA 2OF4A 3RTPA 3TXOA 4WD5A 3DJ5A 1SYKA 3LFSA 4BCOA 3HAVA 3PSDA 4JRNA 4QYHA 3C4CA 4FIGA 5KZIA 2GQRA 5EW3A 2NRUA 3WZKA 4CQEA 4G3EA 4JI9A 4L42A 4TW9A 3ZH8A 5CXHA 1W8CA 5HCYA 3QHWA 5BVEA 3VF9A 4ACMA 4IZ5A 4ZZNA 3IOPA 2WTIA 4R1VA 3HV4A 4PP9A 2GTNA 4ANLA 4DGGA 3C5UA 3ZYAA 1K3AA 5IQDA 3G2FA 3ANQA 2ZM4A 5F94A 2A1AB 4C4FA 5M57A 5HBEA 3TUDA 5DHJA 3DB8A 3VQHA 4ASDA 4ZY5A 3K5UA 2QG7A 2Y7JA 2GNHA 5A46A 4O7WA 3BGPA 2C6LA 3IDCA 5EK7A 5FUTA 3LFDA 4FSTA 4H1JA 2Q83A 3DK3A 3MJ1A 4YPSA 2XK7A 4QTCA 2C3IB 1Q8ZA 2R3KA 3F5XA 2R0UA 3FAAA 3LXLA 4LMUA 4TYEA 3PVGA 1UU8A 4J99A 4XV2A 4F9BA 4L7SA 3Q04A 4JAIA 3PY3A 4TWNA 4NJ3A 4A9RA 3HAMA 3BYVA 4FKUA 2IVTA 4XRJA 5EKOA 3SOAA 3QKMA 3VF8A 4DBXA 4DT8A 4C35A 3OF0A 1W0XC 2W1FA 4DEDA 5EOBA 5T6KA 1XH5A 3GU5A 4RJ6A 4BZOA 3G0FA 1G3NA 1XH6A 4ENXA 1TQMA 3FMNA 4GYIA 4MHAA 4M15A 1SVGA 3NW6A 4IAYA 4WKQA 4RIWA 3TCPA 1H08A 5CQUA 5EYDA 2W9FB 1WBPA 1H0WA 1M14A 3RWQA 3FI4A 4BDHA 3R7IA 2CCIA 3PVWA 3P78A 3SXSA 5IUGA 1OBDA 5HGIA 3QZIA 3BHHA 2BZJA 5A4CA 3RZBA 3PE1A 4LRKA 3PZEA 1GAGA 3RCDA 3SHEA 2P55A 3QYZA 2R3IA 4A06A 3ZSIA 5LQFA 4EHEA 4X3FA 3EFJA 3F3ZA 1V0BA 3OWJA 4GW8A 4UY9A 3V51A 2QU6A 2YFXA 3KY2A 2C6MA 2QCSA 3NNWA 4ZY4A 2HW6A 4BIDA 2UUEA 3PJ2A 5CAQA 2BMCA 4WOVA 1Q99A 3W10A 3MPAA 3OCSA 4ZMEA 3I6WA 5ETIA 2JKKA 3CE3A 2IJMA 3QD4A 4AZTA 3VVHA 4YSJA 3UG1A 3FKOA 2OIDA 3FLNC 4IZ7A 4GK2A 2JAMA 4AN2A 2WELA 4LGGA 4RFYA 3TT0A 3DU8A 3R63A 1S9JA 4ONAA 5L2SA 4AT5A 4JXFA 3VHEA 4F0FA 1J7LA 3C5IA 2OG8A 2PSQA 2WO6A 4FOCA 5EDRA 5IU2A 3A7GA 3ORKA 3U4WA 3PPKA 4QQTA 5ANKA 2CSNA 4UMPA 1YDTE 4NEUA 3LLTA 3EQRA 3BX5A 3KXXA 4TYHA 3V6SA 1LP4A 2VO0A 2R3MA 4P5ZA 5T68A 3R1YA 4I6BA 2WB8A 3POZA 4LV8A 5I3RA 3QZHA 3MJ2A 2H96A 5BVWA 4IH8A 4PPCA 3OUKA 4EHZA 1PXJA 4QP1A 3BI6A 4G9RA 4WG5A 2Q0NA 5FBOA 4HZSA 2PULA 4NYEA 4DCEA 4DEBA 4I23A 3BQCA 3TEIA 2UZOA 1OBGA 4I5CA 5ITAA 1KE6A 3WE8A 3CBLA 3VAPA 2HAKA 1W84A 3NW7A 5AP4A 4OTPA 4XX9A 3COKA 3P86A 4EH7A 5ANOA 1FINA 4JBVA 2YZLA 3NAXA 3QTIA 4HVIA 2VTRA 3S95A 4LYNA 4AW5A 4QTAA 3CQEA 4DG0E 3TIZA 2VWYA 4G34A 4ACCA 2GS7A 3AD5A 4G9CA 4IE9A 4TYJA 4MTAA 5AP5A 5F20A 4I0SA 3RPSA 5HQ0A 3GP0A 4YJQA 3P7AA 4RJ3A 2C6TA 2OWBA 3LW0A 3IK3A 1Y57A 2W9ZB 4EK4A 3TZMA 3BWJA 2BPMA 3QTQA 4Q5EA 2I7QA 4D2RA 4XEYA 4BFMA 1JOWB 3OT3A 4FKIA 4QP4A 3R8VA 1P14A 5EQEA 2X2LA 1ATPE 2X8EA 4GT4A 2ERKA 4PRJA 3D0EA 3UZRA 3FXWA 2RGPA 4NT4A 3P23A 3IGGA 4QPAA 3W32A 4CEGA 4H58A 3PA3A 4BYJA 2F7EE 5I9UA 3A7FA 4C3RA 2W17A 4L45A 1ZLTA 2RKUA 4YJOA 1EH4A 3M1SA 3SV0A 1Q4LA 3EN7A 4FSMA 2PVJA 2A19B 2ZAZA 2J0LA 2VWVA 5BVDA 3DOGA 3P0MA 3NR9A 4KD1A 3ZFMA 3WE4A 3HEGA 3RCJA 5IMXA 4EYJA 4UBAA 4FNYA 3DXNA 3TNHA 5AAEA 3A61A 4NU1A 4ZXTA 4I20A 2F7XE 3VRZA 4Z16A 3PLSA 4AZEA 4QQJA 3BV2A 3BKBA 4FTAA 4LGDA 3BRBA 4BDIA 4I94A 3OCTA 3QCQA 1HCLA 4MXXA 4Z55A 2X4ZA 4IAKA 2PVFA 2X7OA 2JD5A 4PNKA 4BYIA 1KOAA 4RIWB 2PY3A 3OWLA 3QTZA 3FXXA 3OWPA 4UXLA 3V04A 4FTTA 4EORA 4AA0A 5HX8A 1MUOA 5AP1A 5DN3A 3KRWA 4FG7A 2UVYA 2PTKA 3H3CA 4WG3A 4R78A 2BALA 4II5A 1P5EA 4DFXE 4DCAA 3PXYA 3DCVA 5A6NA 2OJFE 2C5VA 4JBQA 4YHFA 3UIMA 1ZYCA 2VUWA 2ZMCA 3MH3A 3DFAA 3OWKA 3UJGA 2QURA 1OB3A 5ETAA 2C1AA 3QXPA 3FWQA 5FWKK 2Y4PA 4CG8A 3ULZA 3DKCA 2C47A 4IB0A 3FC2A 2W4JA 4ENYA 3ALOA 2ITWA 4UYNA 4DYMA 4AWIA 3VQUA 5FRIA 3DTWA 4PTGA 3RK9A 3SKCA 3QC9A 1JSVA 5AR5A 4F9AA 3PTGA 1T46A 4QD6A 2LGCA 2I0VA 3DGKA 4W4YA 2WXVA 1XBBA 3GC7A 4O82A 3FKNA 5CEOA 5AUYA 2BRGA 5AP2A 3F7WA 5EYKA 2BFXA 4G2FA 2YM5A 3F3TA 5AMNA 4MXOA 1ZYSA 2QKRA 3TNPC 2P4IA 1OPJA 5K9IA 2FUMA 3DDPA 5EQYA 4CGAA 4K33A 4RA5A 1OIUA 4TYHB 2UZUE 4ZTLA 1H4LA 2V62A 1BYGA 3RK5A 1UNLA 1ZOEA 4X21A 2QC6A 2XKFA 2XYNA 4KS8A 4FSNA 4LOOA 5GJDA 4G5JA 1FVRA 3UTOA 4O1OA 3RNYA 4M84A 5EDPA 2ITNA 2Y9QA 3DLSA 4DGNA 4BDBA 3EOCA 4Y83A 4D4RA 3KN6A 4GS6A 1ZMVA 2YERA 3Q9ZA 1YXSA 3HMPA 3ZC6A 3FMHA 5B2LA 2QO9A 5HO7A 4WA9A 3BYMA 1JSUA 3W1FA 4E4LA 2C6KA 2JEDA 5KBRA 3AMYA 5HNGA 3RPYA 3UVPA 3HDMA 4D55A 4JNWA 3AC5A 4TYGA 3WZDA 3I79A 5J5TA 4CZYB 3EN6A 1OMWA 2DUVA 3NVKI 1RQQA 3O8TA 4H3QA 3ZFYA 3ZMMA 2YCQA 3MVJA 1YWRA 2KULA 3MYGA 4PDYA 3FEGA 3PPJA 4TWPA 3VWAA 3TV4A 2UZLA 4F6SA 5BVNA 3FXZA 4HPTE 1WZYA 2J4ZA 4I1ZA 3AQVA 3FLZA 4E4XA 1BUHA 4IHPA 4GG5A 4AOJA 3W16A 4NTTA 3C4FA 3FKLA 3GU8A 5E90A 3REPA 4BTJA 1XR1A 3FZSA 4DTKA 4ANSA 1ZY5A 2JBOA 4K1BA 3L9MA 3C4XA 1YDSE 3MV5A 3ACJA 4GFGA 2QODA 4FTJA 5AR3A 1UWHA 3OZ6A 3PSBA 3AC8A 3UOLA 2PL0A 4MKCA 3IW8A 2GNJA 3DK6A 3ZDIA 2O0UA 4N70A 4PMPA 2EB3A 3PJ8A 3DJ7A 3TZ7A 1REKA 3PXZA 3IS5A 3QTSA 4ZIMA 4BC6A 5GINE 3SLSA 3Q2JA 2XIZA 4LGHA 4IB3A 1NVRA 4IIRA 3ZC5A 2G15A 2W1IA 2XIXA 5BVFA 2W1CA 2BAJA 4U79A 4UZDA 5FM3A 4E93A 2EUFB 1SMHA 4KSQA 3LCOA 4CKRA 4RT7A 4DLJA 5EW8A 4UV0A 3VRYA 3CQUA 2HZ4A 5KMLA 1WMKA 3KCFA 4N6YA 4B9DA 4O7VA 4ZTHA 4L67A 3K54A 5D10A 3PJCA 4CCUA 3I1AA 2ZDTA 2PZYA 2UW9A 3OY3A 4DE4A 1ZMUA 1VR2A 4NZWB 2F49A 2W0JA 2I0HA 3MTFA 3U8WA 4F7SA 3FL4A 5JQ8A 4FF8A 4UMUA 1IAHA 2IZSA 4D5KA 3R1NA 5FTOA 3UMXA 3FZ1A 1JKKA 5I9VA 2XNMA 4FEQA 2C5YA 4BGHA 1YDRE 3DZOA 3EFWA 5CEPA 4C34A 2HZ0A 4S33A 4E73A 5HG7A 1OIRA 1U54A 2HOGA 2HXLA 3G5DA 5ACBC 3HV5A 4NKSA 3OUNB 3THBA 3LCSA 2OF2A 3W8QA 4BCJA 4C4JA 3AG9A 4CV9A 2F4JA 4FGBA 4H05A 1JKLA 5DT4A 3LKMA 4U41A 2HY81 5C8MA 4GVAA 4S34A 5CNNA 5LVLA 3FJQE 3PWYA 4NTSA 2WQEA 3F69A 3KXMA 3O8PA 3TI1A 3UNKA 4FTRA 1BI8A 3BLHA 5L3AA 4JRVA 4DFUA 3SVVA 4FKTA 4ZLOA 1Q61A 2G2FA 4S2ZA 4OTRA 3BU3A 1ND4A 4GRBA 2PZPA 1Q8WA 4HYHA 4AN3A 3QRTA 4TXCA 1OPKA 5AV0A 3UPXA 3VUHA 3Q96A 2YDIA 1J3HA 3KMWA 4BB4A 4RLKA 1KV2A 1ZZLA 4DGLC 5HTIA 5IQFA 4MD7E 4XRLA 4GFOA 4WIHA 2P3GX 3DBEA 4QQ5A 4RBLA 4D1XA 4IX6A 4UX9A 4L00A 4G3DA 3DS6A 4XUFA 3A62A 1XKKA 4YZNA 4FTNA 2QR7A 4PL3A 2GHGA 3V8WA 4PQNA 4KBAA 2ZMDA 3I5ZA 4U3ZA 3QGWA 4K9YA 4U5JA 4YMJA 2PZ5A 2OZOA 4YJPA 5CVFA 4P4CA 5HCXA 2PZIA 5HE1A 1KUTA 4FTCA 2XRWA 3AC3A 1UNHA 4AS0A 2CMWA 4C0TA 3NCZA 3UZPA 4YLLA 5F9EA 3R7YA 3EB0A 2R64A 4KKHA 2B9JA 4TT7A 4AW0A 3E8EA 4C2WA 4ANBA 2C0IA 4NFNA 3ZHPC 4OLIA 1VYZA 4O6LA 5JH6A 5DH3A 5IEVA 4MNEA 5DR9A 4BHZA 2OBJA 5CI6A 3OXTA 3ORLA 5JRQA 4O21A 3C0HA 4KBKA 4AZSA 2R3LA 4EH2A 3HYHA 4EOPA 5M44A 4JR7A 2HWOA 4IAIA 4K8AA 3PP1A 3FMJA 2B4SB 1H07A 2PVRA 2YM4A 1M17A 2OK1A 4IDTA 4NW5A 4OBQA 1NW1A 4RX7A 4CFWA 2YJRA 1Y8GA 4Z3VA 2CNVA 3C9WA 4D2PA 1ZARA 2GTMA 4QOXA 2VGOA 4DITA 5M55A 4FR4A 2XVDA 5IQBA 3VHKA 4FMQA 4E8AA 4RWKA 2YLFA 3QQLA 2XNOA 5ANJA 2C0TA 3DFCB 5FD2A 4E4MA 4GV1A 2C4GA 4RA4A 5DPVA 1IEPA 3C1XA 4BTFA 2J51A 3PWDA 5IA1A 2RFSA 5CEMA 1X8BA 3O7LB 5EM7A 3NVMB 1W83A 2V0DA 2CCHA 2WNTA 4YJNA 4ZSAA 1CSNA 4IX5A 4MWHA 5AIRA 3O50A 4CT1A 5JN2A 2UZEA 1Q8YA 3KXGA 5CEQA 4BDGA 2WPAA 4D4VA 3OEZA 3VJOA 1WBSA 3NGAA 5FP5A 2YABA 3AD6A 2XK8A 2IWIA 4LL0A 3MS9A 4V05A 2J6MA 2GS6A 1YHVA 3EQBA 3G15A 3MFUA 4M69B 3RGFA 1H1RA 1QPEA 1Z5MA 3K3IA 2VX3A 4IDVA 2VO7A 4JIAA 3JR1A 5BMSA 4AN9A 5IDPA 3N4TA 4XS2A 4A9TA 5HG9A 2JBPA 2QQ7A 3ZO2A 3I6UA 4C7TA 4KAOA 3ZEWA 2IZTA 2W4KA 3UG2A 3FY0A 2F7ZE 1GJOA 5DIAA 4QP9A 5IDNA 4JBPA 3F6XA 2IVSA 1JBPE 3WIGA 2PWLA 1LUFA 4YLKA 4AOTA 4FSYA 4RX5A 4D2SA 5AUVA 2X9EA 2BZKB 3MH0A 4JQEA 5KMMA 3U9NA 2CHLA 1PJKA 4RJ4A 5CY3A 4IB5A 2UW7A 4UZHA 3SA0A 2ZB0A 5J8IA 2RFEA 1H27A 2OFUA 4AFEA 4QP8A 1U54B 4KABA 5CF6A 3QCXA 5IF1A 5FXSA 1U5QA 2R5TA 3IG7A 4Z7HA 4AE6A 3TV6A 3V5PA 3A8XA 2O65A 4RZWA 4PV0A 1XWSA 1OECA 4ZTRA 5TE0A 4C8BA 1YHWA 4TWOA 3U54A 3PJ1A 3CEKA 4EOLA 4OR5A 5HBJA 1OL5A 4I21A 2RL5A 2AYPA 3LOKA 4LOPA 4R8QA 4WSYA 2GFSA 4BDJA 3E7OA 5GJGA 1QL6A 2ZV9A 3W2PA 4F70A 1JNKA 2XK9A 3RJCA 2IG7A 1I09A 4O0SA 3P08A 3F3VA 4GMYA 4OTWA 1Q41A 2VN9A 2P2HA 4AQCA 1FGIA 4IAZA 4R3CA 4D9UA 1L8TA 1LEWA 2YCRA 4F0IA 2WOUA 1K9AA 2QI8A 1OIQA 3MDYA 3F5UA 2RF9A 2YIYA 4YC8A 5HIBA 4O2ZA 5G1XA 1ERKA 2I40A 2I0EA 3KVWA 3QLGA 1NXKA 3PE2A 3OCBA 3TUCA 2OGVA 4FVQA 3MY5A 4GL9A 2EXEA 3HV6A 4EH5A 5KE0A 2X1NA 4ALWA 4EJ7A 1FMKA 3CD8A 4R77A 4UWBA 2WTVA 4GEOA 4DH7A 5A9UA 4L44A 4IC8A 1H26A 2EXMA 5E8ZA 3ZRLA 4L3LA 4MXAA 5AUXA 4GU6A 3A7JA 4FC0A 3ZCLA 3ZXTA 3LMIA 2HZNA 2A4LA 4MNEB 3NEWA 4DHFA 4FYNA 2ZM3A 1V1KA 1OKZA 3JPVA 2YM8A 3MH1A 3VBXA 3KRLA 3V01A 3BPRA 4R5YA 5BYYA 3FMKA 5CT0A 4BCNA 4QP6A 4EKLA 1PXPA 5HD4A 4U43A 5AV4A 4FV7A 2WMWA 4E6DA 4EOIA 5AA8A 5LWMA 3QUDA 3BU5A 4OTDA 2IVVA 2WKMA 3EN5A 3IDPA 5CSWA 5C8KA 1PRYA 5J79A 5L8LA 4FIHA 2GSFA 3KK9A 4PPAA 1KE5A 4QQCA 2ZV2A 3UNJA 4HGEA 3FLSA 1QPJA 2HY0A 3C4WA 4A07A 2IPXA 3RHXA 4K77A 4M7IA 4TY1A 4LI5A 3WOWA 4ZZOA 2YM6A 4QYEA 4XG6A 4U8ZA 3OTUA 2DWBA 3KF4A 3DA6A 2R7IA 1WVXA 2B55A 3I7CA 3KMUA 3LCKA 1OUYA 2VGPA 4L46A 3NYXA 3QWKA 3Q5ZA 4DF3A 2WMRA 4U42A 3ZBXA 4BIEA 2XA4A 2PVLA 4ZJJA 4DFYA 2WZJA 2OSCA 3V6RA 3GCPA 3LXPA 5AR8A 3R8ZA 2CNUA 2VWZA 3FDNA 2C6IA 1JVPP 3GQIA 4HNFA 3O23A 4LV5A 3UP2A 1KSWA 2XZSA 1DM2A 2UW3A 4AE9A 4PMSA 4CTCA 4D58A 5GZ8A 4MF0A 1GY3A 3QCYA 5C4KA 4FZFB 5IEXA 3SGCA 1APME 5DGZA 5F1ZA 1Q97A 2PK9A 4QO9A 4GKHA 5CVGA 1YKRA 3AC1A 2X0GA 4I5PA 3WARA 4B8LA 1WAKA 4IANA 3EYGA 2QONA 3HP2A 4FT7A 3KU2A 3QCSA 5IQIA 3CGFA 4MK0A 3ZO3A 1KE7A 1AD5A 1URWA 5AP3A 3ZUTA 3PSCA 5JT2A 3VS2A 3SD0A 5I3OA 4YUQA 5CXZA 5IEYA 3NWWA 4JQ7A 4RSSA 2WQBA 2VTHA 2XJ2A 1H1SA 4FV4A 4J8NA 3ZLSA 1KWPA 3DBCA 5CTPA 4BGQA 5IA0A 5ANIA 1WBWA 1OKVA 1O6KA 4AZWA 2BRMA 4YHJA 5CSPA 5GJFA 2AUHA 4CMOA 5JKGA 4X6RA 4BR3A 2JIIA 3MY1A 1TQPA 4WNPA 3WZEA 3MPTA 4OBOA 4KS7A 1DAYA 4X7QA 4FT0A 3SAYA 4IADA 2B9IA 3HX4A 2VO6A 3PY1A 1QPDA 4ZSJA 3FL5A 4FX3A 1A06A 4CFUA 3GT8A 2P0CA 5DR6A 4FL3A 4ZK5A 2J0MB 1GOLA 4HOKA 4I5MA 5EM8A 5BMMA 3NIZA 4W9XA 5M08A 4ZTSA 5CAOA 3P7CA 2XNBA 4S30A 2YISA 4M12A 4BDEA 4V04A 5HEZA 5IA2A 4ITIA 1WVWA 3TTJA 3R7UA 4EL9A 3ODZX 2ETRA 3LCDA 4L53A 4A9SA 4V01A 5CALA 3U87A 3U6JA 3QD3A 2OJ9A 3FQEA 3FQSA 4C57A 4I4FA 3U51A 2GHMA 1F0QA 5KHWA 4NM0A 3RMFA 3ORIA 3PA5A 1PXMA 2RFNA 4M68A 3DTCA 4MCVA 1GZOA 4FT5A 1KOBA 3ZLWA 4S32A 3DDQA 4IWQA 5LMKA 1NT2A 1B38A 2ZVAA 3V5LA 1JWHA 5EG3A 4F1TA 1FPUA 1SVHA 4I3ZA 2WFYA 5C4LA 2UZNA 5L4QA 4ZMFA 3MVMA 4AX8A 3QX2A 4XBRA 3ZEPA 2G2HA 4QPSA 5DWRA 2B54A 3IW4A 5H9BA 4BCKA 1QCFA 1PW2A 3NUYA 2PE1A 4AW2A 2VTJA 5A6OA 1OI9A 1RW8A 2Z60A 3Q6WA 4EK8A 4AG8A 2F57A 3OOMA 4RVLA 3O0GA 2W1ZA 4F09A 1H00A 3RVGA 2W99B 3D7TB 4OAUC 2BCJA 5HU3A 4KIOA 3Q4CA 1PXKA 2BHHA 5E8XA 1Q8TA 3MW1A 4JT3A 2CKQA 3BV3A 2OLCA 3T8OA 4RC4A 3M11A 3IPHA 5IA3A 4U0IA 4MQ2A 4GIIA 3I7BA 4LRJA 4C59A 3CTHA 3TIYA 4FICA 3L8VA 2BAQA 1ZMWA 4BDKA 3OFMA 3BHUA 4LL5A 5DRBA 2FB8A 3FLWA 3U9CA 1UA2A 5CU2A 5LVOA 3D2KA 4W4XA 2QVSE 2FGIA 3G51A 4J7BA 5CQWA 2IW6A 3SG8A 3A4PA 2VD5A 3EH9A 1VYWA 3ZSHA 5GIOE 1V0PA 1J7UA 1YRPA 3AC4A 3IW6A 2J5FA 3OVVA 5JK3A 3ZS5A 4U3YA 5HU9A 4GKIA 5C9CA 3BHYA 4EKKA 3R2BA 5I4NA 4GSBA 5B2MA 2W7XA 4FV0A 4QTDA 4ZJIA 4W8EA 2WGJA 4YBJA 3O7LD 3DXPA 2P33A 5BQ0A 3R04A 4O22A 1CKIA 3BZ3A 3UO6A 3VS5A 3VUIA 2JDSA 4B7TA 4DFNA 3TG1A 5LCJA 5BX0A 1ZOHA 1XHAA 1QPCA 2BVAA 2G9XA 4EJNA 4JX7A 2EB2A 4FSWA 2PUPA 4O0TA 2O63A 2JDOA 1OKWA 1YWVA 2PE0A 2XMYA 4FTKA 3DT1A 4KWPA 4WT6A 5L8JA 3RAKA 4ZTMA 4FTQA 4YGAA 5BPYA 3ZTXA 2FSTX 4EI4A 5LVNA 2CDZA 5CSHA 5AR4A 3MVLA 3QTXA 2VTMA 1MRYA 2BTSA 4Y95A 5M4CA 5H8EA 3ENHA 4ZP5A 2XB7A 5K5NA 2YCFA 5HO6A 1BLXA 3OBGA 2HELA 3VS4A 5CAVA 5FLFA 3V5QA 3OROA 4J96A 2ITXA 3POOA 1M7QA 4FKOA 5AX3A 5A3XA 3UNZA 4BCPA 3DY7A 2FYSA 5JRSA 5E1SA 2WMBA 1XH7A 3F82A 3MI9A 5EYCA 2PUNA 3ZFXA 1MQBA 4YZDA 1GZ8A 3DK7A 1XH8A 2JIVA 3PRIA 1CKJA 5IA4A 3NUAA 4IJPA 4CFFA 4RVMA 3LFQA 2BRHA 3KMMA 3QKKA 3DQXA 3PFQA 4UMTA 3QRJA 5AM7A 5FEEA 2J0JA 4RC3A 4DH1A 3TDVA 5LMKC 3BE9A 3UC3A 1P4FA 4I24A 4RZVA 4B8MA 4FZDB 2BIKB 2W5AA 3B8RA 4TWCA 2J9MA 2WU6A 4FTUA 5A4QA 5AP0A 4CFMA 4EHVA 2W06A 3KB7A 4TRLA 3QU0A 5CU3A 2XEZA 3ZZWA 2V7AA 5AR2A 1NVSA 2OIBA 4JG6A 1O6LA 4L9IA 4EBVA 3E63A 1ZWSA 2J2IB 3AD4A 3I0QA 2WMQA 2ZOQA 4PX6A 4BDAA 4I6QA 3KEXA 2QU5A 3HNGA 4RIOA 5JMSA 3HRBA 2VTPA 4QMOA 4FTIA 4HVDA 4BBFA 5AJQA 1MQ4A 2YIXA 3D94A 4M0YA 2R2PA 3T3VA 3LZBA 4L7FA 3E5AA 2AC5A 4Q9ZA 3DPKA 5LVPA 2FVDA 5FXRA 1LR4A 4PF4A 4FIIA 4F6UA 4O0VA 1PYXA 2R3FA 5C1QB 4N57A 1YVJA 3Q9XA 4QRCA 3SW4A 5FXQA 4E7WA 3E3PA 3G9LX 4DG3E 3UBDA 2O8YA 3LJ0A 3FSFA 3K2LA 3G33A 3LPBA 3PIXA 4V0GA 4BTMA 3ORTA 5J9LA 2UVZA 4E1ZA 3R30A 3WBLA 4IZYA 4CMUA 2WU7A 4FVRA 4W8DA 3OXZA 4HGTA 1SM2A 2GS2A 4KIKA 2B7AA 3LFAA 4QMTA 3E88A 4QP7A 3T9IA 3R7OA 1PMNA 2G01A 4JIKA 2QOHA 5B0XA 3UDBA 1B6CB 3ZDUA 5HE2A 4NK9A 3VBYA 4M14A 4EOMA 2RG6A 2XKCA 3EQIA 4OUCA 4F64A 5C27A 5BVOA 3ROCA 3VBTA 3HMIA 2QOOA 4IXPA 3CPCA 5HVJA 2GCDA 4AP7A 4FA2A 5K4JA 3OT8A 4L8MA 4HW7A 4QNYA 3EQCA 4DFLA 4EC8A 4EOKA 4F65A 5JFVA 1XH4A 4OGRA 2NP8A 2WTDA 4ZTQA 4X0MA 4IBMA 5GZ9A 4LRMA 1Y6AA 5HBHA 1OL6A 3OOGA 4YTHA 2JFLA 2C69A 4RX9A 3CKWA 3LMGA 1WBNA 3RP9A 4DTBA 5LWNA 4YO6A 2UW4A 1URCA 4PL4A 4FOBA 4A4OA 4EQUA 5A4TA 5M4FA 5AUTA 4IZAA 2YCSA 3F3WA 1MP8A 2CPKE 1CM8A 1Y8YA 3MN3A 5FDXA 3LXNA 5KMNA 4RRVA 4E6CA 4DN5A 4U40A 3ORZA 4YO4A 5DA3A 3WF5A 5M56A 2BROA 2WQNA 1OL7A 3BGQA 3CLYA 4EQMA 3MA6A 5J7BA 1ZRZA 4CT2A 4BDFA 5L2TA 4BBEA 1PY5A 2CJMA 3QFVA 1PXLA 4A7CA 2ITPA 2PVYA 4ERKA 4OTFA 2QG5A 3NW5A 1IASA 4P5QA 5DYJA 3P1AA 3KGAA 5E8UA 4WUNA 3QUEA 1M2RA 4PPBA 4RJ7A 4F99A 3KL8A 1BL7A 3AT3A 2VWBA 4RMZA 4BCQA 1STCE 2F9GA 2UZVA 4L3PA 4OTHA 4XMOA 1UV5A 3O2MA 3GFEA 4FKGA 3C13A 3EHAA 3QUPA 1KE8A 2QLQA 4TPTA 3IO7A 5EHOA 2UZDA 4G1WA 2XUUA 3FHRA 3NUSA 5JFWA 4X2KA 3FMEA 2XCKA 4NSTA 4M69A 4K11A 3GBZA 3R9DA 3BYSA 3NDMA 4KINA 4B6LA 1OUKA 3VULA 5BUJA 4MAOA 2B9HA 2HW7A 2XKDA 2YJSA 2Z8CA 3FMLA 3S3IA 2YDKA 3HMOA 2I6LA 4XG8A 2QOBA 5FQDC 3MIYA 4FYOA 3VN9A 3A8WA 3D5XA 4BIBA 3C4ZA 4I5HA 5I9WA 2GPHA 3GCVA 3LM0A 5HD7A 3ZXZA 4DH8A 4F7LA 3R7GA 2VTLA 1U5RA 2X4FA 3V3VA 3MTLA 3CQWA 1PMVA 3GU7A 5L2IA 4HNIA 4ARKA 4IX3A 3L1SA 3OW4A 4R3PA 4FK6A 3ERKA 4XH6A 3NYNA 1GIHA 2PUUA 5CWZA 4B0GA 4CV8A 4IC7A 3V8SA 2XNNA 3VS1A 4EWHA 2XKEA 1REJA 2Q0BA 3EFLA 4L52A 4O0WA 4OT5A 4QMXA 3L9NA 5CEIA 3ZRMA 4BWPA 4PMTA 3H30A 4F63A 2XM8A 4WG4A 4DGOA 5AUWA 5KMIA 1G8SA 4QMWA 2W1HA 2I1MA 3TKIA 5JSMA 1PXIA 2I0YA 3KXZA 4U45A 5HE0A 4HYUA 4L6QA 3GGFA 3RI1A 3DB6A 3ORXA 2NRYA 3ROYA 4EK3A 3KREA 2JITA 5LXMA 3Q53A 4V0GB 1E1VA 3DAJA 3R7VA 2ITOA 4BCGA 4FUYA 1TQIA 5HIEA 4KIKB 4IAAA 4TL0A 4G17A 2WMTA 2PHKA 2ITVA 3RWPA 5LOHA 1YXUA 4HVHA 2YWPA 4F9CA 4YU2A 2PYWA 2HENA 5JEBA 2J50A 5E1EA 3S00A 3FLQA 5D11A 2R3NA 3HRCA 1ZYJA 3MH2A 2OICA 1CKPA 2WMAA 2ZM1A 2Z2WA 1R1WA 4Y8DA 2QLUA 1K2PA 4YHTA 4UWYA 1YXXA 4O1PA 5FGKA 4I6FA 3JVRA 3TKUA 5GZAA 5HORA 5DR2A 4CMTA 4C33A 2A27A 4F0GA 4CG9A 4P7EA 3HECA 5JFXA 4GVJA 3NPCA 4QMNA 4G6LA 1W7HA 3FZOA 4IEBA 2CGWA 4CYJA 3OCGA 4ZAUA 3PXRA 4CKJA 1WCCA 4FEXA 3FV8A 2VU3A 3II5A 4JS8A 4Q2AA 4ORKA 3LIJA 4I0TA 3PVBA 4XP3A 5AWMA 4CQGA 2XNPA 4CCBA 5M06A 5HLPA 2C5XA 2VTSA 3CTJA 3FE3A 4ANMA 3HA8A 4QYGA 2PUIA 4MF1A 1DI8A 3N51A 1P2AA 4IVDA 4UB7A 4WBBB 4FKWA 1YOLA 3CY3A 4IVBA 4IB1A 4GU9A 4RVTA 1RJBA 2BTRA 3ANRA 4IVCA 5AAGA 3VNTA 3U55A 4FZAB 4S31A 5ETCA 4WRSA 1J1BA 3MA3A 3QYWA 1PMUA 3QZFA 5DT3A 5J1VA 1FGKA 5EDQA 3GUBA 1OL1A 3DJ6A 4ALUA 4F4PA 2OH4A 5E8WA 5C8NA 4YJUA 3NUXA 4OBPA 1YI3A 5L2WA 1PXNA 3L9PA 3RM6A 4F9WA 3Q4TA 2DYLA 3IOKA 4KKGA 2BAKA 3Q4UA 3W18A 2QOFA 1UNGA 1CDKA 3BLQA 3QD0A 2YAAA 4GG7A 2PMIA 4NH1A 5H8BA 3S2PA 4EK6A 4C58A 3VS6A 5J87A 3PYYA 2V22A 3A60A 3OEFX 2WAJA 3QRUA 5IH5A 1DS5A 2Z7LA 1U46A 4YJTA 3G6HA 2VX1A 1J1CA 5IPJA 3MY0A 4DFZE 3VO3A 2ERZE 4IACA 5M09A 1J7IA 4L68A 5LVMA 2BDWA 4G3CA 4BRXA 2CGVA 4D28A 2IZRA 4O0XA 4EYMA 3W2SA 4MBLA 4XYFA 4MBIA 4RG0A 4R1YA 4I22A 3Q32A 3KN5A 3QD2B 1YI6A 5HE3A 5J95A 3TWJA 4C61A 4F1MA 3SG9A 4JBOA 3RHKA 2FO0A 4O0RA 2ZYBA 3LFFA 4APCA 3IGOA 2NO3A 3D5VA 4XG3A 3CTQA 3QF9A 4NKAA 2XK4A 4QMZA 5DOSA 3NUUA 4F7JA 2JDTA 3SW7A 2ITQA 1YXTA 4C62A 2HIWA 2VV9A 4K2RA 2EVAA 3G9NA 5M07A 4DLIA 3ZUUA 1OL2A 3HMMA 3DBDA 4JG7A 4CFXA 5CU0A 1Y6BA 3WF6A 4USDA 2B0QA 3F5PA 2O3PA 3D83A 1MRUA 4N4SA 3NS9A 4TNDA 4C4HA 4HGSA 5JZJA 4D2VA 3ORPA 4BZNA 3MIAA 4GK3A 3OY1A 1TKIA 1J91A 2OI4X 2X8DA 1T45A 5H2UA 4O81A 4DG2E 1F5QA 5A54A 5HZNA 4FKQA 3TM0A 2BRNA 2VTAA 4IQ6A 3VUTA 2R3OA 2E9UA 3AXWA 2PVMA 1O9UA 1SNUA 3DBQA 3F2NA 2CGUA 3UVRA 4R6VA 5E8SA 2Z7QA 4GT3A 4Y72A 3EQGA 4O0UA 4CVAA 3AGMA 5IUIA 4RWIA 3UQFA 4WO5A 2YDJA 3ODYX 2UZBA 1AGWA 2X2MA 4C3PA 5CZHA 5DRDA 4E26A 4O7LA 2R3JA 4QYFA 4C02A 3R6XA 4AZVA 1XBCA 4XNEA 3G6GA 3DBFA 4Q9SA 3W2OA 5A4LA 4EONA 5IG1A 4UN0C 2HK5A 3IQ7A 4AOIA 4O7YA 2XF0A 4KIPA 3UO5A 2VWWA 3HV7A 2UZWE 2G1TA 5L6PA 2CLQA 1OKYA 3UMWA 5L2QA 4D4SA 3RNIA 4FT9A 4XOYA 3QA8A 4FEWA 4ZOGA 3JY0A 3MVHA 1H1PA 2LAVA 3NNUA 2QOCA 4FK3A 4D1ZA 3W55A 1VZOA 2QOQA 4XP0A 3UIXA 4MVFA 3FY2A 5HTBA 1WBOA 3A7HA 3EQDA 5HOAA 4ASXA 3LFCA 2C3LA 2VWUA 2YIWA 3PXFA 3R2YA 4JVGA 4A4LA 5CAUA 2YWVA 1H01A 3QBNA 5EOLA 4BL1A 4DH5A 4O7RA 5KMJA 1ZYDA 3GENA 3EKKA 1O6YA 2GDOA 3PJ3A 3QAME 4YJSA 3EZVA 4JDKA 3R0TA 4FVPA 3L8SA 4BBMA 2PPQA 3DKOA 5J7HA 3OMVA 1UKHA 2OH0E 5CLPA 3AOXA 3FC1X 3KULB 4GUEA 4MXZA 3EIDA 4ZY6A 5CF8A 2BFYA 1R3CA 3K3JA 4PMMA 3FPMA 4MX9A 4ANOA 2PMLX 4KRDA 2YITA 2ONLA 4O91A 3ZO4A 3QL8A 2H6DA 4PTEA 1OGUA 4FIFA 4KB8A 5IA5A 5CX9A 3D7TA 3I4BA 5D41A 5LCKA 5BUIA 2IW9A 2B52A 4RFZA 3GEQA 3LVPA 5DE2A 4AW1A 5KCVA 4QPMA 3DKFA 2QO2A 3JUHA 2OJJA 5IUHA 4XG9A 1LPUA 3G90X 2XK3A 4GH2A 2XRUA 3NRMA 1RE8A 2RSVA 2QOKA 3L9LA 4IFGA 2GFCA 3Q2MA 5HNBA 5JGBA 2R3RA 3ZM9A 5M4IA 4TTHB 5KO1A 2ZB1A 4D9TA 3O71A 5EHYA 5GIPE 1UU7A 5AV1A 3HL7A 4ZLYA 3UOHA 3LE6A 3D15A 1R39A 4RJ8A 4KSPA 3JVSA 2UW8A 3E3BX 4RIXA 1P4OA 3UQGA 3IONA 1FVTA 2JIUA 5E91A 3MWUA 5LMBA 4LFIA 3TTIA 1G5SA 4JR3A 3Q3BA 3KF7A 4HPUE 4ERWA 3IDBA 5CI7A 3DNDA 2XIKA 5D7AA 4ANNA 4M13A 5EI2A 2NPQA 5JFSA 2J5EA 1WBTA 5CF5A 3KFAA 4KA3A 5HHWA 2PMNX 3QQHA 4YLJA 4RQKA 4UMRA 4CLJA 5J9YA 3FSKA 4C2VA 3Q52A 2HZIA 2DS1A 1YW2A 4USFA 4AGDA 2O2UA 5IISA 2Z02A 2C1BA 5FEDA 3CIKA 4XBUA 1Q62A 5FP6A 1FBNA 4M67A 5EM5A 2ESMA 2W1GA 4CSVA 1H1WA 5AV2A 2C3KA 4FODA 4XOZA 2BKKA 4FT3A 4GJ3A 2XIRA 2SRCA 5IQAA 3QGYA 2C0OA 2ETKA 3F61A 4TYIA 5CANA 4ZZMA 1XJDA 3PZHA 4FG8A 4Y73A 5G6VA 5KX8A 1BI7A 4YJRA 4YZMA 3BELA 4HJOA 4M8TA 1KV1A 2XM9A 2XP2A 1SVEA 1JSTA 2E9OA 3F88A 1GIJA 3W2RA 1G8AA 3N4VA 4D2TA 4WSQA 5AADA 1RDQE 3GNIB 3R9HA 3I0OA 3FMDA 4FSUA 4FV2A 4BCFA 3FZTA 1PHKA 2BR1A 4FBXA 3RKBA 5LMAA 4P90A 3PVUA 5ANGA 4AFJA 3DV3A 3HDNA 4U9AA 5ICPA 2XBAA 4BCHA 2P2IA 1B39A 3R22A 4WHZA 4KKEA 4AACA 4OTGA 3F66A 3FQHA 3LM5A 5EI8A 2R3PA 1IAJA 2R3GA 4RPVA 4USEA 5DT0A 2CKPA 3DZQA 3QX4A 2GNGA 4NCTC 4RVKA 4IX4A 3CC6A 3QC4A 4I4EA 2WMXA 2X7FA 2HCKA 4RWJA 3R71A 3D7ZA 5IKWA 3QWJA 5E8VA 3BBTB 2RIOA 2VWXA 1YXVA 2OIQA 1UWJA 2REIA 4I41A 3TNIA 4EOJA 4J98A 2CGXA 4FV8A 4NM5A 3LFEA 3O8UA 4ACHA 1JKSA 4IM3A 4CKIA 2VTOA 1FMOE 2J90A 2QNJA 2R7BA 2W5HA 2OZAA 1WVYA 4EEVA 4O6EA 2ONLC 2E2BA 3ORNA 3C50A 2C3JA 4JLCA 3S0OA 4JAJA 2H9VA 2Z7SA 3QQGA 1IRKA 4FKJA 2WOTA 3BYOA 5AEPA 3GCQA 1CTPE 2WMSA 3FI3A 5E9EA 2X81A 2ITUA 3E8DA 4U6RA 5AR7A 3KRRA 4A9YA 3UZTA 3PDTA 4Z9LA 1DI9A 3HVCA 4X2GA 4ANQA 3O51A 3KXHA 3HZTA 5CSVA 2YA9A 4J1RA 5H3QA 4F9YA 3QTRA 2VNYA 4C3FA 4JDIA 4L01A 5CU4A 3VUGA 4BKZA 3GCSA 5M4UA 5IQCA 3TV7A 3CS9A 4OW8A 4CYIA 3PY0A 3GC9A 2ITYA 3KRJA 4AU8A 2IW8A 4FEUA 5DI1A 4MXCA 4PDPA 4YZCA 4YPDA 5FBNC 2O5KA 5AA9A 4BCIA 3OHTA 4QP2A 3VS7A 4BDCA 5I9YA 4BICA 2QKWB 3H9FA 4TNBA 1OITA 2WTWA 2X8IA 3ZONA 4ZS4A 4QTEA 5EQPA 4FKLA 4R7IA 4FNXA 5J1WA 3PG3A 1JKTA 4W4WA 1R0PA 2Y6OA 3TZ9A 1S9IA 2V7OA 4PUZA 1XQZA 3RZFA 2JAVA 4XG2A 4YBKA 3MBLA 4CRSA 3ZRKA 4DEIA 5DG5A 4F1OA 4HYIA 2R9SA 3R1SA 4PNIA 5E8TA 3ZU7A 1AQ1A 4BI0A 3EN9A 3F7ZA 1Q5KA 5HI2A 4GCJA 5KKRC 3PUPA 5HICA 3ZM4A 3IW5A 2J7TA 3GC0A 4FZ7A 2CNQA 4H3BA 2ZV7A 2AC3A 1A9UA 4CLIA 4ZLZA 4LM5A 4IJ9A 5DMZA 2IO6A 3F2RA 3RPVA 3R8MA 3N9XA 1HCKA 3FI2A 3R8LA 1IA9A 4RIXB 5FG8A 5HO8A 2GQGA 4KBCA 1R0EA 3NNXA 3NZ0A 4WNMA 4YC6A 5KMOA 5ANEA 4BY9E 3CR0A 4DEGA 2PVKA 3P7BA 3DAEA 4FE2A 4QMLA 3VW8A 3NMUF 1YI4A 3A7IA 4IVAA 4YC3A 4XLIA 5HKMA 2BRBA 4G16A 4MWIA 4IMYA 4EC9A 3BBWA 4NL0A 3OP5A 4HCTA 3SDJA 4AT3A 5DBXA 1U59A 4IWPA 4HVSA 3CKXA 5DEWA 3FYKX 4GK4A 3LQ3A 2GNLA 4X2NA 4O27B 3WF9A 5K0XA 3LHJA 3KKVA 4X2JA 3UOKA 5KKRB 2CLXA 3NYVA 1Y91A 3BEAA 4OTIA 4UWCA 3U4UA 3CJGA 3UO4A 4NM3A 4C4EA 2QOIA 3H10A 4XG7A 3P5KA 1Z57A 2VRXA 4UMQA 1XO2B 1YQJA 2VTTA 2ITTA 2YEXA 1I44A 3DKGA 3UIBA 2VZ6A 3UE4A 1JQHA 3OBJA 4AA4A 1IA8A 3GU6A 4U97A 5FTGA 5GHVA 4RX8A 4TN6A 2PVNA 5HX6A 3RK7A 3Q9WA 4G6OA 2WTCA 1H24A 4F7NA 5M51A 5KHXA 3BCEA 3QRIA 4DA5A 4Q5HA 5I5ZA 1IG1A 5M53A 4LUEA 2VWIA 5CU6A 5KNJA 3ITZA 3H9RA 3VBWA 3P4KA 5FTQA 4AUAA 3LXKA 2IN6A 4BWKA 5CAPA 4Y46A 1FQ1B 4J8MA 1GNGA 2PMOX 1BKXA 1CMKE 4YJVA 3LQ5A 3E8NA 4GUBA 4MYGA 4C36A 1OM1A 2IZUA 2V5QA 3AC2A 4LUDA 1H1QA 3VS3A 3WZUA 2GU8A 2OXDA 3GB2A 4ZSGA 4YTIA 4CXAA 3MFRA 2ETMA 5TO8A 3VBQA 4I92A 5HCZA 1NY3A 4MD9E 4EK5A 2OXXA 3UOJA 4DEAA 3CCNA 4NFMA 4LQMA 3VS0A 4E5AX 4X3FC 4NUSA 4L3JA 3JXWA 3QQJA 3BEGA 3NYOA 2OZAB 3E64A 2X9FA 2BUJA 4LOQA 5K3YA 2Z7RA 3GQLA 3MGYA 4L43A 5LJJA 2GMXA 2A2AA 1HOWA 4W4VA 4XV9A 1L3RE 3EL8A 4RIYA 4O7NA 3ATTA 4R3RA 1U4DA 4E5WA 3TUBA 3ACKA 4D5HA 3L8XA 4RJ5A 3ZOSA 2XJ0A 4N0SA 5IQEA 2XNEA 5EFQA 4ZJVA 4E6QA 4R5SA 4M0ZA 5DEYA 5K0KA 3ORMA 4GFMA 4CZUA 5L8KA 3RPOA 3SQQA 4UEUA 2CKOA 4NM7A 4QMPA 3R8PA 3VUMA 4G31A 3RPRA 2PZRA 5FEQA 2VNWA 4FV5A 3ULIA 4X3FB 3HP5A 1IR3A 2X39A 3HGKA 5FM2A 2XJ1A 2CN8A 1SZMA 3V8TA 3WYXA 3W33A 3FUPA 2OXYA 3P79A 4FSZA 5BNJA 3KXNA 2B53A 1M2PA 4C4IA 4NW6A 4O7TA 2OJIA 4RLLA 3UC4A 3VUKA 5J5SA 5HVKA 2YM7A 3MB7A 2ZDUA 2RFDA 3COIA 3R8UA 1Z9XA 3FLYA 4M66A 4FV3A 4I93A 3H9OA 3HLLA 5D9HA 2VTIA 4FKVA 2XEYA 4HVGA 1PKDA 4NWMA 5CYIA 2WQOA 1GZNA 4EH6A 4F08A 3KVXA 4M97A 5AX9A 4LG4A 3VW6A 1DAWA 2JLDA 4JOAA 3RBWA 4E5BA 4NJDA 5IZFA 4X3JA 3AMAA 2W4OA 3C7QA 3E8CA 2XBJA 3V5WA 4DAWA 4DINA 4YURA 4FV6A 4YNEA 1XH9A 3TKHA 4BDDA 3A2CA 4IM2A 5IH6A 4R7HA 5HLWA 4AAAA 3NSZA 5DLSA 4K6ZA 3CY2A 4QMSA 2YIRA 3RAWA 4DT9A 2EWAA 1JAMA 4G3GA 1PKGA 5CENA 3ZO1A 5JGAA 2YZAA 4FGRA 1E9HA 3LJ2A 4B99A 3WIKA 4JL9A 1TVOA 2GNFA 4D4YA 4IW0A 3GU4A 2OJGA 3EL7A 3COMA 3FYJX 4RC2A 2RG5A 2V55A 3MESA 4QMUA 4EHGA 4U80A 3OG7A 3WYYA 3NAYA 4C4GA 3MFSA 2HYYA 5HVYA 3HUCA 3UODA 3D5WA 3BHVA 3ZLXA 2ACXA 5HG5A 4MXYA 4Y5QA 4XP2A 5E4HA 3ENMA 5CNOA 3HV3A 3W8LA 3R21A 4EH9A 4ASZA 1UVRA 1YOJA 2E9PA 5F4NA 3C4EA 4GYGA 4IAFA 3WI6A 1A48A 2W5BA 3KQ7A 4EOSA 3VUDA 3V5JA 3BIZA 3R01A 5ETFA 3RAHA 3UQCA 3E92A 3PIYA 3Q4ZA 3OTVA 3OXIA 3HMNA 4H39A 2OO8X 2QO7A 1UKIA 4FSQA 4EUUA 3QQKA 3RM7A 3W2CA 3CGOA 3EQHA 3C0IA 3LMHA 2B9FA 3U6IA 3FMMA 1MRVA 5EHLA 4PWNA 4MH7A 4DEHA 5JQ5A 3E93A 4KNBA 3TL8A 4QNAA 4O38A 3AT2A 4O7ZA 4B4LA 4U44A 5AP6A 3LLAA 3SOCA 1ZOGA 4XG4A 4ZS0A 2PVHA 3DNEA 2BKZA 1UU3A 2QOLA 1Q3DA 3QRKA 3TJCA 1OVEA 5J9ZA 5EM6A 3Q6UA 4HZRA 4QMYA 3TN8A 4QMQA 4YP8A 3TZ8A 3D14A 3H0ZA 3VC4A 4D1SA 2WTJA 2GNIA 2WEVA 5AUZA 4YZBA 5EI6A 4BGGA 4ITHA 4JQ8A 1PYEA 5HNIX 3ET7A 2J0IA 4K18A 2VAGA 1Q8UA 3LAUA 1W82A 2YHVA 2Y6MA 4J52A 2BZIB 3F3UA 2JKOA 3C0GA 3WF7A 3QTUA 4FKRA 4HCVA 3R1QA 2B1PA 3SRVA 4EZ3A 2BHEA 4O2PA 2FH9A 1PXOA 3GCUA 5L6WL 4HGLA 4A9UA 4AZFA 4JDHA 5KZ0A 1LEZA 5C26A 3PLAE 1YOMA 4GJ2A 4N6ZA 4RIYB 2FSOX 4EH4A 3HUBA 4G5PA 2QHMA 3N4UA 3RALA 2PU8A 2X6DA 3CD3A 2W05A 4CTBA 2XH5A 3WZJA 5HLNA 2XK6A 4J97A 4PDOA 2OKRA 5CZIA 4EBWA 4YTCA 5C01A 3R00A 3H0YA 4OT6A 3ELJA 5H8GA 1W98A 5IH4A 4O84A 3L8PA 4O7SA 2JFMA 2WMUA 5D1JA 3JYAA 1OZ1A 3QXOA 2BDJA 4IWDA 4I6HA 3RAIA 4EQCA 5DNRA 5L6OA 2A0CX 4MNFA 2VO3A 1H28A 1ZY4A 3PPZA 1FOTA 1Q24A 5DFPA 4YR8A 2XIYA 2E9NA 4KIQA 5CT7A 5A14A 4RGJA 3EJ1A 5BVKA 4FEVA 3D9VA 3LJ1A 3NUPA 4E20A 5EW9A 3EN4A 4CFVA 1ZXEA 3NLBA 4WBOA 2YLEA 4DGMA 4A4XA 3LQ8A 3FHIA 4PDSA 4DH3A 3HKOA 2OFVA 5D12A 3BU6A 2X6EA 3T9TA 3DQWA 3BLRA 1M7NA 2EU9A 4AA5A 4AGCA 4YNOA 4FL2A 1ZAOA 3OW3A 3WF8A 2O64A 3GOKA 3GVUA 4O86A 4UXQA 4K0YA 4OAVB 3DAKA 2XNGA 4EZ7A 5I9XA 2WIPA 5HIDA 3QHRA 3KRXA 5I9ZA 4XHKB 2HXQA 3COHA 3AMBA 4R7BA 4RQVA 2VTNA 3HA6A 3KULA 3G0EA 1BL6A 2XYUA 4QTBA 4QMMA 2FSLX 3IECA 2WEIA 2YM3A 4NIFA 1OPLA 4BWXA 1WBVA 3ZLYA 5BYLA 2JKQA 4ASEA 3FBVA 2OW3A 3GI3A 3PRFA 5IMEA 3S1HA 5GNKA 3ZBFA 5TOZA 3SC1A 5T3QA 2UV2A 3PP0A 3T3UA 3QALE 5EKNA 2H34A 1YWNA 4MBJA 2G2IA 3R9RA 2C5OA 3UYSA
chains in the Genus database with same CATH superfamily
4HCUA 3BGZA 4ID7A 4KRCA 3AGLA 2GHLA 3W2QA 4CZTA 5HG8A 2QR8A 3NFGB 4JG8A 5AP7A 4ZSLA 2Y0AA 3F5GA 2YAKA 3CP9A 3F9NA 4FNZA 4FZ6A 4BN1A 4BTKA 4BVUA 4CD0A 2UZTA 3MPMA 3DXQA 3E7VA 3SXFA 3I5NA 4EZ5A 2W1EA 4XCUA 4BHNA 3QA0A 1H8FA 3UVQA 2F2UA 1UU9A 3O17A 4ALVA 3EYHA 2W1DA 4G3FA 3CXWA 4ZEGA 3HRFA 3BWFA 3S4QA 3V5TA 5F95A 3R9NA 3EKNA 1NVQA 3ATSA 1PMEA 3GOPA 3MB6A 4GIHA 4EUTA 4C37A 5JGDA 5AAFA 5CASA 2FA2A 2R3HA 3EMGA 3CSVA 4RFMA 2YIQA 2JKMA 3VBVA 4DHJA 2QD9A 4M3QA 2C6EA 1FVVA 2JGZA 3VJNA 4KUJA 3UDZA 3SXRA 4RWLA 4MQ1A 3CPBA 4FIJA 4D2WA 4FKPA 4BF2A 3ZUVA 1M52A 4FNWA 4XV3A 5HESA 3AT4A 3QQUA 4H3PA 4YSMA 1V0OA 4IFCA 5LARA 1XBAA 5TR6A 3BQRA 5AUUA 4E3CA 4ACDA 1H25A 3PG1A 5FDPA 4BKJA 5I0BA 3OD6X 2YN8A 4XJ0A 4JDJA 5E7RA 3EWHA 2WQMA 4AQKA 3TNQB 2W96B 3BYUA 3H4JA 3P9JA 3NIEA 5BYZA 1BMKA 2VTQA 3KK8A 4O96A 4TKSA 4X6QC 2JDVA 4BI1A 2H8HA 2JC6A 1WFCA 2XS0A 3A99A 3LCTA 4BKYA 5IQHA 3TJDA 4EOOA 4AGUA 3UPZA 3GXLA 4FKSA 4FI1A 1E1XA 4FTLA 2C6DA 3SRVB 5B2KA 3QTWA 5AM6A 4EH8A 4PY1A 5CEKA 3D5UA 2Y8OA 3VIDA 3OC1A 2QHNA 4AXAA 4UYAA 4HYSA 4O83A 4D0XA 4C38A 4DBNA 4Y85A 4AT4A 4G6NA 4ZTNA 1JPAA 2WIHA 3PXKA 3Q60A 3M2WA 1H0VA 4J95A 4U81A 5ANDA 5ACKA 2ZJWA 4J53A 4XV1A 5E8YA 4FTOA 5HTCA 4DTAA 3B8QA 1VJYA 2R0IA 3Q9YA 2X7GA 4QT1A 4FIEA 3JS2A 2ITZA 3NNVA 3ETAA 2X2KA 2BDFA 3QZGA 4MEDA 4H1MA 4UALA 3R83A 3TACA 5CF4A 3E62A 3B2TA 4MD8E 3I60A 2DQ7X 3K5VA 4W9WA 4X2FA 4I0RA 5KBQA 5E92A 3M42A 3EQPA 3NCGA 4FV1A 3QQFA 4FG9A 4EWQA 5B7VA 3QLFA 4FTMA 3R9OA 4O0YA 3RINA 3TNWA 2WTKC 3CJFA 3FI8A 1KE9A 1NA7A 3LFBA 5K4IA 4FV9A 4DC2A 2XANA 1ZYLA 3EFKA 4QYYA 3UP7A 3WILA 2CN5A 1GIIA 2KTYA 4OTQA 4AF3A 3OS3A 4CFNA 5TKDA 4P2KA 4JJRA 3U6HA 3FZRA 4GT5A 3R02A 4NCTA 3D4QA 3ZSGA 3IW7A 3FZPA 2HWPA 1BX6A 4H36A 1GZKA 2FSMX 3KA0A 2BILB 4J71A 1M2QA 2WD1A 2PE2A 4FSRA 4TZRA 2J0KA 3R28A 3FPQA 4LMNA 3MSSA 5TF9A 4F6WA 3ALNA 4IM0A 1PF8A 2GQSA 3O96A 4ITJA 5EYMA 2OU7A 2R4BA 4DEEA 4WNKA 3BHTA 1Q3WA 3GFWA 1SNXA 2C68A 4NIFB 4Z7GA 4EOQA 4U7ZA 2E9VA 3W0PA 4Y5HA 5IQGA 2WTKB 4YZ9A 5TT7A 3ZZEA 2BZHB 5KUPA 3GC8A 2C30A 1ZZ2A 4FUXA 3C51A 4CNHA 4E4NA 5AFVA 5JZNA 2UW0A 2EXCX 4BI2A 3TDWA 3PXQA 4PP7A 4EH3A 5EH0A 5AIKA 2XCHA 3BE2A 3NUNA 4QP3A 2UW5A 4PL5A 3SX9A 5KMKA 5CVHA 4AGWA 1OIYA 2Y4IC 2ZV8A 3B2WA 2R3QA 3W0SA 4WRGA 2JDRA 5A4EA 2WMVA 3EQFA 2BIYA 3A4OX 4APPA 2UW6A 1VEBA 3R7EA 2F2CB 3D2IA 5K5XA 3QKLA 2C6OA 4JX3A 4QMVA 2WHBA 4BCMA 1QMZA 3UIUA 4ACGA 4CRLA 2IVUA 4E6AA 3UYTA 4YTFA 1YHSA 2VX0A 1R78A 3NX8A 5D7VA 2UVXA 3F2AA 1F3MC 4IWOA 5AV3A 1JLUE 3LFNA 3PIZA 5CSXA 4PTCA 3I81A 3DLZA 3JY9A 3E87A 4BZDA 3PA4A 5C03A 2NNWB 5CS6A 4ZSEA 3Q5IA 4D0WA 4WUAA 3R73A 5DVRA 3KC3A 5BUEA 4FL1A 2CKEA 3KCKA 3ID6C 4DFBA 3UGCA 3EZRA 2Y4IB 4WNOA 3IKAA 4XLVA 3MFTA 2YACA 2C5NA 2OF4A 3RTPA 3TXOA 4WD5A 3DJ5A 1SYKA 3LFSA 4BCOA 3HAVA 3PSDA 4JRNA 4QYHA 3C4CA 4FIGA 5KZIA 2GQRA 5EW3A 2NRUA 3WZKA 4CQEA 4G3EA 4JI9A 4L42A 4TW9A 3ZH8A 5CXHA 1W8CA 5HCYA 3QHWA 5BVEA 3VF9A 4ACMA 4IZ5A 4ZZNA 3IOPA 2WTIA 4R1VA 3HV4A 4PP9A 2GTNA 4ANLA 4DGGA 3C5UA 3ZYAA 1K3AA 5IQDA 3G2FA 3ANQA 2ZM4A 5F94A 2A1AB 4C4FA 5M57A 5HBEA 3TUDA 5DHJA 2XALA 3DB8A 3VQHA 4ASDA 4ZY5A 3K5UA 4AXCA 2QG7A 2Y7JA 2GNHA 5A46A 4O7WA 3BGPA 2C6LA 3IDCA 5EK7A 5FUTA 3LFDA 4FSTA 4H1JA 1XMLA 2Q83A 3DK3A 3MJ1A 4YPSA 2XK7A 4QTCA 2C3IB 1Q8ZA 2R3KA 3F5XA 2R0UA 3FAAA 3LXLA 4LMUA 4TYEA 3PVGA 1UU8A 4J99A 4XV2A 4F9BA 4L7SA 3Q04A 4JAIA 3PY3A 4TWNA 4NJ3A 4A9RA 3HAMA 3BYVA 4FKUA 2IVTA 4XRJA 5EKOA 3SOAA 3QKMA 3VF8A 4DBXA 4DT8A 4C35A 3OF0A 1W0XC 2W1FA 4DEDA 5EOBA 5T6KA 1XH5A 3GU5A 4RJ6A 4BZOA 3G0FA 1G3NA 1XH6A 4ENXA 1TQMA 3FMNA 4GYIA 4MHAA 4M15A 1SVGA 3NW6A 4IAYA 4WKQA 4RIWA 3TCPA 1H08A 5CQUA 5EYDA 2W9FB 1WBPA 1H0WA 1M14A 3RWQA 3FI4A 4BDHA 3R7IA 2CCIA 3PVWA 3P78A 3SXSA 5IUGA 1OBDA 5HGIA 3QZIA 3BHHA 2BZJA 5A4CA 3RZBA 3PE1A 4LRKA 3PZEA 1GAGA 3RCDA 3SHEA 2P55A 3QYZA 2R3IA 4A06A 3ZSIA 5LQFA 4EHEA 4X3FA 3EFJA 3F3ZA 1V0BA 3OWJA 4GW8A 4UY9A 3V51A 2QU6A 2YFXA 3KY2A 2C6MA 2QCSA 3NNWA 4ZY4A 2HW6A 4BIDA 2UUEA 3PJ2A 5CAQA 2BMCA 4WOVA 1Q99A 3W10A 3MPAA 3OCSA 4ZMEA 3I6WA 5ETIA 2JKKA 3CE3A 3PUFC 2IJMA 3QD4A 4AZTA 3VVHA 4YSJA 3UG1A 3FKOA 2OIDA 3FLNC 4IZ7A 4GK2A 2JAMA 4AN2A 2WELA 4LGGA 4RFYA 3TT0A 3DU8A 3R63A 1S9JA 4ONAA 5L2SA 4AT5A 4JXFA 3VHEA 4F0FA 1J7LA 3C5IA 2OG8A 2PSQA 2WO6A 4FOCA 5EDRA 5IU2A 3A7GA 3ORKA 3U4WA 3PPKA 4QQTA 5ANKA 2CSNA 4UMPA 1YDTE 4NEUA 3LLTA 3EQRA 3BX5A 3KXXA 4TYHA 3V6SA 1LP4A 2VO0A 2R3MA 4P5ZA 5T68A 3R1YA 4I6BA 2WB8A 3POZA 4LV8A 5I3RA 3QZHA 3MJ2A 2H96A 5BVWA 4IH8A 4PPCA 3OUKA 4EHZA 1PXJA 4QP1A 3BI6A 4G9RA 4WG5A 2Q0NA 5FBOA 4HZSA 2PULA 4NYEA 4DCEA 4DEBA 4I23A 3BQCA 3TEIA 2UZOA 1OBGA 4I5CA 5ITAA 1KE6A 3WE8A 3CBLA 3VAPA 2HAKA 1W84A 3NW7A 5AP4A 4OTPA 4XX9A 3COKA 3P86A 4EH7A 5ANOA 1FINA 4JBVA 2YZLA 3NAXA 3QTIA 4HVIA 2VTRA 3S95A 4LYNA 4AW5A 4QTAA 3CQEA 4DG0E 3TIZA 2VWYA 4G34A 4ACCA 2GS7A 3AD5A 4G9CA 4IE9A 4TYJA 4MTAA 5AP5A 5F20A 4I0SA 3RPSA 5HQ0A 3GP0A 4YJQA 3P7AA 4RJ3A 2C6TA 2OWBA 3LW0A 3IK3A 1Y57A 2W9ZB 4EK4A 3TZMA 3BWJA 2BPMA 3QTQA 4Q5EA 2I7QA 4D2RA 2IF8A 4XEYA 4BFMA 1JOWB 3OT3A 4FKIA 4QP4A 3R8VA 1P14A 5EQEA 2X2LA 1ATPE 2X8EA 4GT4A 2ERKA 4PRJA 3D0EA 3UZRA 3FXWA 2RGPA 4NT4A 3P23A 3IGGA 4QPAA 3W32A 4CEGA 4H58A 3PA3A 4BYJA 2F7EE 5I9UA 3A7FA 4C3RA 2W17A 4L45A 1ZLTA 2RKUA 4YJOA 1EH4A 3M1SA 3SV0A 1Q4LA 3EN7A 4FSMA 2PVJA 2A19B 2ZAZA 2J0LA 2VWVA 5BVDA 3DOGA 3P0MA 3NR9A 4KD1A 3ZFMA 3WE4A 3HEGA 3RCJA 5IMXA 4EYJA 4UBAA 4FNYA 3DXNA 3TNHA 5AAEA 3A61A 4NU1A 4ZXTA 4I20A 2F7XE 3VRZA 4Z16A 3PLSA 4AZEA 4QQJA 3BV2A 3BKBA 4FTAA 4LGDA 3BRBA 4BDIA 4I94A 3OCTA 3QCQA 1HCLA 4MXXA 4Z55A 2X4ZA 4IAKA 2PVFA 2X7OA 2JD5A 4PNKA 4BYIA 1KOAA 4RIWB 2PY3A 3OWLA 3QTZA 1OGYA 3FXXA 3OWPA 4UXLA 3V04A 4FTTA 4EORA 4AA0A 5HX8A 1MUOA 5AP1A 5DN3A 3KRWA 4FG7A 2UVYA 2PTKA 3H3CA 4WG3A 4R78A 2BALA 4II5A 1P5EA 4DFXE 4DCAA 3PXYA 3DCVA 5A6NA 2OJFE 2C5VA 4JBQA 4YHFA 3UIMA 1ZYCA 2VUWA 2ZMCA 3MH3A 3DFAA 3OWKA 3UJGA 2QURA 1OB3A 5ETAA 2C1AA 3QXPA 3FWQA 5FWKK 2Y4PA 4CG8A 3ULZA 3DKCA 2C47A 4IB0A 3FC2A 2W4JA 4ENYA 3ALOA 2ITWA 4UYNA 4DYMA 4AWIA 3VQUA 5FRIA 3DTWA 4PTGA 3RK9A 3SKCA 3QC9A 1JSVA 5AR5A 4F9AA 3PTGA 1T46A 4QD6A 2LGCA 2I0VA 3DGKA 4W4YA 2WXVA 1XBBA 3GC7A 4O82A 3FKNA 5CEOA 5AUYA 2BRGA 5AP2A 3F7WA 5EYKA 2BFXA 4G2FA 2YM5A 3F3TA 5AMNA 4MXOA 1ZYSA 2QKRA 3TNPC 2P4IA 1OPJA 5K9IA 2FUMA 3DDPA 5EQYA 4CGAA 4K33A 4RA5A 1OIUA 4TYHB 2UZUE 4ZTLA 1H4LA 2V62A 1BYGA 3RK5A 1UNLA 1ZOEA 4X21A 2QC6A 2XKFA 2XYNA 4KS8A 4FSNA 4LOOA 5GJDA 4G5JA 1FVRA 3UTOA 4O1OA 3RNYA 4M84A 5EDPA 2ITNA 2Y9QA 3DLSA 4DGNA 4BDBA 3EOCA 4Y83A 4D4RA 3KN6A 4GS6A 1ZMVA 2YERA 3Q9ZA 1YXSA 3HMPA 3ZC6A 3FMHA 5B2LA 3W0NA 2QO9A 5HO7A 4WA9A 3BYMA 1JSUA 3W1FA 4E4LA 2C6KA 2JEDA 5KBRA 3AMYA 5HNGA 3RPYA 3UVPA 3HDMA 4D55A 4JNWA 3AC5A 4TYGA 3WZDA 3I79A 5J5TA 4CZYB 3EN6A 1OMWA 2DUVA 3NVKI 1RQQA 3O8TA 4H3QA 3ZFYA 3ZMMA 2YCQA 3MVJA 1YWRA 2KULA 3MYGA 4PDYA 3FEGA 3PPJA 4TWPA 3VWAA 3TV4A 2UZLA 4F6SA 5BVNA 3FXZA 4HPTE 1WZYA 2J4ZA 4I1ZA 3AQVA 3FLZA 4E4XA 1BUHA 4IHPA 4GG5A 4AOJA 3W16A 4NTTA 3C4FA 3FKLA 3GU8A 5E90A 3REPA 4BTJA 1XR1A 3FZSA 4LV7A 4DTKA 4ANSA 1ZY5A 2JBOA 4K1BA 3L9MA 3C4XA 1YDSE 3MV5A 3ACJA 4GFGA 2QODA 4FTJA 5AR3A 1UWHA 3OZ6A 3PSBA 3AC8A 3UOLA 2PL0A 4MKCA 3IW8A 2GNJA 3DK6A 3ZDIA 2O0UA 4N70A 4PMPA 2EB3A 3PJ8A 3DJ7A 3TZ7A 1REKA 3PXZA 3IS5A 3QTSA 4ZIMA 4BC6A 5GINE 3SLSA 3Q2JA 2XIZA 4LGHA 4IB3A 1NVRA 4IIRA 3ZC5A 2G15A 2W1IA 2XIXA 5BVFA 2W1CA 2BAJA 4U79A 4UZDA 5FM3A 4E93A 2EUFB 1SMHA 4KSQA 3LCOA 4CKRA 4RT7A 4DLJA 5EW8A 4UV0A 3VRYA 3CQUA 2HZ4A 5KMLA 1WMKA 3KCFA 4N6YA 4B9DA 4O7VA 4ZTHA 1G8JA 4L67A 3K54A 5D10A 3PJCA 4CCUA 3I1AA 2ZDTA 2PZYA 2UW9A 3OY3A 4DE4A 1ZMUA 1VR2A 4NZWB 2F49A 2W0JA 2I0HA 3MTFA 3U8WA 4F7SA 3FL4A 5JQ8A 4FF8A 4AXFA 4UMUA 1IAHA 2IZSA 4D5KA 3R1NA 5FTOA 3UMXA 3FZ1A 1JKKA 5I9VA 2XNMA 4FEQA 2C5YA 4BGHA 4I6LA 1YDRE 3DZOA 3EFWA 5CEPA 4C34A 2HZ0A 4S33A 4E73A 5HG7A 1OIRA 1U54A 2HOGA 2HXLA 3G5DA 5ACBC 3HV5A 4NKSA 3OUNB 3THBA 3LCSA 2OF2A 3W8QA 4BCJA 4C4JA 3AG9A 4CV9A 2F4JA 4FGBA 1ST0A 4H05A 1JKLA 5DT4A 3LKMA 4U41A 2HY81 5C8MA 3NFFB 4GVAA 4S34A 5CNNA 5LVLA 3FJQE 3PWYA 4NTSA 2WQEA 3F69A 3KXMA 3O8PA 3TI1A 3UNKA 4FTRA 1BI8A 3BLHA 5L3AA 4JRVA 4DFUA 3SVVA 4FKTA 4ZLOA 1Q61A 2G2FA 4S2ZA 4OTRA 3BU3A 1ND4A 4GRBA 2PZPA 1Q8WA 4HYHA 4AN3A 3QRTA 4TXCA 1OPKA 5AV0A 3UPXA 3VUHA 3Q96A 2YDIA 1J3HA 3KMWA 4BB4A 4RLKA 1KV2A 1ZZLA 4DGLC 5HTIA 5IQFA 4MD7E 4XRLA 4GFOA 4WIHA 2P3GX 3DBEA 4QQ5A 4RBLA 4D1XA 4IX6A 4UX9A 4L00A 4G3DA 3DS6A 4XUFA 3A62A 1XKKA 4YZNA 4FTNA 2QR7A 4PL3A 2GHGA 3V8WA 4PQNA 4KBAA 2ZMDA 3I5ZA 4U3ZA 3QGWA 4K9YA 4U5JA 4YMJA 2PZ5A 2OZOA 4YJPA 5CVFA 4P4CA 5HCXA 2PZIA 5HE1A 1KUTA 4FTCA 2XRWA 3AC3A 1UNHA 4AS0A 2CMWA 4C0TA 3NCZA 3UZPA 4YLLA 5F9EA 3R7YA 3EB0A 2R64A 4KKHA 2B9JA 4TT7A 4AW0A 3E8EA 4C2WA 4ANBA 2C0IA 4NFNA 3ZHPC 4OLIA 1VYZA 4O6LA 5JH6A 5DH3A 5IEVA 4MNEA 5DR9A 4BHZA 2OBJA 5CI6A 3OXTA 3ORLA 5JRQA 4O21A 3C0HA 4KBKA 4AZSA 2R3LA 4EH2A 3HYHA 4EOPA 5M44A 4JR7A 2HWOA 4IAIA 4K8AA 3PP1A 3FMJA 2B4SB 1H07A 2PVRA 2YM4A 1M17A 2OK1A 4IDTA 4NW5A 4OBQA 1NW1A 4RX7A 4CFWA 2YJRA 1Y8GA 4Z3VA 2CNVA 3C9WA 4D2PA 1ZARA 2GTMA 4QOXA 2VGOA 4DITA 5M55A 4FR4A 2XVDA 5IQBA 3VHKA 4FMQA 4E8AA 4RWKA 2YLFA 3QQLA 2XNOA 5ANJA 2C0TA 3DFCB 5FD2A 4E4MA 4GV1A 2C4GA 4RA4A 5DPVA 1IEPA 3C1XA 4BTFA 2J51A 3PWDA 5IA1A 2RFSA 5CEMA 1X8BA 3O7LB 5EM7A 3NVMB 1W83A 2V0DA 2CCHA 2WNTA 4YJNA 4ZSAA 1CSNA 4IX5A 4MWHA 5AIRA 3O50A 4CT1A 5JN2A 2UZEA 1Q8YA 3KXGA 5CEQA 4BDGA 2WPAA 4D4VA 3OEZA 3VJOA 1WBSA 3NGAA 5FP5A 2YABA 3AD6A 2XK8A 2IWIA 4LL0A 3MS9A 4V05A 2J6MA 2GS6A 1YHVA 3EQBA 3G15A 3MFUA 4M69B 3RGFA 1H1RA 1QPEA 1Z5MA 3K3IA 2VX3A 4IDVA 2VO7A 4JIAA 3JR1A 5BMSA 4AN9A 5IDPA 3N4TA 4XS2A 4A9TA 5HG9A 2JBPA 2QQ7A 3ZO2A 3I6UA 4C7TA 4KAOA 3ZEWA 2IZTA 2W4KA 3UG2A 3FY0A 2F7ZE 1GJOA 5DIAA 4QP9A 5IDNA 4JBPA 3F6XA 2IVSA 1JBPE 3WIGA 2PWLA 1LUFA 2XAMA 4YLKA 4AOTA 4FSYA 4RX5A 4D2SA 5AUVA 2X9EA 2BZKB 3MH0A 4JQEA 5KMMA 3U9NA 2CHLA 1PJKA 4RJ4A 5CY3A 4IB5A 2UW7A 4UZHA 3SA0A 2ZB0A 5J8IA 4AXDA 2RFEA 1H27A 2OFUA 4AFEA 4QP8A 1U54B 4KABA 5CF6A 3QCXA 5IF1A 5FXSA 1U5QA 2R5TA 3IG7A 4Z7HA 3P5JC 2IEWA 4AE6A 3TV6A 3V5PA 3A8XA 2O65A 4RZWA 4PV0A 1XWSA 1OECA 4ZTRA 5TE0A 4C8BA 1YHWA 4TWOA 3AKKA 3PJ1A 3CEKA 4EOLA 4OR5A 3U54A 5HBJA 1OL5A 4I21A 2RL5A 2AYPA 3LOKA 4LOPA 4R8QA 4WSYA 2GFSA 4BDJA 3E7OA 5GJGA 1QL6A 2ZV9A 3W2PA 4F70A 1JNKA 2XK9A 3RJCA 2IG7A 1I09A 4O0SA 3P08A 3F3VA 4GMYA 2AEGA 4OTWA 1Q41A 2VN9A 2P2HA 4AQCA 1FGIA 4IAZA 4R3CA 4D9UA 1L8TA 1LEWA 2YCRA 4F0IA 2WOUA 1K9AA 2QI8A 1OIQA 3MDYA 3F5UA 2RF9A 2YIYA 4YC8A 5HIBA 4O2ZA 5G1XA 4QEBA 1ERKA 2I40A 2I0EA 3KVWA 3QLGA 1NXKA 3PE2A 3OCBA 3TUCA 2OGVA 4FVQA 3MY5A 4GL9A 2EXEA 3HV6A 4EH5A 5KE0A 2X1NA 4ALWA 4EJ7A 1FMKA 3CD8A 4R77A 4UWBA 2WTVA 4GEOA 4DH7A 5A9UA 4L44A 4IC8A 1H26A 2EXMA 5E8ZA 3ZRLA 4L3LA 4MXAA 5AUXA 4GU6A 3A7JA 4FC0A 3ZCLA 3ZXTA 3LMIA 2HZNA 2A4LA 4MNEB 3NEWA 4DHFA 4FYNA 2ZM3A 1V1KA 1OKZA 3JPVA 2YM8A 3MH1A 3VBXA 3KRLA 3V01A 3BPRA 4R5YA 5BYYA 3FMKA 5CT0A 4BCNA 4QP6A 4EKLA 1PXPA 5HD4A 4U43A 5AV4A 4FV7A 2WMWA 4E6DA 4EOIA 5AA8A 5LWMA 3QUDA 3BU5A 4OTDA 2IVVA 2WKMA 3EN5A 3IDPA 5CSWA 5C8KA 1PRYA 5J79A 5L8LA 4FIHA 2GSFA 3KK9A 4PPAA 1KE5A 4QQCA 2ZV2A 3UNJA 4HGEA 3FLSA 1QPJA 2HY0A 3C4WA 4A07A 2IPXA 3RHXA 4K77A 4M7IA 4TY1A 4LI5A 3WOWA 1W2CA 4ZZOA 2YM6A 4QYEA 4XG6A 4U8ZA 3OTUA 2DWBA 3KF4A 3DA6A 2R7IA 1WVXA 2B55A 3I7CA 3KMUA 3LCKA 1OUYA 2VGPA 4L46A 3NYXA 3QWKA 3Q5ZA 4DF3A 2WMRA 4U42A 3ZBXA 4BIEA 2XA4A 2PVLA 4ZJJA 4DFYA 2WZJA 2OSCA 3V6RA 3GCPA 3LXPA 5AR8A 3R8ZA 2CNUA 2VWZA 3FDNA 2C6IA 1JVPP 3GQIA 4HNFA 3O23A 4LV5A 3UP2A 1KSWA 2XZSA 1DM2A 2UW3A 4AE9A 4PMSA 4CTCA 4D58A 5GZ8A 4MF0A 1GY3A 3QCYA 5C4KA 4FZFB 1XMMA 5IEXA 3SGCA 1APME 5DGZA 5F1ZA 1Q97A 2PK9A 4QO9A 4GKHA 5CVGA 1YKRA 3AC1A 2X0GA 4I5PA 3WARA 4B8LA 1WAKA 4IANA 3EYGA 2QONA 3HP2A 4FT7A 3KU2A 3QCSA 5IQIA 3CGFA 4MK0A 3ZO3A 1KE7A 1AD5A 1URWA 5AP3A 3ZUTA 3PSCA 5JT2A 3VS2A 3SD0A 5I3OA 4YUQA 5CXZA 5IEYA 3NWWA 4JQ7A 4RSSA 2WQBA 2VTHA 2XJ2A 1H1SA 4FV4A 4J8NA 3ZLSA 1KWPA 3DBCA 5CTPA 4BGQA 5IA0A 5ANIA 1WBWA 1OKVA 1O6KA 4AZWA 2BRMA 4YHJA 5CSPA 5GJFA 2AUHA 3KIOC 4CMOA 5JKGA 4X6RA 4BR3A 2JIIA 3MY1A 1TQPA 4WNPA 3WZEA 3MPTA 4OBOA 4KS7A 1DAYA 4X7QA 4FT0A 3SAYA 4IADA 2B9IA 3HX4A 2VO6A 3PY1A 1QPDA 4ZSJA 4DDGA 3FL5A 4FX3A 1A06A 4CFUA 3GT8A 2P0CA 5DR6A 4FL3A 4ZK5A 2J0MB 1GOLA 4HOKA 4I5MA 5EM8A 5BMMA 3NIZA 4W9XA 5M08A 4ZTSA 5CAOA 3P7CA 2XNBA 4S30A 2YISA 4M12A 4BDEA 4V04A 5HEZA 5IA2A 4ITIA 1WVWA 3TTJA 3R7UA 4EL9A 3ODZX 2ETRA 3LCDA 4L53A 4A9SA 4V01A 5CALA 3U87A 3U6JA 3QD3A 2OJ9A 3FQEA 3FQSA 4C57A 4I4FA 4F78A 3U51A 2GHMA 1F0QA 5KHWA 4NM0A 3RMFA 3ORIA 3PA5A 1PXMA 2RFNA 4M68A 3DTCA 4MCVA 1TFFA 1GZOA 4FT5A 1KOBA 3ZLWA 4S32A 3DDQA 4IWQA 5LMKA 1NT2A 3BLAA 1B38A 2ZVAA 3V5LA 1JWHA 5EG3A 4F1TA 1FPUA 1SVHA 4I3ZA 2WFYA 5C4LA 2UZNA 5L4QA 4ZMFA 3MVMA 4AX8A 3QX2A 1W2FA 4XBRA 3ZEPA 2G2HA 4QPSA 5DWRA 2B54A 3IW4A 5H9BA 4BCKA 1QCFA 1PW2A 3NUYA 2PE1A 4AW2A 2VTJA 5A6OA 1OI9A 1RW8A 2Z60A 3Q6WA 4EK8A 4AG8A 2F57A 3OOMA 4RVLA 3O0GA 2W1ZA 4F09A 1H00A 3RVGA 2W99B 3D7TB 4OAUC 2BCJA 5HU3A 4KIOA 3Q4CA 1PXKA 2BHHA 3ML1A 5E8XA 1Q8TA 3MW1A 4JT3A 2CKQA 3BV3A 3VONA 2OLCA 3T8OA 4RC4A 3M11A 3IPHA 5IA3A 4U0IA 4MQ2A 4GIIA 3I7BA 4LRJA 4C59A 3CTHA 3TIYA 4FICA 3L8VA 2BAQA 1ZMWA 4BDKA 3OFMA 3BHUA 4LL5A 5DRBA 2FB8A 3FLWA 3U9CA 1UA2A 5CU2A 5LVOA 3D2KA 4W4XA 2QVSE 2FGIA 3G51A 4J7BA 5CQWA 2IW6A 3SG8A 3A4PA 2VD5A 3EH9A 1VYWA 3ZSHA 5GIOE 1V0PA 1J7UA 1YRPA 3AC4A 3IW6A 2J5FA 3OVVA 5JK3A 3ZS5A 4U3YA 5HU9A 4GKIA 5C9CA 3BHYA 4EKKA 3R2BA 5I4NA 3BL9A 4GSBA 3W0QA 5B2MA 2W7XA 4FV0A 4QTDA 4ZJIA 4W8EA 2WGJA 4YBJA 3O7LD 3DXPA 2P33A 5BQ0A 3R04A 4O22A 1CKIA 3BZ3A 3UO6A 3VS5A 3VUIA 2JDSA 4B7TA 4DFNA 3TG1A 5LCJA 4O4FA 5BX0A 1ZOHA 1XHAA 4DDIA 1QPCA 2BVAA 2G9XA 4EJNA 4JX7A 2EB2A 4FSWA 2PUPA 4O0TA 2O63A 2JDOA 1OKWA 1YWVA 2PE0A 2XMYA 4FTKA 3DT1A 4KWPA 4WT6A 5L8JA 3RAKA 4ZTMA 4FTQA 4YGAA