4HGEA

Jak2 kinase (jh1 domain) in complex with compound 8
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
290
structure length
284
Chain Sequence
QFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK2
publication title Discovery of potent and selective pyrazolopyrimidine janus kinase 2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 284
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4hgeA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4hgeA01
4E4XA 3FXZA 3MFSA 2J0MB 2XIXA 4YP8A 4DEDA 4EQCA 4YTCA 4ARKA 1Q97A 4R5SA 5JRQA 3TUCA 3PJ1A 4E73A 5CF4A 2VTRA 2BRGA 1R0EA 3PPZA 3UPXA 3HDMA 3QUEA 3FMJA 3QQUA 4X3FC 3WE4A 5J79A 3H30A 5GINE 1YQJA 4QD6A 4KAOA 3Q5IA 4BYIA 2OXXA 3TTIA 2QOQA 4IAYA 4AT5A 3S00A 4FZ7A 4DFNA 3F88A 4X0MA 4OUCA 2W17A 5LARA 4D2WA 1YDTE 2YM7A 2UZLA 3VBYA 1ZY5A 3WZEA 4DFYA 3P4KA 4C02A 1APME 4UWYA 2GQSA 3WIKA 4OGRA 3FQHA 4EBWA 5CQUA 1U4DA 1VYWA 3HZTA 3R9DA 4NT4A 4R7IA 3WYXA 3Q60A 1T46A 4GS6A 5FD2A 5I4NA 4PTGA 3IQ7A 3BHVA 1U5RA 2WTCA 2HW7A 4QMVA 2GS2A 3SAYA 4UX9A 5CASA 1XH7A 3R71A 4I22A 3E8CA 4ZSJA 2Y9QA 3HMNA 4HVHA 2VX0A 3R7GA 5BVDA 3Q6WA 4RIYB 1R1WA 3ACJA 4DYMA 3DBCA 3O8TA 2X8DA 4EK6A 4K0YA 4RIYA 4FSYA 1XH4A 3PXQA 4FBXA 1Q99A 2WMBA 2WOTA 4FEWA 2OK1A 1YHVA 3OFMA 4YBKA 1NY3A 5E8YA 3GBZA 2IVSA 3PZHA 4NKAA 1Q3DA 3HRBA 4D4SA 5KZIA 2PUPA 3KXNA 2CCHA 5ETCA 3CJFA 4XEYA 1H1PA 4FV0A 5DR9A 4XUFA 4DTKA 5AEPA 3G2FA 3OXIA 2YDJA 4LGDA 3FHIA 4BZOA 2WMXA 3KFAA 4EH6A 1FPUA 2XNMA 3RHKA 3LFFA 2R7BA 4WUNA 3RNIA 4GU9A 3QTSA 2CGUA 3R9NA 4O7NA 2W1ZA 2BZHB 2C6IA 2J9MA 3F3WA 3CSVA 2UW9A 4YTHA 4QP2A 3QD0A 4YO4A 4FKSA 5F20A 4APCA 3C9WA 4UV0A 4D1XA 5CU4A 4O0SA 4DH8A 4O7TA 3EL7A 4ONAA 4XP0A 5CSXA 4PPBA 4BTFA 5ANDA 2BDFA 3DFCB 5HG5A 3DK3A 4EK8A 3HNGA 4JQEA 1WBNA 1XH6A 2QCSA 4CEGA 4IVCA 5M4FA 5M56A 3WYYA 2IW8A 3LVPA 2OW3A 3P7CA 2FO0A 3D94A 3H4JA 4KA3A 3DGKA 1FMKA 3C4WA 4BTKA 5IEXA 1W0XC 3V8WA 5E7RA 4ZLYA 5HE0A 2VTHA 5AUZA 4FKPA 1ZYSA 4B99A 3E87A 4LGGA 5GJDA 2ITQA 4U45A 2HWOA 3G6GA 4CD0A 5CVGA 4HYUA 2WTWA 5ANKA 2XRWA 4HZSA 3U54A 3R83A 3KN6A 2WIHA 4FSUA 3KC3A 2NPQA 4BHNA 2KULA 4FODA 5AR3A 1G8AA 4E4MA 5LVOA 4B6LA 3C0HA 3LLTA 5AP2A 5E4HA 4QRCA 3JVSA 4QMPA 4IZ7A 3I0OA 5I3RA 3FZTA 4U5JA 4QOXA 4W4XA 3Q4ZA 3GU5A 1B6CB 2LGCA 2Q0BA 4RJ7A 4GH2A 3ZUUA 4EWHA 2W1HA 2IWIA 4RZWA 2VX1A 3QRJA 3TACA 3ALOA 4WA9A 3F2AA 5AA9A 3CCNA 4FEVA 3ULIA 2OLCA 3HRFA 4I5MA 4AW5A 5D10A 3SOAA 4EH2A 5CSWA 1SNUA 4NU1A 1ZZ2A 5KBRA 2UW0A 3OBJA 3W8QA 4FSWA 4ASEA 4DGOA 2RFSA 2Z7LA 5JT2A 1K9AA 4FV7A 4JBOA 4X6QC 4O7SA 2GNIA 4OBOA 1CKJA 3RPVA 3N4UA 3O7LB 3DXQA 3K3IA 1NVRA 4NWMA 4E26A 3NUPA 4EEVA 4EHGA 2W9ZB 3I4BA 3LXPA 3QQFA 2XEYA 2DS1A 3E64A 4FKOA 3L8XA 3T9IA 1OKZA 1MRVA 3U9NA 1H0WA 3OP5A 2IJMA 1WBWA 2A2AA 5A9UA 2GTNA 4QQJA 4IEBA 3RI1A 5CAOA 3ENHA 4CTBA 3LZBA 4DAWA 2HK5A 5AIRA 3AD4A 4XG2A 4RFYA 5EM7A 4K18A 3EQRA 3D5UA 3F61A 3VWAA 3W10A 3CD8A 5E92A 2HENA 4TYGA 1ZMUA 3P7AA 1H1WA 1B38A 2C69A 2X7GA 2XS0A 4EWQA 4EKLA 4ZLOA 4FT7A 4Q2AA 5HTIA 4L45A 2Q83A 4CLJA 5HGIA 2C0IA 3EYGA 2XYUA 4PMMA 4Z9LA 4F6WA 3KVWA 2QI8A 4AGCA 3R00A 3I1AA 2XIRA 3HMPA 3MFUA 3C4CA 5C27A 3R7UA 1MRUA 4O27B 1SVHA 3R7VA 5I9VA 2IW9A 1JOWB 2QQ7A 3WOWA 2WZJA 4AZTA 3QCXA 2WXVA 4NSTA 4NCTC 3CY2A 3R9HA 4M69B 4WG4A 4G3DA 3WBLA 3WZUA 3O50A 4FSNA 1KE5A 5KKRC 4M69A 4J52A 2W1GA 5ANOA 3Q9ZA 2OXDA 3BE9A 4U9AA 5A6NA 3OXTA 4AOJA 3GFWA 2QOFA 4I24A 4YC6A 2YLEA 3LXNA 2R3PA 4CMUA 4MWIA 3C0IA 3PE2A 2E2BA 2R5TA 3CPBA 5HBEA 2CNQA 3R2BA 3R73A 4PMPA 2Z7RA 2I0YA 5EM6A 4ZY5A 5IMEA 3E7OA 4YHTA 1WFCA 2FYSA 4Z7GA 3NW5A 1ND4A 3AD5A 1YXXA 3IW5A 1GZKA 2OGVA 3R6XA 4XOYA 3RAHA 3FAAA 3PG1A 4WG3A 4Y95A 4M97A 4WNPA 3PXYA 4A9SA 4C8BA 1XHAA 4F4PA 3A7GA 4XRLA 4ZTNA 3R22A 4QMWA 5HU9A 3BHHA 3W55A 3LJ2A 4AOIA 2UW7A 1FVRA 4QTDA 3O17A 5C26A 2X4FA 3QWJA 5C8KA 4C33A 4GV1A 4JRVA 4L68A 4NH1A 4S30A 2CSNA 4ZTHA 4A9YA 3JVRA 3OCTA 2VWIA 4DC2A 3NNUA 1CMKE 3L8VA 3NYXA 5TR6A 3E88A 3MI9A 4YZ9A 3TKIA 4DEEA 1NA7A 4ZZMA 4J95A 5EM5A 4R7HA 3NUYA 4FK6A 2V7AA 4RJ5A 4ASDA 4F9BA 5KMNA 1Y91A 2P0CA 5CF5A 4K6ZA 2W96B 2ZM3A 4HCTA 4LGHA 4GMYA 3OW4A 2JDTA 2R3OA 3ZMMA 5G6VA 4E5WA 3ZLXA 3KF4A 4FTJA 2WKMA 2VV9A 5A4LA 2YABA 3FMEA 4F99A 4CSVA 3M11A 1UA2A 3EHAA 3HLLA 3MPMA 5CEQA 4A9UA 3EQCA 1OL5A 2QG7A 3ROCA 5IKWA 2VTMA 5HE1A 3DJ7A 2YCRA 4DITA 4DBXA 2QC6A 1REKA 4PPCA 4IAAA 2HXQA 2ETRA 4RJ4A 3P23A 4UN0C 4ANSA 3E3PA 3KXZA 5AJQA 1PMVA 4S34A 4FTNA 4C2WA 3VIDA 1LUFA 1MRYA 3Q9WA 1Q61A 1TQIA 4I41A 5DR2A 4JAIA 2X4ZA 3KRJA 3O8UA 2V7OA 3GU4A 3RCDA 5FTGA 2VTSA 2QNJA 4F6UA 4XG7A 3ZC5A 2GU8A 2A0CX 1WVWA 3QL8A 2PTKA 3DKOA 3S2PA 5CANA 2YA9A 3PXRA 1XBCA 2UZOA 3OWKA 2W4OA 4JJRA 3LPBA 2C3IB 5FEQA 3U9CA 2PZPA 5KMLA 4CMTA 1JKTA 2X8IA 4IACA 4IC7A 5BVWA 3R63A 2Z7QA 4IJPA 4NJDA 1XBBA 4EHZA 3GU6A 3QCQA 2QO7A 2Z2WA 3B2WA 4BB4A 4C3PA 3UVPA 5G1XA 4IC8A 4EHEA 3FKOA 3UNKA 4L52A 5CSVA 3IGGA 2G2HA 4RRVA 2YISA 3KY2A 1YVJA 3O7LD 3G15A 4PP9A 1FVVA 4QYEA 5CAPA 3MFTA 3K5UA 4F1TA 4F1OA 2F7XE 4B0GA 4B8MA 4XG4A 3GCQA 2VTTA 3N4TA 4EZ3A 3ZM4A 5K0XA 4XG6A 3QQLA 2OFUA 3GT8A 1M7NA 1BI7A 3F3TA 4FTKA 4KIPA 4XV9A 4K8AA 4TW9A 4MX9A 5EHYA 3R8UA 3ZUVA 4CCUA 4F65A 5LJJA 2ZYBA 4G1WA 3N51A 4CRSA 5FM2A 4L7FA 3UG2A 1ZOHA 2UZDA 5CU6A 5L3AA 4BZDA 4E1ZA 2R3RA 3GB2A 4BDCA 1GZOA 3EQIA 2BMCA 2PZ5A 1Q24A 2Z7SA 4IVAA 2ITOA 3EIDA 1PY5A 2WQOA 3MA3A 4PY1A 4X7QA 3A7FA 3F7ZA 5IQIA 2PHKA 5TO8A 2EXEA 3NUUA 3GC9A 4BCKA 4IAZA 3EWHA 3GNIB 4X6RA 3RPSA 3WILA 4L01A 2C6KA 1Q8ZA 5HU3A 4DEIA 3IS5A 3FMMA 3PFQA 2ITXA 2XNNA 4BGGA 3PY1A 4HCUA 2B55A 4TWNA 2QHNA 2X2MA 3CLYA 3QX2A 4TNBA 5CAVA 3D5VA 3BLHA 2ITPA 4C4HA 3HX4A 4PL4A 3V5WA 2OIBA 3CQWA 3VS5A 4U41A 3MW1A 4RLKA 2P2HA 1ERKA 3JYAA 4AGWA 3QD3A 4UBAA 5K3YA 4D2RA 4WSQA 3KB7A 4HVSA 1UKHA 3A62A 3P08A 4QMSA 3Q2JA 4J7BA 3ANRA 2YWPA 4FTRA 5IQDA 5AR4A 4F0GA 2XP2A 4ACDA 3HUBA 1YOLA 4D5HA 3TIYA 3UC3A 4EUUA 2W5AA 5IISA 3Q2MA 4O0VA 3HV5A 1J7UA 3EJ1A 3RAKA 3V3VA 3C50A 4BKYA 1P14A 4Y5QA 4FTLA 2WOUA 2EXCX 3CS9A 3QLGA 2KTYA 4DEAA 5BYLA 1QL6A 3QA8A 2C3KA 3N9XA 1PYEA 2VWBA 5IQCA 2VO6A 4BVUA 1U5QA 2C6MA 3PVGA 2BROA 2VRXA 3UGCA 4C0TA 3ZO1A 4AX8A 1Q8YA 2C1AA 5K0KA 4BIBA 2Y8OA 4MBJA 1LEWA 1OL7A 4FZAB 4JBPA 5HCZA 4XV2A 4BCOA 4ZY4A 5I9YA 2V62A 5IQBA 2V5QA 4PV0A 4C34A 4FKLA 5DRDA 3BEGA 4PPAA 1YXTA 2WEVA 4FV8A 4N6ZA 3V5JA 3GI3A 2Y4IB 3MIYA 3QQKA 3OWLA 4ERKA 4MCVA 2UW8A 4QTCA 5AMNA 5I9UA 4XBUA 4XV1A 5FWKK 3TI1A 2GSFA 5AR7A 4IIRA 1W98A 3NR9A 2UW4A 4UYAA 3NZ0A 4M8TA 4O82A 4WOVA 4M13A 4ZSAA 2J4ZA 2QU6A 3TZMA 2BIKB 2XBAA 3MVHA 4ACMA 1PXKA 4JDKA 5TOZA 4OAUC 4NM3A 4FSZA 3KMWA 4Y73A 4L7SA 4ZZOA 3TG1A 4J8MA 2G9XA 4L44A 5JRSA 4A4OA 2CPKE 4RLLA 5E8ZA 3UOHA 3A61A 4YLJA 3R04A 4R6VA 3NCGA 3DBFA 4FKUA 4Y83A 3TUBA 2B53A 4TXCA 5AP3A 5M4UA 1OBDA 3PIXA 1XQZA 3D83A 3PJCA 3R02A 4FL2A 3A7IA 2C6DA 2R3KA 3D7ZA 2J0JA 1Z5MA 2ITUA 4GFOA 4AT3A 3O23A 2G15A 3MWUA 4OBQA 3SX9A 1O6YA 1Q41A 4KBKA 4X3FB 5HLWA 4YJSA 4I6QA 4YHJA 3QWKA 4QMUA 4JG7A 2XNGA 4BDKA 2XCKA 1QPJA 4CKJA 5J7BA 2CDZA 3KA0A 4X3FA 5E8UA 2UZNA 1Y6AA 3BEAA 3PY0A 2PVKA 3BLQA 4XHKB 4LMNA 5FXRA 4ZS0A 1IA9A 2V0DA 4M15A 1RQQA 4WD5A 1I44A 3FI2A 3MY1A 3QYWA 5AR5A 5K9IA 4QMNA 1FOTA 2CGVA 1VEBA 1MUOA 4MBLA 2QODA 4FC0A 4H36A 4I3ZA 2CMWA 3P1AA 3ZRMA 3QTRA 3U4WA 4FTCA 4ZOGA 5CF8A 2O8YA 5J5SA 2QG5A 4U7ZA 5FEDA 2IVTA 4IDVA 4OTGA 4O6EA 2HXLA 4J71A 4Y72A 1H00A 1PW2A 3RALA 3VRYA 3W2QA 4EOOA 5CXZA 1M17A 3FZOA 1TKIA 4B7TA 4UB7A 4FT9A 4RX5A 2UZBA 5HQ0A 2OWBA 5DLSA 3C4XA 2GHGA 5CNNA 5AP7A 3G5DA 2YZAA 4L67A 3TT0A 3OUKA 1OL6A 5EYKA 5D1JA 5AFVA 5KE0A 4GU6A 2ITWA 3ZUTA 3QRIA 4HNIA 4IZAA 4AE9A 5EKOA 1OZ1A 5E8VA 4ZSLA 5LXMA 5HO7A 4N0SA 3ORIA 4YZCA 5DT3A 5BUJA 1ZAOA 3R1SA 4Q5EA 4YO6A 4PDOA 4DT9A 2VTIA 3ORLA 2C5OA 3PIZA 4MKCA 2ZM4A 2X7FA 1LR4A 2A19B 5AAGA 4UZDA 5IZFA 2XYNA 3QHWA 4B8LA 4GJ3A 2XK6A 4CCBA 3NUSA 2O2UA 3QAME 2WPAA 5TKDA 5BYYA 2IVVA 3ZLWA 3VC4A 2YLFA 3MJ2A 3QZGA 4HGEA 4ZTQA 5KMMA 3OZ6A 3HP2A 1YRPA 4NTTA 5D41A 5I3OA 1FBNA 3NMUF 3ET7A 4C37A 2RG6A 3Q9XA 3L9LA 4D0WA 2XK7A 4MNEB 5H3QA 4YR8A 5CVHA 4F0FA 2A4LA 2J0KA 1XJDA 5EDPA 3D7TB 1BLXA 3E93A 4U0IA 4FT0A 4MNEA 2VTPA 1EH4A 2UUEA 3R1QA 4O0UA 4EKKA 5IH4A 4CKRA 3UIUA 4FG9A 3F6XA 1QCFA 4ORKA 1G3NA 2YIYA 3ORXA 4KINA 4MXYA 4QPSA 4D1SA 2HCKA 2B1PA 5HLNA 3TIZA 2YHVA 2VTLA 4HVGA 5CU3A 5T6KA 4RWIA 3FMDA 4MD9E 2FSOX 4MVFA 4Z16A 3BV2A 2OXYA 3JY0A 4D4VA 2J5FA 4J98A 3UVQA 4AT4A 4IJ9A 4R77A 5IQHA 5IF1A 4ZMEA 2YERA 5HZNA 4WBOA 3VHKA 3TJDA 3LCDA 3OF0A 3NAXA 5IA3A 4FV5A 4E5AX 3MV5A 3ENMA 4DH7A 4JAJA 3AG9A 3EFLA 3EKNA 4HGLA 4H58A 5AIKA 5BPYA 4BR3A 1P5EA 2PVMA 5JFXA 3ERKA 3H9RA 5CLPA 2QR8A 3FLYA 4FSRA 3AMBA 4QYYA 4DGLC 2IPXA 1H4LA 1VYZA 4YNEA 3CKWA 3R01A 1H08A 3AC8A 4G5PA 2YWVA 5FGKA 2X1NA 2HY0A 3KXHA 2WMWA 4TYJA 2C6LA 3CTHA 1H1SA 3NS9A 4EL9A 2O65A 3M1SA 4L8MA 2C0OA 3P78A 4RQKA 3QCYA 4WBBB 5EW3A 3V8TA 1PJKA 4U42A 2RL5A 2ONLC 4G6LA 4JR3A 3QD4A 3O71A 4KRDA 3LCTA 4QNYA 3MBLA 2R3NA 5EHLA 4IBMA 3Q96A 4ANOA 4NIFA 4D9UA 3QTZA 5GNKA 3V01A 2FH9A 5E8XA 1JAMA 4I1ZA 1IG1A 3KRXA 4KKHA 3ALNA 4EH7A 5LWMA 4RGJA 3KN5A 2ZMCA 3OWPA 3EOCA 4C3FA 3PSBA 1ZLTA 1H25A 4UMUA 4E6QA 2DQ7X 2P2IA 3AC1A 3TWJA 5AUUA 3BZ3A 4C4GA 5J5TA 4A4XA 5ANIA 4NTSA 2YIQA 2BR1A 5CENA 5IEYA 5DE2A 4O7YA 2CHLA 4FICA 2G2IA 3O96A 3TDVA 3OCSA 4FKTA 5AP5A 4JIAA 3HGKA 4RMZA 5HVYA 4LYNA 4CT2A 3NNVA 5BVFA 4WKQA 4MBIA 2B9HA 5DT0A 4FSMA 2VTAA 4TWOA 4U6RA 4G2FA 2OJ9A 2IW6A 2JIVA 5AV3A 3NWWA 3COKA 2QOBA 4MD7E 4AUAA 3VW8A 4EOKA 5L6WL 3PSDA 3QALE 5HE2A 2ERZE 3HP5A 5BVOA 2I7QA 5H9BA 4FGRA 1WBTA 4TTHB 5C1QB 2NRYA 4NM0A 4G5JA 1UU8A 2BZIB 2VN9A 4AZFA 4BCNA 5JEBA 4GK3A 2YDIA 4S33A 4X2KA 5F4NA 2XNBA 1OKYA 5M44A 4DT8A 2XKFA 4NCTA 2VAGA 5KKRB 1OL2A 3R7IA 1REJA 4YLLA 3ZSIA 2PYWA 4IXPA 3V5TA 1T45A 3A4PA 4AF3A 5LOHA 4GK2A 3QQGA 4DEBA 1NT2A 4L43A 5ANJA 4PL5A 5DEWA 3D2KA 2CNUA 3D15A 3OUNB 2GHLA 2QLQA 3VJNA 2VO7A 3SD0A 4N70A 3VVHA 3QTIA 2AC3A 5BMMA 2UZWE 2OICA 2VWXA 3P79A 4ENYA 1OB3A 4I5HA 2ITZA 5EQEA 4LI5A 4KS8A 1OI9A 3PLSA 3EN7A 4J1RA 4DGGA 3T8OA 4EC9A 1K3AA 2OH0E 3AOXA 2GNFA 4M12A 5KCVA 3FMKA 3IPHA 4ALVA 2O64A 4B4LA 1WBVA 4IWDA 4R1YA 3NW6A 2R3HA 2ZOQA 4DGNA 2BKKA 3G9NA 4I93A 5AM7A 2F7EE 5L2WA 4FZFB 4XP3A 1CDKA 3P9JA 4W4YA 3QA0A 2C5NA 1JSTA 1WBPA 5JFWA 1R0PA 2BUJA 5H8EA 3CGFA 2B4SB 1OGUA 2F57A 3FMLA 2P55A 4IZYA 5C01A 4ITHA 2GMXA 3TXOA 3HYHA 3F3UA 3GEQA 4PF4A 5LQFA 4AS0A 3MB6A 4FNWA 4HVIA 4UMPA 2ZV7A 4QPMA 2W5BA 3U87A 3TEIA 5DGZA 5IDNA 4QMZA 5HX6A 5LCJA 4RX8A 4C38A 4YTIA 2GCDA 4I5PA 4RQVA 4TY1A 5EFQA 3HAVA 4FZDB 1YOMA 3BKBA 4JOAA 2OU7A 4QP9A 2R3JA 1ZZLA 4BC6A 4DG0E 1GIHA 3TJCA 4DH3A 1H28A 3BRBA 4YBJA 4YUQA 4M7IA 2IG7A 2WMAA 3K2LA 1LEZA 5JFVA 5L4QA 5J87A 2UV2A 5DPVA 2YEXA 3LJ1A 4BFMA 3OEFX 3EN6A 3FL5A 4K33A 2OH4A 4FYNA 3HL7A 1VZOA 2DWBA 3BYOA 4V04A 4CFXA 2UZUE 5JSMA 2H8HA 4D2TA 1H1RA 3FYJX 5L2IA 3HMIA 2YM6A 2QD9A 3FI4A 4ZTRA 2WTKC 5L6PA 2Y6MA 1P4OA 3UJGA 3V04A 4DFLA 2XVDA 3SLSA 3UMWA 2JIIA 1GIJA 5FM3A 2PE2A 1GZ8A 5B2KA 4FOBA 5L2TA 5J9LA 3NYNA 3I81A 4YZMA 5GZ9A 3GOPA 4FTAA 3R7EA 2XKDA 4OTFA 4O7VA 4E4LA 5IA0A 3FEGA 4O96A 3R9RA 3FYKX 3EZRA 4I94A 2PZRA 2WIPA 3UZTA 3DJ6A 4OTQA 1UU9A 4GIHA 3UG1A 3PSCA 3QZFA 4KSPA 2UZEA 2V55A 3GGFA 2VTJA 3G90X 4K1BA 5K5XA 1WZYA 3ATSA 4ITIA 2PULA 5A4QA 1FVTA 5DN3A 3LCSA 5D7VA 4IAFA 3DAKA 3D4QA 4NJ3A 5D11A 2JKKA 4O7ZA 2YCSA 1URWA 2R0UA 2ZVAA 3CE3A 2B9FA 3IDPA 3SW4A 3TZ8A 2WD1A 2IZUA 1OMWA 2HZIA 4GFMA 3RKBA 3UO4A 3IGOA 3FV8A 4K11A 5EG3A 4E4NA 4O81A 1V0BA 2XJ2A 4BCIA 4FTUA 2I1MA 3QTQA 1RE8A 1WVYA 5IH5A 4EH9A 5CQWA 3O0GA 3WZJA 4YGAA 2OFVA 2JLDA 4ANLA 4O7RA 5AP4A 2GNHA 1LP4A 3W8LA 1Q8WA 3BYSA 1DM2A 1YDSE 4F64A 5DMZA 1OVEA 3SQQA 2ZDTA 2W1FA 5AV2A 5HO6A 3VS7A 5EDQA 3QXPA 5H2UA 5CEIA 3FMNA 5K5NA 4JR7A 4XCUA 4O2ZA 5IU2A 5IQAA 2WTIA 4LRMA 1DI8A 4UXQA 4IB1A 2EVAA 3AC3A 3U51A 4D0XA 1W84A 4I21A 5A6OA 4H05A 3MY5A 5C8MA 3R1YA 1YXSA 1PXNA 2OO8X 4JBVA 4G3FA 4G3CA 4ZJVA 4AOTA 4MQ2A 1DS5A 3NPCA 2CLQA 1A06A 5DHJA 4FVRA 3W1FA 3DT1A 5AV1A 1S9IA 3JUHA 4GFGA 4QMMA 3VRZA 3AT4A 4TWCA 3SRVB 3G0EA 2BDJA 2OG8A 4C57A 3QLFA 1PMUA 2ITNA 5H8BA 4BF2A 3OOMA 1UVRA 4QP1A 4CZTA 5HVKA 3KRRA 4RWJA 3SRVA 3UVRA 2PVYA 3EB0A 3CTQA 1PF8A 4AA0A 3UP2A 4G9RA 4AA5A 3BI6A 3LMIA 2Y7JA 3K54A 5M4IA 5HTCA 3I0QA 2HZNA 4BBFA 5CAUA 2EUFB 5HX8A 1OM1A 3KRWA 5AAEA 3DAJA 4G16A 5DH3A 4GT4A 2CCIA 3ZO2A 3FWQA 2VWYA 4K2RA 3VF8A 2HZ4A 3FLNC 2UVZA 2PMLX 4I6FA 2AC5A 4QPAA 4XH6A 2XK4A 3F7WA 4BDEA 4UXLA 4F7JA 5HBHA 3Q3BA 4IM2A 4JXFA 5LMKC 3LFCA 4F7SA 4N4SA 2VNYA 3LCOA 4CFNA 2JC6A 2WHBA 3RWPA 3VUIA 3CXWA 4DFUA 3BE2A 2J7TA 2FGIA 3MTFA 1PKGA 4WIHA 2YFXA 3NUAA 5M4CA 2FA2A 3DKGA 3GU7A 4RJ6A 4EONA 3DS6A 2JD5A 3QRKA 2GDOA 3IW8A 5M07A 4IX5A 5HCXA 5F94A 4BICA 5AR2A 2JBPA 1DAYA 2F2CB 3FL4A 5CTPA 2XK3A 4R8QA 5E8WA 2IZSA 4IFCA 4AZEA 4BDBA 5GZAA 1JVPP 5CSPA 5J95A 3UE4A 3OS3A 5TE0A 4ZZNA 1OPKA 4GT3A 3RK9A 4CFUA 4RJ3A 1SVEA 3IO7A 3EFJA 4PQNA 2RIOA 4OT5A 1OL1A 1O6KA 4H3BA 2XIKA 2UVYA 5M51A 1GJOA 3PVBA 4F9CA 3DBDA 2JDSA 4QYFA 3FSFA 2GNLA 4RWKA 4HVDA 5B0XA 3S0OA 4TNDA 3BELA 3MDYA 5F95A 3A4OX 3BYUA 4RFZA 3DKCA 3FJQE 3W2RA 5E90A 3DLZA 2JAVA 5C8NA 3C5IA 2E9PA 4IB0A 4JQ7A 3SG9A 3MH0A 3W16A 4CVAA 2VO3A 3ZEPA 4C3RA 4EC8A 3C7QA 3VS0A 2ZJWA 2B54A 3U6JA 3HV4A 4FIGA 2WO6A 2J0LA 2FSLX 5JH6A 4GG7A 3RCJA 3BBWA 2OZAB 4U40A 4C4JA 2R3QA 3AQVA 3BQRA 4P2KA 3ZCLA 3U55A 2XRUA 3ZSGA 4A9RA 5LVNA 3AT3A 5J9YA 2OZAA 3IW4A 3MH2A 4D4RA 4WNOA 4EZ5A 3UODA 4BN1A 5F9EA 5KX8A 5HTBA 4YJPA 4YSJA 4M0YA 2QKRA 4RZVA 3QHRA 2OI4X 3F3VA 4DG3E 2X39A 3ZRKA 4BL1A 2QHMA 3HRCA 5C03A 2OIDA 5LVLA 4QMXA 2X0GA 3NSZA 3QRUA 5CALA 1OUKA 3RZBA 3EQPA 2UW6A 2OBJA 1SYKA 4MD8E 3DFAA 4OTRA 1YW2A 3IECA 4QT1A 3SDJA 3DY7A 5EKNA 3L8PA 4E7WA 5I9XA 4X21A 3RGFA 3OCGA 1YWNA 4QMQA 3PIYA 5FDXA 1QMZA 2X2LA 3PWYA 4FKWA 5FRIA 3VS3A 2BIYA 4A9TA 2EB3A 2WMSA 2VWUA 3DDPA 2BAKA 3MFRA 3PVWA 4FG7A 1JKLA 4IE9A 4AXAA 3R8LA 3ATTA 1GZNA 2BRNA 4Z55A 1FQ1B 3EMGA 4TT7A 2XJ1A 2IN6A 1JQHA 2PVJA 4FOCA 5HOAA 5LVMA 3EQBA 2WMQA 2VNWA 1HCLA 3PXFA 2OKRA 3KKVA 5GHVA 4LM5A 3DQXA 3PUPA 5KHXA 4NKSA 4H1MA 3UYSA 2XZSA 3BU6A 4DCEA 4O6LA 3VUMA 3TUDA 3UIXA 1KOBA 3OMVA 3Q32A 4O0TA 4W4VA 5EYDA 5HG7A 3TV6A 3VS6A 1J7IA 3IOKA 4QP4A 2X2KA 5ACKA 2C5VA 3K5VA 4HOKA 3MA6A 4U3ZA 2YACA 3FUPA 1J1BA 3OTUA 4BKJA 3KCKA 4FT3A 2J0IA 4PX6A 2ZV2A 2H9VA 2UZTA 4FL1A 4PMTA 1YWVA 1ZWSA 3ZOSA 1GAGA 2EU9A 3D14A 1YI4A 3TM0A 4QQTA 3VJOA 1NW1A 4IFGA 4QTBA 4S32A 1UKIA 4W8EA 5CEMA 3H0YA 5IA1A 3H3CA 4IQ6A 5IQEA 3OC1A 1CTPE 5CY3A 4IX3A 3G51A 4G6NA 3R8PA 3QQHA 5GZ8A 3LQ5A 2J51A 3CGOA 3RMFA 4FUXA 4C2VA 3RP9A 4DLJA 1NXKA 5D9HA 1P2AA 3ZH8A 1TQMA 3E5AA 4PTEA 5DFPA 3T9TA 3HVCA 3ZLSA 1OIYA 2WELA 3A2CA 4J99A 1V0OA 4X2JA 2SRCA 4ALUA 4E93A 2ZAZA 3PY3A 5IA5A 4PDYA 4GEOA 3FZRA 4R7BA 1P4FA 1URCA 1YWRA 2CN8A 3AC4A 3REPA 4GSBA 5HE3A 1M2QA 1B39A 1XO2B 3DPKA 4IWQA 1UWJA 3LFAA 5M53A 3MGYA 3HV6A 5AUWA 1SVGA 3UYTA 3NNWA 3HMMA 4FIFA 3ZZWA 4YURA 3UBDA 4I5CA 4ZJIA 3FDNA 3I5NA 3RNYA 3BWFA 3CC6A 5BMSA 5A3XA 4P5ZA 3SA0A 2PUIA 4ZMFA 3N4VA 1OKVA 1H07A 3Q6UA 4D4YA 4GW8A 4O38A 3VS1A 3IK3A 2C6EA 3RJCA 1ZMVA 4P7EA 3BCEA 4FEQA 3ETAA 1WMKA 4WT6A 3HA8A 4EK5A 2ACXA 4LRKA 4FEUA 3FBVA 3LCKA 4RC4A 4GKHA 3R8VA 2PVHA 2JKQA 4G3EA 4O91A 3FQEA 4MXXA 4XJ0A 3MPTA 4U79A 5FDPA 3FE3A 4DH1A 3P5KA 4AACA 2QO2A 3QFVA 5KUPA 5IQFA 4NM7A 2W1IA 3BLRA 3GVUA 4HJOA 2REIA 2R9SA 3QUDA 4I0SA 5E1SA 3EQHA 4ACGA 4E6AA 1PRYA 3I6WA 4FF8A 4AFEA 2G1TA 3M42A 3QKLA 2ONLA 4CQEA 3Q9YA 4RVTA 4NW6A 2GPHA 4L3LA 4OR5A 2W1CA 2WB8A 4LUEA 4O2PA 4N57A 5FUTA 3R9OA 4GUBA 2WEIA 5KZ0A 3QF9A 2PVLA 2VWVA 2RFNA 5CSHA 1BKXA 1F3MC 3TCPA 2XNEA 3DAEA 5HORA 5IDPA 3II5A 5B7VA 4Y85A 4BWXA 3D9VA 5HIBA 3CR0A 2HAKA 4GK4A 1OBGA 5IEVA 4IH8A 4JNWA 2X6EA 4O21A 5HI2A 3UMXA 1KE8A 2YM5A 2PE1A 4U97A 3WARA 3LMHA 4TZRA 4WRSA 5HNIX 2NP8A 3E3BX 4FV9A 4JIKA 4AW1A 3SW7A 3BHTA 4I0TA 4ZP5A 4G9CA 2C5XA 2E9UA 4FTMA 3UQFA 3FI8A 4OTIA 5TF9A 2V22A 3CJGA 3BGZA 4FV1A 3TNIA 3ZS5A 4QP8A 4WUAA 3FLZA 4O7WA 3IW7A 5JFSA 4KABA 5CWZA 3OT3A 4WSYA 3VF9A 3NCZA 2VTOA 4CZYB 3S1HA 5JMSA 4Z3VA 2WFYA 1FGKA 3SXSA 4I4FA 4L6QA 4DLIA 4RSSA 4FL3A 2QONA 2WTJA 4U81A 4CFVA 4L00A 2BILB 4LMUA 3A8WA 3Q52A 2I0EA 1QPCA 2BALA 3PWDA 4U8ZA 3QC4A 4UALA 5CX9A 1AGWA 3VS4A 1JKKA 5AP1A 2YIWA 2VWWA 3RINA 1JNKA 3T3UA 4GVJA 2BVAA 1UU3A 3ORKA 3Q5ZA 4R5YA 4OTWA 2XCHA 3A8XA 3RK7A 2YJRA 3PDTA 4FUYA 3FMHA 3NUXA 4G31A 4W4WA 3TL8A 3ROYA 3EZVA 4XNEA 3TNHA 3R8ZA 4EHVA 4BYJA 5M08A 2XMYA 4YPDA 4TRLA 5HKMA 2X81A 2XBJA 4HW7A 4FR4A 5GJFA 4GJ2A 4DEHA 5L8LA 4AGDA 4OTDA 1L3RE 3F82A 1IASA 2BAQA 5AUVA 3ZFYA 1SNXA 3LFNA 1CKPA 3R21A 3NUNA 3TN8A 3KXMA 4EOJA 1Z57A 4M68A 5I5ZA 4QQCA 3ZDUA 3LXKA 4I4EA 5HBJA 4O1PA 5KHWA 5AP6A 1BX6A 3P86A 2CN5A 3BYVA 5EM8A 1PXLA 4O0XA 4IVDA 4YJVA 5A4EA 4EOIA 3EFWA 3AMYA 3ACKA 3D7TA 3GCUA 1KE7A 4LV5A 4E8AA 1H8FA 5HHWA 3POOA 5GIOE 1UNLA 1Y8GA 2VUWA 3QTWA 3ZU7A 2R3LA 3DXPA 2ZV8A 2FUMA 4IWPA 3S3IA 4BZNA 4KSQA 5EI6A 5C9CA 4ANQA 4EK4A 3UDBA 4R3RA 5JGBA 2EB2A 4PRJA 4GG5A 3TNQB 4EI4A 4M14A 2C68A 4BI0A 3SXFA 1PMEA 3H10A 5HIDA 5J7HA 2YJSA 4CG8A 3GENA 5AX9A 4HZRA 2YDKA 2ETMA 2FB8A 4C35A 1ZYCA 2JDVA 3WE8A 1IA8A 4D2PA 1PYXA 2WTKB 4YJQA 3A99A 4C7TA 4YTFA 2R3FA 4KNBA 5M57A 4XMOA 5ANEA 3W18A 1WBOA 3GCSA 4BIEA 3D5XA 4RT7A 4XV3A 5JZNA 4TWPA 4K9YA 1KE6A 4Q5HA 5LMAA 2XKCA 3S95A 5EW8A 4DGMA 1JWHA 3OROA 4FKGA 1Y57A 1FGIA 2QU5A 1UNHA 3DZQA 1ZYJA 3F69A 3ZHPC 4BDJA 4W8DA 3WF9A 4ASZA 1PXPA 3DK6A 3HKOA 3C13A 5AUYA 1BMKA 5FXQA 5HNGA 3W33A 3UO6A 2PMOX 4W9XA 3LQ3A 3MH3A 3PE1A 2GFCA 3FLWA 5GJGA 1RW8A 5AR8A 5DEYA 1ZMWA 1NVQA 2X7OA 1OIUA 2Q0NA 3C4FA 3ULZA 5E91A 4DH5A 2UW5A 1V1KA 3BHUA 4IADA 2BFXA 1H27A 4MAOA 5FTOA 4ZEGA 3MESA 1U46A 5CU2A 3EFKA 3L1SA 2JFMA 3TDWA 4F63A 4PUZA 4F70A 4G6OA 4JRNA 3F3ZA 4HCVA 2QR7A 2YITA 4LUDA 3RAIA 4D5KA 4DF3A 4EH4A 2QVSE 3ORNA 5L2SA 1G5SA 3F66A 3AGLA 5BYZA 4PMSA 5IQGA 5KMKA 4KRCA 3V5LA 5D7AA 1IAJA 2Y6OA 3OCBA 2CGXA 4FK3A 4JG6A 4RA4A 3RM7A 5J1VA 3VS2A 1PHKA 1ZYLA 4JLCA 5DBXA 4ACHA 4OAVB 1ZXEA 3LFSA 3WZDA 2B52A 4DA5A 2R2PA 2XEZA 4V05A 1GNGA 4II5A 2B0QA 4DTAA 3KEXA 4FKJA 3FKNA 3PA3A 2ERKA 3HV3A 2VO0A 3CQUA 4UEUA 3ZBXA 2NNWB 3IONA 2I40A 2CNVA 4FIHA 5AA8A 3AMAA 3R30A 2UVXA 3UZRA 3DZOA 4AAAA 4FKQA 1STCE 3HEGA 4J53A 2F4JA 3JR1A 3DKFA 5AV0A 3IDCA 2AUHA 3EH9A 1UNGA 1OKWA 4CTCA 2W4KA 4F1MA 5IG1A 4O7LA 4XRJA 3PJ2A 3VUGA 4YJTA 2JKOA 4D2SA 4UWCA 3R0TA 1Q62A 2R0IA 3I79A 3QTUA 3T3VA 2XNPA 3ANQA 2WAJA 3F5GA 1ZY4A 3NW7A 4ZIMA 4NZWB 4KKGA 2QOKA 5IUIA 3GFEA 5DI1A 4CV8A 3FQSA 3KRLA 4JDHA 4XBRA 3RAWA 3UIMA 3UNZA 4CKIA 4PDSA 5BQ0A 3LMGA 4JBQA 4D9TA 3KL8A 3MSSA 1BL7A 4TYHB 2YAAA 3SGCA 3F2RA 4YZNA 3OY3A 2LAVA 1JKSA 3LLAA 3KXGA 3DCVA 1RDQE 1TQPA 2H96A 4TYHA 4OW8A 3FC1X 5DT4A 2XB7A 3DK7A 3VUHA 1A48A 3R8MA 1PXOA 4FTTA 2BPMA 5LWNA 3JY9A 1YXUA 3V5QA 3QTXA 3E7VA 2AYPA 3CBLA 3VULA 1OIQA 3I5ZA 3UNJA 2YN8A 4EOPA 5KNJA 4J8NA 3CIKA 4LV8A 4CGAA 4OTPA 4LOQA 4XG3A 1ATPE 1OPJA 4IM3A 4HYHA 5LMKA 3V6RA 3COIA 1WAKA 2PVNA 2BKZA 3GC7A 4IX4A 4MHAA 3C4EA 4A07A 3IDBA 3KCFA 1ZYDA 2IZTA 5EDRA 4BTMA 2WQEA 4CFWA 4ERWA 5BX0A 4ZY6A 3COMA 4CT1A 3UZPA 2C6OA 3COHA 3KXXA 3W2PA 1KUTA 3B8RA 1R39A 1JSUA 4KBAA 5EOLA 4ANBA 4RC3A 4AU8A 5DNRA 1Q5KA 4PNIA 1H26A 3LOKA 3PJ3A 4GCJA 2CKOA 4FIIA 3NVMB 1MP8A 4HGTA 3BIZA 3VAPA 2WQMA 3D2IA 3L9NA 3PA4A 3A7JA 4FZ6A 4YJRA 4CNHA 2ZB1A 2Z60A 2QKWB 1J1CA 4Q9SA 2I0VA 4GVAA 1KV2A 1QPDA 2CJMA 5CNOA 2XK9A 3BWJA 4RX9A 3TKUA 4UYNA 5K4IA 4IB5A 3LM5A 3R1NA 3PA5A 1XH8A 2X8EA 3HV7A 1K2PA 4BWPA 4G34A 3QRTA 4KWPA 2VWZA 4A7CA 4U43A 2BHEA 1ZOEA 2OSCA 3MJ1A 3TKHA 3NGAA 1RJBA 4GT5A 3AC2A 2XK8A 2FSTX 4WNKA 5A54A 4BHZA 4AE6A 4MH7A 4Q9ZA 3AD6A 4MYGA 2GHMA 4YSMA 4TL0A 3PTGA 4JDJA 2HY81 5LVPA 4USFA 3PRIA 3QZHA 4IX6A 5CT7A 5AUXA 5LMBA 5GIPE 4S31A 2BDWA 2XIYA 4JG8A 1FMOE 4YZDA 4BIDA 3ZC6A 4D2VA 5BNJA 1O9UA 3UQGA 4I20A 2JBOA 2RGPA 2YCFA 3WF5A 4L3JA 2GNJA 3UOKA 3W2SA 3BU3A 2XA4A 4H39A 2NO3A 1YHWA 4RWLA 3GC8A 4V0GB 5IUHA 3ZLYA 5FP5A 3VHEA 1LPUA 2J5EA 2W9FB 4I0RA 4QMOA 4XG9A 2JAMA 2C0TA 2OF2A 4QP6A 2IZRA 5FXSA 3RPRA 4V0GA 3VUKA 5B2LA 2PK9A 2C4GA 4PDPA 5HG8A 4QP3A 4AZSA 2VTQA 3FKLA 3FLQA 3KQ7A 4I6HA 4TYIA 1Q4LA 1VJYA 3OG7A 4DG2E 3O8PA 5HG9A 5BUEA 3QGYA 2W06A 3ZZEA 4AGUA 4DINA 3NX8A 2WMRA 4RX7A 4YJUA 2E9NA 4FSTA 3ORMA 3DXNA 4GRBA 3QU0A 3OD6X 2XKEA 2QOIA 2WTVA 1ZARA 2R7IA 4MXZA 4QO9A 4IZ5A 2ZV9A 3TV7A 3V6SA 4OTHA 3VUTA 3QUPA 3U4UA 4C58A 3SG8A 4ZTSA 5CI7A 4IVBA 5EOBA 4EH5A 1Q8UA 3NAYA 4JVGA 4K77A 4KB8A 4CMOA 5C4KA 3KREA 2VU3A 3G6HA 5IMXA 4EQMA 4D58A 3ELJA 2RSVA 3BPRA 1O6LA 1ZRZA 2BRHA 3LAUA 4ASXA 4AW0A 4TPTA 3DBEA 2X9FA 4X2GA 2ETKA 1CSNA 4XX9A 5DVRA 3MIAA 4GYGA 3BYMA 4IW0A 4L9IA 4ZK5A 4FV2A 3W32A 4BRXA 2C30A 5HD7A 4FTIA 5KMIA 3VBXA 4CFFA 3NLBA 3RPYA 3OWJA 1HCKA 4HPTE 2W4JA 4ZJJA 5ACBC 5CU0A 4NL0A 2C5YA 3I6UA 4BCPA 5ICPA 4D28A 4O0YA 5B2MA 4FE2A 5J1WA 3ORTA 4EJ7A 1M14A 4QYHA 5E8TA 4L46A 2R3IA 3R7YA 4IAKA 4XP2A 5HCYA 3MYGA 1X8BA 2EWAA 4QNAA 1OECA 4EQUA 1UV5A 3RPOA 3JPVA 3WF7A 4DFXE 2PVFA 4RVMA 2O0UA 3KMMA 3OTVA 3E62A 3BU5A 3EKKA 4PWNA 1XBAA 1UWHA 3PPKA 3ZFMA 4C62A 4IWOA 2PMNX 4NW5A 4AP7A 4YNOA 2GQGA 4WRGA 1E1XA 4DFZE 5CEOA 2J2IB 4DTBA 4LG4A 1GIIA 4V01A 4ZSEA 5KMOA 5HLPA 3CQEA 4WHZA 1W8CA 3Q4UA 3UPZA 3MN3A 4APPA 2YZLA 3PPJA 3BGQA 4LQMA 4ANNA 3E92A 4EZ7A 5AP0A 3RVGA 4AW2A 2YAKA 3NDMA 2JDOA 4KIOA 3PRFA 4BKZA 3BGPA 2BFYA 2HWPA 4QMYA 4LRJA 1HOWA 3JXWA 2F49A 3I60A 5ANGA 4ITJA 3MTLA 1CKIA 1KE9A 2VZ6A 4FIEA 5CVFA 3ZYAA 3W2OA 2GNGA 2H6DA 5AM6A 4MXCA 3F5UA 1KV1A 1QPEA 5EH0A 3C4ZA 5K4JA 4CLIA 3KK9A 4RA5A 4U3YA 2OJIA 2PPQA 3D0EA 4JL9A 4Y46A 2RFEA 4ZTLA 3QQJA 4GYIA 4C59A 3PZEA 4NEUA 4RG0A 4RBLA 4JDIA 2CKEA 2CKPA 3FY2A 3CPCA 1DAWA 3WF8A 2BAJA 4FV6A 3TTJA 5E1EA 3KF7A 3NVKI 1JLUE 3KGAA 3Q04A 3DB8A 3OXZA 4H1JA 4U80A 4YC8A 3KULB 3FY0A 3ZTXA 2IO6A 4NUSA 4O1OA 3EYHA 1M52A 1W83A 5EQPA 5FP6A 2JEDA 4EK3A 3KULA 2WTDA 5CT0A 2ZM1A 3RZFA 1W7HA 4FEXA 2ITYA 3O51A 2OJFE 2PVRA 5HNBA 4EOMA 2PU8A 5HICA 1R3CA 1PMNA 3ODZX 4R3CA 4FKIA 5A14A 3KVXA 4AN2A 3DJ5A 4NFNA 4UZHA 4X2FA 2YIRA 3F5XA 3PYYA 4CQGA 2EXMA 2GS6A 2OF4A 4IMYA 4TKSA 1SZMA 3WF6A 3QKMA 1F0QA 4FTQA 4MWHA 5H8GA 3POZA 2YM3A 3MY0A 4FKVA 3FI3A 4HYSA 4DFBA 2CLXA 4XG8A 4YPSA 4P4CA 5J8IA 3MB7A 3F5PA 2H34A 4X2NA 3SKCA 3VQHA 2F9GA 2F2UA 2XM8A 5A46A 4R78A 2VD5A 2VX3A 4OBPA 4EH8A 4AN3A 3EQDA 3HECA 1IRKA 3DA6A 3LFQA 5T3QA 3JS2A 5DRBA 3SC1A 3DTWA 1GOLA 3O2MA 2XH5A 3HAMA 4WG5A 4C4FA 5ETIA 4RFMA 3WI6A 3MVJA 4USEA 2ITTA 5FBOA 5CF6A 4XYFA 5IA4A 3UQCA 4ANMA 4F9WA 3CY3A 4S2ZA 5JQ8A 5BVKA 3GU8A 4F08A 4C61A 3L9MA 2R3MA 4EOQA 4EORA 2UZVA 4HPUE 4JT3A 3FZ1A 3PJ8A 4D1ZA 4ZAUA 1F5QA 4YU2A 2GTMA 3C5UA 5IH6A 4BY9E 2PZIA 3VBWA 5L6OA 3L9PA 4GIIA 2OJGA 4FNZA 4FNYA 4TYEA 2BTSA 4F09A 4FA2A 3UP7A 4M0ZA 4EUTA 3TNPC 2W1DA 1WBSA 3LQ8A 4Z7HA 2BZJA 3NRMA 1Y8YA 3KU2A 3K3JA 4QYGA 5E8SA 4JX3A 5M55A 4UWBA 3QX4A 2XJ0A 1YI6A 5JGAA 2R64A 1H24A 4O86A 3VBVA 3SOCA 4FSQA 4EOLA 3FC2A 2O3PA 2B9JA 2C1BA 2PWLA 3E8DA 4JQ8A 4MK0A 1XKKA 4M3QA 3EN5A 3LJ0A 3OVVA 4NM5A 4UMTA 5DYJA 1XH5A 3PG3A 4NFMA 1M2RA 4U44A 3G33A 3TZ9A 2XF0A 4IM0A 4YJOA 4BCHA 3TNWA 3OOGA 4RC2A 2I6LA 2J6MA 4AQCA 5CYIA 4FV4A 4BGHA 3B2TA 4LL0A 3I7CA 4ZXTA 3MVMA 4FNXA 3EQFA 5ETFA 2E9VA 3M2WA 2OIQA 4A06A 4C4IA 3E63A 3PLAE 3ZXZA 5AADA 2JITA 3ZDIA 2Y0AA 2BCJA 2QLUA 1KWPA 1WCCA 3P7BA 3FPQA 3V51A 4L3PA 3DB6A 4B9DA 1AQ1A 3BQCA 3FPMA 3NIEA 2RG5A 3PP1A 4EJNA 1BUHA 4IHPA 2ZB0A 2BRBA 3H9FA 1JSVA 3MPAA 4CZUA 1CM8A 2PE0A 4Y8DA 2B7AA 2XUUA 3D5WA 3RHXA 1BYGA 4WO5A 1KSWA 5HO8A 3RBWA 4IDTA 1H1QA 1NVSA 3QKKA 1E9HA 4XLVA 5FTQA 3PXZA 1WVXA 2WMTA 3E8NA 4A4LA 4CYJA 3LE6A 2FVDA 3R2YA 4JX7A 4MEDA 4MNFA 3QGWA 3ZONA 4BDAA 2QURA 3BBTB 4EBVA 2R3GA 2Z8CA 2HOGA 4WNMA 4FMQA 4CRLA 2CGWA 1W82A 1J91A 3LKMA 4MF0A 3RWQA 3Q4CA 5EHOA 5EI2A 3ID6C 4ZSGA 5EQYA 3LFEA 3C1XA 3HUCA 5DA3A 3WZKA 3IOPA 3SXRA 4F9AA 2YCQA 3NEWA 3V5PA 5BVNA 2RFDA 2W7XA 3GUBA 1YOJA 5BVEA 4NYEA 2W0JA 3OHTA 3P0MA 4FIJA 4LOPA 2IVUA 3DLSA 3LFBA 3DQWA 2QOLA 2W99B 3DOGA 2YM4A 1FINA 4KIKB 1Q8TA 4ACCA 2J50A 5T68A 4QMTA 1UU7A 3IKAA 5CZHA 4LFIA 4BDHA 1OITA 4F0IA 4KIKA 4J96A 3C0GA 4QP7A 4ZLZA 3EN4A 4CFMA 5HVJA 3ZO4A 4AG8A 3DNDA 2E9OA 3IG7A 4FV3A 4KBCA 4QMLA 4GKIA 4HNFA 4LL5A 4USDA 4YMJA 3GC0A 4AA4A 4FKRA 4D55A 4P90A 2HELA 4M67A 4AZWA 5M06A 3G0FA 4EOSA 4NK9A 4W9WA 4FVPA 4RPVA 3UC4A 3IW6A 4FT5A 5FLFA 3FSKA 2WNTA 5KO1A 4RIXB 4ID7A 5JQ5A 3ORZA 1A9UA 2J90A 1V0PA 4GL9A 3OBGA 5AV4A 2C6TA 3BHYA 2VGOA 4P5QA 4RIXA 2FSMX 4UY9A 4L42A 1S9JA 3ORPA 4BDIA 4MTAA 3VN9A 1XR1A 1J3HA 3NNXA 4UMQA 3SHEA 3ZBFA 4DN5A 4BCJA 1TVOA 2X6DA 4E6CA 2R4BA 2JGZA 3VW6A 5CAQA 4EH3A 4FX3A 4ALWA 1R78A 2ESMA 4BDGA 2C3JA 5CEPA 3FLSA 2PY3A 5HEZA 3Q53A 4FG8A 5J9ZA 2G2FA 1G8SA 2PSQA 4JI9A 4C4EA 3F9NA 4KD1A 1OUYA 2O63A 4EYJA 4CG9A 3ZRLA 1IR3A 4FVQA 3QXOA 4QTEA 3A60A 4TN6A 5F1ZA 4RVLA 5DR6A 4BCQA 4BI1A 2BHHA 1GY3A 3MH1A 2PZYA 1SM2A 3NYVA 4KS7A 2JIUA 4DBNA 5CZIA 4XOZA 2ITVA 4E20A 3CKXA 5C4LA 4EYMA 5IUGA 2VTNA 1H01A 1AD5A 4BDFA 3CD3A 3PP0A 4G17A 4HYIA 3W2CA 5CEKA 5EW9A 5L2QA 4PTCA 3NIZA 4PNKA 4FTOA 4RJ8A 4YHFA 3S4QA 2WMUA 4F7LA 3VUDA 3ITZA 5CXHA 1YDRE 2YIXA 3OW3A 5ETAA 4DE4A 3AC5A 5DG5A 1H0VA 3WIGA 5A4TA 1PKDA 3H0ZA 4CV9A 3ZM9A 3KMUA 4H3PA 3CTJA 3QZIA 5AAFA 4F9YA 1BI8A 5E9EA 1YI3A 2RF9A 4G3GA 2C47A 5FEEA 5AX3A 3I7BA 4AN9A 4JS8A 3UIBA 4IAIA 3V8SA 2GFSA 3VBQA 3ZEWA 5KMJA 4FI1A 2W5HA 4ENXA 4J97A 2W1EA 5FQDC 4IANA 4DHFA 4O83A 2BTRA 2XNOA 5EYMA 2A1AB 3QYZA 4MQ1A 4BBEA 3ZO3A 1I09A 2WGJA 1OIRA 3DNEA 4H3QA 4XLIA 5DWRA 4BWKA 5IA2A 3TV4A 2HYYA 4L53A 5L8JA 3GQIA 1M2PA 3L8SA 4KIQA 4QQ5A 4PL3A 3RTPA 2O5KA 3CP9A 3BX5A 1PXMA 4O0WA 5AWMA 3FZPA 4AWIA 1JBPE 1KOAA 2QOOA 3PXKA 2JDRA 4PP7A 5I9ZA 3EL8A 3B8QA 3AXWA 2YM8A 1M7QA 2GQRA 4AFJA 5HESA 3U8WA 1ZOGA 2QOCA 3VQUA 2PUUA 4E6DA 3SVVA 3FHRA 1YKRA 3U6IA 2WMVA 3RM6A 3ZSHA 4BCGA 4ZS4A 5AUTA 5I0BA 4FGBA 1Y6BA 1DI9A 3UTOA 3SV0A 4C36A 4E5BA 4F6SA 4IB3A 1XWSA 3BV3A 4I23A 1E1VA 2VGPA 2PMIA 4YZBA 2GS7A 2G01A 2QO9A 4KUJA 1IAHA 3FXXA 3U6HA 3A7HA 2ZMDA 3HA6A 4YC3A 5FG8A 3LM0A 2B9IA 2OZOA 2RKUA 4CYIA 3AT2A 5IPJA 1PXIA 2HW6A 3QC9A 4RIWB 2F7ZE 3OEZA 4RIOA 2JFLA 4OLIA 4YLKA 3F2NA 2BRMA 3VNTA 4MXAA 5JZJA 2Z02A 2DYLA 3E8EA 3VO3A 3LHJA 5DIAA 4BBMA 5ITAA 5KBQA 3DTCA 3ODYX 2C3LA 4MXOA 4RIWA 2WQBA 4X3JA 3DU8A 2PL0A 3Q4TA 3DBQA 3THBA 4DCAA 3DDQA 5DOSA 5CS6A 4AZVA 3RK5A 5D12A 4O84A 5JK3A 4LOOA 4M84A 3GCVA 2X9EA 4E3CA 3ZFXA 1YXVA 5TT7A 2P3GX 2OJJA 5BUIA 5A4CA 1MQ4A 1PXJA 3UOLA 2A27A 5L8KA 3GP0A 3H9OA 1JPAA 1MQBA 2P4IA 3LXLA 2CKQA 4XS2A 3R28A 3AGMA 3G9LX 3GOKA 4R3PA 3LIJA 3ZXTA 3GCPA 3NYOA 3LW0A 4KKEA 5HIEA 1SMHA 3GXLA 3HMOA 5EYCA 1U59A 3FXWA 3EQGA 4YJNA 5EK7A 4F7NA 3CEKA 4RVKA 4BGQA 2Y4PA 4O22A 3MVLA 4Y5HA 2QOHA 3UO5A 3R7OA 2PUNA 1OPLA 4I92A 4UMRA 5I9WA 4R1VA 4BCFA 3FZSA 5LCKA 3MS9A 2Y4IC 5CI6A 5M09A 3GQLA 4QTAA 4DEGA 4BCMA 2WQNA 3DV3A 4FYOA 1U54B 2W05A 4ZTMA 5HD4A 3OT8A 1Z9XA 3OY1A 5FBNC 4N6YA 3VBTA 2DUVA 1U54A 4I6BA 4BI2A 3C51A 2UW3A 2WU6A 4CXAA 1IEPA 1J7LA 2XIZA 2XM9A 4BTJA 3QD2B 2JKMA 3HDNA 3LFDA 1BL6A 4M66A 4O0RA 4NIFB 2HIWA 2HZ0A 4BDDA 2BZKB 4HGSA 5JGDA 3UOJA 2WU7A 5JN2A 1VR2A 2I0HA 1L8TA 3PVUA 2NRUA 5EI8A 1Q3WA 4MF1A 4GUEA 2P33A 5JKGA 3QCSA 1XH9A 3TZ7A 3QBNA 3EN9A 1YHSA 2ZDUA 4OT6A 3KK8A
chains in the Genus database with same CATH superfamily
4E4XA 3FXZA 3MFSA 2J0MB 2XIXA 4YP8A 4DEDA 4EQCA 4YTCA 4ARKA 1Q97A 4R5SA 5JRQA 3TUCA 3PJ1A 4E73A 5CF4A 2VTRA 2BRGA 1R0EA 3PPZA 3UPXA 3HDMA 4AAYA 3QUEA 3FMJA 3QQUA 4X3FC 3WE4A 5J79A 3H30A 5GINE 1YQJA 4QD6A 4KAOA 3Q5IA 4BYIA 2OXXA 3TTIA 2QOQA 4IAYA 4AT5A 3S00A 4FZ7A 4DFNA 3F88A 4X0MA 4OUCA 2W17A 5LARA 4D2WA 1YDTE 2YM7A 2UZLA 3VBYA 1ZY5A 3WZEA 4DFYA 3P4KA 4C02A 1APME 4UWYA 2GQSA 3WIKA 4OGRA 3FQHA 4EBWA 5CQUA 1U4DA 1VYWA 3HZTA 3R9DA 4NT4A 4R7IA 3WYXA 3Q60A 1T46A 4GS6A 5FD2A 5I4NA 4PTGA 3IQ7A 3BHVA 1W2DA 1U5RA 2WTCA 2HW7A 4QMVA 2GS2A 3SAYA 4UX9A 5CASA 1XH7A 2XALA 3R71A 4I22A 3E8CA 4ZSJA 2Y9QA 3HMNA 4HVHA 3PUFC 2VX0A 3R7GA 5BVDA 3Q6WA 4RIYB 1R1WA 3ACJA 4DYMA 3DBCA 3O8TA 2X8DA 4EK6A 4K0YA 4RIYA 4FSYA 1XH4A 3PXQA 4FBXA 1Q99A 2WMBA 2WOTA 4FEWA 2OK1A 1YHVA 3OFMA 4YBKA 1NY3A 5E8YA 3GBZA 2IVSA 3PZHA 4NKAA 1Q3DA 3HRBA 4D4SA 5KZIA 2PUPA 3KXNA 2CCHA 5ETCA 3CJFA 4XEYA 1H1PA 4FV0A 5DR9A 4XUFA 4DTKA 5AEPA 3G2FA 3OXIA 2YDJA 4LGDA 3FHIA 4BZOA 2WMXA 3KFAA 4EH6A 1FPUA 2XNMA 3RHKA 3LFFA 2R7BA 4WUNA 3RNIA 4GU9A 3QTSA 2CGUA 3R9NA 4O7NA 2W1ZA 2BZHB 2C6IA 2J9MA 3F3WA 3CSVA 2UW9A 4YTHA 3BLAA 4QP2A 3QD0A 4YO4A 4FKSA 5F20A 4APCA 3C9WA 4UV0A 4D1XA 5CU4A 4O0SA 4DH8A 4O7TA 3EL7A 4ONAA 4XP0A 5CSXA 4PPBA 4BTFA 5ANDA 2BDFA 3DFCB 5HG5A 3DK3A 4EK8A 3HNGA 4JQEA 1WBNA 1XH6A 2QCSA 4CEGA 4IVCA 5M4FA 5M56A 3WYYA 2IW8A 3LVPA 2OW3A 3P7CA 2FO0A 3D94A 3H4JA 4KA3A 3DGKA 1FMKA 3C4WA 4BTKA 5IEXA 1W0XC 3V8WA 5E7RA 4ZLYA 5HE0A 2VTHA 5AUZA 4FKPA 1ZYSA 4B99A 3E87A 4LGGA 5GJDA 2ITQA 4U45A 2HWOA 3G6GA 4CD0A 5CVGA 4HYUA 2WTWA 5ANKA 2XRWA 4HZSA 3U54A 3R83A 3KN6A 2WIHA 4FSUA 3KC3A 2NPQA 4BHNA 2KULA 4FODA 5AR3A 1G8AA 4E4MA 5LVOA 4B6LA 3C0HA 3LLTA 5AP2A 5E4HA 4QRCA 3JVSA 4QMPA 4IZ7A 3I0OA 5I3RA 3FZTA 4U5JA 4QOXA 4W4XA 3Q4ZA 3GU5A 1B6CB 2LGCA 2Q0BA 4RJ7A 4GH2A 3ZUUA 4EWHA 2W1HA 2IWIA 4RZWA 2VX1A 3QRJA 3TACA 3ALOA 4WA9A 3F2AA 5AA9A 3CCNA 4FEVA 3ULIA 2OLCA 3HRFA 4I5MA 4AW5A 5D10A 3SOAA 4EH2A 5CSWA 1SNUA 4NU1A 1ZZ2A 5KBRA 2UW0A 3OBJA 3W8QA 4FSWA 4ASEA 4DGOA 2RFSA 2Z7LA 5JT2A 4AXEA 1K9AA 4FV7A 4JBOA 4X6QC 4O7SA 2GNIA 4OBOA 1CKJA 3RPVA 3N4UA 3O7LB 3DXQA 3K3IA 1NVRA 4NWMA 4E26A 3NUPA 4EEVA 4EHGA 2W9ZB 3I4BA 3LXPA 3QQFA 2XEYA 2DS1A 3E64A 4FKOA 3L8XA 3T9IA 1OKZA 1MRVA 3U9NA 1H0WA 3OP5A 2IJMA 1WBWA 2A2AA 5A9UA 2GTNA 4QQJA 1XMMA 4IEBA 3RI1A 5CAOA 3ENHA 4CTBA 3LZBA 4DAWA 2HK5A 5AIRA 3AD4A 4XG2A 4RFYA 5EM7A 4K18A 3EQRA 3D5UA 3F61A 3VWAA 3W10A 3CD8A 5E92A 2HENA 4TYGA 1ZMUA 3P7AA 1H1WA 1B38A 2C69A 2X7GA 2XS0A 4EWQA 4EKLA 4ZLOA 4FT7A 4Q2AA 4DDIA 5HTIA 4L45A 2Q83A 4CLJA 5HGIA 2C0IA 3EYGA 2XYUA 4PMMA 4Z9LA 4F6WA 3KVWA 2QI8A 4AGCA 3R00A 3I1AA 3W0NA 2XIRA 3HMPA 3MFUA 3C4CA 5C27A 3R7UA 1MRUA 4O27B 1SVHA 3R7VA 5I9VA 2IW9A 1JOWB 2QQ7A 3WOWA 2WZJA 4AZTA 3QCXA 2WXVA 4NSTA 4NCTC 3CY2A 3R9HA 4M69B 4WG4A 4G3DA 3WBLA 3WZUA 3O50A 4FSNA 1KE5A 5KKRC 4M69A 4J52A 2W1GA 5ANOA 3Q9ZA 2OXDA 3BE9A 4U9AA 5A6NA 3OXTA 4AOJA 3GFWA 2QOFA 4I24A 4YC6A 2YLEA 3LXNA 2R3PA 4CMUA 4MWIA 3C0IA 3PE2A 2E2BA 2R5TA 3CPBA 5HBEA 2CNQA 3R2BA 3R73A 4PMPA 2Z7RA 2I0YA 5EM6A 4ZY5A 5IMEA 3E7OA 4YHTA 1WFCA 2FYSA 4Z7GA 3NW5A 1ND4A 3AD5A 1YXXA 3IW5A 3AKKA 1GZKA 2OGVA 3R6XA 4XOYA 3RAHA 3FAAA 3PG1A 4WG3A 4Y95A 4M97A 4WNPA 3PXYA 4A9SA 4C8BA 1XHAA 4F4PA 3A7GA 4XRLA 4ZTNA 3R22A 4QMWA 5HU9A 3BHHA 3W55A 3LJ2A 4AOIA 2UW7A 1FVRA 4QTDA 3O17A 5C26A 2X4FA 3QWJA 5C8KA 4C33A 4GV1A 4JRVA 4L68A 4NH1A 4S30A 2CSNA 4ZTHA 4A9YA 3JVRA 3OCTA 2VWIA 4DC2A 3NNUA 1CMKE 3L8VA 3NYXA 5TR6A 3E88A 3MI9A 4YZ9A 3TKIA 4DEEA 1NA7A 4ZZMA 4J95A 5EM5A 4R7HA 3NUYA 4FK6A 2V7AA 4RJ5A 4ASDA 4F9BA 5KMNA 1Y91A 2P0CA 5CF5A 4K6ZA 2W96B 2ZM3A 4HCTA 4LGHA 4GMYA 3OW4A 2JDTA 2R3OA 4O4FA 3ZMMA 5G6VA 4E5WA 3ZLXA 3KF4A 4FTJA 2WKMA 2VV9A 5A4LA 2YABA 3FMEA 4F99A 4CSVA 3M11A 1UA2A 3EHAA 3HLLA 3MPMA 5CEQA 4A9UA 3EQCA 1OL5A 2QG7A 3ROCA 5IKWA 2VTMA 5HE1A 3DJ7A 2YCRA 4DITA 4DBXA 2QC6A 1REKA 4PPCA 4IAAA 2HXQA 2ETRA 4RJ4A 3P23A 4UN0C 4ANSA 3E3PA 3KXZA 5AJQA 1PMVA 4S34A 4FTNA 3W0RA 4C2WA 3VIDA 1LUFA 1MRYA 3Q9WA 1Q61A 1TQIA 4I41A 5DR2A 4JAIA 2X4ZA 4O4DA 3KRJA 3O8UA 2V7OA 3GU4A 3RCDA 5FTGA 2VTSA 2QNJA 4F6UA 4XG7A 3ZC5A 2GU8A 2A0CX 1WVWA 3QL8A 2PTKA 3DKOA 3S2PA 5CANA 2YA9A 3PXRA 1XBCA 2UZOA 3OWKA 2W4OA 4JJRA 3LPBA 2C3IB 5FEQA 3U9CA 2PZPA 5KMLA 4CMTA 1JKTA 2X8IA 4IACA 4IC7A 5BVWA 3R63A 2Z7QA 4IJPA 4NJDA 1XBBA 4EHZA 3GU6A 3QCQA 2QO7A 2Z2WA 3B2WA 4BB4A 4C3PA 3UVPA 5G1XA 4IC8A 4EHEA 3FKOA 3UNKA 4L52A 3UDZA 5CSVA 3IGGA 2G2HA 4RRVA 2YISA 3KY2A 1YVJA 3O7LD 3G15A 4PP9A 1FVVA 4QYEA 5CAPA 3MFTA 3K5UA 4F1TA 4F1OA 2F7XE 4B0GA 4B8MA 4XG4A 3GCQA 3O5AA 2VTTA 3N4TA 4EZ3A 3ZM4A 5K0XA 4XG6A 3QQLA 2OFUA 3GT8A 1M7NA 1BI7A 3F3TA 4FTKA 4KIPA 4XV9A 4K8AA 4TW9A 4MX9A 2X0QA 5EHYA 3R8UA 4CCUA 4F65A 5LJJA 2ZYBA 4G1WA 3N51A 4CRSA 5FM2A 4O4BB 4L7FA 3UG2A 1ZOHA 2UZDA 5CU6A 5L3AA 4BZDA 4E1ZA 2R3RA 3GB2A 4BDCA 1GZOA 3EQIA 2BMCA 2PZ5A 1Q24A 2Z7SA 4IVAA 2ITOA 3EIDA 1PY5A 2WQOA 3MA3A 4PY1A 4X7QA 3A7FA 3F7ZA 5IQIA 2PHKA 5TO8A 2EXEA 3NUUA 3GC9A 4BCKA 4IAZA 3EWHA 3GNIB 4X6RA 3RPSA 3WILA 4L01A 2C6KA 1Q8ZA 5HU3A 4DEIA 3IS5A 3FMMA 3PFQA 2ITXA 2XNNA 4BGGA 3PY1A 4HCUA 2B55A 4TWNA 2QHNA 2X2MA 3CLYA 3QX2A 4TNBA 5CAVA 3D5VA 3BLHA 2ITPA 4C4HA 3HX4A 4PL4A 3V5WA 2OIBA 3CQWA 3VS5A 4U41A 3MW1A 4RLKA 2P2HA 1ERKA 3JYAA 4AGWA 3QD3A 4UBAA 5K3YA 4D2RA 4WSQA 3KB7A 4HVSA 1UKHA 3A62A 3P08A 4QMSA 3Q2JA 4J7BA 3ANRA 2YWPA 4FTRA 5IQDA 5AR4A 4F0GA 2XP2A 4ACDA 3HUBA 1YOLA 4D5HA 3TIYA 3UC3A 4EUUA 2W5AA 5IISA 3Q2MA 4O0VA 3HV5A 1J7UA 3EJ1A 3RAKA 3V3VA 3C50A 4BKYA 1P14A 4Y5QA 4FTLA 2WOUA 2EXCX 3CS9A 3QLGA 2KTYA 4DEAA 5BYLA 1QL6A 3QA8A 2C3KA 3N9XA 1PYEA 2VWBA 5IQCA 2VO6A 4BVUA 1U5QA 2C6MA 3PVGA 2BROA 3ML1A 2VRXA 3UGCA 4C0TA 3ZO1A 4AX8A 1Q8YA 2C1AA 5K0KA 4BIBA 2Y8OA 4MBJA 1LEWA 1OL7A 4FZAB 4JBPA 5HCZA 4XV2A 4BCOA 4ZY4A 5I9YA 2V62A 5IQBA 2V5QA 3BL7A 4PV0A 4C34A 4FKLA 5DRDA 3BEGA 4PPAA 4FJVA 1YXTA 2WEVA 4FV8A 4N6ZA 3V5JA 3GI3A 2Y4IB 3MIYA 3QQKA 3OWLA 4ERKA 4MCVA 2UW8A 4QTCA 5AMNA 5I9UA 4XBUA 4XV1A 5FWKK 3TI1A 2GSFA 5AR7A 4IIRA 1W98A 3NR9A 2UW4A 4UYAA 3NZ0A 4M8TA 4O82A 4WOVA 4M13A 4ZSAA 2J4ZA 2QU6A 3TZMA 2BIKB 4MUQA 2XBAA 3MVHA 4ACMA 1PXKA 4JDKA 5TOZA 4OAUC 4NM3A 4FSZA 3KMWA 4Y73A 4L7SA 4ZZOA 3TG1A 4J8MA 2G9XA 4L44A 5JRSA 4A4OA 2CPKE 4RLLA 5E8ZA 3UOHA 3A61A 4YLJA 3R04A 4R6VA 3NCGA 3DBFA 4FKUA 4Y83A 3TUBA 2B53A 4TXCA 5AP3A 5M4UA 1TFFA 1OBDA 3PIXA 1XQZA 3D83A 3PJCA 3R02A 4FL2A 3A7IA 2R3KA 2C6DA 2AQXA 2J0JA 1Z5MA 3D7ZA 2ITUA 4GFOA 4AT3A 3O23A 2G15A 3MWUA 4OBQA 3SX9A 1O6YA 1Q41A 4KBKA 4X3FB 5HLWA 4YJSA 4I6QA 4YHJA 3QWKA 4QMUA 4JG7A 2XNGA 4BDKA 2XCKA 1QPJA 4CKJA 5J7BA 2CDZA 3KA0A 4X3FA 5E8UA 2UZNA 1Y6AA 3BEAA 3PY0A 2PVKA 3BLQA 4XHKB 4LMNA 5FXRA 4ZS0A 1IA9A 2V0DA 4M15A 1RQQA 4WD5A 1I44A 3FI2A 3MY1A 3QYWA 5AR5A 5K9IA 4QMNA 1FOTA 2CGVA 1VEBA 1MUOA 4MBLA 2QODA 4FC0A 4H36A 4I3ZA 2CMWA 3P1AA 3ZRMA 3QTRA 3U4WA 4FTCA 4ZOGA 5CF8A 2O8YA 5J5SA 4LV7A 2QG5A 4U7ZA 5FEDA 2IVTA 4IDVA 4OTGA 4O6EA 2HXLA 4J71A 4Y72A 1H00A 1PW2A 3RALA 3VRYA 3W2QA 4EOOA 5CXZA 1M17A 3FZOA 1TKIA 4B7TA 4UB7A 4FT9A 4RX5A 2UZBA 5HQ0A 2OWBA 5DLSA 3C4XA 1G8JA 2GHGA 5CNNA 5AP7A 3G5DA 2YZAA 4L67A 3TT0A 3OUKA 1OL6A 5EYKA 5D1JA 5AFVA 5KE0A 4GU6A 2ITWA 3ZUTA 3QRIA 4HNIA 4IZAA 4AE9A 5EKOA 1OZ1A 5E8VA 4ZSLA 5LXMA 5HO7A 4N0SA 3ORIA 4YZCA 5DT3A 5BUJA 1ZAOA 3R1SA 4Q5EA 4YO6A 4PDOA 4DT9A 2VTIA 3ORLA 2C5OA 3PIZA 4MKCA 2ZM4A 2X7FA 1LR4A 2A19B 5AAGA 4UZDA 5IZFA 2XYNA 3QHWA 4B8LA 4GJ3A 2XK6A 4CCBA 3NUSA 2O2UA 3QAME 2WPAA 5TKDA 5BYYA 2IVVA 3ZLWA 3PFYA 3VC4A 2YLFA 3MJ2A 3QZGA 4HGEA 4ZTQA 5KMMA 3OZ6A 3HP2A 1YRPA 4NTTA 5D41A 5I3OA 1FBNA 3NMUF 3ET7A 4C37A 2RG6A 3Q9XA 3L9LA 4D0WA 2XK7A 4MNEB 5H3QA 4YR8A 5CVHA 4F0FA 2A4LA 2J0KA 1XJDA 5EDPA 3D7TB 1BLXA 3E93A 4U0IA 4FT0A 4MNEA 2VTPA 1EH4A 2UUEA 3R1QA 4O0UA 4EKKA 5IH4A 4CKRA 3UIUA 4FG9A 3F6XA 1QCFA 4ORKA 1G3NA 2YIYA 3ORXA 4KINA 4MXYA 4QPSA 4D1SA 2HCKA 2B1PA 5HLNA 3TIZA 2YHVA 2VTLA 4HVGA 5CU3A 5T6KA 4RWIA 3FMDA 4MD9E 2FSOX 4MVFA 4Z16A 3BV2A 2OXYA 3JY0A 4D4VA 2J5FA 4J98A 3UVQA 4AT4A 4IJ9A 4R77A 5IQHA 5IF1A 4ZMEA 2YERA 5HZNA 4WBOA 3VHKA 3TJDA 3LCDA 3OF0A 3NAXA 5IA3A 4FV5A 4E5AX 3MV5A 3ENMA 4DH7A 4JAJA 3AG9A 3EFLA 3EKNA 4FRFA 4H58A 4HGLA 5AIKA 5BPYA 1P5EA 4BR3A 2PVMA 5JFXA 3ERKA 3H9RA 5CLPA 2QR8A 3AKJA 3FLYA 4FSRA 3AMBA 4QYYA 4DGLC 2IPXA 1H4LA 1VYZA 4YNEA 3CKWA 3R01A 1H08A 3AC8A 4G5PA 2YWVA 5FGKA 2X1NA 2HY0A 3KXHA 2WMWA 4TYJA 2C6LA 3CTHA 1H1SA 3NS9A 4EL9A 2O65A 3M1SA 4L8MA 2C0OA 3P78A 4RQKA 3QCYA 4WBBB 5EW3A 3V8TA 1PJKA 4U42A 2RL5A 2ONLC 4G6LA 4JR3A 3QD4A 3O71A 4KRDA 1G8KA 3LCTA 4QNYA 3MBLA 2R3NA 5EHLA 4IBMA 3Q96A 4ANOA 3TMOA 4NIFA 4D9UA 3QTZA 5GNKA 3V01A 2FH9A 5E8XA 1JAMA 4I1ZA 1IG1A 3KRXA 4KKHA 3ALNA 4EH7A 5LWMA 4RGJA 3KN5A 2ZMCA 3OWPA 3EOCA 4C3FA 3PSBA 1ZLTA 1H25A 4UMUA 4E6QA 2DQ7X 2P2IA 3AC1A 3TWJA 5AUUA 3BZ3A 4C4GA 5J5TA 4BJJB 4A4XA 5ANIA 4NTSA 2YIQA 2BR1A 5CENA 5IEYA 5DE2A 4O7YA 2CHLA 4FICA 2G2IA 3O96A 3TDVA 4BJJA 3OCSA 4FKTA 5AP5A 4JIAA 3HGKA 4RMZA 5HVYA 4LYNA 4CT2A 3NNVA 5BVFA 4WKQA 4MBIA 2B9HA 5DT0A 4FSMA 2VTAA 4TWOA 4U6RA 4G2FA 2OJ9A 2IW6A 2JIVA 5AV3A 3NWWA 3COKA 2QOBA 4MD7E 4AUAA 3VW8A 4EOKA 5L6WL 3PSDA 3QALE 5HE2A 2ERZE 3HP5A 5BVOA 2I7QA 5H9BA 4FGRA 1WBTA 4TTHB 5C1QB 2NRYA 4NM0A 4G5JA 1UU8A 2BZIB 2VN9A 4AZFA 4BCNA 5JEBA 1W2CA 2YDIA 4GK3A 4S33A 4X2KA 2XNBA 5F4NA 1OKYA 5M44A 4DT8A 2XKFA 4NCTA 2VAGA 5KKRB 1OL2A 3R7IA 1REJA 4YLLA 3ZSIA 2PYWA 4IXPA 3V5TA 2XAMA 1T45A 3A4PA 4AF3A 5LOHA 4GK2A 3QQGA 4DEBA 1NT2A 4L43A 5ANJA 4PL5A 5DEWA 3D2KA 2CNUA 3D15A 3OUNB 2GHLA 2QLQA 3VJNA 2VO7A 3SD0A 4N70A 3VVHA 3QTIA 2AC3A 5BMMA 2UZWE 2OICA 2VWXA 3P79A 4ENYA 1OB3A 4I5HA 2ITZA 5EQEA 4LI5A 4KS8A 1OI9A 3PLSA 3EN7A 4J1RA 4DGGA 3T8OA 4EC9A 1K3AA 3KIOC 2OH0E 3AOXA 2GNFA 4M12A 5KCVA 3FMKA 3IPHA 4ALVA 2O64A 4B4LA 1WBVA 4IWDA 4R1YA 3NW6A 2R3HA 2ZOQA 4DGNA 2BKKA 3G9NA 4I93A 5AM7A 2F7EE 5L2WA 4FZFB 4XP3A 1CDKA 3P9JA 4W4YA 3QA0A 2C5NA 1JSTA 1WBPA 5JFWA 1R0PA 2BUJA 5H8EA 3CGFA 2B4SB 1OGUA 2F57A 3FMLA 2P55A 4IZYA 5C01A 4ITHA 2GMXA 3TXOA 3HYHA 3F3UA 3GEQA 4PF4A 5LQFA 4AS0A 3MB6A 4FNWA 4HVIA 4UMPA 2ZV7A 4QPMA 2W5BA 3U87A 3TEIA 5DGZA 5IDNA 4QMZA 5HX6A 5LCJA 4RX8A 4C38A 4YTIA 2GCDA 4I5PA 4RQVA 4TY1A 5EFQA 3HAVA 4FZDB 1YOMA 3BKBA 4JOAA 2OU7A 4QP9A 2R3JA 1ZZLA 4BC6A 4DG0E 1GIHA 3TJCA 4DH3A 2XARA 1H28A 3BRBA 4YBJA 4YUQA 4M7IA 2IG7A 2WMAA 3K2LA 1LEZA 5JFVA 5L4QA 5J87A 2UV2A 5DPVA 2YEXA 3LJ1A 4BFMA 3OEFX 3EN6A 3FL5A 4K33A 2OH4A 4FYNA 3HL7A 1VZOA 2DWBA 3BYOA 4V04A 4CFXA 2UZUE 5JSMA 2H8HA 4D2TA 1H1RA 3FYJX 5L2IA 3HMIA 2YM6A 2QD9A 3FI4A 4ZTRA 2WTKC 5L6PA 2Y6MA 1P4OA 3UJGA 3V04A 1TZDA 4DFLA 2XVDA 3SLSA 3UMWA 2JIIA 1GIJA 5FM3A 2PE2A 1GZ8A 5B2KA 4FOBA 5L2TA 5J9LA 3NYNA 3I81A 4YZMA 5GZ9A 3GOPA 4FTAA 3R7EA 2XKDA 4OTFA 4O7VA 4E4LA 3ZUVA 5IA0A 4O96A 3FEGA 3R9RA 3FYKX 3EZRA 4I94A 2PZRA 2WIPA 3UZTA 3DJ6A 4OTQA 1UU9A 4GIHA 3UG1A 3PSCA 3QZFA 4KSPA 2UZEA 2V55A 3GGFA 2VTJA 3G90X 4K1BA 5K5XA 1WZYA 3ATSA 4ITIA 2PULA 5A4QA 1FVTA 5DN3A 3LCSA 5D7VA 2X0OA 3DAKA 3D4QA 4IAFA 4NJ3A 5D11A 4DHZA 2JKKA 4O7ZA 2YCSA 1URWA 2R0UA 2ZVAA 3CE3A 2B9FA 3IDPA 3SW4A 3TZ8A 2WD1A 2IZUA 1OMWA 2HZIA 4GFMA 3RKBA 3UO4A 3IGOA 3FV8A 4K11A 5EG3A 4E4NA 4O81A 1V0BA 2XJ2A 4BCIA 4FTUA 2I1MA 3QTQA 1RE8A 1WVYA 5IH5A 4EH9A 3W0QA 5CQWA 3O0GA 3WZJA 4YGAA 2OFVA 2JLDA 4ANLA 4O7RA 5AP4A 2GNHA 1LP4A 3W8LA 1Q8WA 3BYSA 1DM2A 1YDSE 4F64A 5DMZA 1OVEA 3SQQA 2ZDTA 2W1FA 5AV2A 5HO6A 3VS7A 5EDQA 3QXPA 5H2UA 5CEIA 3FMNA 5K5NA 4JR7A 4XCUA 4O2ZA 5IU2A 5IQAA 2WTIA 4LRMA 1DI8A 4UXQA 4IB1A 2EVAA 3AC3A 3U51A 4D0XA 1W84A 4I21A 5A6OA 4H05A 3MY5A 5C8MA 3NFGB 3R1YA 1YXSA 1PXNA 2OO8X 4JBVA 4G3FA 4G3CA 4ZJVA 4AOTA 4MQ2A 1DS5A 3NPCA 2CLQA 1A06A 5DHJA 4FVRA 3W1FA 3DT1A 5AV1A 1S9IA 3JUHA 4GFGA 4QMMA 3VRZA 3AT4A 4TWCA 3SRVB 3G0EA 2BDJA 2OG8A 4C57A 3QLFA 1PMUA 2ITNA 5H8BA 4BF2A 3OOMA 1UVRA 4QP1A 4CZTA 5HVKA 3KRRA 4RWJA 3SRVA 3UVRA 2PVYA 3EB0A 3CTQA 1PF8A 4AA0A 3UP2A 4G9RA 4AA5A 3BI6A 3LMIA 2Y7JA 3K54A 5M4IA 5HTCA 3I0QA 2HZNA 4BBFA 5CAUA 2EUFB 5HX8A 1OM1A 3KRWA 5AAEA 3DAJA 4G16A 5DH3A 4GT4A 2CCIA 3ZO2A 3FWQA 2VWYA 4K2RA 3VF8A 2HZ4A 3FLNC 2UVZA 4DDGA 2PMLX 4I6FA 2AC5A 4QPAA 4XH6A 2XK4A 3F7WA 4BDEA 4UXLA 4F7JA 5HBHA 3Q3BA 4IM2A 4JXFA 5LMKC 3LFCA 4F7SA 4N4SA 2VNYA 3LCOA 4CFNA 2JC6A 2WHBA 3RWPA 3VUIA 3CXWA 4DFUA 3BE2A 2J7TA 2FGIA 3MTFA 1PKGA 4WIHA 2YFXA 3NUAA 5M4CA 2FA2A 3DKGA 3GU7A 4RJ6A 4EONA 3DS6A 2JD5A 3QRKA 2GDOA 3IW8A 5M07A 4IX5A 5HCXA 5F94A 4BICA 5AR2A 2JBPA 1DAYA 2F2CB 3FL4A 5CTPA 2XK3A 4R8QA 5E8WA 2IZSA 4IFCA 4AZEA 4BDBA 5GZAA 1JVPP 5CSPA 5J95A 3UE4A 3OS3A 5TE0A 4ZZNA 1OPKA 4GT3A 3RK9A 4CFUA 4RJ3A 1SVEA 3IO7A 3EFJA 4PQNA 2RIOA 4OT5A 1OL1A 1O6KA 4H3BA 2XIKA 2UVYA 5M51A 1GJOA 3PVBA 4F9CA 3DBDA 2JDSA 4QYFA 3FSFA 2GNLA 4RWKA 4HVDA 5B0XA 3S0OA 4TNDA 3BELA 3MDYA 5F95A 3A4OX 3BYUA 4RFZA 3DKCA 3FJQE 3W2RA 5E90A 3DLZA 2JAVA 5C8NA 3C5IA 2E9PA 4IB0A 4JQ7A 3SG9A 3MH0A 3W16A 4CVAA 2VO3A 3ZEPA 4C3RA 4EC8A 3C7QA 3VS0A 2ZJWA 2B54A 3U6JA 3HV4A 4FIGA 2WO6A 2J0LA 2FSLX 5JH6A 4GG7A 3RCJA 3BBWA 2OZAB 4U40A 4C4JA 2R3QA 3AQVA 3BQRA 4P2KA 3ZCLA 3U55A 2XRUA 3ZSGA 4A9RA 5LVNA 3AT3A 5J9YA 3UDTA 2OZAA 3IW4A 3MH2A 4D4RA 4WNOA 4EZ5A 3UODA 4BN1A 5F9EA 5KX8A 5HTBA 4YJPA 4YSJA 4M0YA 2QKRA 4RZVA 3QHRA 2OI4X 3F3VA 4DG3E 2X39A 3ZRKA 4BL1A 2QHMA 3HRCA 5C03A 2OIDA 5LVLA 2ZFYA 4QMXA 2X0GA 3NSZA 3QRUA 5CALA 1OUKA 3RZBA 3EQPA 2UW6A 2OBJA 1SYKA 4MD8E 3DFAA 4OTRA 1YW2A 3IECA 4QT1A 3SDJA 3DY7A 5EKNA 3L8PA 4E7WA 5I9XA 4X21A 3RGFA 3OCGA 1YWNA 4QMQA 3PIYA 5FDXA 1QMZA 2X2LA 3PWYA 4FKWA 5FRIA 3VS3A 2BIYA 4A9TA 2EB3A 2WMSA 2VWUA 3DDPA 2BAKA 3MFRA 3PVWA 4FG7A 1JKLA 4IE9A 4AXAA 3R8LA 3ATTA 1GZNA 2BRNA 4Z55A 1FQ1B 3EMGA 4TT7A 2XJ1A 2IN6A 1JQHA 2PVJA 4FOCA 5HOAA 5LVMA 3EQBA 2WMQA 2VNWA 1HCLA 3PXFA 2OKRA 3KKVA 5GHVA 4LM5A 3DQXA 3PUPA 5KHXA 4NKSA 4H1MA 3UYSA 2XZSA 3BU6A 4DCEA 4O6LA 3VUMA 3TUDA 3UIXA 1KOBA 3OMVA 3Q32A 4O0TA 4W4VA