1ZZLA

Crystal structure of p38 with triazolopyridine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
351
structure length
351
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Theoretical and Experimental Design of Atypical Kinase Inhibitors: Application to p38 MAP Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 107
structure length 351
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zzlA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zzlA01
4ZAUA 4MAOA 3BCEA 3HUCA 2VWIA 4IHPA 2WQBA 4RFZA 4IDTA 4LQMA 4BIBA 3DY7A 3PY0A 3V5JA 4O38A 4I24A 3TG1A 4DFZE 1JKTA 1S9JA 3KGAA 1R1WA 2PUUA 4CZTA 1U4DA 3I6UA 3GC9A 2I7QA 3LOKA 2J90A 3HV7A 4TZRA 3BEAA 3SC1A 4UXLA 4HVSA 2QR8A 4ZTRA 4AN3A 4JG7A 1J91A 1FGIA 4FIIA 1H8FA 1KE7A 2XM8A 4I93A 3WF7A 4C36A 5EQPA 4IFGA 3VNTA 4FV3A 1UVRA 4IANA 5GJFA 2O65A 4CKIA 3MPTA 3EMGA 5BQ0A 4WSYA 2H6DA 2F7XE 4I4FA 5I9UA 3GQLA 1M7NA 2UW9A 3HEGA 5CANA 1GZNA 5BPYA 4AX8A 5AFVA 3RZFA 5B2MA 1EH4A 2BCJA 3R73A 4GYIA 2WZJA 4EOOA 4LOQA 2UVZA 4TY1A 4FKRA 3TT0A 4JQ7A 5JN2A 2XJ0A 2PPQA 1XWSA 4L43A 4BBFA 4IC8A 3OUNB 2EXEA 3CGOA 4OUCA 4ZZMA 4D9TA 5FWKK 4E6AA 5BYLA 5FRIA 5H2UA 1XJDA 2W96B 4UWBA 1RDQE 3L8VA 4ZLOA 5CSPA 4N6ZA 2XRUA 3HMOA 3PVBA 4U9AA 3FYKX 4Z16A 5HX8A 2F7ZE 4WSQA 3A8WA 1SVEA 4C4GA 1LUFA 1B39A 4FTOA 5T6KA 4Z3VA 5K4IA 3Q52A 4K6ZA 3QQJA 4H05A 3KVXA 4NKSA 3VRZA 4NTSA 5L2QA 4V0GA 3PXRA 5CX9A 3EB0A 3PP1A 2QOLA 1FINA 3Q53A 4UWYA 3P86A 4EKLA 5KX8A 3BELA 2C6IA 5D9HA 2XCHA 4CYJA 4DFYA 3MTFA 4EOMA 2XEZA 3P4KA 1R3CA 4RQVA 1NVRA 3FL4A 4FGBA 5E8YA 3FQHA 1ZYSA 4RIYB 5HLNA 1YOMA 2C5VA 3E63A 3GC0A 3FI2A 4EHVA 4YZCA 5EQEA 5LMBA 3G6GA 4AFJA 5AP2A 2BAQA 2XK6A 3NIZA 2WTDA 5E8XA 4FNZA 5FBNC 3IW8A 2XNNA 1CM8A 4LRKA 1A06A 5B2LA 1OPKA 4L45A 2NPQA 3K2LA 4C8BA 4ZMEA 3NR9A 3UYTA 5J1VA 2YM4A 3FKNA 3MGYA 4B4LA 2PVMA 5E8TA 4B0GA 5M08A 2VNYA 4XV1A 3O51A 1ZMWA 4XYFA 5A4TA 5E4HA 3ZO3A 4O7YA 4XEYA 4A9TA 3NUAA 3F82A 1Q4LA 2E2BA 2GNHA 5IQBA 5AP3A 2VZ6A 2OXDA 4KIKA 5EH0A 4EK5A 4OLIA 2P2IA 4FKJA 4BBMA 3H3CA 1CKJA 1JKSA 3ANRA 4S30A 4AOJA 4HW7A 5A4CA 3Q4ZA 1JNKA 4GUBA 4TYHB 3VBQA 4BZNA 3HA8A 4ANLA 3WBLA 1JBPE 5BVWA 4DFUA 3MA6A 5HNBA 1OGUA 1LP4A 5D1JA 3Q9ZA 3VS6A 3BYUA 5I5ZA 2VO0A 3A7IA 2J6MA 2B55A 2XJ2A 2VTSA 4DH1A 2X9FA 2PZRA 3I4BA 4TXCA 4CFNA 2YABA 3BEGA 2BHHA 4AGUA 5IA5A 4QPMA 3CXWA 3D2IA 4JDHA 1H26A 1MRVA 3BBWA 3BV2A 2EXCX 2OJGA 4ZTLA 1J7UA 4LUDA 5AIKA 4RVTA 4WNKA 3PVGA 4S2ZA 5F1ZA 3D14A 5KMOA 4K1BA 2OF2A 2UZBA 2ITPA 3OVVA 3ODZX 2NRYA 4IWDA 3V6SA 4O81A 4RWLA 4KBKA 1SZMA 5I9VA 4CT1A 4Z7HA 4PTGA 2XK7A 3FSKA 4XLVA 3VS5A 4I0SA 5AP7A 2VTNA 5CI6A 2W1ZA 2P2HA 3NUSA 4GU9A 3UNZA 5CSVA 4ASXA 5JMSA 2X8EA 3DK6A 2QC6A 3Q5IA 4FKTA 4EBWA 4UBAA 3SKCA 4PNKA 3UO5A 2BRMA 3N9XA 2QD9A 3VS3A 5I9YA 4JQEA 4YJNA 2PVFA 3F5PA 1ZY4A 3KMMA 1ZYLA 4ZJJA 4E6CA 2XYUA 3L8XA 2YERA 3V5WA 4U42A 4MF0A 1Y6BA 3QZIA 5IEVA 4I1ZA 2JBPA 1OKYA 4XUFA 4B7TA 3NUYA 4XOYA 3NNWA 3RCJA 4EBVA 4J8MA 3M11A 2V0DA 3CEKA 2ITXA 3DBQA 3P7AA 3QTZA 3CP9A 1JOWB 3B8QA 4FG8A 1WBSA 4DYMA 2W5HA 5JRSA 2C6MA 3ETAA 3FWQA 3R02A 3N4UA 5EM6A 3QXPA 4UWCA 2C1AA 2XH5A 3VWAA 4O22A 4M67A 4HCUA 4IAFA 2FSLX 4UEUA 4USDA 2IVVA 3VRYA 2OFUA 3ET7A 2BDWA 3KU2A 1ZMUA 4BN1A 2UW6A 4G16A 4L42A 4H3BA 4QMTA 1UNHA 4ZS0A 3C0GA 2ZM4A 3KVWA 1URCA 2WGJA 3QALE 4C61A 3V8TA 4RZVA 1KV1A 2R3HA 1PF8A 2WMBA 2WU6A 3ZRLA 2BTRA 4YJTA 2NRUA 2UZNA 4IAYA 3LAUA 4RJ7A 2Z7LA 3G15A 2X39A 3PSCA 5TE0A 2WMAA 3RWPA 4BKJA 4LGHA 2BRHA 4CMTA 3FHRA 3GFWA 4PDPA 3MA3A 4YZDA 4CKJA 3MVHA 1G8SA 4FTUA 4M13A 1OIRA 4C02A 3EQIA 4G31A 3BGZA 4F0IA 2PMLX 2BAKA 2QOKA 3CJFA 3KXZA 3LXPA 3K54A 1A9UA 5L2IA 3CIKA 4C4EA 2I6LA 4UV0A 4QNYA 5G1XA 3S4QA 3QD2B 3QXOA 5ITAA 3A2CA 5DT4A 3A7JA 1MQ4A 1BL7A 3C5UA 3Q9YA 4UMQA 3H0ZA 4W4WA 2FGIA 1R0EA 1Q8YA 3C0HA 1Y8GA 4LRJA 3LCOA 3PVUA 4ZY5A 3UOHA 3PZEA 2BVAA 4FZAB 2WOTA 3P08A 4JXFA 4JDIA 1CKPA 3POOA 3I0QA 4DH3A 1W83A 4I5PA 1OUYA 4D1XA 4ZSAA 2WQMA 1OVEA 4IQ6A 4O0VA 4P5QA 3H9OA 5CT0A 3LFAA 3FLWA 3S1HA 5AV2A 2ZM3A 1XQZA 3W16A 2FA2A 2I0HA 4RIOA 3V8SA 3NEWA 3UIXA 1PMNA 2WMTA 3VHKA 5JKGA 4LOOA 4UMTA 2CCHA 3FC2A 3KXMA 2XK9A 1YKRA 4K2RA 3BQRA 4FT0A 3BI6A 4YZ9A 5C1QB 2VAGA 4C4FA 1M14A 2YM7A 4QMQA 2VN9A 3EFWA 3UVPA 4J71A 4E5AX 3ZBFA 4HJOA 4CSVA 5FXRA 5IH6A 4X2GA 3R8LA 2C6DA 3FZSA 1O6YA 2XKCA 2PVKA 3C4ZA 3DXNA 3HDMA 1DAYA 2XNPA 4FNWA 4FT9A 3S3IA 3FXWA 4IEBA 2GNLA 3Q9WA 4FL3A 4XG8A 4BVUA 4BCQA 4C3PA 4C35A 2C30A 3IKAA 5ANJA 2VWYA 4Q5HA 5J87A 5ACKA 5B2KA 1P4FA 2F2UA 4IB5A 4PV0A 4CV8A 3DS6A 1Q99A 4HVIA 2XJ1A 3H0YA 3LCDA 5H8GA 5DEYA 2UW3A 3IGGA 4RIXA 3ELJA 5J9YA 2YWPA 4RLKA 4CTBA 4ANQA 5AMNA 3EQPA 4WD5A 5AV1A 4PP9A 2ITTA 4JBVA 4UYAA 3FHIA 4O0XA 5EI8A 4BWPA 3VS2A 3HMIA 2BZJA 2OKRA 3ORKA 4D5HA 4PPAA 5A4QA 5E1EA 5A3XA 2XBAA 4UB7A 4WO5A 3KK9A 3DTWA 2Z7QA 3GB2A 4Y85A 5CSHA 3QHWA 4KS8A 3A7FA 3VF8A 2Y6MA 3PXFA 4J96A 2YCRA 4ZZOA 1OM1A 2ESMA 3EQBA 3JYAA 2G01A 4D1SA 5HIDA 3Q4CA 1K3AA 3C1XA 4DEAA 5M51A 4IWPA 1YOJA 2Z2WA 3DB8A 4MD9E 4I23A 3D7TB 3GQIA 1IA9A 2QO9A 3T9IA 2QO7A 3QLGA 4YTFA 2EXMA 4CGAA 2CDZA 4PDOA 5M44A 3MY1A 1YW2A 5L8KA 1OUKA 1PYEA 3W33A 2UZDA 4GU6A 2QONA 3VBWA 4XOZA 4AZEA 3IK3A 5M4CA 1VEBA 3EYHA 2W7XA 5JH6A 3NYNA 4MQ2A 4F70A 2PU8A 3U9NA 3CKXA 5LVLA 2XK3A 3FV8A 3U8WA 4EL9A 3WZDA 2HIWA 3VJOA 3CJGA 2RGPA 4G6NA 3DT1A 2X0GA 5AP5A 4D4SA 3CQWA 4KBAA 3UZTA 1PYXA 4R1VA 3ZRMA 5JFWA 5HI2A 1KOAA 4D4YA 4GFOA 5IA2A 5GZAA 2DYLA 1BMKA 2GCDA 1R0PA 3L9NA 4FZFB 4IX3A 5HLWA 3OFMA 2WTIA 2ZOQA 2JDRA 2EVAA 3CY3A 3DGKA 5KZIA 3VHEA 5CENA 2VX0A 2QLQA 4EK6A 2OWBA 2GQRA 4R5YA 1WMKA 3OY3A 3GT8A 1J1BA 4FV9A 4RX7A 5AP4A 3VN9A 4ACHA 4EH3A 1CKIA 3PRIA 4IACA 4DFNA 4RVKA 3PSBA 4KRDA 2R9SA 5HESA 1PMUA 2PVRA 4FL1A 3LCTA 1ZYJA 4D0XA 4FIGA 5M57A 3MPMA 5GZ9A 3ULIA 3CSVA 4YJRA 3WYXA 2OICA 5IMXA 3QRKA 5LJJA 2GNJA 2YA9A 5DVRA 4IX5A 2CKEA 4UMUA 1Q41A 2J0IA 3PYYA 2RKUA 4JAIA 5AR5A 4DTBA 5IKWA 4KIPA 3HAVA 4XJ0A 5CAPA 3MDYA 2FSTX 4YURA 3NVMB 3HVCA 3SRVB 3HP2A 4FT5A 5CZIA 4XRJA 2WQNA 4X21A 3VS0A 3W10A 5BNJA 3WF6A 3ZM4A 5EFQA 1PMEA 4UN0C 4CG8A 4UY9A 3OWJA 2CHLA 4NCTA 3SX9A 2PUIA 5ANDA 4EHEA 3JR1A 4YZBA 5DH3A 4IX6A 3I6WA 4JL9A 3V5PA 4MXOA 2VWBA 2W5BA 3RK5A 3CLYA 5HZNA 4BCIA 3SGCA 4AG8A 4R3RA 4U7ZA 4XH6A 3KXGA 3WYYA 1K2PA 4CVAA 3BQCA 3ZFMA 4R7BA 4H3QA 3ZO2A 1Q3WA 2Q0BA 1VR2A 3FL5A 4FT7A 3Q32A 4G17A 3ORPA 4RZWA 3W2PA 1YHSA 2QKWB 4QTCA 4BBEA 4CQGA 3ZSGA 4A4OA 4HGLA 5JFSA 2IVSA 4FEUA 4IW0A 2WAJA 3WZUA 5BUIA 3QQUA 2UW7A 4E73A 3UC3A 5I9ZA 4PPCA 3E92A 3NCGA 4WHZA 3SA0A 3QC9A 4OBPA 3QCYA 5HE3A 4RQKA 2JDVA 5CQUA 2VRXA 5A46A 5BUEA 4ZOGA 4AA4A 3SQQA 5JSMA 2VX1A 3QHRA 3OY1A 2WB8A 3RALA 5KKRC 5D10A 3HMMA 2PZPA 3TCPA 5DG5A 3QAME 2HWPA 4NUSA 3RAIA 3D5WA 3LFQA 2AYPA 3Q6WA 1H00A 2YLEA 3RHXA 4DEEA 5CF4A 3VW6A 4X0MA 1M17A 1W84A 4X2NA 4BDCA 1JVPP 3TM0A 5AWMA 1CTPE 4TYHA 4Z55A 3FMDA 3VBTA 4DCEA 3SW7A 4YU2A 4UXQA 2C0OA 3DQWA 3DKFA 1PXJA 4G3FA 2W05A 3OZ6A 4M8TA 4AE6A 1YRPA 3QBNA 3I7BA 4IJ9A 1PXLA 3I81A 3EIDA 3DKCA 4OTGA 3QQKA 5IMEA 5AUVA 4FIHA 4J1RA 4XX9A 3BGQA 5HTCA 4HZRA 3CR0A 3P1AA 2UZUE 3UVQA 4YNOA 4A9YA 2WMVA 3F69A 3NW7A 4XG6A 5CSXA 4ZTNA 4O84A 1NT2A 2XKDA 4G6OA 2XMYA 3V3VA 3OBGA 3Q96A 2A2AA 4O0RA 3D7ZA 3IW4A 4CV9A 5KO1A 4QMOA 5DEWA 3RTPA 2GTMA 3QD3A 2HW7A 4GK2A 4XNEA 1PKDA 3H4JA 4F4PA 5IH5A 2W4KA 3S0OA 4O86A 2OSCA 5DRBA 2E9OA 3NW6A 4IWOA 1BI7A 3TEIA 1KSWA 5EYCA 3TACA 4FG7A 4A7CA 2VTHA 4F99A 4GT5A 5L6PA 1MRYA 1PXNA 2GFCA 4O2ZA 4GT3A 3MFTA 5DFPA 4YJPA 5L8JA 4DHFA 5JFVA 2IG7A 2A4LA 3NNVA 3PJ8A 3I60A 4A07A 5HQ0A 3C4EA 3DQXA 1Y57A 3AXWA 5AA8A 2WKMA 3EHAA 5BVEA 3HP5A 3RKBA 5CASA 3SD0A 5BVFA 5L2SA 3C9WA 1JPAA 5DT3A 4XMOA 5J1WA 4XRLA 3W2RA 2ZMDA 3EKNA 5L8LA 5FQDC 4JOAA 3MH1A 4MD8E 1FMOE 4FI1A 3R9OA 3V6RA 5CU4A 4HNIA 4FL2A 4ALWA 2WXVA 2JLDA 3A61A 3W55A 2F2CB 3KF7A 5IQDA 4YC3A 4J53A 2JKQA 2VV9A 3KRLA 4JBPA 2GNGA 4FKQA 2XNMA 4QP3A 4AS0A 2Y8OA 3TZ9A 2ONLC 1BI8A 5AADA 5IA0A 2B9HA 3UZRA 2HOGA 3NYVA 5AIRA 3QZFA 2J51A 4IC7A 4F6SA 2OXXA 3FLNC 1H25A 2XRWA 3OEZA 2QKRA 3EZRA 4BCGA 4BCOA 5KNJA 2J0KA 4XBUA 4N57A 4PDSA 3CQUA 3PIXA 3U6IA 3ZM9A 3C4WA 5TT7A 3OD6X 1NA7A 1YVJA 2XBJA 1OZ1A 5IUHA 5CAQA 3TKIA 3FC1X 4CRSA 4DH5A 4EEVA 1YOLA 5A14A 5M56A 1TVOA 2J0MB 3DXPA 3TUBA 3KULB 5FXSA 5I0BA 4Q2AA 5FDXA 2O2UA 2X81A 3MH2A 5JZJA 4FTQA 4XS2A 4A06A 2OJIA 4BR3A 4QRCA 4D1ZA 4LI5A 2Y4IB 4ZP5A 2Y0AA 3ZLSA 4EH4A 4FKUA 3WIGA 4EH9A 5JRQA 3C4FA 3SAYA 1YQJA 4Z7GA 4ENYA 2W1FA 3GUBA 5EHYA 3OW3A 3W32A 4IAKA 4DFXE 4KB8A 5DGZA 3F3WA 3OUKA 3VQHA 3DNEA 1PXIA 3KRWA 1W0XC 4YC6A 1H1WA 3F61A 2XB7A 4Y5HA 4ZY4A 5HICA 2Y4PA 2RG5A 3UQGA 2PULA 2VTMA 3ZBXA 2E9VA 4BKYA 4FZ6A 4II5A 5HG5A 4IZ7A 4CFVA 2QOHA 4J97A 2CGWA 2C6EA 4MBJA 4GG7A 3G5DA 2F57A 3ORZA 3FUPA 4FV1A 5CXZA 4CLJA 4MX9A 3MTLA 2HZIA 3N51A 5CEPA 1UU7A 4QP8A 4HVHA 1FPUA 4FSWA 5JT2A 2YM3A 2BRNA 3MS9A 4AZVA 4BTFA 2HENA 2GS6A 2RFEA 3ITZA 4O7WA 4AQCA 5AV3A 3A4PA 4U3YA 4A9UA 4E5BA 4JT3A 5FTOA 1PHKA 4HYHA 3RM6A 3QFVA 4HOKA 2G15A 3E3PA 4IB0A 1OB3A 1SM2A 2JIVA 5AUZA 3QUEA 2UVXA 3FQSA 3R1QA 3IG7A 3OOMA 5LCJA 1YXUA 4NFMA 4F64A 5AUTA 3KFAA 4LL5A 2WTWA 1V0BA 3GU6A 5LCKA 2WTCA 5LOHA 1ZLTA 4FG9A 4YJUA 4O82A 3OT3A 3P0MA 4KABA 4QMZA 3ZSIA 4NKAA 2OH0E 4IAAA 4FVRA 3VUTA 2DQ7X 2HY0A 3EL8A 4RC4A 2PYWA 4MWIA 4YGAA 1UWJA 4YBKA 4R3CA 4YTIA 3IDCA 3UPXA 4TKSA 4DEDA 3PJ3A 1GY3A 4QTEA 4FKVA 4D2WA 2QU6A 4D2VA 4KSQA 4Q9ZA 3DAKA 3VW8A 3TIYA 4WG4A 3ROYA 4CFWA 4YZMA 3UNJA 5BVKA 3HRFA 4ERWA 1A48A 5CYIA 3W18A 4HGEA 2ZMCA 3NSZA 4D2RA 4FNYA 4KWPA 3NNXA 4GRBA 5E92A 3P7BA 2RF9A 2VGPA 5DPVA 5HIEA 1ZZLA 4W8EA 3LFDA 4CZYB 4CFMA 1R39A 3LCSA 5IDNA 4JBQA 5KMIA 5TOZA 3TV7A 5ANIA 3R30A 3RGFA 3B2TA 2GQGA 1H08A 3DFCB 4AFEA 4H1JA 4DINA 3R71A 5HBEA 5FG8A 1SVGA 3V8WA 3G0FA 4O27B 4QMNA 3OP5A 4LFIA 4FGRA 3D7TA 2JBOA 3Q2MA 2OJ9A 3QYZA 4TTHB 5HTIA 2C5YA 3LLTA 5T3QA 4QT1A 4X3JA 3ZC5A 2C6KA 3L9MA 3OBJA 3ORLA 3R2BA 4FMQA 5AM7A 1IEPA 4N4SA 3SXRA 3QTWA 4AW0A 2XNOA 4CZUA 3R21A 5FGKA 5M06A 5K5NA 2BZHB 4AAAA 5EHLA 3G9NA 1U5RA 4AGDA 3EH9A 4ANSA 5JGDA 2J5FA 4F1MA 3QTQA 3QWJA 3EQCA 3IO7A 4U81A 2X8IA 3A60A 4RJ6A 4X3FC 3TNHA 3PJ2A 5CI7A 4PPBA 3DB6A 5CEMA 2YDJA 4Y8DA 4KINA 4QTAA 3DCVA 4HPTE 4IM3A 2PVLA 4ANNA 4ZZNA 3RPVA 3VVHA 2ACXA 4C4IA 4F1TA 2VTOA 5J5SA 3FI8A 3IPHA 4BDAA 1XH9A 3MESA 3ENHA 1DS5A 4HNFA 2GPHA 3FKLA 4I4EA 1SNXA 4EZ7A 4N0SA 5F4NA 5LMKA 4Y46A 3VUGA 3ZCLA 5LMAA 4NL0A 2BTSA 2IW8A 3MJ1A 4TWCA 2C4GA 2V5QA 5F95A 2X8DA 3R0TA 4NM5A 5BYZA 4NM7A 4RMZA 3AGMA 1GZ8A 1ZAOA 4FK3A 1REJA 4RC3A 4J98A 4AZSA 3RZBA 3U6JA 3Q60A 2P3GX 3DJ5A 4WG3A 1H1SA 1IAJA 4AOTA 4DFBA 2IZUA 3GNIB 3GCSA 3FPQA 4RIWB 3SRVA 3ODYX 4DTAA 5HHWA 5K9IA 2BRBA 3NAXA 4E20A 4D2SA 4F63A 1M7QA 4F6UA 3L8PA 4EWHA 1UV5A 2C3IB 5B7VA 2FH9A 4USEA 2AC3A 3HMNA 5LVNA 3BE9A 3CKWA 3IS5A 4YTHA 5B0XA 3F3TA 3DBEA 3ORXA 3C4CA 2C0IA 4FSZA 1WVXA 2XIXA 5EDQA 2H34A 3MH0A 3TJDA 5DR9A 1XKKA 5EM8A 2WOUA 5IUIA 3TZ7A 4F6WA 3QC4A 5KMLA 2CGUA 3R6XA 4ZLZA 4FUYA 4NW6A 3E8CA 2X9EA 4BCPA 5HTBA 2W99B 3V5QA 1SMHA 4FF8A 3LXLA 4W4VA 4YNEA 1RQQA 5AR7A 5IQHA 2XYNA 4JAJA 3P79A 3QRIA 4ZMFA 3OXIA 4J8NA 1OBDA 2EB3A 3F5XA 4BZOA 3MW1A 5A6NA 2CKQA 3LIJA 3QZHA 2Z60A 4PP7A 1RJBA 2C1BA 3HV6A 4NFNA 2VUWA 4RA5A 4FYNA 3K3IA 5C4LA 3AC2A 2QR7A 3BHVA 5K0XA 1TQPA 5DRDA 5ETIA 2QVSE 2BILB 2R3OA 4AWIA 3JY9A 4BDFA 4KIOA 2ERKA 3FI4A 5EOBA 3TZMA 5GIPE 4JIAA 3VULA 1Q3DA 2R3IA 3FZ1A 3QUPA 4IWQA 4YHFA 5TKDA 3LMIA 3RPOA 3MY5A 4YPDA 3R9NA 3I79A 5M53A 4ITJA 4D9UA 4ACMA 2YITA 3ZDUA 1UKHA 3OXZA 4AN9A 1XBAA 2VTTA 3ZO4A 5EKNA 4BDEA 1X8BA 2R3QA 3HGKA 1HOWA 3O8TA 3IW7A 2X6EA 4OTQA 4OT6A 4L9IA 4FKIA 4PMTA 4Z9LA 2WTJA 4FVQA 3LM0A 2I40A 4G9CA 4F9BA 4CFXA 2WTVA 3EYGA 4AE9A 5HX6A 2YM5A 2PMOX 3A8XA 1KE9A 4MBIA 2OIBA 2X7GA 3LFSA 2Y6OA 2X2KA 3R63A 4K77A 4OW8A 3VC4A 4ZTMA 2I0VA 2V62A 5E9EA 3EOCA 3BKBA 4M12A 4YLLA 3K5UA 3PE1A 5AX3A 2HK5A 3HKOA 3DAEA 3OROA 4DGMA 2CNUA 4H3PA 5IQAA 4IZYA 4BIDA 3DFAA 2QOIA 3E8DA 4K11A 3L1SA 4U79A 3QKMA 4EOKA 4C3RA 4WUNA 5M4UA 3TNQB 3WI6A 3A7HA 1OL2A 3UBDA 4GVAA 4L46A 3BYMA 3HV5A 4RC2A 4X2KA 1JSTA 5FUTA 5EYMA 3V51A 4RSSA 4O0WA 4NSTA 3UIMA 4DGLC 4P2KA 3GENA 2GQSA 3NDMA 2WMXA 3BHTA 3SXFA 3KXNA 3WF8A 4O7ZA 3AD5A 3HNGA 2BHEA 4U0IA 3R7YA 5KHXA 2ZV7A 4AACA 5EI2A 2O3PA 4IM0A 3AD6A 1YI3A 4U45A 3LLAA 3PLAE 1WCCA 4ANOA 4BCMA 5AUWA 4XV2A 2X4ZA 4RA4A 3V5LA 4I5MA 4PTCA 4B9DA 2XUUA 3NYOA 4MEDA 4CMOA 4EH7A 2PMNX 4A4LA 2PE1A 3Q5ZA 4EKKA 4EYMA 2HELA 3UE4A 1O6LA 5HNGA 2R7BA 4RGJA 5AJQA 1XH7A 2R3RA 4NW5A 4F09A 4BI1A 1OECA 3W2QA 3UPZA 3ZHPC 2BAJA 1PW2A 5HEZA 3R04A 2GDOA 3GU5A 2XM9A 5FM3A 4PNIA 4BYJA 2JAMA 3E8NA 4GVJA 2J0LA 3TTIA 2BIYA 2CGVA 3OCGA 1PKGA 5KBRA 3O17A 3LXKA 2CKPA 4HGSA 4U3ZA 2ZB0A 3RM7A 3CS9A 3FAAA 3KULA 3QQHA 4DGNA 4JJRA 4EORA 2J9MA 4YTCA 2XA4A 2VNWA 3VQUA 2GHGA 2ERZE 4EOJA 3O23A 1ND4A 3PVWA 2E9UA 4JNWA 4QYFA 3HV4A 3TTJA 4YJVA 4D0WA 2WNTA 4BWKA 4W9WA 5GINE 2X1NA 2WQOA 4QP4A 4K8AA 3O7LB 4UZHA 5HNIX 5KMNA 1YWRA 4E6QA 4DA5A 3ZC6A 3QWKA 4O7LA 3ZXZA 2B52A 1CSNA 2H96A 4TNDA 4Y73A 1G8AA 5C4KA 3F3ZA 4EH6A 1GIJA 4C33A 3PPKA 4GFGA 1H1QA 2WIPA 4X2FA 3R1YA 1VYWA 3FZOA 4XBRA 2HY81 5EM7A 3UP2A 3SVVA 4QP2A 3ZYAA 4BICA 4PMSA 5AUYA 4RPVA 4I20A 3EWHA 5D7AA 3OCSA 3SG8A 4BI2A 5L4QA 3UO6A 4F9WA 5HGIA 4BC6A 5IA3A 3PIZA 4K0YA 2QURA 4DG0E 5CALA 3QZGA 2IZSA 2GS7A 2YISA 4ZSEA 3DK7A 3ZZEA 2PUNA 4QYEA 3NRMA 3PA5A 4FKSA 3EFJA 2HXLA 4JG8A 4LGDA 1NW1A 3W8LA 2CMWA 2V7AA 4UALA 5KMKA 1TQIA 5I4NA 3VS4A 3GFEA 3GEQA 3NUUA 3G6HA 4WG5A 5L6WL 3H9FA 3F2NA 5AP1A 4ALVA 4M68A 5D7VA 2YLFA 5EOLA 3JXWA 2BR1A 2R3MA 3LJ2A 2Y9QA 4AT3A 4NWMA 3E8EA 5GJGA 1OITA 3MSSA 4TW9A 5T68A 1E1VA 4C58A 3NZ0A 2YZLA 3TI1A 3EJ1A 5DIAA 5CU6A 1ZOGA 3BLRA 2WMQA 3UOLA 3BHUA 4AGCA 4ASDA 3KXHA 2UUEA 4I5CA 3W1FA 1JLUE 2JFLA 4G5PA 4ID7A 2GNIA 4M3QA 4FTNA 3CCNA 3LMGA 5H9BA 4CFUA 3AC1A 1NVSA 4O0YA 2QCSA 2IO6A 4FV4A 5IEYA 3PSDA 3HECA 4O7TA 4WBOA 2HAKA 3GGFA 4L53A 2FSMX 3P23A 2W17A 2Q0NA 4M0YA 4FR4A 5HO6A 3GCUA 2GTNA 5F20A 1FMKA 5M09A 5GNKA 3QA8A 3WOWA 3RPSA 4O7SA 3CPBA 4QMPA 1H0WA 3OEFX 5BUJA 5ETCA 4NIFA 4QPAA 2BIKB 3LFBA 3FKOA 1Q8TA 2YJSA 5EG3A 2W4JA 2VX3A 2XKFA 5DE2A 5DLSA 5HE0A 5JQ5A 3FEGA 1UU9A 3PPJA 3R8MA 2YFXA 4QMVA 4M84A 5AAEA 1PRYA 3RK7A 2C3KA 4R5SA 3LFFA 4AXAA 4E7WA 2GHMA 3BU6A 3U55A 5JGAA 2CNVA 1Q62A 3PE2A 5C8NA 4XV3A 4MWHA 4DAWA 3N4TA 4O7RA 3DXQA 1XH8A 1P14A 5IEXA 3ROCA 3S2PA 5M4FA 4WIHA 3TV6A 4DEHA 4R77A 4RRVA 3ZO1A 1WBWA 3UIBA 4CQEA 2JKKA 4C34A 4NEUA 4D5KA 1WBPA 4U43A 2OIDA 3RPRA 2UW0A 1JKKA 4OGRA 3KRRA 4BCHA 3MIYA 1VZOA 4J95A 4KAOA 4BWXA 4KBCA 2XNGA 3V01A 1ZWSA 3BGPA 3FJQE 3V04A 4QYHA 5L6OA 4L3LA 4XHKB 3GCPA 4U97A 3FI3A 3UODA 3MB7A 3ZLXA 4ZJVA 5IPJA 5LQFA 2BROA 4OAUC 3FXXA 3MBLA 5ETFA 3II5A 4EH2A 4OT5A 4FKLA 1BL6A 2PL0A 1WZYA 2C5XA 2Z7RA 4TWPA 4HPUE 3V5TA 2WD1A 4C37A 4PF4A 1WVYA 3FLQA 3SG9A 4YO4A 3LFCA 4FX3A 4P5ZA 1CDKA 5CVGA 4CT2A 2KTYA 2W9FB 4IX4A 2CN5A 1Q8UA 2G2HA 4MQ1A 3H9RA 3I0OA 4U41A 5FDPA 2Z02A 4PMPA 2QOCA 5J79A 2J7TA 3AMYA 4M15A 3BLQA 3JS2A 4FSRA 1FVRA 4WA9A 2OI4X 5DYJA 2X6DA 3IECA 3CGFA 1ZMVA 4YC8A 5ANKA 5CEIA 4BTKA 5C9CA 4PX6A 5E8WA 2OIQA 1YHWA 3RAKA 4EJNA 4I6BA 4APCA 3QU0A 5BMSA 5GJDA 3QRJA 4S34A 2F7EE 4GYGA 4LYNA 4RIWA 2R5TA 4GJ2A 3VIDA 2PE2A 1UU8A 2IN6A 2YCSA 4I6QA 4AU8A 2EUFB 2F49A 2OW3A 2O0UA 2B53A 3FZRA 2OZAB 4FSUA 4I94A 4FV5A 2PE0A 4GT4A 5C27A 3R2YA 1O6KA 4BI0A 3NMUF 4MXCA 3U51A 3ZOSA 4RX8A 2A19B 5HCYA 4E4NA 2DS1A 2UZTA 2F9GA 4F9CA 1WBTA 4FTIA 3T3UA 4L6QA 4BDKA 2JEDA 5I9XA 1Q24A 2R7IA 4IZ5A 4D2PA 1JKLA 3F2AA 3MWUA 4OTIA 2B1PA 4NM3A 3TL8A 4RT7A 4CRLA 2GNFA 2H9VA 3EN6A 4F9AA 3JY0A 1Q5KA 1YI6A 4FBXA 4UZDA 4J52A 4I6FA 4MD7E 3PWDA 5HG9A 3WILA 5HVKA 5F94A 3C0IA 3SDJA 1L8TA 2GU8A 3D4QA 4WNMA 4ZTSA 3VBXA 1K9AA 2PMIA 3Q6UA 2WIHA 4UMPA 4DBXA 3CPCA 2A0CX 3NCZA 4UX9A 4FKGA 4HVDA 1YDRE 4LV8A 4UMRA 5CNNA 5HKMA 4BYIA 4IIRA 2I1MA 2YCFA 3MH3A 4M14A 4AT5A 5CAUA 3R8PA 4BGGA 3DA6A 2ETKA 2FYSA 3LE6A 2PZYA 1YDTE 2BMCA 1GZKA 4ZSJA 3SW4A 2LGCA 2WO6A 2B0QA 4PUZA 3R1NA 1U54B 3RWQA 4IAIA 4YSJA 2UW4A 1I09A 1UU3A 1YXVA 3FMHA 4YJQA 1S9IA 4EUUA 3RK9A 3NVKI 4L8MA 4O21A 4R78A 4FC0A 3LQ5A 3BRBA 4O6LA 4XP3A 4OBQA 4TT7A 1H24A 3CD8A 4ZTQA 1KUTA 4PY1A 3A62A 5HORA 4PTEA 4PL5A 3CTHA 4ZK5A 2C3JA 2BZIB 4AF3A 4YMJA 2NO3A 4ASEA 3CY2A 2YIWA 3RPYA 3TDVA 3W8QA 4M66A 5LVOA 3RJCA 3NUNA 3DKGA 5CU3A 1OKZA 4KSPA 3GC7A 3QA0A 4TPTA 5H8BA 1UWHA 3U4UA 3LJ0A 5AR3A 4IAZA 5FBOA 4I6HA 3G9LX 4CTCA 5M55A 2RSVA 4M7IA 4H39A 3TKUA 4AA5A 4CD0A 4CFFA 5AAFA 2P55A 2WFYA 2YIXA 1OIQA 1TQMA 2G2IA 4MXAA 4U6RA 4FTJA 3VUDA 1P2AA 2FSOX 2R64A 3HZTA 5IU2A 5EYKA 3PJ1A 3QQGA 4QMXA 2QO2A 4ZSLA 4MXZA 3BE2A 2J4ZA 4R8QA 4RG0A 1GOLA 4ONAA 3NS9A 5DA3A 3COMA 4U80A 2O63A 1PMVA 2VO3A 2VU3A 4DFLA 5HVJA 5HU9A 3D94A 3PXQA 3UG1A 4DITA 1IRKA 1KE5A 4WRSA 3BZ3A 4CG9A 1F5QA 4IXPA 5LXMA 3F66A 3R7IA 4JR3A 2XIKA 2XIYA 3BV3A 3QD4A 4AUAA 4C7TA 5A54A 2O5KA 3AT4A 2ITUA 4ZSGA 3GCQA 3MFRA 1V1KA 3R83A 2XEYA 4ZEGA 4DG3E 3AC8A 4KA3A 1VYZA 3D15A 3G33A 5IA1A 4YLKA 4GKHA 4E26A 2Q83A 1LEWA 4F7NA 4NH1A 4CCBA 3DOGA 5I3OA 3OC1A 1GZOA 4RWIA 2REIA 1V0PA 4IE9A 2V55A 2YAAA 4GL9A 4L7SA 4TN6A 4TWNA 2UZVA 2XIRA 3DNDA 3GXLA 3COKA 3U87A 5TO8A 4EQUA 3K5VA 3I1AA 1XBBA 2J50A 2JC6A 3BLHA 2VO7A 4LMNA 5HBJA 4O83A 3QTXA 3ZUTA 4NTTA 3AGLA 5J9LA 4F9YA 2YCQA 3QCXA 4BIEA 4FZ7A 4MNFA 3OW4A 4YZNA 4MBLA 4RWJA 2HWOA 1CMKE 1W82A 4ASZA 3CQEA 4AA0A 3PUPA 2DWBA 2PZIA 4BB4A 3FMKA 4WUAA 1FOTA 1HCLA 4D4VA 3MIAA 5CU0A 5CZHA 5LMKC 3MFUA 4MNEB 4E8AA 4OAVB 2BZKB 4JS8A 4EC8A 3R8ZA 5AEPA 3GBZA 4E5WA 3VAPA 1OI9A 1BKXA 1AD5A 1JAMA 3AC5A 3KK8A 1H1RA 3P7CA 5CVFA 3OCTA 4BTMA 5AV4A 3KCFA 4NK9A 4B6LA 1T46A 5M4IA 4DH7A 2FUMA 5BVNA 4IBMA 5CNOA 3QKKA 3E3BX 4OBOA 1V0OA 5HO8A 5CF6A 5DOSA 3JPVA 1I44A 4FA2A 3PLSA 4QQJA 3ORMA 3CTQA 1DM2A 4DLJA 5HG8A 2BRGA 2RIOA 5HD7A 4CKRA 4AW5A 4QTBA 2XK4A 4IFCA 3UNKA 4LM5A 3F5GA 5JK3A 3ENMA 1XO2B 3IONA 3UTOA 2ZAZA 4R3PA 5A6OA 3IQ7A 4GK3A 2CLXA 1STCE 3VUMA 4EUTA 3D83A 4XP0A 5BMMA 3QYWA 2C0TA 3MY0A 4G34A 2WTKC 3NGAA 5IG1A 1IAHA 2R3LA 2XKEA 2OU7A 4FV0A 5JQ8A 3FDNA 1P4OA 4AZFA 2UW8A 4X6RA 5KMJA 5BX0A 4TYIA 1BYGA 1YWVA 3SV0A 3TNWA 3VJNA 4O0TA 5HLPA 3ATSA 4NIFB 4S32A 4FEWA 3UC4A 4DGOA 2P4IA 2F4JA 3TKHA 3W2OA 3OWPA 2R3GA 2W4OA 1GIHA 4G9RA 5A4LA 4HZSA 4ZXTA 2R3PA 3QCSA 4HYUA 1M2QA 4QYGA 3EKKA 5DNRA 2Y7JA 4O7NA 4CEGA 2R0IA 5K4JA 4PDYA 3UQFA 1HCKA 1OKWA 1J7IA 5DN3A 3UP7A 4IJPA 3ZLWA 5EYDA 4WNPA 3P9JA 2VTIA 4XCUA 3UYSA 3COHA 3LCKA 2PVYA 4JX3A 3G90X 5BVOA 5CT7A 1LPUA 4NJ3A 3I5NA 1R78A 4MXXA 5LWMA 3E93A 2JDOA 2C6TA 4D28A 3HDNA 3KEXA 2W1HA 4BRXA 3DDPA 4KS7A 4BDBA 4ZS4A 4W4YA 1NXKA 4FTMA 3ACKA 4M0ZA 2JFMA 2ONLA 4AZWA 4DBNA 3QTSA 1Q97A 2BUJA 4XG2A 1QPCA 3MJ2A 3BYVA 4BFMA 2FVDA 5EW3A 4MHAA 1XH5A 3EZVA 2ITWA 2CNQA 3AMBA 5HBHA 4NT4A 2JKOA 3F5UA 4G2FA 3O50A 2PWLA 2OJFE 3UJGA 5JEBA 4H1MA 5K5XA 3HAMA 1RW8A 4X2JA 2GHLA 4WT6A 4A9RA 4PL4A 1IA8A 4Y5QA 5FD2A 4DT9A 1WAKA 1FQ1B 5HVYA 4L3PA 4FUXA 3D0EA 4BTJA 4FYOA 3F2RA 2HXQA 4KNBA 3QTUA 5ANGA 2PY3A 3RBWA 2XS0A 4I22A 3LVPA 3ZUUA 4FTCA 2G1TA 2AC5A 4G6LA 3I7CA 5G6VA 2LAVA 3EQRA 2IVTA 4RFYA 3FE3A 5E7RA 3QD0A 1SYKA 4F1OA 4DEGA 4H58A 3OTVA 1IG1A 1JSVA 2HZ0A 3VO3A 4EC9A 2WQEA 4U5JA 1OPJA 1WBNA 3F3VA 5LARA 4QMWA 5CS6A 3JUHA 2ZYBA 3AD4A 4JDKA 4EK4A 2QHNA 1YHVA 4CYIA 3EQFA 3QGWA 2C6OA 5HO7A 5LWNA 2PUPA 5D11A 3O0GA 3MB6A 4FEVA 3DKOA 4AP7A 1LEZA 2R3JA 4FV2A 4P90A 2OGVA 4C2VA 2E9NA 1E9HA 1SNUA 2VTPA 1JQHA 2ITYA 4IZAA 3LJ1A 4J7BA 4C4JA 3H30A 4DG2E 1Q61A 3KB7A 2YWVA 4FIFA 1XH4A 4LV5A 2EB2A 5KBQA 5KMMA 1UNGA 2XVDA 4V01A 3NUXA 4GW8A 3QLFA 2WMRA 3EN7A 3M2WA 3WIKA 5EQYA 3A4OX 3DBDA 4GH2A 3SOAA 2UZLA 4MVFA 3KQ7A 4KRCA 3NNUA 4RBLA 4AW1A 4ZY6A 2CGXA 1YWNA 3MPAA 3FLYA 3ATTA 2A1AB 3ORIA 3D2KA 4D4RA 2B4SB 4EH8A 3U4WA 3ZEWA 3D5UA 4DN5A 5IQIA 2UZEA 3E87A 4HYSA 3R8VA 4QMMA 4I0TA 4I92A 4O1OA 5L3AA 2CCIA 3AT3A 3GCVA 2YM6A 3UQCA 3HMPA 4AGWA 4ZTHA 3RI1A 1REKA 3PRFA 4QPSA 4RJ3A 3KC3A 2O64A 3R7VA 3OS3A 1AQ1A 2OZAA 4Q5EA 5KHWA 2W1EA 4OTHA 4ACGA 3O96A 1Y91A 4EK8A 4FEXA 2Z7SA 3GP0A 1QPJA 2Y4IC 4FEQA 5C8KA 3B8RA 4FKPA 4OTWA 5HE1A 3ALOA 1P5EA 2VTRA 5C26A 3IOKA 3PZHA 1ZOEA 4FKWA 4GV1A 3T9TA 3ERKA 5GIOE 2V7OA 2XK8A 4E1ZA 4BDIA 4QD6A 3MN3A 2R3KA 3M42A 1JSUA 3L9PA 4QO9A 5ACBC 5AAGA 1XH6A 3TUDA 3C7QA 4XG4A 3QKLA 3JVRA 4GUEA 4MF1A 3KMWA 4FZDB 4EHZA 3ZZWA 4XP2A 1FBNA 4XG9A 3IW5A 3MVLA 1O9UA 1PXMA 4M97A 2IW6A 3EN4A 5CQWA 2NNWB 2CPKE 5KUPA 2ZV8A 4EZ3A 4O7VA 4FIEA 4DTKA 4ORKA 3AC3A 4R7HA 3MVJA 2IWIA 4EK3A 2JAVA 3C13A 5FTQA 5CU2A 1QL6A 2VWWA 3OF0A 4BL1A 3S95A 3ZFXA 4FSQA 2A27A 3R8UA 5C8MA 2RG6A 4KUJA 3UMWA 4BHZA 3LFEA 4E4LA 1U54A 4EI4A 4RWKA 3SOCA 3DAJA 3EFLA 4W4XA 5KZ0A 2CKOA 5DBXA 3G51A 1H0VA 1DI9A 2BDFA 4DEBA 5ETAA 4QYYA 4KKEA 4X3FA 2FB8A 3NPCA 4NU1A 3Q4TA 3PG3A 4YSMA 3LKMA 3ORTA 4RJ5A 2R2PA 3IDBA 1XHAA 5IZFA 5AUXA 2YZAA 4LOPA 3F88A 2HW6A 3FYJX 4L52A 2WMSA 5E8ZA 5EKOA 5FLFA 1FVTA 4JI9A 3O8PA 5E8SA 3FZTA 3VF9A 4FOBA 5CY3A 4EHGA 3D9VA 3ZH8A 5IQEA 4DC2A 1LR4A 5C01A 3W2SA 3KRXA 4JDJA 3ZUVA 4B8MA 3NAYA 3VBVA 5EW8A 4JR7A 4ANMA 3WF5A 3U54A 2O8YA 2PVHA 4X7QA 4GEOA 3PDTA 4YJSA 4F7SA 1U59A 4QQCA 4MCVA 3F9NA 4JG6A 3WE8A 4QMLA 4FTKA 3UMXA 4AN2A 2C47A 4ITHA 5FXQA 4YP8A 3PY1A 3VBYA 4R6VA 4RX9A 5HCZA 4QMYA 5K3YA 3TUCA 3TDWA 4M69B 4RJ8A 5A9UA 1GNGA 2CN8A 2PVJA 4FODA 4DCAA 5E90A 4RFMA 1OMWA 1M52A 3FZPA 3L9LA 4O1PA 3LFNA 4XV9A 1Z57A 3R7EA 1SVHA 4C2WA 4QP7A 3QUDA 1JWHA 3TZ8A 5CAVA 4FE2A 2BKZA 4EJ7A 1NVQA 4G3CA 3E5AA 4RLLA 5KKRB 4HCTA 4FSTA 3OT8A 2W06A 3A7GA 5CWZA 3LM5A 4BDGA 1PY5A 4QNAA 5EHOA 2CJMA 4O0SA 5H8EA 1WBOA 1DI8A 3UGCA 4E93A 3MV5A 2OLCA 1XR1A 3ZTXA 4P4CA 3PXKA 1T45A 3ZDIA 2WEVA 3R28A 4YLJA 4TYJA 4LMUA 4F7JA 1MUOA 4QQTA 2RL5A 2VO6A 3DPKA 4C57A 2UZWE 1NY3A 4CCUA 5IQGA 1GIIA 2IZRA 2XIZA 4WRGA 4C59A 1ZYDA 4OTPA 2ZDUA 3Q04A 1W7HA 3Q3BA 3UDBA 1YXTA 1UA2A 4Y72A 5E8VA 3QTIA 4YJOA 2XP2A 3QRTA 3ZSHA 1VJYA 1F0QA 5CXHA 4C0TA 4ACDA 1UNLA 2QI8A 4WKQA 3O7LD 4IVAA 2ZDTA 4JRNA 2C6LA 3R00A 2ZV9A 5EDRA 5LVMA 2R0UA 4D55A 5D41A 2OZOA 4BCNA 2BKKA 4NCTC 4B8LA 2YEXA 1OKVA 4TYGA 4YO6A 4G5JA 3QCQA 3ZEPA 3RHKA 4BCFA 3BYSA 2VWZA 3OHTA 5FTGA 3PPZA 4MNEA 5AP6A 1ZARA 2QOOA 5J95A 4FTAA 2JKMA 2V22A 4MH7A 2C5OA 2ITOA 3RMFA 3THBA 3NW5A 3WARA 4GS6A 2QODA 2VTAA 3BPRA 4IVCA 1UKIA 2C3LA 4NZWB 4E4XA 4F65A 3G0EA 1J1CA 5M07A 3PA3A 2RFNA 4DT8A 2C68A 3WE4A 3GC8A 4EOLA 4JRVA 4ENXA 4N6YA 2QLUA 3ZU7A 1ZY5A 3ID6C 4DLIA 2W1IA 3KA0A 5AR8A 3UO4A 4DEIA 4F08A 5DWRA 3OTUA 5CF8A 2H8HA 5I3RA 4RVMA 4DF3A 2G2FA 5DHJA 5ANEA 5HOAA 2JIUA 2ITNA 3F7ZA 3QX2A 4FVPA 3O2MA 4YHTA 5LVPA 5L2TA 4MYGA 4I0RA 2XCKA 4TNBA 2QG5A 4YR8A 2OXYA 5EDPA 3O8UA 4GMYA 3SLSA 1KV2A 1BLXA 3COIA 5CEOA 3FY2A 2SRCA 4O0UA 5CF5A 2EWAA 2PHKA 4NJDA 2NP8A 3PXZA 5HG7A 2BPMA 1Y6AA 4GG5A 4IVDA 4QTDA 4IM2A 1F3MC 3KREA 2QOFA 1KE8A 3L8SA 4E4MA 4XG7A 1Q8ZA 3C4XA 3DLZA 5AV0A 2IW9A 5IH4A 2GSFA 5DR2A 1APME 1ZXEA 4G3GA 5EM5A 2HZ4A 4FK6A 4GIHA 5DT0A 3R1SA 4LGGA 4H36A 3BYOA 3RNYA 2IJMA 4PRJA 1OL6A 4P7EA 4S33A 3GU4A 3KN5A 3OXTA 5IQFA 3U6HA 4GKIA 1AGWA 3KCKA 1YXXA 4BDJA 4BCJA 3R01A 2P33A 4L67A 5K0KA 3CD3A 3EQDA 3QF9A 4A4XA 4IMYA 4HGTA 3ZS5A 5J9ZA 5DI1A 3F6XA 1H28A 4D58A 1OL1A 2RFSA 2ETRA 3B2WA 4USFA 2OO8X 3P5KA 4PL3A 4FIJA 4J99A 3CC6A 2IZTA 5CTPA 4EOQA 2KULA 2BDJA 4BGQA 4L68A 5C03A 3E88A 2B9FA 3D5XA 1PXOA 3SHEA 4V05A 4ERKA 2JDSA 3C5IA 3OCBA 4YHJA 4IDVA 2ITZA 5CEQA 1KOBA 2DUVA 2YAKA 3C51A 5CLPA 5EK7A 3QX4A 4PQNA 3ANQA 2VTLA 4V0GB 4R1YA 2XF0A 3EL7A 3TNPC 3QGYA 1M2RA 2W1DA 4GJ3A 2VD5A 2HYYA 3DJ7A 5EW9A 3WZEA 5CEKA 2CLQA 4ANBA 5J7BA 2X2LA 3R7UA 2ZV2A 4IB3A 2GMXA 3ZMMA 5CVHA 5HD4A 2W1GA 4RJ4A 3ZRKA 3ALNA 4N70A 1ZZ2A 3UG2A 1WBVA 2JGZA 2ZB1A 1H1PA 5ICPA 2HZNA 3EFKA 3OG7A 4ARKA 4BDDA 2JDTA 3AQVA 4BHNA 1FVVA 3LQ8A 2UVYA 1YXSA 1KE6A 2VWXA 2I0EA 3WF9A 2J0JA 3LMHA 3KF4A 4KD1A 1Y8YA 2GFSA 5FP5A 3ACJA 3ZONA 4R7IA 1U5QA 3EQGA 2C5NA 2YM8A 4GFMA 3DLSA 3NYXA 5H3QA 5AUUA 3KRJA 2WTKB 4TYEA 2B54A 4UYNA 2JIIA 2VTJA 5CAOA 5GHVA 1OBGA 2X7OA 5IDPA 2WEIA 2YJRA 3BHHA 3FMNA 1PXKA 3KKVA 3QL8A 4EONA 4KIKB 5JGBA 3DBFA 3ZLYA 4F0FA 1G3NA 5AR4A 1QCFA 3Q4UA 2W5AA 3C50A 1DAWA 2YDKA 2VTQA 3FMMA 3PTGA 1URWA 4RIYA 1ZYCA 5KCVA 3AG9A 1OIUA 3IGOA 4EOIA 5AM6A 3Q2JA 4C3FA 3FBVA 4EWQA 4FV8A 1QPEA 2OFVA 3CBLA 1J7LA 3R9RA 5AA9A 3OMVA 4U40A 3DK3A 5EI6A 1H27A 3E7OA 4GIIA 3FLZA 2YIQA 4DE4A 3VUHA 4GCJA 3HX4A 4APPA 2YIRA 3LXNA 3DU8A 1OPLA 2UZOA 4GK4A 1YDSE 1MRUA 3MVMA 4LUEA 1GAGA 3DZQA 4JQ8A 5F9EA 1M2PA 2ZM1A 2OG8A 4JIKA 3DDQA 5HIBA 3BWFA 4X6QC 3R22A 5AR2A 3KMUA 4PWNA 3VUKA 1OL7A 4QOXA 1G5SA 2ZJWA 3VUIA 3GOPA 2UV2A 3POZA 3CE3A 4FTRA 4EOPA 2WMWA 4C38A 3MYGA 3PWYA 4FSNA 4EYJA 1H4LA 2WU7A 3UOJA 2QNJA 3IW6A 2C69A 3TIZA 3RCDA 2BFYA 4HCVA 3PIYA 4FV6A 4IH8A 1IASA 3G2FA 2QOBA 3BWJA 1WVWA 2R4BA 3LW0A 5DR6A 4I5HA 5J5TA 4ALUA 3EN5A 5FEDA 4TL0A 3FMLA 4X3FB 4EQCA 4BZDA 3PG1A 3QTRA 4KKHA 2GS2A 2QHMA 3KN6A 3PJCA 4O91A 3R9DA 4AT4A 2AUHA 2X7FA 3RP9A 3E7VA 4FICA 1MP8A 5HU3A 5IA4A 3DJ6A 3MI9A 3QQLA 3RINA 3HA6A 4QP6A 4LG4A 4BF2A 2WELA 2P0CA 2X4FA 1BX6A 1BUHA 2YHVA 3FY0A 4K33A 1WFCA 3D5VA 4MTAA 3TNIA 3A99A 4CMUA 3NUPA 1L3RE 4Q9SA 3BIZA 3LHJA 3AC4A 4TWOA 3O71A 2ETMA 2PSQA 3E64A 3F7WA 3OWKA 3HLLA 5AX9A 3WZJA 4QP1A 3KY2A 1B6CB 3GI3A 4KIQA 4AW2A 2J5EA 2JD5A 2VWVA 4V04A 5TF9A 3FLSA 3EN9A 2HCKA 4K9YA 4L7FA 4RX5A 2I0YA 3VS1A 3R7OA 1TKIA 4QMUA 4EH5A 4TRLA 2WMUA 4NM0A 3DBCA 5L2WA 4FV7A 3UZPA 3CTJA 4MK0A 1B38A 3GOKA 3H10A 2FO0A 2VWUA 1GJOA 3ZXTA 2ZVAA 3LQ3A 4EOSA 2UW5A 4AZTA 4I41A 2OBJA 2OH4A 4FSYA 3UIUA 3REPA 1ZOHA 4F0GA 1RE8A 4W8DA 3FMJA 2YACA 3M1SA 2JITA 3FXZA 2BFXA 2WHBA 3T8OA 5CSWA 3HL7A 3RVGA 3UOKA 4O2PA 2IPXA 4LL0A 3GVUA 4FSMA 5KE0A 3EQHA 2ITQA 4ZJIA 4W9XA 5FEQA 2CSNA 4I21A 4QP9A 3QRUA 3FSFA 4K18A 3UVRA 3HV3A 2W9ZB 4KKGA 5IUGA 2IVUA 4MXYA 5JZNA 2OJJA 4OTDA 2PZ5A 4JLCA 2QG7A 4WBBB 4G3EA 1W8CA 5BYYA 4XLIA 4Y83A 3GU7A 4XG3A 3Q9XA 3P78A 4FKOA 4GSBA 2OK1A 3TXOA 4L3JA 4U44A 2QU5A 3IOPA 5E8UA 3TN8A 4A9SA 2R3FA 3BX5A 4L00A 4OR5A 4C4HA 5ANOA 3WZKA 5FEEA 2QQ7A 3DV3A 5E1SA 4ZLYA 5IQCA 4HVGA 3RAWA 1ATPE 2EU9A 3FMEA 5DMZA 3HRCA 4B99A 1OL5A 2WPAA 4M69A 3ZFYA 1QPDA 3E62A 4I3ZA 4DGGA 1J3HA 2QOQA 4MKCA 4RVLA 2E9PA 3NLBA 4YUQA 2B9JA 1MQBA 3NWWA 5J7HA 3W2CA 3T3VA 4QQ5A 5TR6A 3KXXA 3AT2A 3OOGA 1H01A 3PFQA 1PXPA 1FGKA 4FTLA 4PMMA 4Y95A 4BKZA 3S00A 3BBTB 3BU5A 2R3NA 4EZ5A 2YIYA 4CLIA 4FTTA 5GZ8A 3NX8A 4CXAA 1ZRZA 4G1WA 2OF4A 5FM2A 1ERKA 4OTRA 4EQMA 3F3UA 1XBCA 3RNIA 4NYEA 4S31A 3U9CA 2XZSA 5HCXA 5HE2A 2YN8A 3GU8A 3TV4A 3BHYA 2J2IB 3N4VA 2XNEA 3TJCA 4JVGA 3LPBA 4L01A 4BGHA 1YI4A 3DZOA 2X2MA 2VGOA 3IDPA 4BDHA 3JVSA 2ITVA 4JX7A 1QMZA 1KWPA 3ORNA 4D2TA 4CNHA 4G3DA 3VS7A 3PXYA 5I9WA 2Z8CA 3HRBA 2PTKA 1Z5MA 2B9IA 5J8IA 4YBJA 2RFDA 5E91A 2W1CA 4C62A 1Z9XA 4WNOA 3PY3A 5FP6A 3MFSA 4L44A 1OIYA 1E1XA 4HYIA 3SXSA 3R7GA 4BCKA 4LRMA 1U46A 3HYHA 4IB1A 3BU3A 4RIXB 4FOCA 4O96A 5D12A 3ULZA 4QMSA 2PVNA 3K3JA 4O6EA 5IISA 3KL8A 5AP0A 5BVDA 5JFXA 3AMAA 3LZBA 1Q8WA 3RAHA 2G9XA 4FT3A 3DTCA 4AOIA 1IR3A 1H07A 3I5ZA 2B7AA 4U8ZA 3PP0A 3QQFA 4ACCA 2YDIA 4IVBA 4BY9E 3AOXA 2W0JA 4ITIA 3TWJA 1PJKA 3OWLA 2XNBA 3HUBA 4FNXA 5A4EA 4YPSA 4OTFA 3NIEA 4ZIMA 2PK9A 4E3CA 3FQEA 4JBOA 4E6DA 2BALA 4F7LA 3R9HA 3PA4A 5IF1A 3FPMA 1W98A 4WOVA 4DH8A 4IADA
chains in the Genus database with same CATH superfamily
4ZAUA 4MAOA 3BCEA 3HUCA 2VWIA 4IHPA 2WQBA 4RFZA 4IDTA 4LQMA 4BIBA 4AXEA 3DY7A 3PY0A 3V5JA 4O38A 4I24A 3TG1A 4DFZE 1JKTA 1S9JA 3KGAA 1R1WA 2PUUA 4CZTA 1U4DA 3I6UA 1TFFA 3GC9A 2I7QA 3LOKA 2J90A 3HV7A 4TZRA 3BEAA 3SC1A 4UXLA 4HVSA 2QR8A 4ZTRA 4AN3A 4JG7A 1J91A 1FGIA 4FIIA 1H8FA 1KE7A 2XM8A 4I93A 3WF7A 4C36A 5EQPA 4IFGA 3VNTA 4FV3A 1UVRA 4IANA 5GJFA 2O65A 4CKIA 3MPTA 3EMGA 5BQ0A 4WSYA 2H6DA 2F7XE 4I4FA 4FRFA 5I9UA 3GQLA 1M7NA 2UW9A 3HEGA 5CANA 1GZNA 5BPYA 4AX8A 5AFVA 3RZFA 5B2MA 1EH4A 2BCJA 3R73A 4GYIA 2WZJA 4EOOA 4LOQA 2UVZA 4TY1A 4FKRA 3TT0A 4JQ7A 5JN2A 2XJ0A 2PPQA 1XWSA 4L43A 4BBFA 4IC8A 3OUNB 2EXEA 3CGOA 4OUCA 4ZZMA 4D9TA 5FWKK 4E6AA 5BYLA 5FRIA 5H2UA 1XJDA 2W96B 4UWBA 1RDQE 3L8VA 4ZLOA 5CSPA 4N6ZA 2XRUA 3HMOA 3PVBA 4U9AA 3FYKX 4Z16A 5HX8A 2F7ZE 4WSQA 3A8WA 1SVEA 4C4GA 1LUFA 1B39A 4FTOA 5T6KA 4Z3VA 5K4IA 3Q52A 4K6ZA 3QQJA 4H05A 4LV7A 3KVXA 4NKSA 3VRZA 4NTSA 5L2QA 4V0GA 3PXRA 5CX9A 3EB0A 3PP1A 2QOLA 1FINA 3Q53A 4UWYA 3P86A 4EKLA 5KX8A 3BELA 2C6IA 5D9HA 2XCHA 4CYJA 4DFYA 3MTFA 4EOMA 2XEZA 2X0QA 3P4KA 1R3CA 4RQVA 1NVRA 3FL4A 4FGBA 5E8YA 3FQHA 1ZYSA 4RIYB 5HLNA 1YOMA 2C5VA 3E63A 3GC0A 3FI2A 4EHVA 4YZCA 5EQEA 5LMBA 3G6GA 4AFJA 5AP2A 2BAQA 2XK6A 3NIZA 3W0NA 2WTDA 5E8XA 4FNZA 5FBNC 3IW8A 2XNNA 1CM8A 4LRKA 1A06A 5B2LA 1OPKA 4L45A 2NPQA 3K2LA 4C8BA 4ZMEA 3NR9A 1ST4A 3UYTA 5J1VA 2YM4A 3FKNA 3MGYA 4B4LA 2PVMA 5E8TA 4B0GA 5M08A 2VNYA 4XV1A 3O51A 1ZMWA 4XYFA 5A4TA 5E4HA 3ZO3A 4O7YA 3P5JC 4XEYA 4A9TA 3NUAA 3F82A 1Q4LA 2E2BA 2GNHA 5IQBA 5AP3A 2VZ6A 2OXDA 1OGYA 4KIKA 5EH0A 4EK5A 4OLIA 2P2IA 4FKJA 4BBMA 3H3CA 1CKJA 1JKSA 3ANRA 4S30A 4AOJA 4HW7A 5A4CA 3Q4ZA 1JNKA 4GUBA 4TYHB 3VBQA 4BZNA 3HA8A 4ANLA 3WBLA 1JBPE 5BVWA 4DFUA 3MA6A 5HNBA 1OGUA 1LP4A 5D1JA 3Q9ZA 3VS6A 3BYUA 5I5ZA 2VO0A 3A7IA 2J6MA 2B55A 2XJ2A 2VTSA 4DH1A 2X9FA 2PZRA 3I4BA 4TXCA 4CFNA 2YABA 3BEGA 2BHHA 4AGUA 5IA5A 4QPMA 3CXWA 3D2IA 4JDHA 1H26A 1MRVA 3BBWA 3BV2A 2EXCX 2OJGA 4ZTLA 1J7UA 4LUDA 5AIKA 4RVTA 4WNKA 3PVGA 4S2ZA 5F1ZA 3D14A 5KMOA 4K1BA 2OF2A 2UZBA 2ITPA 3OVVA 3ODZX 3AKKA 2NRYA 4IWDA 3V6SA 4O81A 4RWLA 4KBKA 1SZMA 5I9VA 4CT1A 4Z7HA 4PTGA 2XK7A 3FSKA 4XLVA 3VS5A 4I0SA 5AP7A 2VTNA 5CI6A 2W1ZA 2P2HA 3NUSA 4GU9A 3UNZA 5CSVA 4ASXA 5JMSA 2X8EA 3DK6A 2QC6A 3Q5IA 4FKTA 4EBWA 4UBAA 3SKCA 4PNKA 3UO5A 2BRMA 3N9XA 2QD9A 3VS3A 5I9YA 4JQEA 4YJNA 2PVFA 3F5PA 1ZY4A 3KMMA 1ZYLA 4ZJJA 4E6CA 2XYUA 3L8XA 2YERA 3V5WA 4U42A 4MF0A 1Y6BA 3QZIA 5IEVA 4I1ZA 2JBPA 1OKYA 4XUFA 4B7TA 3NUYA 4XOYA 3NNWA 3RCJA 4EBVA 4J8MA 3M11A 2V0DA 3CEKA 2ITXA 3DBQA 3P7AA 3QTZA 3CP9A 1JOWB 3B8QA 4FG8A 1WBSA 4DYMA 2W5HA 5JRSA 2C6MA 3ETAA 3FWQA 3R02A 3N4UA 5EM6A 3QXPA 4UWCA 2C1AA 2XH5A 3VWAA 4O22A 4M67A 4HCUA 4IAFA 2FSLX 4UEUA 4USDA 2IVVA 3VRYA 2OFUA 3ET7A 2BDWA 3KU2A 1ZMUA 4BN1A 2UW6A 4G16A 4L42A 4H3BA 4QMTA 1UNHA 4ZS0A 3C0GA 2ZM4A 3KVWA 1URCA 2WGJA 3QALE 4C61A 3V8TA 4RZVA 1KV1A 2R3HA 1PF8A 2WMBA 2WU6A 3ZRLA 2BTRA 4YJTA 2NRUA 2UZNA 4IAYA 3LAUA 4RJ7A 2Z7LA 3G15A 2X39A 3PSCA 5TE0A 2WMAA 3RWPA 4BKJA 4LGHA 2BRHA 4CMTA 3FHRA 3GFWA 4PDPA 3MA3A 4YZDA 4CKJA 3MVHA 1G8SA 4FTUA 4M13A 1OIRA 4C02A 3EQIA 4G31A 3BGZA 4F0IA 2PMLX 2BAKA 2QOKA 3CJFA 3KXZA 3LXPA 3K54A 1A9UA 5L2IA 3CIKA 4C4EA 2I6LA 4UV0A 4QNYA 5G1XA 3S4QA 3QD2B 3QXOA 5ITAA 3A2CA 5DT4A 3A7JA 1MQ4A 1BL7A 3C5UA 3Q9YA 4UMQA 3H0ZA 4W4WA 2FGIA 1R0EA 1Q8YA 3C0HA 1Y8GA 4LRJA 3LCOA 3PVUA 4ZY5A 1W2CA 3UOHA 3PZEA 2BVAA 4FZAB 2WOTA 3P08A 4JXFA 4JDIA 1CKPA 3POOA 3I0QA 4DH3A 1W83A 4I5PA 1OUYA 4D1XA 4ZSAA 4QEBA 2WQMA 1OVEA 4IQ6A 4O0VA 4P5QA 3H9OA 5CT0A 3LFAA 3FLWA 3S1HA 5AV2A 2ZM3A 1XQZA 3W16A 2FA2A 2I0HA 4RIOA 3V8SA 3NEWA 3UIXA 1PMNA 2WMTA 3VHKA 5JKGA 4LOOA 4UMTA 2CCHA 3FC2A 3KXMA 2XK9A 1YKRA 4K2RA 3BQRA 4FT0A 3BI6A 4YZ9A 5C1QB 2VAGA 4C4FA 1M14A 2YM7A 4QMQA 2VN9A 3EFWA 3UVPA 4J71A 4E5AX 3ZBFA 4HJOA 4CSVA 5FXRA 5IH6A 4X2GA 3R8LA 2C6DA 3FZSA 1O6YA 2XKCA 2PVKA 3C4ZA 3DXNA 3HDMA 1DAYA 2XNPA 4FNWA 4FT9A 3S3IA 3FXWA 4IEBA 2GNLA 3Q9WA 4FL3A 4XG8A 4BVUA 4BCQA 4C3PA 4C35A 2C30A 3IKAA 5ANJA 2VWYA 4Q5HA 5J87A 5ACKA 5B2KA 1P4FA 2F2UA 4IB5A 4PV0A 4CV8A 3DS6A 1Q99A 4HVIA 2XJ1A 3H0YA 3LCDA 5H8GA 4JMQA 5DEYA 2UW3A 3IGGA 4RIXA 3ELJA 5J9YA 2YWPA 4RLKA 4CTBA 4ANQA 5AMNA 3EQPA 4WD5A 5AV1A 4PP9A 2ITTA 4JBVA 4UYAA 3FHIA 4O0XA 5EI8A 4BWPA 3VS2A 3HMIA 2BZJA 2OKRA 3ORKA 4D5HA 4PPAA 5A4QA 5E1EA 5A3XA 2XBAA 4UB7A 4WO5A 3KK9A 3DTWA 2Z7QA 3GB2A 4Y85A 5CSHA 3QHWA 4KS8A 3A7FA 3VF8A 2Y6MA 3PXFA 4J96A 2YCRA 4ZZOA 1OM1A 2ESMA 3EQBA 3JYAA 2G01A 4D1SA 5HIDA 3Q4CA 1K3AA 3C1XA 4DEAA 5M51A 4IWPA 1YOJA 2Z2WA 3DB8A 4MD9E 4I23A 2NYAA 3D7TB 3GQIA 1IA9A 2QO9A 3T9IA 2QO7A 3QLGA 4YTFA 2EXMA 4CGAA 2CDZA 4PDOA 5M44A 3MY1A 1YW2A 5L8KA 1OUKA 1PYEA 3W33A 2UZDA 4GU6A 2QONA 3VBWA 4XOZA 4AZEA 3IK3A 5M4CA 1VEBA 3EYHA 2W7XA 5JH6A 3NYNA 3O5AA 4MQ2A 4F70A 2PU8A 3U9NA 3CKXA 5LVLA 2XK3A 3FV8A 3U8WA 4EL9A 3WZDA 2HIWA 3VJOA 3CJGA 2RGPA 4G6NA 3DT1A 3KIOC 2X0GA 5AP5A 4D4SA 3CQWA 4KBAA 3UZTA 1PYXA 4R1VA 3ZRMA 5JFWA 5HI2A 1KOAA 4D4YA 4GFOA 5IA2A 5GZAA 2DYLA 1BMKA 2GCDA 1R0PA 3L9NA 4FZFB 4IX3A 5HLWA 3OFMA 2WTIA 2ZOQA 2JDRA 2EVAA 3CY3A 3DGKA 5KZIA 3VHEA 5CENA 2VX0A 2QLQA 4EK6A 2OWBA 2GQRA 4R5YA 1WMKA 3OY3A 3GT8A 1J1BA 4FV9A 4RX7A 5AP4A 3VN9A 4ACHA 4EH3A 1CKIA 3PRIA 4IACA 4DFNA 4RVKA 3PSBA 4KRDA 2R9SA 5HESA 1PMUA 2PVRA 4FL1A 3LCTA 1ZYJA 4D0XA 4FIGA 5M57A 3MPMA 5GZ9A 3ULIA 3CSVA 4YJRA 3WYXA 2OICA 5IMXA 3W0SA 3QRKA 5LJJA 2GNJA 2YA9A 5DVRA 4IX5A 2CKEA 4UMUA 1Q41A 2J0IA 3PYYA 2RKUA 4JAIA 5AR5A 4DTBA 5IKWA 4KIPA 3HAVA 4XJ0A 5CAPA 3MDYA 2FSTX 4YURA 3NVMB 3HVCA 3SRVB 3HP2A 4F78A 4FT5A 5CZIA 4XRJA 2WQNA 4X21A 3VS0A 3W10A 5BNJA 3WF6A 3ZM4A 5EFQA 1PMEA 4UN0C 4CG8A 4UY9A 3OWJA 2CHLA 4NCTA 3SX9A 2PUIA 5ANDA 4EHEA 3JR1A 4YZBA 5DH3A 4IX6A 3I6WA 4JL9A 3V5PA 4MXOA 2VWBA 2W5BA 3RK5A 3CLYA 5HZNA 4BCIA 3SGCA 4AG8A 4R3RA 4U7ZA 4XH6A 3KXGA 3WYYA 1K2PA 4CVAA 3BQCA 3ZFMA 4R7BA 4H3QA 3ZO2A 1Q3WA 2Q0BA 1VR2A 3FL5A 4FT7A 3Q32A 4G17A 3ORPA 4RZWA 3W2PA 1YHSA 2QKWB 4QTCA 4BBEA 4CQGA 3ZSGA 4A4OA 4HGLA 5JFSA 2IVSA 4FEUA 4IW0A 2WAJA 3WZUA 5BUIA 3QQUA 2UW7A 4E73A 3UC3A 5I9ZA 4PPCA 3E92A 3NCGA 4WHZA 3SA0A 3QC9A 4OBPA 3QCYA 5HE3A 4RQKA 2JDVA 5CQUA 2VRXA 5A46A 5BUEA 4ZOGA 4AA4A 3SQQA 5JSMA 2VX1A 3QHRA 3OY1A 2WB8A 3RALA 5KKRC 5D10A 3HMMA 2PZPA 3TCPA 5DG5A 3QAME 2HWPA 4NUSA 3RAIA 3D5WA 3LFQA 2AYPA 3Q6WA 1H00A 2YLEA 3RHXA 4DEEA 5CF4A 3VW6A 4X0MA 1M17A 1W84A 4X2NA 4BDCA 1JVPP 3TM0A 5AWMA 1CTPE 4TYHA 4Z55A 3FMDA 3VBTA 4DCEA 3SW7A 4YU2A 4UXQA 2C0OA 3DQWA 3DKFA 1PXJA 4G3FA 2W05A 3OZ6A 4M8TA 4AE6A 1YRPA 3QBNA 3I7BA 4IJ9A 1PXLA 3I81A 3EIDA 3DKCA 4OTGA 3QQKA 5IMEA 5AUVA 4FIHA 4J1RA 4XX9A 3BGQA 5HTCA 4HZRA 3CR0A 3P1AA 2UZUE 3UVQA 4YNOA 4A9YA 2WMVA 3F69A 2IF8A 3NW7A 4XG6A 5CSXA 4ZTNA 4O84A 1NT2A 2XKDA 4G6OA 2XMYA 3V3VA 3OBGA 3Q96A 2A2AA 4O0RA 3D7ZA 3IW4A 4CV9A 5KO1A 4QMOA 5DEWA 3RTPA 2GTMA 4AXFA 3QD3A 2HW7A 4GK2A 4XNEA 1PKDA 3H4JA 4F4PA 5IH5A 2W4KA 3S0OA 4O86A 2OSCA 5DRBA 2E9OA 3NW6A 4IWOA 1BI7A 3TEIA 1KSWA 5EYCA 3TACA 4FG7A 4A7CA 2VTHA 4F99A 4GT5A 5L6PA 1MRYA 1PXNA 2GFCA 4O2ZA 4GT3A 3MFTA 5DFPA 4YJPA 5L8JA 4DHFA 5JFVA 2IG7A 2A4LA 3NNVA 3PJ8A 3I60A 4A07A 5HQ0A 3C4EA 3DQXA 1Y57A 3AXWA 5AA8A 2WKMA 3EHAA 5BVEA 3HP5A 3RKBA 5CASA 3SD0A 5BVFA 5L2SA 3C9WA 1JPAA 5DT3A 4XMOA 5J1WA 4XRLA 3W2RA 2ZMDA 3EKNA 5L8LA 5FQDC 4JOAA 3MH1A 4MD8E 1FMOE 4FI1A 3R9OA 3V6RA 5CU4A 4HNIA 4FL2A 4ALWA 2WXVA 2JLDA 3A61A 4O4FA 2F2CB 3KF7A 3W55A 4YC3A 5IQDA 4J53A 2JKQA 2VV9A 3KRLA 4JBPA 2GNGA 4FKQA 2XNMA 4QP3A 4AS0A 2Y8OA 3TZ9A 2ONLC 1BI8A 5AADA 5IA0A 2B9HA 3UZRA 2HOGA 3NYVA 5AIRA 3QZFA 2J51A 4IC7A 4F6SA 2OXXA 3FLNC 1H25A 2XRWA 3OEZA 2QKRA 3EZRA 4BCGA 4BCOA 5KNJA 3W0RA 2J0KA 4XBUA 4N57A 4PDSA 3CQUA 3PIXA 3U6IA 3ZM9A 3C4WA 5TT7A 3OD6X 1NA7A 1YVJA 2XBJA 1OZ1A 5IUHA 5CAQA 3TKIA 3FC1X 4CRSA 4DH5A 4EEVA 1YOLA 5A14A 5M56A 1TVOA 2J0MB 3DXPA 3TUBA 3KULB 5FXSA 5I0BA 4Q2AA 5FDXA 2O2UA 2X81A 3MH2A 5JZJA 4FTQA 4XS2A 4A06A 2OJIA 4BR3A 4QRCA 4D1ZA 4LI5A 2Y4IB 4ZP5A 2Y0AA 3ZLSA 4EH4A 4FKUA 3WIGA 4EH9A 4DDIA 5JRQA 3C4FA 3SAYA 1YQJA 4Z7GA 4ENYA 2W1FA 3GUBA 5EHYA 3OW3A 3W32A 4IAKA 4DFXE 4KB8A 5DGZA 3F3WA 3OUKA 3VQHA 3DNEA 1PXIA 3KRWA 1W0XC 4YC6A 1H1WA 3F61A 2XB7A 4Y5HA 4ZY4A 5HICA 2Y4PA 2RG5A 3UQGA 2PULA 2VTMA 3ZBXA 2E9VA 4BKYA 4FZ6A 4II5A 5HG5A 4IZ7A 4AAYA 4CFVA 2QOHA 4J97A 2CGWA 2C6EA 4MBJA 4GG7A 3G5DA 2F57A 3ORZA 3FUPA 4FV1A 5CXZA 4CLJA 4MX9A 3MTLA 2HZIA 3N51A 5CEPA 1UU7A 4QP8A 4HVHA 1FPUA 4FSWA 5JT2A 2YM3A 2BRNA 3MS9A 4AZVA 4BTFA 2HENA 2GS6A 2RFEA 3ITZA 4O7WA 4AQCA 5AV3A 3A4PA 4U3YA 4A9UA 4E5BA 4JT3A 5FTOA 1PHKA 4HYHA 3RM6A 3QFVA 4HOKA 2G15A 3E3PA 4IB0A 1OB3A 1SM2A 2JIVA 5AUZA 3QUEA 2UVXA 3FQSA 3R1QA 3IG7A 3OOMA 5LCJA 1YXUA 4NFMA 4F64A 5AUTA 3KFAA 4LL5A 2WTWA 1V0BA 3GU6A 5LCKA 2WTCA 5LOHA 1ZLTA 4FG9A 4YJUA 4O82A 3OT3A 3P0MA 4KABA 4QMZA 3ZSIA 4NKAA 2OH0E 4IAAA 4FVRA 3VUTA 2DQ7X 2HY0A 3EL8A 4RC4A 2PYWA 4MWIA 4YGAA 1UWJA 4YBKA 4R3CA 4YTIA 3IDCA 3UPXA 4TKSA 4DEDA 3PJ3A 1GY3A 4QTEA 4FKVA 4D2WA 2QU6A 4D2VA 4KSQA 4Q9ZA 3DAKA 3VW8A 3TIYA 4WG4A 3ROYA 4CFWA 4YZMA 3UNJA 5BVKA 3HRFA 4ERWA 1A48A 5CYIA 3W18A 4HGEA 2ZMCA 3NSZA 4D2RA 4FNYA 4KWPA 3NNXA 4GRBA 5E92A 4QDEA 3P7BA 2RF9A 2VGPA 5DPVA 5HIEA 1ZZLA 4W8EA 3LFDA 4CZYB 4CFMA 1R39A 3LCSA 5IDNA 4JBQA 4DHIB 5KMIA 5TOZA 3TV7A 5ANIA 3R30A 3RGFA 3B2TA 2GQGA 1H08A 3DFCB 4AFEA 4H1JA 4DINA 3R71A 5HBEA 5FG8A 1SVGA 3V8WA 3G0FA 4O27B 4QMNA 3OP5A 4LFIA 4FGRA 3D7TA 2JBOA 3Q2MA 2OJ9A 3QYZA 4TTHB 5HTIA 2C5YA 3LLTA 5T3QA 4QT1A 4X3JA 3ZC5A 2C6KA 3L9MA 3OBJA 3ORLA 3R2BA 4FMQA 5AM7A 1IEPA 4N4SA 3SXRA 3QTWA 4AW0A 2XNOA 4CZUA 3R21A 5FGKA 5M06A 5K5NA 2BZHB 4AAAA 5EHLA 3G9NA 1U5RA 4AGDA 3EH9A 4ANSA 5JGDA 2J5FA 4F1MA 3QTQA 3QWJA 3EQCA 3IO7A 4U81A 2X8IA 3A60A 4RJ6A 4X3FC 3TNHA 3PJ2A 5CI7A 4PPBA 3DB6A 5CEMA 2YDJA 4Y8DA 4KINA 4QTAA 3DCVA 4HPTE 4IM3A 2PVLA 4ANNA 4ZZNA 3RPVA 3VVHA 2ACXA 4C4IA 4F1TA 2VTOA 5J5SA 3FI8A 3IPHA 4BDAA 1XH9A 3MESA 3ENHA 1DS5A 4HNFA 2GPHA 3FKLA 4I4EA 1SNXA 4EZ7A 4N0SA 5F4NA 5LMKA 4Y46A 3VUGA 3ZCLA 5LMAA 4NL0A 2BTSA 2IW8A 3MJ1A 4TWCA 2C4GA 2V5QA 5F95A 2X8DA 3R0TA 4NM5A 5BYZA 4NM7A 4RMZA 3AGMA 1GZ8A 1ZAOA 4FK3A 1REJA 4RC3A 4J98A 4AZSA 3RZBA 3U6JA 3Q60A 2P3GX 3DJ5A 4WG3A 1H1SA 1IAJA 4AOTA 4MUQA 4DFBA 2IZUA 3GNIB 3GCSA 3FPQA 4RIWB 3SRVA 3ODYX 4DTAA 5HHWA 5K9IA 2BRBA 3NAXA 4E20A 4D2SA 4F63A 1M7QA 4F6UA 3L8PA 4EWHA 1UV5A 2C3IB 5B7VA 2FH9A 4USEA 2AC3A 3HMNA 5LVNA 3BE9A 3CKWA 3IS5A 4YTHA 5B0XA 3F3TA 3DBEA 3ORXA 3C4CA 2C0IA 4FSZA 1WVXA 2XIXA 5EDQA 2H34A 3MH0A 3TJDA 5DR9A 1XKKA 5EM8A 2WOUA 5IUIA 3TZ7A 2XALA 4F6WA 3QC4A 5KMLA 2CGUA 3R6XA 4ZLZA 4FUYA 4NW6A 3E8CA 2X9EA 4BCPA 5HTBA 2W99B 3V5QA 1SMHA 4FF8A 3LXLA 4W4VA 4YNEA 1RQQA 3UDZA 5AR7A 5IQHA 2XYNA 4JAJA 3P79A 3QRIA 4ZMFA 3OXIA 4J8NA 1OBDA 2EB3A 3F5XA 4BZOA 3MW1A 5A6NA 2CKQA 3LIJA 3QZHA 2Z60A 4PP7A 1RJBA 2C1BA 3HV6A 4NFNA 2VUWA 4RA5A 4FYNA 3K3IA 5C4LA 3AC2A 2QR7A 3BHVA 5K0XA 1TQPA 5DRDA 5ETIA 2QVSE 2XARA 2BILB 2R3OA 4AWIA 3JY9A 4BDFA 4KIOA 2ERKA 3FI4A 5EOBA 3TZMA 5GIPE 4JIAA 3VULA 1Q3DA 2R3IA 3FZ1A 3QUPA 4IWQA 4YHFA 5TKDA 3LMIA 3RPOA 3MY5A 4YPDA 3R9NA 3I79A 5M53A 4ITJA 4D9UA 4ACMA 2YITA 3ZDUA 1UKHA 3OXZA 4AN9A 1XBAA 2VTTA 3ZO4A 5EKNA 4BDEA 1X8BA 2R3QA 3HGKA 1HOWA 3O8TA 3IW7A 2X6EA 4OTQA 4OT6A 4L9IA 4FKIA 4PMTA 4Z9LA 2WTJA 4FVQA 3LM0A 2I40A 4G9CA 4F9BA 4CFXA 2WTVA 3EYGA 4AE9A 5HX6A 2YM5A 2PMOX 3A8XA 1KE9A 4MBIA 2OIBA 2X7GA 3LFSA 2Y6OA 2X2KA 3R63A 4K77A 4OW8A 3VC4A 4ZTMA 2I0VA 2V62A 4O4EA 5E9EA 3EOCA 3BKBA 4M12A 4YLLA 3K5UA 3PE1A 5AX3A 2HK5A 3HKOA 3DAEA 3OROA 4DGMA 2CNUA 4H3PA 5IQAA 3UDTA 4IZYA 4BIDA 3DFAA 2QOIA 3E8DA 4K11A 3L1SA 4U79A 3QKMA 4EOKA 3BL7A 4C3RA 4WUNA 5M4UA 3PUFC 3TNQB 3WI6A 3A7HA 1XMLA 1OL2A 3UBDA 4GVAA 4L46A 3BYMA 3HV5A 4RC2A 4X2KA 1JSTA 5FUTA 5EYMA 3V51A 4RSSA 4O0WA 4NSTA 3UIMA 4DGLC 4P2KA 3GENA 2GQSA 3NDMA 2WMXA 3BHTA 3SXFA 3KXNA 3WF8A 4O7ZA 3AD5A 3HNGA 2BHEA 4U0IA 3R7YA 5KHXA 2ZV7A 4AACA 4O4BB 2O3PA 4IM0A 5EI2A 3AD6A 1YI3A 4U45A 3LLAA 3PLAE 1WCCA 4ANOA 4BCMA 5AUWA 4XV2A 2X4ZA 4RA4A 3V5LA 4I5MA 4PTCA 4B9DA 2XUUA 3NYOA 4MEDA 4CMOA 4EH7A 2PMNX 4A4LA 2PE1A 3Q5ZA 4EKKA 4EYMA 2HELA 3UE4A 1O6LA 5HNGA 2R7BA 4RGJA 5AJQA 1XH7A 2R3RA 4NW5A 4F09A 4BI1A 1OECA 3W2QA 3UPZA 3ZHPC 1XMMA 2BAJA 1PW2A 5HEZA 3R04A 2GDOA 3GU5A 2XM9A 5FM3A 4PNIA 4BYJA 2JAMA 3E8NA 4GVJA 2J0LA 3TTIA 2BIYA 2CGVA 3OCGA 1PKGA 5KBRA 3O17A 3LXKA 2CKPA 4HGSA 4U3ZA 2ZB0A 3RM7A 3CS9A 3FAAA 3KULA 3QQHA 4DGNA 4JJRA 4EORA 2J9MA 4YTCA 2XA4A 2VNWA 3VQUA 2GHGA 2ERZE 4EOJA 3O23A 1ND4A 4LDTA 3PVWA 2E9UA 4JNWA 4QYFA 3HV4A 3TTJA 4YJVA 4D0WA 3AKLA 2WNTA 4BWKA 4W9WA 5GINE 2X1NA 2WQOA 4QP4A 4K8AA 3O7LB 4UZHA 5HNIX 5KMNA 1YWRA 4E6QA 4DA5A 3ZC6A 3QWKA 4O7LA 3ZXZA 2B52A 1CSNA 2H96A 4TNDA 4Y73A 1G8AA 5C4KA 3F3ZA 4EH6A 1GIJA 4C33A 3PPKA 4GFGA 1H1QA 2WIPA 4X2FA 3R1YA 1VYWA 3FZOA 4XBRA 2HY81 5EM7A 3UP2A 3SVVA 4QP2A 3ZYAA 4BICA 4PMSA 5AUYA 4RPVA 4I20A 3EWHA 5D7AA 3OCSA 3SG8A 4BI2A 5L4QA 3UO6A 4F9WA 5HGIA 4BC6A 5IA3A 3PIZA 4K0YA 2QURA 4DG0E 5CALA 3QZGA 2IZSA 2GS7A 2YISA 4ZSEA 3DK7A 3ZZEA 2PUNA 4QYEA 3NRMA 3PA5A 4FKSA 2IEWA 2HXLA 3EFJA 4JG8A 4LGDA 1NW1A 3W8LA 2CMWA 2V7AA 4UALA 5KMKA 1TQIA 5I4NA 3VS4A 3GFEA 3GEQA 3NUUA 3G6HA 4WG5A 5L6WL 3H9FA 3F2NA 5AP1A 4ALVA 4M68A 5D7VA 2YLFA 5EOLA 3JXWA 2BR1A 2R3MA 3LJ2A 2Y9QA 4AT3A 4NWMA 3E8EA 5GJGA 1OITA 3MSSA 4TW9A 5T68A 1E1VA 4C58A 3NZ0A 2YZLA 3TI1A 3EJ1A 5DIAA 5CU6A 1ZOGA 3BLRA 2WMQA 3UOLA 3BHUA 4AGCA 4ASDA 3KXHA 2UUEA 4I5CA 3W1FA 1JLUE 2JFLA 4G5PA 4ID7A 2GNIA 4M3QA 4FTNA 3CCNA 3LMGA 5H9BA 4CFUA 3AC1A 1NVSA 4O0YA 2QCSA 2IO6A 4FV4A 5IEYA 3PSDA 3HECA 4O7TA 4WBOA 2HAKA 3GGFA 4L53A 2FSMX 3P23A 2W17A 2Q0NA 4M0YA 4FR4A 5HO6A 3GCUA 2GTNA 5F20A 1FMKA 5M09A 5GNKA 3QA8A 3WOWA 3RPSA 4O7SA 3CPBA 4QMPA 1H0WA 4DHJA 3OEFX 5BUJA 5ETCA 4NIFA 4QPAA 2BIKB 3LFBA 3FKOA 1Q8TA 2YJSA 5EG3A 2W4JA