5LVMA

Human pdk1 kinase domain in complex with adenine bound to the atp-binding site
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
284
structure length
283
Chain Sequence
KKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Bidirectional Allosteric Communication between the ATP-Binding Site and the Regulatory PIF Pocket in PDK1 Protein Kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 283
sequence length 284
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5lvmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5lvmA01
2I0VA 4K2RA 2DWBA 3AC2A 1Q3WA 2RIOA 4FZ6A 4CCUA 3D7ZA 2XB7A 3P4KA 4N0SA 4QTDA 4QMLA 2R3PA 4BZNA 5FP5A 3UO6A 5IEVA 4FSTA 5C8MA 2QQ7A 5BQ0A 3O71A 3GUBA 5E8ZA 3THBA 1RW8A 4B99A 1W8CA 4I0TA 5HKMA 3NUNA 3R01A 4F08A 3UVPA 3GENA 4TY1A 1MP8A 1VZOA 3ETAA 1XH5A 3K3JA 4IAZA 3QAME 3RI1A 3D15A 4DFNA 5HD7A 1V0BA 4NFNA 4QMXA 1OBGA 2GNFA 5BVDA 2A1AB 1BL6A 3PP0A 3Q5ZA 4V0GB 3WARA 4C62A 4EH3A 4UXLA 3OD6X 2CGVA 4S31A 2C69A 5EW9A 3I5ZA 2BRBA 3LMGA 3GQLA 2EWAA 4MK0A 4OAUC 4J8MA 3WYXA 3FY0A 5GNKA 2WMBA 3AGMA 2VO3A 2X4ZA 3C0IA 4FSNA 4MD8E 4J98A 4LV5A 3ZO2A 3V5QA 1H26A 2EB3A 4FEVA 4PP9A 4LV8A 3O51A 1XH6A 2PY3A 3B8RA 1PY5A 3OZ6A 4NJDA 5HG9A 4EBWA 3KVWA 1ZMWA 2BZJA 3QTUA 4G9CA 3PWDA 3R8ZA 2NPQA 3FWQA 3P5KA 4R1VA 4BTKA 4Y85A 2VTAA 5EI8A 5FTQA 4CCBA 1OVEA 2W1FA 2ZMCA 4RA4A 3PSBA 4TTHB 4G2FA 5J7BA 2VX0A 1PXKA 2RKUA 2XRWA 4BI2A 1CSNA 5HLWA 4TW9A 3OY3A 4RPVA 1JKLA 5ANJA 2I40A 3UOHA 5EQYA 4CGAA 1ATPE 4NKSA 1QCFA 3NIEA 4G1WA 1UNHA 3WE4A 3P79A 2GFCA 5TE0A 2AC5A 4W8DA 4CG9A 3QTIA 1FBNA 2C3IB 4O6EA 3R9OA 5GIOE 1DAYA 3HRCA 3QUEA 5E92A 4JQEA 4F1OA 3VC4A 5I9WA 3DZQA 3A7HA 3EN5A 2FB8A 3IW4A 2Y4IB 3VHEA 4ZOGA 5D12A 4RBLA 2GCDA 4BFMA 5T68A 4QMYA 5CT7A 4C3RA 1MUOA 4D1XA 4N57A 3G6GA 3OG7A 5IZFA 4K77A 3EQHA 3G9NA 4U3YA 5H8GA 3R7IA 4D5KA 2BRMA 2HAKA 4OTDA 2QOCA 4R5SA 3QC9A 3SG9A 5GZ9A 1Q97A 4DEEA 3EZVA 5DE2A 2R3OA 3ZSIA 3NNUA 3BHTA 4CFWA 5B0XA 2OK1A 1FQ1B 4KWPA 5DLSA 4M13A 4Y72A 5EHYA 5KMIA 3V5PA 4FKJA 2OKRA 3R2BA 3BHVA 4MXAA 3TUBA 2X2LA 2UZUE 3DQXA 4H3BA 3VJOA 2J4ZA 5JZJA 3VVHA 3BZ3A 4ZP5A 4AT4A 4PTEA 3AQVA 4UV0A 4AE9A 1Y6BA 3DFAA 1WCCA 3H10A 4OGRA 5ETAA 5CU6A 5M4CA 2BKZA 2WMXA 4YJUA 3D2IA 4UX9A 4ZZNA 3W8LA 3VBYA 3NSZA 3JPVA 3U4WA 3L8VA 3CPBA 3MIYA 4FK3A 4DH1A 2FO0A 3DK6A 2J51A 3EZRA 3ZUUA 1M2RA 4NM0A 3UPZA 4CZTA 1NT2A 5M53A 4FKSA 4RWJA 3RPRA 3FMNA 4BDGA 1UNLA 3K5UA 3Q4CA 3NYVA 3R04A 3GOKA 3GU4A 5FTOA 5E90A 3ZEPA 5DR2A 1FGKA 1CM8A 3O8TA 3PXRA 4AGCA 5BMMA 5AP7A 3H9OA 4FT5A 5A46A 4LGDA 4A9TA 2H9VA 4NT4A 1YWRA 2VX3A 3OT3A 3NUAA 2ZAZA 4PNKA 4U0IA 3BYVA 2XJ1A 3BI6A 2WELA 2XP2A 3UZPA 4DN5A 2FSTX 3KRXA 3QRUA 4ERKA 4FV4A 4GCJA 3RK9A 5BYYA 4OBPA 2WOUA 1ZYJA 3O8PA 4BCMA 2IZSA 3CTJA 4RC3A 4CQEA 1KUTA 1KSWA 2PVFA 3HGKA 4YO6A 4ID7A 3Q9YA 1P2AA 2JDSA 4O91A 4V04A 2O5KA 3UC3A 4AOJA 4ZAUA 4JG6A 3ZTXA 2OGVA 4FIEA 3FL4A 4AZVA 3Q4TA 1L8TA 4KKEA 5AV4A 3ZS5A 4G5PA 4J97A 1KE8A 3LQ8A 4FTJA 4XG2A 1WBVA 2YDKA 5ANIA 1UU8A 4DEIA 2ZB1A 4MWHA 3D2KA 4WG3A 3L9LA 4U80A 3GB2A 3I60A 4F99A 2J0MB 4TWPA 4G3CA 2J2IB 4K33A 3ZM9A 1F3MC 5HOAA 4IEBA 1ZAOA 4AN2A 3GNIB 3W2PA 3KN6A 4KIPA 2GQSA 5A4TA 5C9CA 4EOSA 5AAGA 5AP6A 3D7TB 1O6KA 2WIHA 3BGQA 1NVRA 4L7SA 3DAKA 3QRKA 4FUXA 1KV2A 2UW9A 4BDKA 1U5QA 2EXCX 1OITA 3PJCA 1BMKA 4ITHA 3Q4UA 3R73A 1ZLTA 4GK4A 3QX2A 5HE1A 4CMUA 4FTOA 4QYGA 2R3LA 4AOTA 4HJOA 1XH8A 4YHJA 3A7FA 3Q96A 3RPOA 4R3PA 1R0EA 4C37A 4DFLA 3KMWA 5EI6A 3Q4ZA 3TIZA 5TOZA 1Q41A 2X8EA 3I79A 4ACCA 5BYZA 2GTMA 2G2FA 1OIYA 4EJNA 2CKPA 4NL0A 3ORKA 4L46A 4M0YA 1ZOHA 3V5LA 5AUTA 3UC4A 4CFNA 3MH2A 3QQJA 2BKKA 1JKTA 3VUDA 4EK8A 3OC1A 3DDQA 2I0HA 4YPSA 3MV5A 5D7VA 5AV2A 2NRYA 3COMA 1Q24A 3OUKA 4JDJA 4ZMFA 4GYGA 5DI1A 4YSJA 4O7RA 1UKHA 4YZDA 4AGUA 1OGUA 5CZIA 2PUUA 3BHHA 3TI1A 4GSBA 3OHTA 4I0SA 2IW8A 3KULB 4IAFA 2IVVA 3EN4A 4DITA 3HRBA 1QPEA 5ANGA 4YGAA 4IACA 3C0HA 4AW5A 2X0GA 3EFKA 5K0XA 2ZM4A 4IFCA 4RX7A 3WZJA 4I94A 3ZYAA 3D5WA 4XV3A 2I6LA 2RGPA 5AA9A 3VBVA 4NCTC 5ANKA 4WG5A 1FPUA 3WE8A 2WEVA 5IF1A 1YDSE 4R1YA 3SHEA 5HG8A 3AT2A 3PY3A 4KIKA 5E4HA 1I09A 4DFXE 1ZYDA 2YFXA 4FTUA 4IANA 2PVYA 4R6VA 4D2SA 3Q9ZA 4XP3A 4JT3A 3CJGA 5GJFA 5EM5A 3EQGA 3PP1A 1NY3A 2UZVA 4GK2A 4L53A 4QT1A 5L4QA 3ZZWA 4FK6A 1PMEA 1YDRE 2H6DA 3VW6A 2WQMA 2YM5A 4I3ZA 4BF2A 3HV4A 5CU3A 5FG8A 4XOYA 3F6XA 4MXOA 3R63A 4FV1A 1ZMUA 3FHRA 4FNWA 4L7FA 4QP6A 5KBRA 2VTQA 2GSFA 1PXNA 2FH9A 2HXQA 4BIEA 4IZYA 1Y6AA 4G6NA 4OTWA 5IUGA 4FKVA 1J3HA 2XH5A 4M68A 1CTPE 4EOLA 4X2NA 3HL7A 2XCKA 4RJ6A 3NR9A 1WVWA 1YI3A 4UMQA 4BDJA 2GHLA 3VWAA 5JFSA 4FTNA 4EC9A 1F0QA 3LXKA 3HYHA 4LL5A 3G51A 3Q5IA 4ALWA 5M57A 2YIXA 4F1MA 1M17A 2FYSA 4JBPA 2QR7A 5G1XA 3MVMA 4E1ZA 4E3CA 2QCSA 3NIZA 4FI1A 5IDPA 5JFWA 3UO4A 3FI3A 2OICA 4GFGA 4FSUA 1GZNA 4O0WA 4O38A 4KBKA 2IJMA 5EM6A 3RCJA 5M4IA 3HA8A 4LRJA 2Y7JA 2JGZA 3Q32A 3QYWA 4L01A 3TTJA 1PKDA 3OTUA 2P55A 3B2WA 5LVMA 4E7WA 4I0RA 4I4EA 4CFMA 3AGLA 2YCFA 4ZSJA 4ZTRA 3FI4A 4BY9E 4B7TA 4CNHA 5LCJA 4O2ZA 3BLQA 5D1JA 2ERKA 1FOTA 3REPA 1NXKA 2Q83A 1H1PA 2WMUA 4USEA 2XUUA 3ELJA 3H9RA 4FKRA 2HELA 2QLUA 4FIIA 4Z7HA 5CEMA 3L9MA 4NM7A 1P4FA 5AADA 1JOWB 3CLYA 5A4LA 3CKXA 3NEWA 3W18A 4QMZA 5JGAA 4J52A 4AGWA 4FEWA 4CSVA 5CI6A 4UYNA 4G16A 3L8PA 4DEBA 3SDJA 3UMXA 3F2RA 3EWHA 2C6MA 3IECA 5I9UA 3QZGA 3W55A 4BKYA 5B2MA 4BDAA 2HK5A 4EI4A 2QOFA 4GEOA 3R7UA 4YZBA 2HW6A 4HYUA 1CKJA 2W9ZB 1YVJA 5AUYA 4ZY6A 3FYKX 5ITAA 4WRGA 3I0OA 3FMDA 4IZ5A 2PVNA 4Y95A 1CKIA 4EH9A 3F3VA 3TN8A 1MRVA 2C6TA 2JLDA 2Y6MA 3RTPA 3HRFA 3QRIA 3S3IA 1OKWA 2E2BA 2OZAB 4IW0A 2VWWA 3C5UA 5HTCA 1J7IA 3VF8A 4E6DA 4O0SA 1GZOA 4L3LA 4XRLA 5AP5A 4HGTA 1VR2A 1H1QA 5EM7A 3ZUTA 1BL7A 3MPMA 4F64A 2IVSA 3GCSA 2FVDA 4DLIA 4EZ7A 5F4NA 3EQFA 3QGWA 4AA4A 5CAQA 5FBOA 3DBQA 1XH7A 1OUKA 1H1RA 5TKDA 5CS6A 4GKHA 4ZLOA 4RIYB 1LEZA 2ZDUA 3OUNB 4JQ8A 4FVQA 3BQCA 4MQ2A 1Y91A 3HV7A 2XJ0A 4NM3A 4X7QA 3ROCA 3P9JA 2BFYA 4M14A 4G5JA 3QQUA 4EHVA 4ZEGA 5I9VA 4CFXA 4EK6A 2VWBA 4QTBA 4AFEA 1XQZA 3N9XA 3OWKA 2RFSA 4HPUE 5CNNA 3ZO4A 2Z7SA 3MI9A 3A4OX 4IAAA 2OWBA 3ZEWA 4CYJA 4RG0A 3HAVA 4O7VA 4LOPA 4ZTQA 5FD2A 2XZSA 3MJ2A 3RALA 1G8SA 1YI4A 3UIMA 2GNHA 3QCQA 2UZEA 1T46A 3ZLWA 4L00A 3BHYA 5L2WA 4GVJA 4J1RA 1OMWA 1H8FA 5C4KA 3W16A 2P0CA 2IW9A 3W2RA 3MYGA 3FZTA 2WPAA 3NUUA 3Q2MA 4FVRA 5AP0A 2C0TA 5HE0A 3RNIA 4B4LA 4OLIA 1UV5A 4E6AA 5LMKC 3EH9A 4YJVA 3E8CA 4FTQA 4PMSA 5KZ0A 1W7HA 1ZY5A 2BCJA 4Y5HA 5ACBC 3KGAA 3QD0A 4BGQA 1H0VA 3G15A 5CANA 4XG4A 4ARKA 3HV6A 3BV3A 3Q2JA 3F66A 1IR3A 1UWHA 4E5BA 5I0BA 3FMJA 5D9HA 2O2UA 1Q8WA 5DRDA 3AOXA 2ZV2A 2J90A 2OF2A 3LFBA 3PUPA 1REJA 2JDVA 3QHWA 4U44A 4C8BA 3ZDUA 3LXLA 4JRNA 4X2KA 2BZHB 3MGYA 4X3JA 2F2UA 5AR2A 4IZ7A 3FMEA 4Y83A 2VTTA 1OB3A 2WTKB 4LQMA 4NTSA 2W4JA 5HO6A 2JIVA 4IM2A 2R3KA 1M2PA 1AD5A 4K0YA 4IX4A 3T9TA 3POZA 3NUSA 3BELA 3QWKA 2UVZA 2WTWA 2X9FA 2RFNA 3PVWA 4RVMA 3TUCA 5HG7A 3RCDA 2ITOA 4AZFA 3HKOA 2I7QA 3PXZA 1QPJA 3CY3A 3NUXA 4R8QA 4FV6A 4CG8A 3VRZA 4H1MA 4FKUA 4CRLA 3FE3A 4GIHA 4JQ7A 1H1WA 5AV1A 2IZTA 4J96A 3V8TA 4NU1A 2V22A 3T9IA 3FV8A 2ITXA 3I7BA 2ITTA 3F3WA 3IW7A 4QPMA 3GC8A 4FKLA 3LM0A 4EYJA 2QOOA 4YBJA 4B0GA 5HD4A 3BGZA 3R28A 2OG8A 4NYEA 5AM7A 5B2KA 4D2RA 4IDTA 4UMTA 3EHAA 4I21A 5DFPA 2BR1A 4DTKA 4FZFB 3ZBFA 3KXHA 5B2LA 3ALNA 4AUAA 5HX6A 3UOKA 1J91A 1RQQA 2WQEA 4L45A 5IH5A 4XV1A 4O0VA 1PXPA 5DR9A 5E8SA 3VS5A 1A48A 4L9IA 4JBOA 3IDCA 2X7OA 4EKKA 4FSMA 4RIYA 4OBQA 3ZC5A 3RK7A 4GV1A 3UNJA 4BGGA 4DGLC 5L2IA 1ZARA 2PVMA 5M44A 2PYWA 5EH0A 3BRBA 3D83A 2X81A 4MXYA 2NRUA 2CGXA 3WI6A 5CAUA 3ZMMA 2X7GA 3R1SA 4GW8A 5EDPA 4UBAA 2GNJA 5J9YA 3DKCA 3KK8A 3C1XA 4XYFA 3F88A 3WIKA 1OM1A 4N6YA 4XUFA 4JIKA 4C38A 5A9UA 3GVUA 3DCVA 4EL9A 4YLKA 2OXDA 1BI7A 1GOLA 1OZ1A 3GOPA 3GU6A 4X2JA 4AG8A 2H96A 3LAUA 1B38A 5KX8A 4PL4A 2O8YA 4XG9A 5AMNA 4BKZA 4BKJA 4N6ZA 5CLPA 4CT2A 4GT4A 4H3PA 5L6WL 2WTJA 4PRJA 4S33A 3DS6A 1GZKA 3C51A 4BWPA 3ZSHA 2V62A 2AYPA 3C4EA 4QMTA 1H27A 4FTAA 4JAJA 4XLIA 5IUHA 3E92A 4G17A 2KTYA 5H8EA 5AX9A 3E7VA 5HX8A 3DNEA 4RRVA 2W1DA 4CXAA 4CFVA 3RP9A 3AT4A 4FMQA 3S00A 1XBBA 1U46A 5FEEA 3ULIA 3SGCA 4BDHA 2F2CB 3EN7A 2BDJA 5CEKA 4NW6A 4O2PA 4QMMA 1FMKA 3R6XA 3KCKA 5HVJA 4W9XA 5AUWA 3VRYA 2JKKA 4EH8A 2OFUA 5I3RA 2YJSA 3ZLXA 2JD5A 3LCDA 4I5MA 5IA4A 4ZSLA 3DBFA 3IDPA 4FV8A 4GMYA 4JBQA 3ALOA 5DEYA 2CKOA 4XG8A 3COKA 2W5HA 1GIIA 1PYXA 4MNFA 4PWNA 4D2VA 4DINA 5CF6A 3DJ5A 3TNQB 4EZ3A 2WOTA 3U9CA 3BYUA 4CVAA 2R7IA 2RL5A 4BCJA 4GU9A 3MH3A 3LFFA 3P08A 3IS5A 4GL9A 4IXPA 1M14A 2W96B 3VQUA 2B52A 4PPCA 5GJDA 4BCPA 4KBCA 2YM4A 1M7NA 4G3EA 2C0IA 3QKLA 3IGOA 2GNIA 2UW4A 3KN5A 4MD7E 3TJCA 2R7BA 3KK9A 3T8OA 4AU8A 4CQGA 4NIFB 4YC8A 2VTSA 2IVTA 3RVGA 3OCBA 3C0GA 3LE6A 3P23A 3HP5A 5IG1A 3FQEA 3KQ7A 1NVSA 2WKMA 3Q6WA 1WBTA 3DGKA 3A61A 3R0TA 1WBOA 1YQJA 2C47A 2WU7A 4FSRA 4L52A 4PMTA 2LAVA 3VUHA 4DFYA 4F0IA 5IQBA 4B6LA 2B9IA 4FT7A 2XNNA 4FEQA 3C13A 2AC3A 4ZJJA 2XK3A 4JRVA 4D0XA 5BUJA 3NYXA 4GFOA 4BWKA 4FSWA 4QTAA 3VUKA 3WOWA 5CVGA 3DXQA 3AG9A 3EB0A 3LXPA 5KKRC 4QMVA 2HYYA 2J5FA 4YP8A 3SVVA 3FI2A 3QZIA 5FRIA 5FXQA 5JQ8A 2HZNA 4M97A 3E93A 5TF9A 4BZOA 3WF6A 4BWXA 3KREA 3NNVA 4DFUA 3VUTA 4PUZA 3MJ1A 3UBDA 2ETMA 2W5AA 4DH8A 3VBWA 3FMLA 4DC2A 4A06A 4TNDA 4CT1A 4CYIA 4F7LA 5EYKA 3QKKA 3G0EA 3FC2A 4XEYA 3PY0A 2XYNA 3SX9A 4IHPA 2PVHA 2R0UA 1OKYA 5G6VA 5L8KA 2W9FB 2YIWA 2DS1A 2WEIA 4FT0A 4JJRA 3KRRA 2CKQA 4GG7A 4FV0A 1R78A 3AMBA 3DK3A 4EORA 2VTNA 5EYDA 5FDPA 2OJJA 2R3MA 3PE2A 4ANMA 4FKGA 3IGGA 3MS9A 3FJQE 4IE9A 3ZC6A 4X0MA 1YXVA 1M7QA 4LL0A 4AZEA 4CKIA 3FMKA 3WZUA 2W1IA 2WNTA 3F3UA 3UIXA 2H34A 3E8NA 3LKMA 4RWIA 3KB7A 1URWA 1YHWA 1WMKA 4EKLA 5H9BA 1GIHA 3E8EA 2XNGA 1Z5MA 4TT7A 5LVPA 2VWIA 3NW7A 2WAJA 2VV9A 1KE5A 4FODA 1OIUA 2BPMA 1E1VA 3RPYA 4APCA 1XH4A 3UNKA 4ZY5A 3NVMB 2YLFA 3QQKA 4NCTA 2BFXA 4A9SA 3C4CA 4RIXB 5BPYA 3HP2A 3UG2A 3W2SA 4U6RA 3CQEA 3E8DA 3PXFA 2EXMA 4CMOA 3JY9A 4G3FA 4HYHA 4JX3A 3NYOA 4C02A 1YXTA 5HLPA 3D94A 2Z8CA 4I92A 5EOBA 2YHVA 3KCFA 4BGHA 5L2TA 2OO8X 3IW5A 4Y73A 3F5GA 3UVRA 3NW6A 5M4FA 4HPTE 2WXVA 5CSXA 4DFZE 2HZ0A 4Q9SA 4NIFA 2YLEA 2QOHA 3ZONA 5EQPA 1OIRA 5M07A 5FDXA 4I41A 3LZBA 4E4MA 2QO9A 3DTWA 1UA2A 4P5ZA 4NH1A 4O0UA 3FYJX 4D1SA 4DE4A 3L9PA 3GBZA 2VO7A 3KMMA 3KU2A 3BU5A 4FZAB 4IDVA 4TWOA 3WIGA 4WUNA 1PMUA 3ZFMA 3ORIA 4LM5A 4D2PA 4CLJA 3LMIA 2R3IA 5DWRA 3ACKA 1U54B 3H0ZA 3BEGA 3NS9A 2RFDA 4HNIA 4W8EA 4ZJIA 3RINA 3ENMA 4II5A 3UYTA 3SD0A 1JQHA 3FHIA 3GCPA 2P2HA 3VBQA 4WG4A 1ZOEA 1YOJA 2BILB 5ETCA 3P7BA 4AFJA 3KRWA 2HENA 2F7XE 2WMQA 4OTIA 2OFVA 1KWPA 4ANOA 4NK9A 4OR5A 2PUPA 4BTFA 5IEYA 3BEAA 3BE2A 4TWCA 4WIHA 5EYCA 3DBDA 1SMHA 3QD3A 3U54A 2P3GX 4IVBA 3QD4A 3UTOA 1TKIA 3VS3A 3N4VA 5AUXA 4IB5A 4P4CA 4JXFA 4FX3A 2VUWA 4DG3E 3ZU7A 5FUTA 4PPAA 1P14A 3GCUA 4A4OA 4RX5A 3U4UA 2CNQA 3FC1X 4D5HA 3MY0A 4FTRA 3IW6A 1H08A 3TACA 1ND4A 1Q5KA 3QQLA 4MCVA 4NJ3A 3FY2A 3QRJA 1Q4LA 3MVJA 3BQRA 4U79A 2RFEA 4AACA 3EJ1A 3PA5A 3SOCA 3NRMA 5IA5A 1WBNA 3GFEA 4FSYA 3BU6A 3FKOA 3TKIA 5BUIA 3OEZA 3MWUA 2B55A 3QCYA 5E1EA 3WYYA 3E62A 4QMPA 5E8YA 1HCKA 2GNGA 2Y8OA 4JG8A 3R9RA 2XF0A 3BLHA 1E9HA 3F61A 1YRPA 3RAHA 4G31A 1YOMA 4EH4A 4PDOA 4OT5A 3PVGA 3HV3A 3NZ0A 4BDCA 4ZTNA 4EYMA 5ETIA 3QD2B 5C03A 3EN6A 4AS0A 4E5WA 5IA2A 3UQCA 5HGIA 2GQRA 5HTBA 3KL8A 4RIXA 1Q8ZA 5DPVA 3VS2A 3L1SA 4FV9A 4ZTMA 4MTAA 3VW8A 2IO6A 3ZM4A 4EBVA 1YXUA 5L2SA 3TEIA 3UO5A 4YZ9A 5LVLA 1JNKA 4BCQA 3PJ3A 5FBNC 2FSMX 3ULZA 3Q53A 2JDOA 4I20A 4G3GA 2XBAA 4R7BA 2XKEA 2ZJWA 3OW4A 4E5AX 5IMXA 4KKGA 4H58A 4MEDA 4BHZA 3Q04A 3ZXTA 3LMHA 2WU6A 4GS6A 5GHVA 3RM7A 4H36A 1FMOE 4K9YA 5F95A 4AZSA 4L68A 4QPAA 2X39A 4FUYA 3TNWA 4E6CA 1H00A 4KKHA 4DG0E 3R83A 3V04A 2XK8A 3DZOA 5JMSA 4XP0A 5KMOA 5AWMA 4RQVA 3QLGA 2W17A 1U54A 3MFTA 4K11A 2HWOA 1Z57A 4PTGA 4KIKB 5DG5A 5FGKA 5KHWA 4MXXA 3CSVA 4XP2A 4FL3A 5JKGA 4C61A 3VAPA 4H05A 4MBIA 1FGIA 5LARA 3LLAA 4O84A 4MH7A 4PQNA 4PMMA 2XJ2A 3HMNA 4W4WA 2A19B 1ZZ2A 3IO7A 4LRMA 4U45A 5F94A 4F9WA 2A27A 3F82A 3RJCA 4Y8DA 1ZXEA 5M4UA 4I93A 4EOJA 4WUAA 4YBKA 4C58A 1H25A 5LMKA 4O7ZA 4IJ9A 4JVGA 2IPXA 2BHEA 4RLLA 5KZIA 2J6MA 3CQUA 2XS0A 1V0PA 1UU9A 5DRBA 4A07A 2B9JA 3B8QA 4KIOA 2O0UA 5J9LA 4OTHA 3HECA 4C4EA 2WMVA 4C0TA 2UW3A 3QA8A 4M12A 2GHGA 4IAKA 4PF4A 2XNPA 1TQIA 2CJMA 1ZYLA 4PY1A 4GU6A 3TNPC 3A8XA 3QTZA 3ZH8A 3FZSA 3UNZA 2ZVAA 1Y8GA 3AT3A 2R2PA 2ZV7A 4E20A 2WQOA 5KUPA 4JR3A 4MWIA 1ZWSA 4IVDA 1PXOA 3GU7A 2B1PA 2C5NA 3GCQA 5GINE 3EFWA 2VTHA 1P5EA 2JAVA 2J7TA 2C0OA 2VTMA 4BR3A 4IAIA 4DT9A 2IW6A 2CLQA 5L2QA 2CDZA 3ORPA 4M7IA 4A7CA 2CGUA 2V0DA 5BX0A 3U6JA 4E8AA 2HW7A 4KRCA 5JQ5A 4X3FB 2CNVA 2OZOA 2YIRA 1YDTE 4O0YA 3AD5A 5FXSA 2C6KA 2XK4A 4EHGA 5JN2A 2EB2A 4UALA 1GY3A 1XBCA 3SAYA 4O7SA 3WF9A 2C3JA 3VS0A 4A4XA 4YC6A 2C4GA 3VS7A 5L6PA 2V7OA 5HIEA 1L3RE 1RJBA 2C6EA 4YJQA 3VNTA 2ITUA 2PMLX 3ZOSA 3O96A 3FZ1A 4FT9A 2BVAA 5IEXA 4O1OA 4NW5A 3QQHA 4NZWB 4Z9LA 4IWPA 4R77A 5CI7A 4BDBA 3FEGA 4ZS0A 3LFSA 5M56A 4QP4A 3BLRA 4KB8A 4X2FA 5HG5A 3TV6A 3I0QA 3PVUA 3UODA 3K2LA 4BYIA 5CEPA 3LJ1A 3MVLA 3U87A 5CALA 2ESMA 4HVGA 3FLQA 3QZFA 3QHRA 3F5XA 3VUGA 4LMUA 4I22A 4HVSA 4O0TA 3W33A 3JXWA 1UU7A 3JY0A 3TTIA 5J8IA 4JG7A 2B54A 2O3PA 5CT0A 4BN1A 5FXRA 3ZLSA 3RGFA 4RVKA 1IAHA 3UVQA 4RFMA 3R7VA 3UGCA 4EK3A 4QQ5A 4DF3A 4XNEA 3CKWA 2F7ZE 5HESA 1PXIA 3MPTA 5HICA 4DAWA 2CNUA 4BB4A 2YWVA 4O7NA 4ZTHA 4EOOA 2BRHA 4PPBA 4W4YA 4F6UA 4NUSA 2NO3A 3FQSA 1YI6A 2JBOA 5HI2A 4I4FA 3F3TA 5CSHA 3D5XA 1KE9A 1H28A 4I1ZA 2VGOA 4C33A 1XH9A 2HWPA 5CNOA 4YZMA 3D4QA 3QYZA 3RBWA 3MH0A 4YU2A 3MSSA 3OWJA 4ZTSA 4AXAA 4XBRA 5CAVA 4CKJA 1H0WA 5E8TA 3M11A 5FQDC 1IASA 2OU7A 1LUFA 3KKVA 2GHMA 3A62A 5AP2A 3EYGA 3CS9A 3CTHA 3I81A 3SRVA 4F9BA 3MW1A 4BBEA 2ZB0A 1Z9XA 4XJ0A 4TWNA 4K6ZA 4FC0A 2JBPA 2QOIA 2W1GA 2WQBA 4YJSA 3CY2A 2YM8A 5HBJA 2UW7A 1YXSA 2YM6A 3EL8A 4LUEA 3PSCA 3C7QA 4ACDA 5JRSA 3HNGA 3R9NA 2PVKA 4WBOA 1OL5A 3FZPA 4DLJA 2PTKA 4J95A 3MH1A 4YURA 5DA3A 1IA9A 3QCSA 2WTIA 3LFDA 3TZ7A 4YNEA 4ALUA 5EYMA 5L8JA 5CF8A 1UU3A 2BRGA 2GPHA 2REIA 4IQ6A 2CN8A 2YACA 3MFSA 4RWKA 4AZWA 2E9OA 5FTGA 4X3FA 3AMYA 3QFVA 4FTTA 4I5CA 4WSYA 4ZZOA 5ANOA 4ZMEA 3TIYA 5CF4A 3FI8A 2JIUA 3BHUA 3ODZX 3SA0A 4ASDA 4PDSA 5KO1A 2Z2WA 4I5PA 3UP2A 4D58A 3G2FA 3QGYA 4CFUA 3II5A 4UYAA 4F9CA 2QODA 1PW2A 1CMKE 4LI5A 4K8AA 1KE6A 4PDPA 3RAWA 5CAOA 2YISA 3NNXA 4TYHA 5D10A 5LVOA 4FVPA 4FNXA 2IWIA 3I6WA 3FXWA 4D4SA 5AV0A 3QC4A 2PE1A 4RJ5A 3T3VA 3W8QA 5CSWA 3NUYA 2YEXA 1Q62A 4ERWA 5K5NA 4F9AA 2CGWA 4BHNA 3DXNA 1JLUE 3DAEA 3S1HA 2QVSE 4QYEA 5E8VA 2P4IA 3LPBA 3KXXA 4ENYA 2Y9QA 4FIGA 4USDA 3DBEA 3FPMA 2BZKB 3RHXA 2GQGA 1WVXA 1A06A 2XCHA 2VZ6A 1W0XC 2YWPA 3FZRA 4WHZA 3GGFA 2GS2A 3T3UA 5HE2A 1EH4A 4EK5A 4FNZA 3UQFA 5FLFA 4MYGA 3JYAA 4GG5A 5CEIA 4ANNA 3OMVA 3MIAA 3IG7A 3P1AA 5TT7A 2A4LA 2OXYA 1R3CA 3TJDA 2FSLX 3QTWA 3SG8A 4V01A 2RF9A 2R9SA 5AIKA 1XHAA 5HBHA 4XOZA 3FPQA 4F4PA 5I9XA 3FAAA 5CX9A 2VD5A 4U7ZA 3LCKA 3PPKA 3LLTA 3FMMA 1XR1A 3QBNA 4ZTLA 5BMSA 1H1SA 4JL9A 3BYMA 5IA1A 2IG7A 2JKQA 4G6OA 4FSZA 4IZAA 4ANBA 4GYIA 3F3ZA 3JVSA 4XG3A 2WTCA 3BE9A 4WNPA 4O96A 4IWDA 5EHOA 1AGWA 2VN9A 2X1NA 2I0YA 3NPCA 4MNEA 4MX9A 5JK3A 4NSTA 2BDWA 3IONA 3QTRA 4PV0A 4BCHA 1WAKA 4F09A 2XKCA 2XNMA 3E64A 3GQIA 4PNIA 3RAIA 2JFMA 4EWHA 3C5IA 5HO8A 5A4QA 3QX4A 4X6QC 4FZ7A 4RLKA 4KD1A 4FBXA 4TYGA 5IA3A 5AFVA 3PPZA 4CZYB 3MTFA 3FXXA 3W10A 1UNGA 2OW3A 3DKOA 4E4NA 3MPAA 3M2WA 2XVDA 4UY9A 4RIWA 3R30A 5IA0A 3VF9A 4QO9A 2UW0A 1AQ1A 2HZ4A 5A3XA 4D4VA 1OI9A 2PPQA 4KS7A 1PYEA 1BLXA 2OIBA 5DOSA 5J87A 2Y4IC 4TN6A 5DIAA 1KOBA 4C34A 2R3HA 4GK3A 1DAWA 4WD5A 5CU2A 3F9NA 3AD4A 4IX5A 5D7AA 3SXRA 4FV2A 3EN9A 3O0GA 1NA7A 3C4ZA 2C5OA 1WBWA 3DK7A 3P86A 4J7BA 3VQHA 3EMGA 2QKWB 4IVCA 1VYZA 4FIJA 2JKOA 4JS8A 5E8UA 3QA0A 5CEQA 4EOIA 3W2QA 2QLQA 4CLIA 4UZDA 3TDVA 5IQCA 4TXCA 1M52A 1U59A 2CLXA 1O9UA 4EJ7A 2C5XA 2OSCA 3EOCA 3VUMA 5IPJA 3R1YA 5E7RA 4XMOA 4Z16A 5HNIX 3A8WA 5EK7A 1JPAA 1KE7A 4LOOA 1TQPA 3A7GA 3DDPA 4BI1A 3NMUF 4DGGA 1GNGA 3U6IA 3M42A 4Y5QA 2VWYA 5JH6A 3OOGA 1W82A 5E8XA 5EFQA 5HVKA 2AUHA 2W1ZA 3LHJA 3F7WA 4H3QA 3RHKA 3CP9A 4RZVA 4DGNA 5K3YA 4DG2E 2QKRA 2GU8A 3IK3A 1FINA 3SW4A 3Q60A 3RK5A 4Y46A 3EQCA 4UXQA 4GUBA 1B6CB 1XBAA 3A60A 3ERKA 3ITZA 3PIXA 5DT4A 3TV7A 4EWQA 5AJQA 3E7OA 4BCIA 3ANQA 2J0KA 4KAOA 4WNMA 5AR8A 5LCKA 3VBTA 4F7SA 4FF8A 3R22A 3E3BX 4YHTA 5K0KA 2VWVA 2OI4X 5J1WA 1SVHA 4OAVB 3KF7A 2W1EA 1SNUA 5JFXA 2JDRA 2SRCA 5LOHA 3UJGA 1BYGA 3D14A 3UPXA 2UUEA 4GIIA 1XO2B 4DYMA 5B7VA 2CN5A 4FSQA 4S2ZA 2QNJA 3PJ2A 3PPJA 4O27B 5HNGA 3HDMA 4DTBA 2UVXA 4QYYA 4OTPA 3NUPA 1PJKA 2GTNA 2R0IA 2XK9A 3KFAA 4XCUA 2R3FA 3SV0A 1JAMA 3CC6A 4ZK5A 4I6BA 3UZRA 2GS6A 2WMWA 3R2YA 1SVEA 4FKPA 4J99A 3C4XA 3I1AA 5DBXA 3L9NA 5HORA 2X8IA 3ZFXA 2BTSA 5EKNA 1JKSA 4KSQA 4I6QA 3SW7A 2UW6A 2VNWA 3MB6A 4IC7A 2G15A 4FE2A 5BVFA 5KHXA 3QXPA 3DAJA 2W5BA 4D9UA 5BVWA 3E63A 5AP1A 4P2KA 4FEXA 3FLZA 3H3CA 3ZHPC 4O21A 3L8SA 4HGEA 2YAKA 1H07A 2QURA 3PSDA 3R7OA 4BIDA 2CHLA 3CQWA 4AA5A 5AA8A 1WFCA 2A0CX 3HDNA 4DCAA 4DEGA 4KS8A 4RA5A 2PZIA 1FVTA 5JT2A 3CEKA 3PA4A 5AM6A 4M15A 2UZBA 4C57A 3U55A 1QPCA 4QMUA 3WF5A 4LUDA 4MVFA 4L43A 4IM3A 4C4IA 4WRSA 1R39A 2Q0BA 3OTVA 3PLSA 4D2TA 4FA2A 3P7AA 3EYHA 2YCSA 2OF4A 3BYOA 4C3PA 1BX6A 4EQMA 4EH2A 4LGHA 2DQ7X 3ZDIA 4QRCA 3D5UA 3TNIA 5E1SA 2HCKA 3OXTA 4FGRA 4PL3A 4BVUA 5D41A 3LQ5A 2BDFA 3G6HA 2J9MA 4J53A 5K4JA 5DGZA 3EQPA 3QL8A 3DOGA 3Q6UA 4BIBA 4L44A 2PVJA 4GJ2A 4F0GA 3CD8A 3OY1A 3W32A 1I44A 4JDIA 4XHKB 5CZHA 4M67A 3TZ8A 3UOLA 2XEYA 5J5TA 2W06A 4CRSA 1OL2A 2I0EA 3K54A 5JGDA 2YDJA 3AMAA 1NW1A 4Z3VA 3OBJA 3DA6A 3IW8A 4IFGA 1KV1A 3FZOA 4U40A 5E8WA 2HIWA 4OTRA 3VO3A 4AT5A 1LP4A 2EU9A 5CXHA 3V8WA 2XYUA 4A9YA 4C36A 3IPHA 5JFVA 2A2AA 5C8NA 4R78A 3ORNA 5BVOA 3LJ0A 3PXKA 3SKCA 1J1CA 2WMTA 4YNOA 4BBFA 2W0JA 3OP5A 2WMAA 5DN3A 4JOAA 4FOCA 4O0RA 2QO7A 4DH5A 4FTLA 3IQ7A 4E4XA 3KXMA 3ACJA 3KVXA 4DEDA 1HCLA 4M0ZA 3VJNA 1VJYA 3FXZA 2YIYA 3ZRMA 3S0OA 4G9RA 5H2UA 1OL1A 1UKIA 2J0IA 3DQWA 3A7JA 2OIQA 2XMYA 3PRIA 4QQCA 3SQQA 4P5QA 4F7NA 3CGOA 1U4DA 4GT3A 4YJRA 5HHWA 4DA5A 2OJ9A 4OTQA 3BWJA 2BALA 3TL8A 4YJNA 4D28A 1JSUA 3IDBA 4U9AA 2WHBA 2X8DA 5IH4A 4BL1A 4PX6A 4PP7A 4ALVA 2WTDA 3H0YA 2CCHA 2BTRA 2R3GA 2OH0E 4C4GA 5GZAA 2F4JA 2Z02A 4FZDB 3OS3A 2O64A 4QTEA 2VO0A 3LFEA 3LM5A 2OH4A 2IVUA 4G3DA 4NKAA 4AW0A 5CU0A 5AR3A 4RX8A 4I23A 2C5YA 2FA2A 2XK6A 3MFUA 3S4QA 4IH8A 2VTIA 1K9AA 4DHFA 4USFA 3BBTB 4AQCA 3FMHA 4O6LA 1YOLA 5CVFA 4B8LA 4DGOA 1YHSA 4ASXA 3FDNA 1ZZLA 2W1CA 4BTJA 3PXYA 3R8PA 3O2MA 2OJGA 2Q0NA 4RJ8A 4O7TA 3PYYA 1O6LA 1YWVA 4JBVA 5HIBA 4O1PA 3SC1A 3HUCA 2XBJA 2W4OA 2Y4PA 3CJFA 1XWSA 2Z7RA 4IB3A 1LEWA 2BAJA 4RJ4A 5AP4A 5HCZA 5BNJA 4EHZA 3RKBA 1GZ8A 3EIDA 1JBPE 4A4LA 1PXLA 4HVHA 2UZDA 3GC0A 4RJ7A 5LWNA 2F49A 4TYIA 3Q9XA 4NTTA 1ZOGA 4ACHA 1K3AA 4L67A 3HMPA 3H30A 2YIQA 4FTCA 4TNBA 4AW1A 5IMEA 3GU8A 3LOKA 4BDFA 4PTCA 3R00A 4C59A 4ZLZA 4FGBA 4PDYA 4L42A 2XA4A 3DFCB 3R8LA 4RVTA 4MBJA 2ETRA 5T3QA 1DM2A 3P7CA 4HCVA 4YJOA 5FWKK 5M09A 3R9DA 4BTMA 3HMMA 1XJDA 3OXIA 3Q9WA 4FV7A 1IRKA 4LGGA 3TKHA 4FG8A 3V6RA 4YC3A 1ZRZA 1LR4A 3P78A 2F57A 4IIRA 4QTCA 4IVAA 4P7EA 2QO2A 5HBEA 5HCYA 2C5VA 3QU0A 2QOLA 4AP7A 3KRJA 3MA6A 4YLJA 3SOAA 4FTIA 3QQGA 3COIA 3VBXA 2PZRA 5LJJA 3MESA 3FBVA 4BYJA 3B2TA 4IMYA 4BDDA 4L3JA 5IISA 3I4BA 3SXFA 3AC4A 4CTCA 2J50A 2XKFA 3FQHA 4FG9A 4BICA 3GXLA 5DMZA 3FSKA 4ZIMA 4C3FA 2ONLC 3F5UA 4DEAA 2NP8A 3GFWA 4QMSA 2GNLA 5DNRA 4UB7A 4YTIA 4RGJA 4QD6A 4DTAA 3KY2A 2XNOA 5EHLA 4YTFA 2OIDA 2PZ5A 1QPDA 2QHNA 4KNBA 5FP6A 4DH3A 1PF8A 4NFMA 4U3ZA 2VWZA 4UN0C 2WMSA 3LQ3A 3IOKA 2IZRA 4YZCA 4CFFA 5IQEA 1W83A 3R9HA 4LG4A 2XIKA 4MF1A 5H3QA 3ROYA 3FLWA 4RIOA 3NLBA 4BCFA 5DHJA 2JIIA 2JC6A 1VEBA 3QALE 5JZNA 4RC2A 3KA0A 5A14A 2P33A 5AEPA 3ET7A 5KMKA 3DKGA 2B4SB 4YHFA 3LCTA 4EK4A 3RWPA 4RX9A 4FKIA 5HNBA 4YJPA 5CSPA 1UVRA 3FKNA 2VTRA 4RT7A 2QD9A 4R7IA 1OUYA 3W2OA 4JDHA 4C7TA 1OKZA 1TQMA 4XBUA 2YJRA 1A9UA 3IKAA 4AN3A 1OL7A 3DV3A 3U51A 1M2QA 4MXZA 5M08A 3BX5A 2VTPA 2ITPA 1ZMVA 5ETFA 4EH5A 3R21A 1MQ4A 4ZXTA 3WZKA 1IEPA 2PVRA 3PA3A 3OT8A 4CV8A 4H39A 3BBWA 3DJ7A 2O63A 5EDRA 4L6QA 3DU8A 3R8UA 2PU8A 3MY1A 3WF8A 3V5TA 2YCRA 2XNEA 3ZFYA 1YHVA 4OTFA 4E93A 4S34A 2HY81 4AT3A 3C50A 3VULA 3RZFA 2PZPA 5CWZA 1OPJA 3AD6A 4V0GA 4ZSEA 5LVNA 3QRTA 3GCVA 3HLLA 5KMNA 4KBAA 3GP0A 4F9YA 4RSSA 4TL0A 5KE0A 3UQGA 2VTJA 4KRDA 5ANDA 3V8SA 4AX8A 2PE0A 2OJFE 3AC1A 2BUJA 1PMNA 3BWFA 1JWHA 4XX9A 2UW8A 1G3NA 2G2HA 2O65A 4ZS4A 3I7CA 3EL7A 2XRUA 4OBOA 1XKKA 3HVCA 4EUTA 4W4VA 2UZTA 4O86A 5K9IA 3MBLA 4EONA 5BYLA 4RFYA 3WILA 2WTKC 2XIZA 4BRXA 5C26A 2X6EA 4C2VA 4G6LA 4TRLA 3OFMA 3ATSA 4QNAA 2UZNA 3LFQA 4U97A 5DEWA 2W1HA 2C3LA 4FIFA 5AUUA 3GEQA 5EW8A 2QG5A 3U9NA 2XNBA 5C1QB 5IQFA 2HXLA 3V6SA 5E91A 3R71A 4FKOA 4DBNA 4LMNA 3V51A 3F69A 2I1MA 2VTLA 3SRVB 3TXOA 4HCTA 3RPVA 5A4EA 3KXZA 2UZOA 1FVRA 2Z60A 2X7FA 3LCOA 3QLFA 5EI2A 4C2WA 1JSVA 2VO6A 3UIUA 5BVNA 3FKLA 3UOJA 3BKBA 4UWYA 5HLNA 4FTMA 2WD1A 4JR7A 3ZXZA 3HAMA 2R3RA 4UMPA 1Q8UA 4IJPA 2YABA 1YXXA 3CCNA 4UMUA 4HVDA 5J1VA 4KUJA 2ZV9A 4ASZA 3COHA 5AUZA 5IQIA 2RG5A 3DB8A 4QMWA 4QMQA 4I5HA 3NYNA 3I6UA 2WQNA 3R7GA 3ZBXA 3E3PA 3VS4A 5KNJA 2PWLA 4MKCA 4XV9A 3DT1A 3PDTA 3NCGA 1REKA 3DBCA 2XEZA 4EHEA 1CDKA 3C4WA 3GU5A 2ZMDA 5DT0A 4ASEA 4TPTA 2X6DA 4QP1A 2E9UA 3N4TA 5L8LA 2ITNA 5DVRA 3NWWA 2PUNA 4FYNA 3JR1A 4FYOA 2ITWA 5AAFA 2WB8A 3ORXA 1Q8YA 2R64A 3PG3A 5FEDA 3MY5A 2C3KA 3OCGA 4Z7GA 3KRLA 4W9WA 4PMPA 1J1BA 2NNWB 3PY1A 3E88A 4IADA 4KSPA 4TYHB 5EQEA 4DEHA 2WZJA 4HOKA 4O82A 2ZM1A 2WO6A 4OUCA 5BVKA 4V05A 5M51A 4CD0A 4EC8A 3S2PA 5EOLA 5LQFA 3SXSA 5J79A 5EDQA 2W7XA 2QOKA 4FL2A 4EUUA 3WBLA 4AAAA 3I5NA 2PE2A 4YUQA 3NDMA 1FVVA 2KULA 4NM5A 4IB1A 4BZDA 2UVYA 3FL5A 3C9WA 4IX6A 4U43A 4WBBB 4YTCA 3PWYA 2G2IA 1SZMA 2GMXA 3F5PA 3FSFA 3OWLA 3PZEA 4QMOA 5CENA 5KKRB 4F63A 3KXGA 2QU5A 2BZIB 2XKDA 2C30A 2LGCA 2W05A 4M8TA 3RZBA 5JSMA 3MB7A 5M55A 4FKQA 2C6OA 3QXOA 4ZSGA 5BUEA 3RWQA 1J7UA 1R0PA 3K5VA 4RQKA 1RDQE 3QCXA 4RZWA 4HGSA 5AR4A 3MA3A 2QC6A 4O22A 5CSVA 1PMVA 2EXEA 3O7LB 3PJ8A 4OTGA 3V5JA 5HU9A 2UW5A 4BDEA 4EZ5A 5AV3A 1G5SA 5I3OA 4EOKA 1OECA 3BPRA 2UV2A 3MN3A 2OLCA 2HOGA 1G8AA 4DFBA 3A4PA 4EOMA 2B53A 3HX4A 4AOIA 4DT8A 3TDWA 4ORKA 4AW2A 4N70A 4AGDA 4XG6A 3R1QA 3A7IA 5ACKA 1BI8A 1GJOA 2G01A 3PTGA 1F5QA 1GIJA 3EQRA 4CV9A 2ZM3A 4FKWA 3KMUA 3QQFA 2P2IA 3TZ9A 3U8WA 1R1WA 1W84A 2V5QA 3N51A 4UEUA 5EG3A 3PLAE 4L3PA 4O7YA 5F9EA 3ORLA 3ZSGA 2PK9A 2JAMA 4MNEB 2CCIA 5IUIA 4F7JA 3F2AA 3BIZA 3BV2A 4D9TA 3MDYA 3PFQA 2ITYA 3V01A 3CXWA 3DNDA 1J7LA 4O7WA 3D7TA 3M1SA 4BDIA 4IM0A 1PHKA 3ZZEA 3W1FA 4AN9A 1V0OA 4I6HA 4QYHA 4F65A 1OPKA 3OOMA 4HVIA 3ZLYA 2PUIA 5IQHA 3MVHA 2W4KA 3CD3A 4F70A 5KMMA 3ATTA 2RSVA 2ERZE 1E1XA 4HYSA 3HMIA 3PRFA 3BYSA 4U81A 4BC6A 4OT6A 2OJIA 4B9DA 3POOA 2ITVA 4RIWB 4EH6A 2FUMA 1KOAA 4IBMA 5CYIA 3RPSA 5KBQA 3JUHA 1QMZA 1HOWA 5DYJA 2PL0A 5JRQA 5AX3A 3PZHA 2JKMA 2R3JA 3O50A 1STCE 2Y0AA 3DTCA 4U5JA 2VTOA 5FEQA 3ZO1A 4ACMA 4D2WA 1APME 4WNOA 5TO8A 4Q9ZA 3OVVA 3C4FA 1QL6A 4GT5A 2Z7QA 4MAOA 1H4LA 4EQUA 3CIKA 3H4JA 2XIXA 5J95A 3LW0A 2B9HA 4M69B 2OBJA 2YM3A 3OWPA 4WNKA 3VS1A 5D11A 2YCQA 3KC3A 2RG6A 4J71A 3S95A 5IQDA 3VIDA 3R8VA 5H8BA 2CSNA 1NVQA 2R3QA 3LVPA 4QPSA 2Z7LA 4HZSA 4F6WA 3DB6A 3HMOA 3GT8A 2WMRA 4S32A 3SLSA 3UP7A 3KULA 4HZRA 4QP9A 4R3RA 4M3QA 3HZTA 4G34A 3UMWA 3BGPA 5A6NA 5AAEA 1SM2A 2BAQA 4FT3A 4EOPA 3ID6C 5C4LA 3V5WA 3TUDA 1K2PA 3JS2A 2BAKA 4NWMA 4APPA 2QOQA 4RWLA 1PXMA 4O81A 4GVAA 3E5AA 4JNWA 1JSTA 5A4CA 2ZOQA 2JFLA 3PE1A 4QQJA 4X21A 5C8KA 3LFAA 5I9YA 3GC9A 4HYIA 4IWQA 2ETKA 3O7LD 3PVBA 4QP2A 4D0WA 3O23A 4ANSA 1X8BA 2PMOX 3FLNC 3HA6A 3ENHA 3OCSA 3JVRA 3OXZA 3DKFA 2YZAA 4LOQA 2G1TA 3UIBA 3EKKA 2BIYA 3E87A 3F2NA 4FG7A 3QTXA 4NEUA 3ZRLA 4F1TA 5I9ZA 5JEBA 3QF9A 5K5XA 1PXJA 2B0QA 4FEUA 5GIPE 4E26A 3QUDA 4YZNA 3OROA 2JEDA 1YWNA 5C01A 4RJ3A 2HZIA 3DLSA 2OXXA 4RMZA 4C4HA 4UWCA 2YZLA 3UZTA 3L8XA 4MXCA 5L6OA 2R5TA 2BROA 4IWOA 3G5DA 5HIDA 5HO7A 3Q3BA 3NGAA 2YA9A 3CR0A 5AR5A 3DXPA 4QMNA 3UYSA 2PVLA 2VWXA 1JKKA 3EKNA 4C4FA 1JVPP 5CTPA 1Q8TA 3UG1A 4ACGA 1PRYA 2F7EE 1LPUA 3EQDA 3OF0A 4P90A 4M84A 1ZY4A 4GFMA 1V1KA 3NX8A 2CKEA 4YO4A 3NNWA 4I6FA 5IH6A 5AP3A 4XLVA 3R7EA 4KA3A 3BCEA 3DJ6A 5DR6A 5T6KA 5A54A 5CASA 4YSMA 1WBSA 3G33A 4R3CA 3VS6A 2JITA 2E9PA 3D5VA 2DYLA 5K4IA 2C68A 2PHKA 3LJ2A 2UZLA 3DY7A 4MHAA 5M06A 2V7AA 3OEFX 4KABA 3LXNA 2B9FA 2PZYA 1ZYCA 4BCOA 4BCKA 4FICA 2PSQA 4QP7A 3MTLA 4U41A 5J7HA 3HEGA 2R3NA 2QHMA 5KCVA 5HTIA 4GJ3A 3ORTA 2X4FA 3NW5A 2WTVA 3OW3A 3G9LX 4CEGA 2C1AA 2QOBA 2VX1A 5HVYA 3ODYX 2X9EA 3AC5A 3PG1A 4M69A 3GC7A 1TVOA 4RVLA 1B39A 2QU6A 5AR7A 3ZRKA 4ANLA 1PKGA 2VNYA 2XIRA 4KIQA 1UWJA 4JIAA 3HUBA 4AE6A 4UMRA 4R7HA 3UE4A 3U6HA 2ZDTA 3EFLA 3R1NA 4IB0A 5I5ZA 5ICPA 1MQBA 3TM0A 2BMCA 4HCUA 4DH7A 2J5EA 1BKXA 4XV2A 2ITQA 3DLZA 2PMNX 4Q2AA 5BVEA 5CY3A 5CVHA 3LFNA 3QTQA 4XH6A 1S9JA 2Y6OA 4FV5A 3QTSA 2YERA 4BBMA 4O7LA 3VN9A 5IDNA 4TYJA 3RNYA 5J9ZA 1U5RA 4ZJVA 4A9RA 3O17A 2WGJA 3AXWA 1ERKA 2ONLA 1O6YA 2IN6A 3AC3A 3CTQA 1WBPA 4KINA 4D4RA 1IAJA 3N4UA 2CPKE 1VYWA 2OZAA 2VGPA 1GAGA 2XK7A 5C27A 2J0JA 5IQGA 1Y57A 4UZHA 3TZMA 4O83A 5HE3A 2C6DA 3FLSA 3R02A 5CQUA 4F0FA 2FSOX 3OBGA 4X6RA 4CZUA 5CF5A 3CE3A 3TG1A 1OL6A 5HU3A 2ZYBA 4Q5EA 4YTHA 2VWUA 4LFIA 3K3IA 4WOVA 3A2CA 4ITJA 4MBLA 4RFZA 4QP8A 4N4SA 4K18A 5HCXA 5ANEA 1P4OA 4S30A 2C6LA 4K1BA 2R4BA 1DS5A 3KEXA 4QNYA 4H1JA 4ONAA 4ZZMA 3Q52A 5HZNA 2PMIA 3WZEA 4MD9E 3CGFA 1YKRA 4DBXA 5LMAA 2DUVA 3PIYA 4MQ1A 3CPCA 4CTBA 5LMBA 4JLCA 2E9VA 5GZ8A 3V3VA 2VRXA 3H9FA 5DH3A 3TV4A 1H24A 3EQIA 4WT6A 3EFJA 4C4JA 4EEVA 5JGBA 2QONA 4GUEA 4IAYA 4W4XA 4IX3A 5J5SA 3D9VA 1YW2A 3WF7A 1WZYA 2WFYA 2YN8A 4BI0A 4YPDA 4YJTA 3GI3A 4FR4A 5CU4A 3R8MA 1MRYA 3ORMA 4R5YA 2QG7A 4QYFA 5CXZA 3KXNA 3LCSA 4U8ZA 3RAKA 4YMJA 4MF0A 4CKRA 1W98A 3G90X 2XM9A 4XG7A 4EQCA 3F7ZA 2ACXA 3QWJA 4ENXA 2YDIA 3PJ1A 3QZHA 5IQAA 1CKPA 4B8MA 4E73A 3G0FA 3W2CA 3RMFA 2GDOA 1DI9A 1Q61A 4XS2A 4A9UA 4M66A 5F20A 2WIPA 4BCNA 1OBDA 3TCPA 4TKSA 4JX7A 5EW3A 3A99A 2GFSA 3D0EA 5LWMA 1S9IA 3ZUVA 1SYKA 1T45A 4L8MA 5LXMA 4Q5HA 1OPLA 3NAYA 4E4LA 2YAAA 4EH7A 4BCGA 3DPKA 4AA0A 4YR8A 4EOQA 2ITZA 4CMTA 4FOBA 4GH2A 2VAGA 4WKQA 3R7YA 3RM6A 4Z55A 4GRBA 4FL1A 3ZCLA 2QI8A 4IC8A 4LYNA 1MRUA 5CQWA 3MFRA 3IOPA 4FV3A 1Q3DA 2ZV8A 3CBLA 2JDTA 2EUFB 4X3FC 2BRNA 4XRJA 3VUIA 2XM8A 3HV5A 3ORZA 1IA8A 2FGIA 4AZTA 5GJGA 2GS7A 4F6SA 2VU3A 3FUPA 2V55A 3QKMA 4QP3A 1SNXA 3ANRA 4FIHA 2YM7A 3LIJA 1BUHA 2YITA 5E9EA 4FKTA 2W99B 4QQTA 2X2KA 3NCZA 2X2MA 4D55A 4FNYA 4UWBA 2IZUA 2EVAA 3NAXA 4JI9A 2E9NA 4PL5A 5FM2A 5IKWA 5KMJA 5L3AA 3VHKA 3OCTA 4RC4A 3QUPA 5HQ0A 2C1BA 2XIYA 4QOXA 4JDKA 5F1ZA 3UDBA 4AWIA 2C6IA 4FTKA 4OW8A 1H01A 4ANQA 5AIRA 4DCEA 2UZWE 3PIZA 3LFCA 4ZLYA 4HGLA 5FM3A 5HEZA 2G9XA 1IG1A 5EM8A 4D4YA 4U42A 4ITIA 1RE8A 3ZO3A 2F9GA 5A6OA 4J8NA 3O8UA 3BU3A 4ZY4A 4O0XA 4E6QA 4LRKA 3FLYA 4WA9A 4JAIA 5CAPA 2QR8A 2J0LA 5DT3A 3TWJA 2BHHA 1WVYA 2BIKB 4TZRA 1OKVA 5EKOA 1Y8YA 5KMLA 3EQBA 1SVGA 3KF4A 3PXQA 4WSQA 4C35A 4D1ZA 2PULA 4I24A 5TR6A 5AUVA 4TYEA 4WO5A 4HW7A 4AF3A 1Q99A 4YLLA 3P0MA 1ZYSA 5I4NA 2CMWA 4HNFA 4ZSAA 5IU2A 1OIQA 2B7AA 3TT0A 1DI8A 4X2GA 1URCA 3WZDA 3NVKI 3TNHA 3AC8A 3TKUA 4DGMA 4GKIA 2H8HA 2HY0A 5CEOA
chains in the Genus database with same CATH superfamily
2I0VA 4K2RA 2DWBA 3AC2A 1Q3WA 2RIOA 4FZ6A 4CCUA 3D7ZA 2XB7A 3P4KA 4N0SA 4QTDA 4QMLA 2R3PA 4BZNA 5FP5A 3UO6A 5IEVA 4FSTA 5C8MA 2QQ7A 5BQ0A 3O71A 3GUBA 5E8ZA 3THBA 1RW8A 4B99A 1W8CA 4I0TA 5HKMA 3NUNA 3R01A 4F08A 3UVPA 3W0RA 3GENA 4TY1A 1MP8A 1VZOA 3ETAA 1XH5A 3K3JA 4IAZA 3QAME 3RI1A 3D15A 4DFNA 5HD7A 2NYAA 1V0BA 4NFNA 4QMXA 1OBGA 2GNFA 4O4CA 5BVDA 2A1AB 1BL6A 3PP0A 3Q5ZA 4V0GB 3WARA 4C62A 4EH3A 4UXLA 3OD6X 2CGVA 4S31A 2C69A 5EW9A 3I5ZA 2BRBA 3LMGA 3GQLA 2EWAA 4MK0A 4OAUC 4J8MA 3WYXA 3FY0A 5GNKA 2WMBA 3AGMA 2VO3A 2X4ZA 3C0IA 4FSNA 4MD8E 4J98A 4LV5A 3ZO2A 3V5QA 1H26A 2EB3A 4FEVA 4PP9A 4LV8A 3O51A 1XH6A 2PY3A 3B8RA 1PY5A 3OZ6A 4NJDA 5HG9A 4EBWA 3KVWA 1ZMWA 2BZJA 3QTUA 4G9CA 3PWDA 3R8ZA 2NPQA 3FWQA 3P5KA 4R1VA 4BTKA 4Y85A 2VTAA 5EI8A 5FTQA 4CCBA 1OVEA 2W1FA 2ZMCA 4RA4A 3PSBA 4TTHB 4G2FA 5J7BA 2VX0A 1PXKA 2RKUA 2XRWA 4BI2A 1CSNA 5HLWA 4TW9A 3OY3A 4RPVA 1JKLA 5ANJA 2I40A 3UOHA 5EQYA 4CGAA 1ATPE 4NKSA 1QCFA 3NIEA 4G1WA 1UNHA 3WE4A 3P79A 2GFCA 5TE0A 2AC5A 4W8DA 4CG9A 3QTIA 1FBNA 2C3IB 4O6EA 3R9OA 5GIOE 1DAYA 3HRCA 3QUEA 5E92A 4JQEA 4F1OA 3VC4A 5I9WA 3DZQA 3A7HA 3EN5A 2FB8A 3IW4A 2Y4IB 3VHEA 4ZOGA 5D12A 4RBLA 2GCDA 4BFMA 5T68A 4QMYA 5CT7A 4C3RA 1MUOA 4D1XA 4N57A 3G6GA 3OG7A 5IZFA 4K77A 3EQHA 3G9NA 4U3YA 5H8GA 3R7IA 4D5KA 2BRMA 2HAKA 4OTDA 2QOCA 4R5SA 3QC9A 3SG9A 5GZ9A 1Q97A 4DEEA 3EZVA 5DE2A 2R3OA 3ZSIA 3NNUA 3BHTA 4CFWA 5B0XA 2OK1A 1FQ1B 4KWPA 5DLSA 4M13A 4Y72A 5EHYA 5KMIA 3V5PA 4FKJA 2OKRA 3R2BA 3BHVA 4MXAA 3TUBA 2X2LA 2UZUE 3DQXA 4H3BA 3VJOA 2J4ZA 5JZJA 3VVHA 3BZ3A 4ZP5A 4AT4A 4PTEA 3AQVA 4UV0A 4AE9A 1Y6BA 3DFAA 1WCCA 3H10A 4OGRA 5ETAA 5CU6A 5M4CA 2BKZA 2WMXA 4YJUA 3D2IA 4UX9A 4ZZNA 3W8LA 3VBYA 3NSZA 3JPVA 3U4WA 3L8VA 3CPBA 3MIYA 4FK3A 4DH1A 2FO0A 3DK6A 2J51A 3EZRA 3ZUUA 1M2RA 4NM0A 3UPZA 4CZTA 1NT2A 5M53A 4FKSA 4RWJA 3RPRA 3FMNA 4BDGA 3TYKA 1UNLA 3K5UA 3Q4CA 3NYVA 3R04A 3GOKA 3GU4A 5FTOA 5E90A 3ZEPA 5DR2A 1FGKA 1CM8A 3O8TA 3PXRA 4AGCA 5BMMA 5AP7A 3H9OA 4FT5A 5A46A 4LGDA 4A9TA 2H9VA 4NT4A 1YWRA 2VX3A 3OT3A 3NUAA 2ZAZA 4PNKA 4U0IA 3BYVA 4AAYA 2XJ1A 3BI6A 2WELA 2XP2A 3UZPA 4DN5A 2FSTX 3KRXA 3QRUA 4ERKA 4FV4A 4GCJA 3RK9A 5BYYA 4OBPA 2WOUA 1ZYJA 3O8PA 4BCMA 2IZSA 3CTJA 4RC3A 4CQEA 1KUTA 1KSWA 2PVFA 3HGKA 4YO6A 4ID7A 3Q9YA 1P2AA 2JDSA 4O91A 4V04A 2O5KA 3UC3A 4AOJA 4ZAUA 4JG6A 3ZTXA 2OGVA 4FIEA 3FL4A 4AZVA 3Q4TA 1L8TA 4KKEA 5AV4A 3BL7A 3ZS5A 4G5PA 4J97A 1KE8A 3LQ8A 4FTJA 4XG2A 1WBVA 2YDKA 5ANIA 1UU8A 4DEIA 2ZB1A 4MWHA 3D2KA 4WG3A 3L9LA 4U80A 3GB2A 3I60A 4F99A 2J0MB 4TWPA 4G3CA 2J2IB 4K33A 3ZM9A 1F3MC 5HOAA 4IEBA 1ZAOA 4AN2A 3GNIB 3W2PA 3KN6A 4KIPA 2GQSA 5A4TA 5C9CA 4EOSA 5AAGA 5AP6A 3D7TB 1O6KA 2WIHA 3BGQA 1NVRA 4L7SA 3DAKA 3QRKA 4FUXA 4QEBA 1KV2A 2UW9A 4BDKA 1U5QA 3BLAA 2EXCX 1OITA 3PJCA 1BMKA 4ITHA 3Q4UA 3R73A 1ZLTA 4GK4A 3QX2A 5HE1A 4CMUA 4FTOA 4QYGA 2R3LA 4AOTA 4HJOA 1XH8A 4YHJA 3A7FA 3Q96A 3RPOA 4R3PA 1R0EA 4C37A 4DFLA 3KMWA 5EI6A 3Q4ZA 3TIZA 5TOZA 1Q41A 2X8EA 3I79A 4ACCA 5BYZA 2GTMA 2G2FA 1OIYA 4EJNA 2CKPA 4NL0A 3ORKA 4L46A 4M0YA 1ZOHA 3V5LA 5AUTA 3UC4A 4CFNA 3MH2A 3QQJA 2BKKA 1JKTA 3VUDA 4EK8A 3OC1A 3DDQA 2I0HA 4YPSA 3MV5A 5D7VA 5AV2A 2NRYA 3COMA 1Q24A 3OUKA 4JDJA 4ZMFA 4GYGA 5DI1A 4YSJA 4O7RA 1UKHA 4YZDA 4AGUA 1OGUA 5CZIA 2PUUA 3BHHA 3TI1A 4GSBA 3OHTA 4I0SA 2IW8A 3KULB 4IAFA 2IVVA 3EN4A 4DITA 3HRBA 1QPEA 5ANGA 4YGAA 4IACA 3C0HA 4AW5A 2X0GA 3EFKA 5K0XA 2ZM4A 4IFCA 4RX7A 3WZJA 4I94A 3ZYAA 3D5WA 4XV3A 2I6LA 2RGPA 5AA9A 3VBVA 4NCTC 5ANKA 1ST4A 4WG5A 1FPUA 3WE8A 2WEVA 5IF1A 1YDSE 4R1YA 3SHEA 5HG8A 3AT2A 3PY3A 4KIKA 5E4HA 1I09A 4DFXE 1ZYDA 2YFXA 4FTUA 4IANA 2PVYA 4R6VA 4D2SA 3Q9ZA 4XP3A 4JT3A 3CJGA 5GJFA 5EM5A 3EQGA 3PP1A 1NY3A 2UZVA 4GK2A 4L53A 4QT1A 5L4QA 3ZZWA 4FK6A 1PMEA 1YDRE 2H6DA 3VW6A 2WQMA 2YM5A 4I3ZA 4BF2A 3HV4A 5CU3A 5FG8A 4XOYA 3F6XA 4MXOA 3R63A 4FV1A 1ZMUA 3FHRA 4FNWA 4L7FA 4QP6A 5KBRA 2VTQA 2GSFA 1PXNA 2FH9A 2HXQA 4BIEA 4IZYA 1Y6AA 4G6NA 3W0SA 4OTWA 5IUGA 4FKVA 1J3HA 2XH5A 4M68A 1CTPE 4EOLA 4X2NA 3HL7A 2XCKA 4RJ6A 3NR9A 1WVWA 1YI3A 4UMQA 4BDJA 2GHLA 3VWAA 5JFSA 4FTNA 4EC9A 1F0QA 3LXKA 3HYHA 4LL5A 3G51A 3Q5IA 4ALWA 5M57A 1ST0A 2YIXA 4F1MA 1M17A 2FYSA 4JBPA 2QR7A 5G1XA 3MVMA 4E1ZA 4E3CA 2QCSA 3NIZA 4FI1A 5IDPA 5JFWA 3UO4A 3FI3A 2OICA 4GFGA 4FSUA 1GZNA 4O0WA 4O38A 4KBKA 2IJMA 5EM6A 1TZDA 3RCJA 5M4IA 3HA8A 4LRJA 2Y7JA 2JGZA 3Q32A 3QYWA 4L01A 3TTJA 1PKDA 3OTUA 2P55A 3B2WA 5LVMA 4E7WA 2XAMA 4I0RA 4I4EA 4CFMA 3AGLA 2YCFA 4ZSJA 4ZTRA 3FI4A 4BY9E 4B7TA 4LDTA 4CNHA 5LCJA 4O2ZA 3BLQA 5D1JA 2ERKA 1FOTA 3REPA 1NXKA 2Q83A 1H1PA 2WMUA 4USEA 2XUUA 3ELJA 3H9RA 4FKRA 2HELA 2QLUA 4FIIA 4Z7HA 5CEMA 3L9MA 4NM7A 1P4FA 5AADA 1JOWB 3CLYA 5A4LA 3CKXA 3NEWA 3W18A 4QMZA 5JGAA 4J52A 4AGWA 4FEWA 4CSVA 5CI6A 4UYNA 4G16A 3L8PA 4DEBA 3SDJA 3UMXA 3F2RA 3EWHA 2C6MA 3IECA 5I9UA 3QZGA 3W55A 4BKYA 5B2MA 4BDAA 2HK5A 4EI4A 2QOFA 4GEOA 3R7UA 4YZBA 2HW6A 4HYUA 1CKJA 2W9ZB 1YVJA 5AUYA 4ZY6A 3FYKX 5ITAA 4WRGA 3I0OA 3FMDA 4IZ5A 2PVNA 4Y95A 1CKIA 4EH9A 3F3VA 3TN8A 1MRVA 2C6TA 2JLDA 2Y6MA 3RTPA 4DDIA 3HRFA 3QRIA 3S3IA 1OKWA 2E2BA 2OZAB 4IW0A 2VWWA 3C5UA 5HTCA 1J7IA 3VF8A 4E6DA 4O0SA 1GZOA 4L3LA 4XRLA 5AP5A 4HGTA 1VR2A 1H1QA 5EM7A 3ZUTA 1BL7A 3MPMA 4F64A 2IVSA 3GCSA 2FVDA 4DLIA 4EZ7A 5F4NA 3EQFA 3QGWA 4AQKA 4AA4A 5CAQA 5FBOA 3DBQA 1XH7A 1OUKA 1H1RA 5TKDA 5CS6A 4GKHA 4ZLOA 4RIYB 1LEZA 2ZDUA 3OUNB 4JQ8A 4FVQA 3BQCA 4MQ2A 1Y91A 3HV7A 4LV7A 2XJ0A 4NM3A 4X7QA 3ROCA 3P9JA 2BFYA 4M14A 4G5JA 3QQUA 4EHVA 4ZEGA 5I9VA 4CFXA 4EK6A 2VWBA 4QTBA 4AFEA 1XQZA 3N9XA 3OWKA 2RFSA 1W2CA 4HPUE 5CNNA 3ZO4A 2Z7SA 3MI9A 3A4OX 4IAAA 2OWBA 3ZEWA 4CYJA 4RG0A 3HAVA 4O7VA 4LOPA 4ZTQA 5FD2A 5JGBA 2XZSA 3MJ2A 3RALA 1G8SA 1YI4A 3UIMA 2GNHA 3QCQA 2UZEA 1T46A 3ZLWA 4L00A 3BHYA 5L2WA 4GVJA 4J1RA 1OMWA 1H8FA 5C4KA 3W16A 2P0CA 2IW9A 3W2RA 3MYGA 3FZTA 2WPAA 3NUUA 3Q2MA 4FVRA 5AP0A 2C0TA 5HE0A 3RNIA 4B4LA 4OLIA 1UV5A 4E6AA 5LMKC 3EH9A 4YJVA 3E8CA 4FTQA 4PMSA 5KZ0A 1W7HA 1ZY5A 2BCJA 4Y5HA 5ACBC 3KGAA 3QD0A 4BGQA 1H0VA 3G15A 5CANA 4XG4A 4ARKA 3HV6A 3BV3A 3Q2JA 3F66A 1IR3A 1UWHA 4E5BA 5I0BA 3FMJA 5D9HA 2O2UA 1Q8WA 5DRDA 3AOXA 2ZV2A 2J90A 2OF2A 3LFBA 3PUPA 1REJA 2JDVA 3QHWA 4U44A 4C8BA 3ZDUA 3LXLA 4JRNA 4X2KA 2BZHB 3MGYA 4X3JA 2F2UA 5AR2A 4IZ7A 3FMEA 4Y83A 2VTTA 1OB3A 2WTKB 4LQMA 4NTSA 2W4JA 5HO6A 2JIVA 3W0MA 4IM2A 2R3KA 1M2PA 1AD5A 4K0YA 4IX4A 3T9TA 3POZA 3NUSA 3BELA 3QWKA 2UVZA 2WTWA 2X9FA 2RFNA 3PVWA 4RVMA 3TUCA 5HG7A 3RCDA 2ITOA 4AZFA 3HKOA 2I7QA 3PXZA 1QPJA 3W0OA 3CY3A 3NUXA 4R8QA 4FV6A 4CG8A 3VRZA 4H1MA 4FKUA 4CRLA 3FE3A 4GIHA 4JQ7A 1H1WA 5AV1A 2IZTA 4J96A 3V8TA 4NU1A 2V22A 3T9IA 3FV8A 2ITXA 3I7BA 2ITTA 3F3WA 3IW7A 4QPMA 3GC8A 4FKLA 3LM0A 4EYJA 2QOOA 4YBJA 4B0GA 5HD4A 3BGZA 3R28A 2OG8A 4NYEA 5AM7A 5B2KA 4D2RA 4IDTA 4UMTA 3EHAA 4I21A 5DFPA 2BR1A 4DTKA 4FZFB 3ZBFA 3KXHA 5B2LA 3ALNA 4AUAA 5HX6A 3UOKA 1J91A 1RQQA 2WQEA 4L45A 5IH5A 4XV1A 4O0VA 1PXPA 5DR9A 5E8SA 3VS5A 1A48A 4L9IA 4DDGA 4JBOA 3IDCA 2X7OA 4EKKA 4FSMA 4RIYA 4OBQA 3ZC5A 3RK7A 4GV1A 3UNJA 4BGGA 4DGLC 5L2IA 1ZARA 2PVMA 5M44A 2PYWA 5EH0A 3BRBA 3D83A 2X81A 4MXYA 2NRUA 2CGXA 3WI6A 5CAUA 3ZMMA 2X7GA 3R1SA 4GW8A 5EDPA 4UBAA 2IEWA 2GNJA 5J9YA 3DKCA 3KK8A 3C1XA 4XYFA 3F88A 3WIKA 1OM1A 4N6YA 4XUFA 4JIKA 4C38A 5A9UA 3GVUA 3DCVA 4EL9A 4YLKA 2OXDA 1BI7A 1GOLA 1OZ1A 3GOPA 3GU6A 4X2JA 4AG8A 2H96A 3LAUA 1B38A 5KX8A 4PL4A 2O8YA 4XG9A 5AMNA 4BKZA 4BKJA 4N6ZA 5CLPA 4CT2A 4GT4A 4H3PA 5L6WL 2WTJA 4PRJA 4S33A 3DS6A 1GZKA 3C51A 4BWPA 3ZSHA 2V62A 2AYPA 3C4EA 4QMTA 1H27A 4FTAA 4JAJA 4XLIA 5IUHA 3E92A 4G17A 2KTYA 5H8EA 5AX9A 3E7VA 5HX8A 3DNEA 4RRVA 2W1DA 4CXAA 4CFVA 3RP9A 3AT4A 4FMQA 3S00A 1XBBA 1U46A 5FEEA 3ULIA 3SGCA 4BDHA 2F2CB 3EN7A 3W0PA 2BDJA 5CEKA 4NW6A 4O2PA 4QMMA 1FMKA 3R6XA 3KCKA 5HVJA 4W9XA 5AUWA 3VRYA 2JKKA 4EH8A 2OFUA 5I3RA 2YJSA 3ZLXA 2JD5A 3LCDA 4I5MA 5IA4A 4ZSLA 3DBFA 3IDPA 4FV8A 4GMYA 4JBQA 3ALOA 5DEYA 2CKOA 4XG8A 3COKA 2W5HA 1GIIA 1PYXA 4MNFA 4PWNA 4D2VA 4DINA 3UDTA 5CF6A 3DJ5A 3TNQB 4EZ3A 2WOTA 3U9CA 3BYUA 4CVAA 2R7IA 2RL5A 4BCJA 4GU9A 4FJVA 3MH3A 3LFFA 3P08A 3IS5A 4GL9A 4IXPA 1M14A 2W96B 3VQUA 2B52A 4PPCA 5GJDA 4BCPA 4KBCA 2YM4A 1M7NA 4G3EA 2C0IA 3QKLA 3IGOA 2GNIA 2UW4A 3KN5A 4MD7E 3TJCA 2R7BA 3KK9A 3T8OA 4AU8A 4CQGA 4NIFB 4YC8A 2VTSA 2IVTA 3RVGA 3OCBA 3C0GA 3LE6A 3P23A 3HP5A 5IG1A 2ZFYA 3FQEA 3KQ7A 1NVSA 2WKMA 3Q6WA 1WBTA 3DGKA 3A61A 3R0TA 1WBOA 1YQJA 2C47A 2WU7A 4FSRA 4L52A 4PMTA 2LAVA 3VUHA 4DFYA 4F0IA 5IQBA 4B6LA 2B9IA 4FT7A 2XNNA 4FEQA 3C13A 2AC3A 4ZJJA 2XK3A 4JRVA 4D0XA 5BUJA 3NYXA 4GFOA 4BWKA 4FSWA 4QTAA 3VUKA 3WOWA 5CVGA 3DXQA 3AG9A 3EB0A 3LXPA 5KKRC 4QMVA 2HYYA 2J5FA 4YP8A 3SVVA 3FI2A 3QZIA 4O4BB 5FRIA 5FXQA 2HZNA 4M97A 5JQ8A 3E93A 5TF9A 4BZOA 3WF6A 4BWXA 3KREA 3NNVA 4DFUA 3VUTA 4PUZA 3MJ1A 3UBDA 2ETMA 2W5AA 4DH8A 3VBWA 3FMLA 4DC2A 4A06A 4TNDA 4CT1A 4CYIA 4F7LA 5EYKA 3QKKA 3G0EA 3FC2A 4XEYA 3PY0A 2XYNA 3SX9A 4IHPA 2PVHA 2R0UA 1OKYA 5G6VA 5L8KA 2W9FB 2YIWA 2DS1A 2WEIA 4FT0A 4JJRA 3KRRA 2XANA 2CKQA 4GG7A 4FV0A 1R78A 3AMBA 3DK3A 4EORA 2VTNA 5EYDA 5FDPA 2OJJA 2R3MA 3PE2A 4ANMA 4FKGA 3IGGA 3MS9A 3FJQE 4IE9A 3ZC6A 4X0MA 1YXVA 1M7QA 4LL0A 4AZEA 4CKIA 3FMKA 3WZUA 2W1IA 2WNTA 3F3UA 3UIXA 2H34A 3E8NA 3LKMA 4RWIA 3KB7A 1URWA 1YHWA 1WMKA 4EKLA 5H9BA 1GIHA 3E8EA 2XNGA 1Z5MA 4TT7A 5LVPA 2VWIA 3NW7A 2WAJA 2VV9A 1KE5A 4FODA 1OIUA 2BPMA 1E1VA 3RPYA 4APCA 1XH4A 3UNKA 4ZY5A 3NVMB 2YLFA 3QQKA 4NCTA 2BFXA 4JMQA 4A9SA 3C4CA 4RIXB 5BPYA 3HP2A 3UG2A 3W2SA 4U6RA 3CQEA 3E8DA 3PXFA 2EXMA 4CMOA 3JY9A 4G3FA 4HYHA 4JX3A 3NYOA 4C02A 1YXTA 5HLPA 3D94A 2Z8CA 4I92A 5EOBA 2YHVA 3KCFA 4BGHA 5L2TA 2OO8X 3IW5A 4Y73A 3F5GA 3UVRA 3NW6A 5M4FA 4HPTE 2WXVA 5CSXA 4DFZE 2HZ0A 4Q9SA 4NIFA 2YLEA 2QOHA 3ZONA 5EQPA 1OIRA 5M07A 5FDXA 4I41A 3LZBA 4E4MA 2QO9A 3DTWA 1UA2A 4P5ZA 4NH1A 4O0UA 3FYJX 4D1SA 4DE4A 3L9PA 3GBZA 2VO7A 3KMMA 3KU2A 3BU5A 4FZAB 4IDVA 4TWOA 3WIGA 4WUNA 1PMUA 3ZFMA 3ORIA 4LM5A 4D2PA 4CLJA 3LMIA 2R3IA 5DWRA 3ACKA 1U54B 3H0ZA 3BEGA 3NS9A 2RFDA 4HNIA 4W8EA 4ZJIA 3RINA 3ENMA 4II5A 3UYTA 3SD0A 1JQHA 3FHIA 3GCPA 2P2HA 3VBQA 4WG4A 1ZOEA 1YOJA 2BILB 5ETCA 3P7BA 4AFJA 3KRWA 2HENA 2F7XE 2WMQA 4OTIA 2OFVA 1KWPA 4ANOA 4NK9A 4OR5A 2PUPA 4BTFA 5IEYA 3BEAA 3BE2A 4TWCA 4WIHA 5EYCA 3DBDA 1SMHA 3QD3A 3U54A 2P3GX 4IVBA 3QD4A 3UTOA 1TKIA 3VS3A 3N4VA 5AUXA 4IB5A 4P4CA 4JXFA 4FX3A 2VUWA 4DG3E 3ZU7A 5FUTA 4PPAA 1P14A 3GCUA 4A4OA 4RX5A 3U4UA 2CNQA 3FC1X 4D5HA 3MY0A 4FTRA 3IW6A 1H08A 3TACA 1ND4A 1Q5KA 3QQLA 4MCVA 4NJ3A 3FY2A 3QRJA 1Q4LA 3MVJA 3BQRA 4U79A 2RFEA 4AACA 3EJ1A 3PA5A 3SOCA 3NRMA 5IA5A 1WBNA 3GFEA 4FSYA 3BU6A 3FKOA 3TKIA 5BUIA 3OEZA 3MWUA 2B55A 3QCYA 5E1EA 3WYYA 3E62A 4QMPA 5E8YA 1HCKA 2GNGA 2Y8OA 4JG8A 3R9RA 2XF0A 3BLHA 1E9HA 3F61A 1YRPA 3RAHA 4G31A 1YOMA 4EH4A 4PDOA 4OT5A 3PVGA 3HV3A 3NZ0A 4BDCA 4ZTNA 4EYMA 5ETIA 3QD2B 5C03A 3EN6A 4AS0A 4E5WA 5IA2A 3UQCA 5HGIA 2GQRA 5HTBA 3KL8A 4RIXA 1Q8ZA 5DPVA 3VS2A 3L1SA 4FV9A 4ZTMA 4MTAA 3VW8A 2IO6A 3ZM4A 4EBVA 1YXUA 5L2SA 3TEIA 3UO5A 4YZ9A 5LVLA 1JNKA 4BCQA 3PJ3A 5FBNC 2FSMX 3ULZA 3Q53A 2JDOA 4I20A 4G3GA 1W2DA 2XBAA 4R7BA 2XKEA 2ZJWA 3OW4A 4E5AX 5IMXA 4KKGA 4H58A 4MEDA 4BHZA 3Q04A 3ZXTA 3LMHA 2WU6A 4GS6A 5GHVA 3RM7A 4H36A 1FMOE 4K9YA 5F95A 4AZSA 4L68A 4QPAA 2X39A 4FUYA 3TNWA 4E6CA 1H00A 4KKHA 4DG0E 3R83A 3V04A 2XK8A 3DZOA 5JMSA 4XP0A 5KMOA 5AWMA 4RQVA 3QLGA 2W17A 1U54A 3MFTA 4K11A 2HWOA 1Z57A 4PTGA 4KIKB 5DG5A 5FGKA 5KHWA 4MXXA 3CSVA 4XP2A 4FL3A 5JKGA 4C61A 3VAPA 4H05A 4MBIA 1FGIA 5LARA 3LLAA 4O84A 4MH7A 4PQNA 4PMMA 2XJ2A 3HMNA 4W4WA 2A19B 1ZZ2A 3IO7A 4LRMA 4U45A 5F94A 4F9WA 2A27A 3F82A 3RJCA 4Y8DA 1ZXEA 5M4UA 4I93A 4EOJA 4WUAA 4YBKA 4C58A 1H25A 5LMKA 4O7ZA 4IJ9A 4JVGA 2IPXA 2BHEA 1G8JA 4RLLA 5KZIA 2J6MA 3CQUA 2XS0A 1V0PA 1UU9A 5DRBA 4A07A 2B9JA 3B8QA 4KIOA 2O0UA 5J9LA 4OTHA 3HECA 4C4EA 2WMVA 4C0TA 2UW3A 3QA8A 4M12A 2GHGA 4IAKA 4PF4A 2XNPA 1TQIA 2CJMA 1ZYLA 4PY1A 4GU6A 3TNPC 3A8XA 3QTZA 3ZH8A 3FZSA 3UNZA 2ZVAA 3KIOC 1Y8GA 3AT3A 2R2PA 2ZV7A 4E20A 2WQOA 5KUPA 3ML1A 4JR3A 4MWIA 1ZWSA 4IVDA 1PXOA 3GU7A 2B1PA 2C5NA 3GCQA 3O5AA 5GINE 3EFWA 2VTHA 1P5EA 2JAVA 2J7TA 2C0OA 2VTMA 4BR3A 4IAIA 4DT9A 2IW6A 2CLQA 5L2QA 2CDZA 3ORPA 4M7IA 4A7CA 2CGUA 2V0DA 5BX0A 3U6JA 4E8AA 2HW7A 4KRCA 5JQ5A 4X3FB 2CNVA 2OZOA 2YIRA 1YDTE 4O0YA 3AD5A 5FXSA 2C6KA 2XK4A 4EHGA 5JN2A 2EB2A 4UALA 1GY3A 1XBCA 3SAYA 4O7SA 3WF9A 2C3JA 2X0PA 3VS0A 4A4XA 4YC6A 2C4GA 3VS7A 5L6PA 2V7OA 5HIEA 1L3RE 1RJBA 2C6EA 4YJQA 3VNTA 2ITUA 2PMLX 3ZOSA 3O96A 3FZ1A 4FT9A 2BVAA 5IEXA 4O1OA 4NW5A 3QQHA 4NZWB 4Z9LA 4IWPA 4R77A 5CI7A 4BDBA 3FEGA 4ZS0A 3LFSA 5M56A 4QP4A 3BLRA 4KB8A 4X2FA 5HG5A 3TV6A 3I0QA 3PVUA 3UODA 3K2LA 4BYIA 5CEPA 3LJ1A 3MVLA 3U87A 5CALA 2ESMA 4HVGA 3FLQA 3QZFA 3QHRA 3F5XA 3VUGA 4LMUA 4I22A 4HVSA 4O0TA 3W33A 3JXWA 1UU7A 3JY0A 3TTIA 5J8IA 4JG7A 2B54A 2O3PA 5CT0A 4BN1A 5FXRA 3ZLSA 3RGFA 4RVKA 1IAHA 3UVQA 4RFMA 3R7VA 3UGCA 4EK3A 4QQ5A 4DF3A 4XNEA 3CKWA 2F7ZE 5HESA 1PXIA 3MPTA 5HICA 4DAWA 2CNUA 4BB4A 2YWVA 3PFYA 4ZTHA 4EOOA 2BRHA 4PPBA 4W4YA 4F6UA 4NUSA 2NO3A 3FQSA 1YI6A 2JBOA 5HI2A 4I4FA 3F3TA 5CSHA 3D5XA 1KE9A 1H28A 4I1ZA 2VGOA 4C33A 1XH9A 2HWPA 5CNOA 4YZMA 3D4QA 3QYZA 3RBWA 3MH0A 4YU2A 3MSSA 3OWJA 4ZTSA 4AXAA 4XBRA 5CAVA 4CKJA 1H0WA 5E8TA 3M11A 5FQDC 1IASA 4AXDA 2OU7A 1LUFA 3KKVA 2GHMA 3A62A 5AP2A 3EYGA 3CS9A 3CTHA 3I81A 3SRVA 4F9BA 3MW1A 4BBEA 2ZB0A 1Z9XA 4XJ0A 4TWNA 4K6ZA 4FC0A 2JBPA 2QOIA 2W1GA 2WQBA 4YJSA 2YM8A 3CY2A 5HBJA 2UW7A 1YXSA 2YM6A 3EL8A 4LUEA 3PSCA 3C7QA 4ACDA 5JRSA 3HNGA 3R9NA 2PVKA 4WBOA 1OL5A 3FZPA 4DLJA 2PTKA 4J95A 3MH1A 4YURA 5DA3A 1IA9A 3QCSA 2WTIA 3LFDA 3TZ7A 4YNEA 4ALUA 5EYMA 5L8JA 5CF8A 1UU3A 2BRGA 2GPHA 2REIA 4IQ6A 2CN8A 2YACA 3MFSA 4RWKA 4AZWA 2E9OA 5FTGA 4X3FA 3AMYA 3QFVA 4FTTA 4I5CA 4WSYA 4ZZOA 5ANOA 4ZMEA 3TIYA 5CF4A 3FI8A 2JIUA 3BHUA 3ODZX 3SA0A 4ASDA