5LVMA

Human pdk1 kinase domain in complex with adenine bound to the atp-binding site
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
284
structure length
283
Chain Sequence
KKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Bidirectional Allosteric Communication between the ATP-Binding Site and the Regulatory PIF Pocket in PDK1 Protein Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 283
sequence length 284
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5lvmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5lvmA01
4CV9A 5EYMA 5AR7A 3LFDA 5FP5A 4R6VA 5HCXA 3VUIA 3ZCLA 3W8QA 1UKIA 2QOQA 3FXWA 3LQ5A 4TPTA 3R83A 3D7ZA 3SV0A 3DFCB 4E4XA 4AZEA 5IQHA 2OLCA 3QQGA 2VO0A 3AD5A 3AD6A 5CU2A 4BDJA 5EQYA 1P4OA 2Y4IC 4QP3A 1RDQE 4QO9A 4IB1A 4M13A 2GTMA 4YSMA 4RZWA 1ZY5A 3E3BX 2PTKA 5DT3A 4BKYA 4C4EA 4NL0A 2QOKA 3FC1X 3LXNA 1SVEA 1URWA 3K3JA 4TWNA 4FSNA 4E6DA 5FXRA 4EOMA 1Q97A 3MW1A 4X7QA 4JAIA 4GU6A 3F3ZA 3GC9A 3OS3A 4PTCA 3MN3A 3G0EA 3PYYA 4JG8A 2C3LA 2PE0A 3PIXA 4CFXA 5AFVA 1KE5A 3DY7A 3COIA 2ZV2A 1FBNA 2Z7LA 5KHXA 2C0OA 1PJKA 3FSFA 5FG8A 3NCZA 3LW0A 5EYDA 2A0CX 4BL1A 3V5TA 4RC2A 3U8WA 3WF8A 2NPQA 4BCPA 3NUSA 3QRJA 1ZMUA 4D2TA 4GUEA 3QX4A 5C01A 4J1RA 1M7QA 1ZYCA 5EW9A 4UMTA 3CJGA 3RAIA 4AUAA 4PV0A 3BQRA 3G33A 5EDPA 3E87A 3GP0A 5HD7A 4OTHA 3R8MA 4GFGA 4QMMA 5FEDA 4HPUE 2NO3A 4YZNA 2UW3A 3QQUA 4FK6A 5BMMA 4AX8A 4DGOA 4YPDA 3Q53A 5LVNA 4LMUA 3MV5A 2YLFA 4U8ZA 3OEZA 4D4VA 5BVFA 2E2BA 3JUHA 4WBBB 3KRRA 3EZRA 3OT3A 4C4FA 3TV7A 3CQEA 4WSYA 4EUTA 2JLDA 4E5AX 2PUPA 3HV6A 4WSQA 4EBWA 4OTGA 2W05A 4GEOA 3F69A 1PXPA 3CY2A 1YXSA 3KK8A 3ATSA 4D4SA 2VTRA 2PVHA 5E8TA 5K3YA 4DGGA 3PPZA 3UYTA 4M15A 5JH6A 5T6KA 4XX9A 4GJ3A 1Q4LA 1OBGA 2YWPA 4U81A 2XK4A 3QTUA 4CKIA 5DT0A 1HCLA 5M4CA 3ZLWA 2XIKA 5TOZA 4YJRA 2W17A 4PL3A 1YI4A 2JDOA 5CI7A 3GFEA 4LFIA 5CTPA 3H9OA 2FSOX 1URCA 1WFCA 4IVDA 1OB3A 3ALNA 4QMPA 4Y85A 4AE6A 5L2IA 3VUTA 3E88A 3G51A 2W1IA 4MVFA 4WD5A 1H0VA 3I7CA 5HIDA 3EYGA 4UN0C 3GI3A 2PE2A 5DE2A 3P78A 5HLNA 1ND4A 3IONA 2BDWA 1YI6A 4FZ6A 1OIRA 3RM6A 4AOTA 5EFQA 3NAXA 4QQ5A 4ZSGA 4CTCA 2W1CA 4UYAA 3I6WA 4D55A 4YZMA 2IO6A 4IADA 1V0PA 3EN9A 4KBKA 3ANRA 4RC3A 3ACKA 1YI3A 4U9AA 3RJCA 1YHVA 4CZUA 1W8CA 3FHIA 4RIOA 3WF7A 2VWZA 3FPMA 1XHAA 4FUXA 4IW0A 4LV5A 2P2IA 2B53A 5HI2A 3VN9A 2GNLA 4DITA 5FD2A 3ZFXA 4JX3A 5ANEA 3MFUA 4F09A 4HW7A 2XS0A 5JGDA 5DYJA 3L9MA 4L9IA 4YJNA 4GK4A 4YJPA 3HGKA 2ESMA 5JMSA 2ZV9A 4DBXA 4BDHA 5BNJA 1ZYDA 2Y9QA 4BKZA 4OTQA 4DFYA 2ZM3A 4EKKA 1GOLA 2A4LA 5A46A 1NT2A 3FEGA 3D83A 1VYZA 2R7BA 3EWHA 3LOKA 4MYGA 3PXFA 4NIFB 3SRVA 1VR2A 5IG1A 4XS2A 1QPEA 5GIOE 3F3VA 4GG5A 5FXQA 2R3LA 3FWQA 1P2AA 5DVRA 2J5FA 4KIOA 5E92A 4PPAA 5CEMA 4TT7A 3NEWA 3CPCA 4GYIA 4EH4A 2X6EA 2Z2WA 2CDZA 5HTBA 2VX3A 3KVXA 2WMAA 3KC3A 5L2SA 3ANQA 3WBLA 1BX6A 3CGFA 2GFCA 1H1SA 4C57A 3C1XA 4FKRA 4BYIA 4CZYB 3CD3A 5ETFA 3TACA 2EXMA 4X3JA 4NEUA 3I0QA 3ZC5A 4F9YA 2IG7A 5J87A 2BDFA 2ITYA 1Q3WA 5J7HA 3EQCA 4GT5A 3R8PA 5LQFA 4PDOA 1ZARA 2E9NA 4ZLYA 3RPVA 1Y6AA 1WBSA 2BZKB 4IWQA 4UWBA 5IH5A 1S9IA 1UKHA 4MNFA 3UVPA 3CP9A 4NCTC 4KS8A 4I5PA 4YHJA 2XM8A 3V04A 4RT7A 2BIKB 3S4QA 5HNBA 4ALWA 4ANNA 4EI4A 2QOOA 5HESA 3E62A 4UXLA 4AN9A 2R9SA 3Q6WA 4E8AA 2PU8A 4FEUA 4Q2AA 4DINA 2PY3A 3DOGA 3C4FA 4C58A 5FDPA 2JKKA 4K2RA 3BZ3A 3NYOA 3OTVA 4WG3A 4XCUA 4O0XA 1Q62A 5BQ0A 2O63A 2P55A 1PXOA 3D5WA 3PXZA 3BE2A 3GCSA 4EOJA 2X8IA 1U5RA 3RK9A 3PRIA 5AUUA 2BILB 5D11A 4XV1A 3AC1A 5AEPA 2QQ7A 3QUPA 4BWPA 2QVSE 3NPCA 4YNEA 3Q52A 2XIYA 4H1JA 2R3NA 2XA4A 4IIRA 5EI2A 3PDTA 3LE6A 3DXPA 4C3PA 3KU2A 3E64A 3EFLA 4DEDA 4AT3A 3G0FA 4IZYA 3TNQB 1QL6A 4FTLA 4RC4A 4C2VA 4D4YA 3ZZEA 5A9UA 5H9BA 5JGBA 5GHVA 1OPKA 4JG6A 4PMTA 3ZH8A 4ZZMA 2OZAA 3W33A 2CCHA 4JJRA 4KBAA 3E8NA 3OP5A 4QP4A 5CLPA 1PY5A 4FTJA 1HCKA 3CEKA 4U97A 4CFVA 3QZIA 3ENHA 2UZEA 4HOKA 3U51A 2QU5A 4I23A 1ZXEA 4TRLA 3NIEA 3KVWA 3VO3A 2YIQA 4TYHB 4LMNA 2W9ZB 5H8GA 4ERWA 3GQLA 3DK6A 2XYNA 4I0TA 2PVJA 4ACDA 4FKVA 4EWHA 2YAAA 2HXQA 4C7TA 4NCTA 1DAYA 4ZTHA 4RBLA 4DTBA 3FHRA 5KBQA 3V8SA 3D7TB 2YA9A 4AW0A 5EI6A 3W1FA 1M17A 2W4JA 5EYKA 3UP7A 3O17A 4IFGA 4IQ6A 4O81A 4PNKA 5ANOA 5BVDA 4IJ9A 2C6DA 1PW2A 2X7FA 4B99A 4EK5A 5GINE 3U6IA 5JSMA 3OCBA 4BCJA 3UOKA 4D5KA 4AG8A 1YW2A 3A8XA 4DGMA 4HZRA 1S9JA 2YDJA 4Y46A 5BYZA 3IO7A 3GCPA 4G3CA 2XNOA 5G1XA 4E3CA 5J1VA 3LLAA 3PY1A 4G5JA 5A4TA 4O0WA 2YAKA 3LFNA 1DI9A 4H3PA 4M68A 1Y57A 3JPVA 4IM3A 3COHA 4BZOA 1WBPA 3KF7A 4I5CA 2Y8OA 2WTWA 1YXVA 2XKDA 2BR1A 4RZVA 3GQIA 3T3UA 3TJDA 4MXXA 2DWBA 5E7RA 5AA9A 4ZP5A 3D5VA 3Q6UA 3C4ZA 3BKBA 5HORA 4YJVA 3F5GA 3OOGA 2REIA 4C38A 2WD1A 3R9HA 2UZBA 4JDJA 4JVGA 2C6TA 2XJ1A 2XNMA 4PRJA 2C0TA 3UG1A 4D5HA 3PZEA 5LVOA 4YLKA 3MY1A 4RLLA 2XBJA 3T3VA 4E6QA 5FM2A 2CPKE 3IOKA 2PZRA 1GIIA 3IDCA 3V5PA 5HG5A 4UV0A 3U9CA 4DFXE 3F5XA 3VHEA 4EH3A 1UU8A 5CANA 3ZMMA 3NRMA 5CF4A 4GL9A 2VNWA 3ULZA 3JR1A 4PTEA 4NKSA 1B38A 4H1MA 4L00A 4B9DA 4U43A 4U40A 4I93A 2ITTA 2WFYA 3ZM4A 4I6BA 3R1YA 3TZ9A 4I0RA 3FMLA 2CNQA 3UNZA 4ZZOA 5B2MA 3R6XA 1VZOA 5DI1A 1NVRA 4PMPA 1XH8A 5DPVA 4E20A 1PMUA 3BIZA 2CMWA 3PTGA 4YR8A 3ZXTA 2WMSA 4IACA 1JLUE 3OW4A 1YQJA 4F9WA 2BZIB 4G1WA 3H0YA 1MRYA 4ZTSA 4IDVA 4FG9A 2PVMA 4Q5EA 1XJDA 2UW5A 3ODYX 2H9VA 2YDIA 3TI1A 4F6WA 1OUYA 4YO4A 3TUBA 3Q9XA 2X9EA 3GXLA 5ANGA 4MF0A 4X21A 4C4GA 1J7UA 3UZRA 4L45A 1OPLA 4FT0A 3SG9A 5AP3A 4BZDA 5LVMA 4O7YA 4XLVA 3F2NA 3FLZA 5FDXA 4XH6A 3PA4A 4RIXB 5F4NA 4CSVA 4EH8A 3BEAA 4QYEA 4E73A 1NXKA 3F5UA 2OJ9A 3WZUA 2YIRA 4N57A 3MPTA 2OF2A 4TZRA 4C33A 4E1ZA 4YC6A 3D2KA 3IW4A 4PMSA 4EYMA 1KV1A 3MS9A 5IEVA 3PIYA 1GZKA 5EDQA 3HP5A 3VBWA 4BDDA 1XQZA 2B54A 2C6MA 3V51A 4WKQA 3QC9A 5HBJA 4FV3A 4R1YA 5LXMA 5IISA 3K3IA 4FODA 3NCGA 4L8MA 2E9VA 1NVQA 4X2KA 4A9RA 4B8MA 3Q5ZA 4JRVA 3V6RA 2X9FA 4FUYA 4FSRA 1F3MC 4C4HA 3DNDA 2ITVA 5GNKA 4IX5A 5BVKA 1OL6A 2W1FA 2Y4IB 4CCUA 5FEEA 4ANOA 3SC1A 3B8QA 3NS9A 4ASDA 3Q5IA 4ITHA 3RINA 2C5YA 2R3HA 3NGAA 2OH4A 2Y4PA 4IZ7A 4S34A 5IA5A 4M8TA 1YKRA 3A61A 3F2AA 3QTZA 2V22A 2W1EA 1VEBA 3EQIA 3NWWA 4MD9E 3ZXZA 5C8KA 4RQVA 4L01A 3A4OX 2QOCA 3VS1A 2A1AB 2W5BA 2X2KA 4EHZA 3UG2A 3KN6A 4MK0A 4Y8DA 1YWRA 5AUXA 3GCQA 3R71A 3WF9A 2UZWE 3PXRA 4DH3A 1YXXA 3PJ8A 2IVUA 3ZSGA 3O71A 4ACHA 4RMZA 1M52A 4G2FA 3FQEA 2HWPA 3TEIA 1PXJA 3C0IA 3SKCA 3BU5A 2PZPA 2YEXA 3DBFA 4CFMA 2BMCA 1REJA 4FTOA 3FY0A 1Q8YA 2ZMDA 2UW8A 1GJOA 2GPHA 3KCKA 5TE0A 3VJNA 4CYJA 1FVVA 5HBEA 4HYSA 4PPCA 4YMJA 3MDYA 3ZSHA 4EUUA 1AD5A 3FPQA 1RE8A 2IVTA 2X1NA 1PXMA 1UWHA 2FUMA 5M08A 4KKGA 3GCUA 5FRIA 5J95A 2W4KA 4FV8A 2GS6A 2FB8A 1J7IA 3CQWA 3FE3A 3I81A 3LFQA 4HCTA 3E93A 1GZOA 3DDQA 4DT9A 3N4TA 4IVAA 2I6LA 2XVDA 4I24A 2OFVA 4RX7A 3SLSA 5IA2A 4KNBA 1YVJA 1YWVA 1SNXA 2VV9A 4BCNA 4W9WA 2OG8A 3TKUA 3CTQA 2OXXA 4I22A 4M69B 4KSPA 4FIFA 3SXFA 4O7SA 5KMMA 4DLJA 3O8PA 3TL8A 5ETAA 1HOWA 4AOIA 2GU8A 3HV3A 3JS2A 4R7IA 2BFYA 4O86A 2O65A 2UZLA 3AC2A 4LRJA 5IDPA 4Y72A 3CC6A 1Q8UA 2UUEA 3BRBA 4D0XA 1OUKA 3B2WA 4EORA 2WU6A 3LXLA 3LPBA 3P0MA 3QKMA 4LGDA 3VIDA 1UWJA 1ZYLA 3A62A 3BEGA 3GOPA 3PXQA 5E8XA 5H2UA 5IA4A 4O7NA 2XIRA 3RALA 4JI9A 4CEGA 3PA5A 2YJRA 2C4GA 3CQUA 4BI1A 4EK6A 4IAFA 3PA3A 4BGQA 4IWDA 3FKLA 3QRUA 4U80A 4F0IA 4V0GB 5E90A 3WIKA 4HYUA 5JZJA 3RBWA 2VTMA 1L3RE 3TIYA 4WNOA 2YDKA 5AR3A 4EH6A 2UZUE 5HTCA 4H58A 3W2OA 4BZNA 2RIOA 2G01A 2WTJA 4S33A 4X3FC 4BBEA 4F7LA 4DH5A 3D5UA 2GQRA 3R8UA 3IQ7A 2R3PA 4QMWA 1JSVA 2PMOX 5DN3A 4LI5A 2XBAA 4AGUA 4XV3A 3FL5A 2QHMA 3FJQE 1JVPP 2PK9A 3GENA 3IK3A 2J0LA 1ZLTA 4IC7A 3M1SA 4GV1A 3UO6A 4PF4A 3TV6A 4M66A 4IAKA 4X2GA 2ZM1A 2GFSA 4L3LA 5LCKA 3SOAA 3GVUA 4PL4A 3NW5A 4EOQA 2WTKC 4BDCA 2W5AA 4YPSA 4CFUA 1QPJA 3H10A 1H01A 5L8JA 3ZLYA 4LRMA 3LMIA 1T46A 2XK8A 3VC4A 5C8NA 4DFUA 1NA7A 1PXIA 3IKAA 3ZRMA 4W4YA 3PRFA 3KK9A 4ZAUA 4IAZA 1BLXA 1UU3A 2GTNA 1TQMA 4UBAA 5JFXA 4JR3A 4BTKA 1W83A 3LCOA 5AA8A 3RNYA 3E8EA 4V01A 5L8LA 3ELJA 3NUXA 5HEZA 4RIWB 3ZZWA 1FPUA 4HGEA 3KRWA 4UWCA 4GG7A 1G8AA 3BHTA 2CLXA 4QYFA 2XUUA 2LAVA 3H9FA 4CTBA 1FMKA 3Q3BA 5AUTA 5F9EA 5IUHA 4ANLA 3AQVA 4MWIA 4FL1A 2UVYA 3NR9A 3VNTA 4QTEA 4ARKA 4JS8A 5CAPA 3DBQA 4Y83A 4S2ZA 3I6UA 2W0JA 1YDSE 2XCKA 1OZ1A 2C1AA 3P08A 4I94A 3KXXA 2C1BA 4RWKA 4PDYA 3DLSA 3IPHA 4UMQA 4G6OA 4YO6A 3P86A 4M84A 3EL7A 3GCVA 4N0SA 3W2SA 1OKVA 3MH2A 5HIEA 4DGLC 5D12A 5AUYA 5KUPA 3ZONA 1KV2A 3OW3A 3P7BA 3CIKA 4O22A 3GFWA 1W82A 4OAUC 4RJ3A 4UWYA 3EFJA 3QD4A 3AMYA 4HZSA 4ZSJA 3THBA 1SZMA 2OJGA 3JVRA 4TYHA 2OJJA 2WEIA 3NYNA 2E9UA 5KE0A 4C35A 3QUDA 4CCBA 1PRYA 1DI8A 5C4LA 4CVAA 4CXAA 4AZWA 2Z8CA 4RA4A 3VF9A 3AT4A 5DR9A 4ANSA 3VS2A 3ZUVA 2HK5A 3FAAA 3D7TA 3MVJA 5CX9A 2FYSA 3VVHA 4FVPA 4KKHA 2GS2A 2B9JA 5FTGA 2GDOA 2WTDA 3A8WA 5FBOA 5I9YA 3VS3A 4H05A 1U5QA 4XG7A 2H6DA 2R7IA 3DK7A 4BCOA 3C7QA 5GJGA 4XP0A 4ONAA 4QPSA 5I9ZA 4IX3A 5A4CA 4BY9E 2WKMA 4BCKA 4CQEA 1GNGA 3HECA 2AC5A 3MFRA 5ANKA 3D2IA 4HNFA 5L6WL 4V04A 4C36A 4ZY6A 4LL5A 5K0KA 4DFLA 5TR6A 5J9YA 3CCNA 2B52A 4W8DA 3DFAA 3RAKA 1ZY4A 2W06A 4TWCA 4GKIA 4DEHA 4RJ7A 4XLIA 1WBWA 3N51A 4AT5A 1ERKA 3HV5A 2O0UA 3HL7A 4IHPA 3HA6A 2H96A 4PUZA 3LXKA 4FL3A 3U55A 4DFZE 1U54B 4ZTQA 4FC0A 1E1VA 3MH1A 3BV2A 4P5ZA 3ORKA 2YERA 3AT2A 5M55A 4QYYA 1WBVA 4EH2A 2XB7A 3LJ2A 4H3QA 4ID7A 2WHBA 3TNIA 3D14A 2X8EA 4NUSA 3SW4A 2UV2A 3PSBA 5DRBA 3KN5A 3NNVA 4U3ZA 3MJ2A 5L6OA 3QHWA 2IZUA 1LEZA 2YLEA 3ZLXA 4BDGA 4L7FA 2DQ7X 3W2CA 2ZB0A 4YUQA 3UO5A 4HCUA 5F95A 3RGFA 2YWVA 3U54A 4A9YA 3JXWA 4W4XA 1KOBA 3A2CA 3ID6C 3G6HA 4P7EA 3M11A 5LCJA 1ATPE 2HW6A 1WZYA 3LFAA 4CFWA 1V1KA 4IAAA 4KINA 2VNYA 4QQTA 4QYHA 3POZA 3IW7A 1YDTE 3CKWA 4R7BA 5AIKA 1JQHA 4A07A 4O7RA 3RPSA 4FSUA 1P5EA 3CR0A 3ORXA 4FVRA 4OTRA 2PUUA 4I92A 4PP7A 5HQ0A 4MD8E 2I0YA 5CENA 5IEXA 5J9ZA 3S00A 5AR2A 3S3IA 1G5SA 1W84A 3EKKA 3FYKX 4QQJA 3POOA 3LCTA 3ZLSA 4MF1A 4N6YA 4O0TA 3W16A 2C0IA 4RIXA 2OH0E 4ASZA 3KULB 3FC2A 3PPJA 4C61A 4O96A 4YHTA 4U3YA 4XG2A 5AADA 3UOLA 3CS9A 5B2LA 2CNUA 3QALE 4QMOA 4Z16A 3ET7A 4I4EA 3K2LA 3FZRA 3TZMA 3P23A 3CPBA 4FGRA 4WRSA 3FMDA 3HVCA 4GMYA 2C6KA 4YNOA 2J50A 2JDRA 4I3ZA 4RFYA 1QMZA 2Q0BA 4FYOA 3KA0A 4F1TA 4YTIA 2WMXA 4DEIA 2OIBA 4GH2A 3MB6A 4I6HA 2RFNA 2IZRA 2HZ4A 4OAVB 3MBLA 3Q96A 3LVPA 4J71A 3BWFA 3MIYA 2CKPA 4BICA 4HVDA 2BRBA 2EVAA 1Y91A 2FSTX 3PSCA 4XG6A 3ORNA 4O0RA 3DZQA 3TNPC 5LWMA 4G9CA 4BHZA 4ENXA 4CT1A 2FA2A 4FOBA 4AP7A 1FQ1B 3BHHA 5E8ZA 4W4WA 3OWLA 1DAWA 2Z60A 4FR4A 4WUAA 5AAEA 3HDNA 4XG4A 4KA3A 4J8NA 4XRJA 4U44A 4G31A 1J91A 2JAVA 3PP0A 4XUFA 3MYGA 5HG8A 4DEBA 3HV4A 3OY3A 3G9LX 1PKGA 4K0YA 4QMZA 5M56A 1J3HA 4QMTA 3E3PA 1LR4A 5HVJA 4JBOA 2VTIA 3Q2MA 5E9EA 2JDSA 4OTFA 2XP2A 4TYGA 3ZO2A 4AACA 3RP9A 4C3FA 1PMEA 3I4BA 4NFNA 4A4OA 4BN1A 2JFLA 4XMOA 2QO7A 4WG4A 2YCFA 2BAQA 3UMWA 2GNHA 5AMNA 2OWBA 4ITIA 5AP5A 2ONLC 2VTNA 5J7BA 5IQBA 3UODA 2PSQA 4O91A 2KTYA 5CXZA 4CKJA 3QKLA 4O27B 3O51A 4D2VA 4HCVA 2PMLX 2EU9A 3QYWA 4IM2A 3R7OA 5IQCA 3RAWA 3EZVA 4FTCA 3PXYA 3R0TA 4BCIA 2O2UA 2QODA 4W4VA 4M3QA 2YISA 3MH3A 4XG8A 4YC8A 3T9IA 3WZKA 3PJ1A 2BHHA 4RPVA 1H0WA 4GS6A 1UU9A 2HWOA 3QQFA 4PPBA 3MA6A 3UQCA 3E8CA 3EN6A 1WVWA 2X0GA 5CVHA 4BDFA 4BYJA 4JAJA 4RX5A 4F7JA 4P90A 4FT5A 5CF5A 1BI7A 4BFMA 4FMQA 5AM7A 3N4UA 5AV3A 2VTHA 3DTCA 4XEYA 4AWIA 2UW6A 5KMLA 1JKSA 4ALUA 2OZOA 4FTNA 4EQCA 4JL9A 3Q2JA 4M69A 4U79A 4AQCA 2XIXA 3QD0A 1OKZA 3R7YA 3WYYA 4BGHA 3HMNA 4EOIA 3PXKA 5E8YA 4YJTA 3ZFYA 3NNXA 3PVBA 4DEAA 4K6ZA 4X6RA 2J51A 4J7BA 4M0ZA 4R1VA 1Q24A 3O23A 4ZSAA 4F6UA 3MSSA 1KE9A 4CG8A 3OCGA 2R3JA 3MPMA 4A7CA 4AGCA 4C0TA 3E7VA 4IB3A 3QYZA 4WA9A 2VWIA 3KGAA 4R3PA 5AAGA 3U6JA 5ANDA 2OO8X 3DJ6A 4YLLA 4YJOA 2YJSA 4PDPA 4BC6A 3FV8A 3I60A 4YTFA 4YZ9A 2QO2A 3HRCA 4V0GA 5CSVA 4DTKA 2BRGA 2XEYA 3HA8A 1JKTA 4RRVA 1KE7A 4JBQA 2ONLA 4E5WA 5DR6A 1W98A 1H26A 4L3JA 3Q04A 3KCFA 4Z7GA 2JBOA 4KAOA 3EH9A 4FEXA 4O1PA 2ETKA 2QC6A 2WNTA 3FI3A 2ZV8A 4I1ZA 4QP1A 3VAPA 5M44A 3ZM9A 4L53A 2R2PA 3LZBA 4FV5A 3CSVA 5DRDA 5D41A 2GNFA 3EQHA 4IVBA 4C34A 4XOYA 5ETIA 2JAMA 5B7VA 3P1AA 5IA0A 3AMAA 2ITXA 3R2BA 2NNWB 3OUKA 2EWAA 5HG9A 3I5NA 3MFTA 4EHVA 5KCVA 3BLHA 3GU8A 3V5LA 1PF8A 2G1TA 1UNGA 4BHNA 5HG7A 2YCQA 3CJFA 4FNWA 4MQ2A 2C6OA 2FSMX 4EH5A 1JKKA 3KKVA 1EH4A 2CN5A 3DAEA 3VUGA 2UVXA 3RM7A 2ITWA 4E4LA 5GJDA 4F0GA 3EKNA 4BDKA 3OC1A 2X7GA 2QLUA 5BVNA 4BIEA 2VX0A 4RIWA 4D2PA 3MY5A 4IC8A 5FTQA 1GY3A 5BX0A 5DFPA 4L42A 3RWQA 1OIQA 3EOCA 4AW1A 4RX9A 4AOJA 1CSNA 2BZHB 5M4IA 2XK6A 3V5JA 3FDNA 4TWOA 2IW9A 4F65A 4FKPA 3L9NA 1CM8A 1JKLA 2ITNA 2PZIA 3KXMA 4GUBA 4RX8A 5HO6A 4AA0A 3VW6A 2BALA 2IN6A 1DS5A 4HJOA 1OPJA 3BHUA 2UW7A 1B6CB 5CSHA 4EHEA 4YTHA 4X3FB 2QI8A 4JDIA 4WIHA 3QQHA 1JWHA 2P3GX 5AM6A 3C0HA 2PZ5A 3DKGA 4LOOA 4NKAA 5GIPE 4EZ5A 1U46A 2HZNA 2C68A 4F64A 1YRPA 4I21A 4O0YA 5HIBA 2XK3A 3AC4A 1Z57A 4IEBA 3LXPA 1YXTA 4A9SA 4TNDA 5DLSA 4GIIA 4RQKA 2WTKB 2ZJWA 3UNJA 2F7XE 3L9PA 2PZYA 3C51A 4CRSA 4EKLA 4ZEGA 3FZSA 4FT7A 2VTOA 4MHAA 1OM1A 4JIAA 3MIAA 4TL0A 1BUHA 1TVOA 2WTIA 4Y73A 2P2HA 4E7WA 4LGGA 3H3CA 2C6LA 3W55A 3ZTXA 4QMQA 4NM0A 1VYWA 4XBRA 4PNIA 3HAVA 4FKJA 5CEKA 4J52A 4KRDA 2VRXA 2GHGA 3JYAA 3IW6A 3RZFA 3BYMA 2J0MB 3I7BA 2XKFA 5LVLA 3G9NA 2GMXA 4DAWA 2XIZA 4JQ8A 2RG5A 4FVQA 4KRCA 4U41A 4LM5A 3R7EA 3PVWA 2YIYA 2W4OA 2O8YA 4MX9A 5HNIX 2PPQA 5KBRA 4DHFA 1Y8YA 4YJSA 3FMJA 4DFNA 4FICA 3KF4A 3RKBA 4QP2A 5HGIA 4AZVA 5K4IA 2DYLA 2ZDUA 4ANQA 5CNNA 5ITAA 3D5XA 1H27A 3TZ7A 4O82A 5KO1A 1OECA 2CGVA 2OIQA 2HENA 2Z7QA 4F1MA 3PPKA 4UYNA 4C3RA 1U54A 1ZYJA 5HE1A 5DEWA 2XKEA 2R0UA 5CU3A 2XYUA 2GNIA 4QD6A 4W9XA 3OMVA 5HD4A 2BROA 4B7TA 3E8DA 1WVYA 3OWPA 2WMRA 3QCXA 4FTTA 3EYHA 3WF5A 3FMEA 3AGMA 1PYXA 3TUDA 4R78A 4ASXA 4F99A 4FK3A 4FV4A 5CU4A 2YHVA 2BIYA 5HE2A 4O21A 3A7IA 4S30A 5AP0A 5GZ8A 4JBPA 4LRKA 4QNAA 4ALVA 5IQIA 4FV9A 1IG1A 2HCKA 5KX8A 2RFDA 3SVVA 2VTJA 2PVNA 3L9LA 4QP8A 2UZTA 1YHWA 4GFOA 3A60A 3TZ8A 4IAIA 3GBZA 2RL5A 3JY9A 4FKOA 4D2WA 4F4PA 5J9LA 4O1OA 4H39A 4L7SA 3HX4A 1XO2B 5IU2A 5A54A 4ITJA 3COKA 4M7IA 2C6IA 4Z3VA 1FGKA 5AP4A 5HZNA 4P4CA 3NYVA 4NJ3A 4I41A 1IRKA 5ETCA 4QP6A 4DG3E 1IA8A 3FQSA 3KULA 3UVQA 2HY81 3R2YA 1IAJA 4DG0E 4FEWA 4XV9A 2O5KA 4AS0A 2XNEA 3GOKA 2FVDA 3C50A 3ZU7A 3RHXA 4DBNA 4DGNA 1XH6A 4FKLA 4FTUA 3ORIA 4FIGA 3G2FA 2R3OA 2RFEA 1L8TA 2QONA 3QBNA 3D15A 5L6PA 5E8VA 2RG6A 4YJQA 3IECA 1ZZLA 5B0XA 5CEQA 2CKQA 2WTCA 5AIRA 1ZMWA 3DXNA 3R7GA 3O50A 5AP2A 5IMXA 1YOJA 3ORMA 2P33A 2RSVA 5EOLA 3QWJA 4MXAA 2ZAZA 4ZLZA 4IZ5A 4ZS0A 2PVYA 4MBLA 2CSNA 5E8UA 4F9CA 5CF8A 4CLJA 5A4QA 2HZIA 5BUJA 3SXSA 4WO5A 4CG9A 2JIUA 1OITA 3NIZA 3QCSA 1XBBA 3ZBXA 5EQPA 3T8OA 1Z9XA 3AD4A 3E7OA 4BF2A 5DOSA 2BAJA 4MXOA 1A48A 3DKOA 3SX9A 1H25A 4YZBA 2BRMA 1P4FA 1LP4A 2UZVA 1PKDA 3ZYAA 5C8MA 2WOUA 3HRBA 4LV8A 4MD7E 3EQPA 2Z7SA 1K2PA 2XKCA 4OTDA 1FINA 4FG8A 3BYVA 3F5PA 3EQBA 4UEUA 3HUCA 4Y5HA 2W99B 4PMMA 4UY9A 5JKGA 3FMNA 3KMMA 3WF6A 4AXAA 2OICA 3WYXA 3R01A 5I9UA 3BHYA 1P14A 3HLLA 3ITZA 2YN8A 4BDBA 5AUZA 4DE4A 4F6SA 3IS5A 3SD0A 3RK5A 3OUNB 4CMTA 2BKKA 5HLPA 4L44A 5JRQA 3NVMB 3TCPA 2C3KA 3AC5A 3QU0A 4MNEB 4O0UA 2NRYA 1YXUA 1Y6BA 2HOGA 3C5IA 1E9HA 4A4XA 2OGVA 4FTAA 5E8SA 1RQQA 4ERKA 4ZJJA 4E93A 2C5XA 4U42A 4YLJA 3RCDA 5C4KA 4IFCA 5M4UA 4P2KA 2CKOA 2I7QA 4FNZA 5H8BA 2OIDA 5JFSA 3VBTA 3E5AA 4BBMA 4WT6A 4F0FA 3ZBFA 2JDTA 3SW7A 3C5UA 4XHKB 3R8VA 3RMFA 2WMUA 3QTWA 5DH3A 2OJIA 3QZFA 3Q4TA 2RKUA 3PSDA 3AGLA 4OBQA 4Z7HA 2J6MA 2OKRA 4DTAA 4EOPA 5LMBA 4TNBA 4GVJA 4EH9A 3HEGA 4UZDA 5TKDA 2FO0A 3QZHA 4M14A 3H4JA 4NWMA 4DEEA 3A7GA 1JNKA 5DNRA 4EJNA 4DCEA 3GU4A 4FNYA 3CTJA 2XZSA 3DJ5A 1UA2A 2WIPA 2YM5A 3IDBA 2XK9A 2RGPA 3DGKA 3LFEA 3PIZA 3F61A 4QTAA 2F57A 2G2FA 2GS7A 4YBJA 2HZ0A 3PWDA 3RPOA 4QMLA 3U4WA 1QPCA 5CWZA 4FT3A 2VWUA 2F2UA 2VWVA 3FMMA 3OFMA 3NDMA 4YC3A 4H3BA 4IM0A 4MEDA 1Q8ZA 3LJ0A 4GVAA 4JIKA 3LKMA 3BBTB 4BWXA 1G8SA 5GJFA 3G6GA 3TKHA 3L8XA 1H1RA 4NTSA 4BR3A 4C02A 4D28A 4EK8A 3OY1A 1F5QA 4YGAA 3UVRA 4V05A 2F4JA 4FZFB 5H8EA 2UW0A 4G6NA 4APCA 4D1XA 3RI1A 4IWPA 4QT1A 3LMHA 3IGOA 5IDNA 3MTFA 3VBQA 4BB4A 4WNKA 2F9GA 5H3QA 3MI9A 3QL8A 4FSWA 3ZOSA 1ZOHA 3V01A 4OTWA 4ZY4A 4Z9LA 3P7CA 4DA5A 3UPZA 3OD6X 3NUUA 3A7FA 2A2AA 3K5VA 3WE4A 1TKIA 2EXCX 2V7AA 1OL2A 3KFAA 4QMUA 4AW5A 2PVKA 4FEQA 4ZK5A 4EZ7A 3QGWA 4E4MA 5HBHA 2WQEA 4G17A 4UZHA 2OF4A 4I0SA 4FTRA 3ETAA 2PYWA 4AE9A 1O9UA 2V7OA 3LAUA 2XMYA 2EXEA 3QX2A 5D9HA 4E6CA 4FSMA 3F3UA 1UNLA 4QMSA 3WILA 1R1WA 5HLWA 3BU3A 2E9PA 3P79A 3QCYA 3UYSA 1PXNA 2VWYA 2X7OA 1XH7A 4QQCA 5HX8A 5KMJA 3R73A 5FTOA 4IBMA 3ULIA 1APME 2C6EA 4GW8A 3QQLA 3W2QA 3C4WA 2F7EE 5AAFA 1PMVA 1RJBA 3R1QA 4FKTA 4CQGA 3PE2A 3CE3A 1MUOA 1R0PA 1J7LA 4USDA 2H8HA 4FIJA 3DKCA 2B4SB 4WG5A 1JOWB 2XRUA 2I0HA 2QLQA 2X4ZA 5EHLA 5A3XA 4C62A 4EH7A 3IGGA 1O6YA 3OTUA 5BUIA 4EL9A 4K8AA 1ZMVA 4UX9A 5AUVA 1H4LA 5D7VA 1YDRE 2ITUA 3EQFA 5I4NA 4Y5QA 3QQJA 3GGFA 3QWKA 2X2LA 3NUAA 5FLFA 4GKHA 1PYEA 2G2IA 1XH4A 2J7TA 3G5DA 4X3FA 4CMOA 5KHWA 2QOLA 3SGCA 5ICPA 3TM0A 5IA1A 3KL8A 2W9FB 2PMNX 5I9VA 4XYFA 1ZOGA 2WELA 3FL4A 3UP2A 3WZDA 4II5A 2BUJA 3UPXA 2VZ6A 2OW3A 5ACBC 4U0IA 3F6XA 2ZMCA 5FP6A 3VQUA 4WNMA 1WBOA 2VO3A 1JAMA 2B7AA 4ZTNA 3AT3A 5G6VA 1OI9A 3REPA 5K0XA 2XJ0A 5CAVA 3ZO4A 4AW2A 4DCAA 5HTIA 3V5QA 3NSZA 4B6LA 5DHJA 5EHYA 2IWIA 2R3GA 4TYEA 4G34A 4ZOGA 5M4FA 3C9WA 2CCIA 2UW9A 2Z7RA 5IUIA 2OFUA 3E63A 3QXPA 3BYSA 1F0QA 3R63A 3BV3A 4DC2A 4QMVA 1MQ4A 3WOWA 1M7NA 3HMOA 1WMKA 2VD5A 4ZMFA 3LFFA 2BPMA 3Q4CA 4GRBA 4WOVA 5CI6A 4C37A 4YSJA 3QAME 5GZ9A 4QOXA 3W2PA 4DH7A 2VN9A 3BWJA 4GFMA 2X8DA 2G15A 4OBOA 1H28A 3F7WA 3V8WA 3GT8A 3ZO3A 3KRJA 5I5ZA 1SYKA 4TW9A 4FE2A 5M07A 3OWJA 3F82A 5JQ8A 2C5NA 2OXDA 3FLYA 2ITOA 5IF1A 4O83A 3TKIA 4D9TA 3DQXA 1Q3DA 3DV3A 5EH0A 5C9CA 2CHLA 3AC3A 3UIBA 3C13A 3MESA 3WARA 4UMRA 4ZSEA 4B0GA 3NAYA 3O0GA 3BI6A 3OG7A 4NW6A 3DT1A 4B4LA 5IZFA 2W5HA 1R3CA 2XK7A 3SHEA 2R0IA 2QURA 4FSTA 4ENYA 4HVGA 4GT3A 3DAJA 5M09A 2C3IB 2BZJA 4FV0A 3FZOA 4MCVA 5M57A 2QCSA 2I0VA 1M2RA 4HNIA 5HCYA 5I3RA 2YFXA 4I5HA 2I0EA 3RK7A 4D4RA 4Q5HA 5CEPA 2DS1A 4JDHA 2ACXA 2BRHA 3CKXA 5AV4A 2PULA 3FMKA 4HYHA 2IVVA 4LL0A 4NW5A 3UIUA 3V8TA 4EQMA 2GQGA 4O7ZA 3DA6A 4N4SA 4GJ2A 3O8TA 3HRFA 5D7AA 4A4LA 5LVPA 3VBYA 4NM3A 4EBVA 5JQ5A 2J0IA 2HELA 3DB6A 4QPMA 4BTMA 4CZTA 5BUEA 4HVHA 5K9IA 1K3AA 2QG7A 2UZNA 3GU6A 2DUVA 3P7AA 3OXIA 3FI2A 5KNJA 4NK9A 3TG1A 4CRLA 3DQWA 5JFWA 3R7IA 2HXLA 2QR8A 4JLCA 2HY0A 2R64A 3II5A 3L1SA 4MXCA 3QXOA 5A4LA 3UMXA 3KXZA 3ZRLA 5IPJA 4KB8A 1BL7A 4FT9A 5M51A 4IDTA 3PJ2A 3MVMA 4HVIA 5E8WA 4AT4A 4IWOA 3DZOA 3QTIA 3NZ0A 1JBPE 4I20A 3R9DA 1WAKA 1IASA 3TNWA 3KEXA 3L8PA 4RIYB 2YCSA 5DG5A 3W32A 1SMHA 1X8BA 4TKSA 3VBVA 4AA5A 4ANMA 3VHKA 1TQPA 3ZEPA 3FQHA 3OOMA 4FZ7A 2JIIA 5KMKA 1GIJA 3CXWA 4JXFA 1OVEA 3LIJA 3MY0A 4KIKB 3NYXA 4F70A 3DLZA 4R5YA 5ACKA 4APPA 1OMWA 3D4QA 5C1QB 1U59A 2UZOA 3EN5A 4TYIA 4A9TA 3NLBA 2XNGA 3UIXA 4GYGA 4K11A 4FV2A 1BL6A 3W2RA 3ZFMA 4C4JA 4EWQA 4ZY5A 2PHKA 2R4BA 5EKOA 4IMYA 4AZTA 4YURA 4FTIA 4ZS4A 3Q9WA 5IA3A 2YIXA 4J95A 3BX5A 3R7UA 4ACCA 5CALA 4QMNA 3R00A 5T3QA 2WOTA 2AC3A 5M06A 2BKZA 3ALOA 5AP1A 3DBCA 3PVGA 5IMEA 3ZDUA 5K5NA 4FG7A 2QG5A 3E92A 4D9UA 1QPDA 2OJFE 2B9HA 2VTAA 4IB0A 4HPTE 4IAYA 4K9YA 5F20A 5CZIA 2OI4X 5CS6A 4AN3A 4E26A 4CLIA 3MFSA 4NYEA 4S31A 5BVOA 3BLQA 5TT7A 2FGIA 5JGAA 3D94A 3RTPA 2G2HA 2X6DA 5CF6A 4EHGA 2YM4A 4WBOA 3NMUF 1JSUA 3QLFA 2XNNA 4YZDA 5HICA 3OBGA 3M2WA 3R22A 3KRXA 2J2IB 3QF9A 1BI8A 1K9AA 3QRTA 1AQ1A 3D9VA 3HP2A 4XP2A 4ORKA 2WQBA 4G9RA 3QD3A 3BBWA 1ZOEA 4OT5A 3ORLA 4ACMA 4OBPA 4L67A 4QTDA 1B39A 4JQEA 3JY0A 2ZVAA 3TDVA 5IKWA 3DCVA 2JITA 4XJ0A 5AV0A 3GB2A 5KMIA 4RJ8A 5HX6A 3EJ1A 4KBCA 5DBXA 3FXZA 5C27A 2BTSA 4TXCA 3BYOA 5DWRA 3DXQA 1OKYA 4TN6A 4O2ZA 3Q4UA 4C8BA 2HAKA 4XRLA 3ROYA 5EQEA 3EN4A 3V5WA 4EEVA 3U9NA 5F94A 4BI2A 3C0GA 5CSWA 5EM5A 4KD1A 3H30A 4MNEA 3VS5A 4GK2A 3R8ZA 3DU8A 4JT3A 1PHKA 4AA4A 5IQFA 1M2PA 3MWUA 4BDEA 5LMKC 2PUIA 4EOOA 2JKQA 4BDAA 3QTSA 1OKWA 3QFVA 3QUEA 1ZRZA 1SVGA 5F1ZA 1XBCA 3TTJA 3BCEA 3VRYA 3P9JA 2WU7A 4JR7A 5GZAA 1ZYSA 2JC6A 4X6QC 5L2TA 3EHAA 5KKRC 4D2RA 3WI6A 1SNUA 3HZTA 2GNJA 4U6RA 5CAQA 3QC4A 3S1HA 3SQQA 4MWHA 3OCTA 4U45A 3RPYA 2W1DA 4FSQA 5AV1A 4RWJA 1VJYA 4CKRA 3LCSA 4ZMEA 4X2JA 1KWPA 4R8QA 4RWLA 2C47A 3OZ6A 3SG8A 3Q9YA 3FLWA 1FGIA 3NNUA 1KOAA 3VRZA 5BVEA 2VWWA 4OT6A 5E1SA 1M2QA 4AFEA 4C2WA 4CGAA 1ZZ2A 1TQIA 2HIWA 3LM0A 4RJ5A 4FSZA 4WRGA 1XBAA 3MJ1A 4U7ZA 3TTIA 4ANBA 5L2WA 3TJCA 3UE4A 2WQOA 1OL7A 4OLIA 1NY3A 4EK4A 3LQ3A 3VUKA 4YTCA 5EM6A 4ZTMA 5C03A 3DDPA 2BRNA 4RG0A 5T68A 4LYNA 4FIEA 4TY1A 4IB5A 3PWYA 5DA3A 3IDPA 3TIZA 4D1ZA 3N4VA 2OXYA 2A19B 2XNBA 4OTIA 2E9OA 3IW8A 3TNHA 2HYYA 2ERZE 3ENMA 4OW8A 3ZDIA 4BIBA 4FKSA 3DBEA 4M67A 4BI0A 4PL5A 4QMYA 4IE9A 1ZAOA 3QD2B 4KABA 5HU9A 2VTQA 3QTRA 5LMKA 1J1CA 4FKIA 3O7LB 3HMMA 3NW6A 2QD9A 4M0YA 5JRSA 5IH6A 4O7LA 2IZTA 2R3MA 2BTRA 4G16A 4FBXA 5HCZA 5CT0A 4BCGA 3KMWA 1H1WA 2VUWA 4H36A 5FGKA 3CD8A 4MXYA 3Q9ZA 4ZJIA 4OGRA 3FBVA 5IQAA 4BVUA 3LJ1A 2BHEA 5EDRA 3WE8A 2C5OA 4E4NA 3UGCA 3BHVA 3MPAA 3CGOA 4TTHB 5FBNC 4PDSA 3SDJA 4X2FA 5IQGA 3LFBA 1LUFA 1KE8A 2H34A 2AYPA 3EL8A 4M97A 4EOSA 2WQMA 5KMNA 3UQFA 4RFMA 4RSSA 2XH5A 4L6QA 4AU8A 4PX6A 3TV4A 5FEQA 5EW8A 4EOKA 2QKRA 4F63A 4AAAA 1UV5A 1Q8WA 3AMBA 4Q9ZA 3UZTA 4XBUA 1YOMA 4CNHA 2JIVA 4KIPA 4UMPA 5EOBA 5L4QA 3EFWA 3WZJA 3GC8A 2VTTA 3FKOA 1H1QA 3FKNA 4QYGA 3P5KA 4R3CA 2GHLA 3LMGA 4J53A 5CY3A 4OUCA 1H00A 2IW6A 3A4PA 3GC7A 4KSQA 1NVSA 2EUFB 4AZSA 3F2RA 5EG3A 2SRCA 2Y7JA 1PXLA 4HGSA 5CYIA 4LQMA 3DBDA 4PTGA 3R7VA 3OXZA 3VWAA 4CV8A 4RLKA 3C4CA 3KRLA 3F66A 4FTMA 2WZJA 1AGWA 2EB3A 4I6FA 3ZO1A 5CSPA 3ORTA 4TYJA 1RW8A 4IX4A 3L8SA 3ZHPC 4F08A 3S0OA 3W8LA 5AP6A 4QP7A 2CN8A 4MXZA 4NFMA 4X2NA 5HO8A 3UJGA 2J4ZA 4ZTLA 4FKGA 5KMOA 5AUWA 4HGLA 4NU1A 4USFA 2XRWA 3W18A 1UNHA 3OROA 4DH8A 1MQBA 2QHNA 2QOBA 2XEZA 4KKEA 3EFKA 3LLTA 4QPAA 1W0XC 4CT2A 2WAJA 5CNOA 5FUTA 1W7HA 4GSBA 4KWPA 3BQCA 3FYJX 2CGXA 3PLSA 4RJ6A 3QTXA 5L2QA 1O6KA 4R3RA 5AR8A 4FYNA 4RVMA 4X0MA 3OXTA 2YM8A 5J8IA 3U4UA 3FZPA 2GCDA 2A27A 2ITZA 2JDVA 4CD0A 5J5TA 1MP8A 3RZBA 1H1PA 4G3EA 4GU9A 5HHWA 1IR3A 4NT4A 2X39A 1WBNA 2YM3A 4USEA 3R02A 3KREA 4LUDA 3DNEA 3OCSA 4LOPA 3KXGA 3DS6A 4FF8A 3M42A 2XM9A 3COMA 3MB7A 3PJCA 2VWBA 3I0OA 1H8FA 4FTKA 2IZSA 3OT8A 5CXHA 4F7SA 4R77A 4GT4A 4BCQA 3Q32A 3BGQA 3PG3A 2VAGA 5EYCA 3MVHA 3KB7A 3AC8A 3UOJA 2NRUA 4KIQA 3VS6A 3PY3A 1H07A 3F88A 3WZEA 3EN7A 2R3QA 4I6QA 1NW1A 1R39A 2WO6A 3LFCA 3W10A 2C69A 1YWNA 3FY2A 3QZGA 4L43A 4XOZA 5E91A 1XH5A 3ZC6A 4EOLA 2OBJA 4F9BA 3QQKA 2WTVA 5M53A 2W1HA 4KS7A 3KY2A 1I09A 3VQHA 5AJQA 1Z5MA 1BMKA 3NUYA 1OIUA 1V0BA 3L8VA 2ITQA 2W1ZA 4O2PA 5I3OA 5EHOA 5CAUA 1J1BA 2WXVA 4FIIA 3F9NA 3MH0A 2QU6A 4EC9A 3A99A 1GZ8A 4O7VA 2VTSA 2JEDA 2NP8A 3BLRA 2ZYBA 3A7JA 4CFNA 4UMUA 2JKMA 2X4FA 3C4EA 1FVRA 3R30A 1G3NA 2WMWA 5CAOA 1BYGA 4N70A 3U87A 2QOFA 3DJ7A 5A6NA 4HGTA 4M12A 4ZSLA 3K54A 1CKIA 3QCQA 2J90A 4K33A 3TWJA 4EYJA 3HKOA 4O6LA 2VTLA 5EI8A 4GIHA 4BDIA 2EB2A 5ANJA 3WIGA 4RVKA 4EC8A 2VO7A 3OBJA 2VO6A 4L52A 4E5BA 3AG9A 4ZJVA 3NUNA 4YHFA 4JOAA 2CGUA 2YZLA 5CVFA 1H24A 2KULA 3HUBA 4XNEA 5BVWA 5J5SA 4MAOA 5L3AA 4JBVA 4D0WA 3VUHA 4JRNA 4NZWB 5HVKA 1KE6A 4NJDA 5JK3A 1U4DA 4AFJA 1OIYA 3DB8A 4BGGA 2QR7A 2R3FA 2W7XA 3GU7A 3R04A 5IQDA 4RIYA 1XH9A 4G3GA 4S32A 4I4FA 5EW3A 4FGBA 1Q41A 3ACJA 3VS7A 4YZCA 5EM7A 1FVTA 4GK3A 3UTOA 2B0QA 2IW8A 4PQNA 4KIKA 2B1PA 3HAMA 1QCFA 3H9RA 4C59A 4RWIA 3DTWA 3EMGA 5HNGA 4PY1A 4QRCA 3S95A 3ZEWA 1MRUA 2ERKA 3ZSIA 2V62A 5K5XA 4Y95A 5BMSA 5CQWA 2GSFA 4FI1A 3UNKA 3UQGA 5AWMA 3BU6A 4FKUA 2R3RA 5AX3A 3BELA 4G5PA 3V6SA 2JD5A 4ZZNA 3HNGA 3ZUTA 2R3IA 4UALA 5D1JA 1JSTA 3MA3A 3MGYA 3MVLA 2F2CB 2C5VA 3KMUA 5DMZA 4EONA 5CVGA 5DEYA 4PWNA 3VS0A 3ORZA 5E4HA 2IVSA 3FZ1A 4CMUA 2JKOA 3I1AA 5CASA 5FM3A 1I44A 3OHTA 4IZAA 5AP7A 4YU2A 5FWKK 4K77A 1UU7A 5DGZA 1PMNA 2J0JA 3VJOA 2J0KA 1JPAA 4DN5A 5DIAA 2AUHA 2BFXA 2GQSA 4RA5A 3RCJA 1OL1A 4FEVA 2WIHA 3LQ8A 4E6AA 1A9UA 2YZAA 3UC3A 2F7ZE 2OSCA 1REKA 2FSLX 2JBPA 4BWKA 3FUPA 4EQUA 4BRXA 3PVUA 3EQGA 2VGOA 4JNWA 4JDKA 1CKPA 2PMIA 3R1NA 4NH1A 3ORPA 4NM5A 5CU6A 3TT0A 3VS4A 2W1GA 2G9XA 3UC4A 4ACGA 4AN2A 3EIDA 4IX6A 4I5MA 4XP3A 5HOAA 5BYYA 2RFSA 5BPYA 3UDBA 4IH8A 2IJMA 4UXQA 3O2MA 3TN8A 2WQNA 5CSXA 2CLQA 2PWLA 3NW7A 2ZV7A 3KXNA 4HYIA 1Q8TA 4KUJA 5DT4A 4K18A 3CLYA 2PUNA 4DG2E 4IVCA 3PE1A 4F9AA 3HV7A 1M14A 1LPUA 3F3TA 3A7HA 4O0VA 1WVXA 3SAYA 5A14A 3VW8A 1XWSA 4FV1A 5I9XA 5A6OA 5IEYA 3CTHA 5LJJA 2Z02A 2C3JA 3GUBA 4J99A 3ZRKA 2V0DA 2CNVA 2ETMA 3DKFA 3TDWA 3OWKA 4RVLA 5LWNA 3R21A 2I40A 4MBJA 3ZS5A 5LOHA 2QOHA 2O64A 1CMKE 2ZOQA 5AR5A 4CFFA 5JT2A 3QA8A 3SRVB 3BPRA 2WMTA 4QTCA 2GNGA 2Q0NA 2J5EA 3FI8A 3CY3A 1GIHA 2CJMA 3PFQA 2BCJA 3T9TA 3SA0A 4LG4A 4IANA 2WMVA 3F3WA 1KSWA 5TO8A 4BKJA 3JVSA 4IXPA 4O7TA 4FZDB 5I9WA 5IQEA 5CU0A 3PJ3A 4O6EA 1CDKA 4FV6A 1YOLA 3NNWA 1GZNA 2R3KA 3FI4A 2F49A 3FZTA 3HYHA 4NIFA 3C4XA 4NTTA 4C4IA 5IH4A 5BYLA 1SVHA 4G6LA 3AOXA 3H0ZA 4FOCA 2XNPA 4FL2A 4F1OA 4RGJA 3IOPA 3O96A 2XF0A 3FLSA 1H08A 3QRKA 4EK3A 4YBKA 4ZLOA 2V5QA 4D1SA 3F7ZA 2WMBA 5HE3A 3B8RA 1WBTA 1IA9A 4A9UA 2Y6OA 2ZM4A 1KUTA 1Q61A 4F7NA 1V0OA 1XR1A 5EKNA 1SM2A 2CGWA 2VX1A 4B8LA 5CEOA 3Q60A 4Q9SA 5KKRB 2PVRA 2YITA 3EB0A 3IW5A 3OEFX 4NM7A 3GC0A 5CZHA 3R8LA 5E1EA 2VU3A 3KQ7A 5A4EA 3TUCA 4DH1A 2WPAA 3HDMA 3QGYA 4O84A 1A06A 1GAGA 3PY0A 4G3FA 4MQ1A 3NX8A 2Y6MA 4DF3A 2Q83A 3O7LD 3AXWA 4WUNA 1Q5KA 1Q99A 5FXSA 1FOTA 5HVYA 4FA2A 3FXXA 3S2PA 1OBDA 2WGJA 4YJUA 4FZAB 4LOQA 3V3VA 1O6LA 4DEGA 3HMPA 3D0EA 4DLIA 4XV2A 5JZNA 5B2KA 3R9OA 4LGHA 5TF9A 3VUDA 4R5SA 4QTBA 5ANIA 5JEBA 2XJ2A 1YHSA 3FLNC 4BCMA 3DPKA 3I79A 3NUPA 4QNYA 2YM6A 3P4KA 3VULA 4FSYA 4R7HA 5FQDC 4FNXA 2CKEA 2YIWA 4CYIA 5CEIA 4QMXA 4BTJA 4P5QA 4U5JA 2UW4A 3FLQA 1T45A 4EZ3A 4W8EA 4K1BA 5C26A 4D58A 1MRVA 1Y8GA 1DM2A 2O3PA 3G15A 3R9RA 4LUEA 4O7WA 2YM7A 2UZDA 4ASEA 5L8KA 4YP8A 2X2MA 2ETRA 3OVVA 4MKCA 2YCRA 2VGPA 2Y0AA 2V55A 3PZHA 4O0SA 4ZXTA 3VF8A 3PP1A 4RVTA 5I0BA 4A06A 3KXHA 3GEQA 3PG1A 3QTQA 2B9IA 2OZAB 2BDJA 5KZ0A 3Q4ZA 1R78A 3QKKA 3LFSA 4AGWA 2WEVA 3UOHA 4BCFA 4FKQA 4AF3A 3N9XA 5KZIA 1ZWSA 4RFZA 4ZTRA 1OL5A 1STCE 2BAKA 3DAKA 4WHZA 4JG7A 3UBDA 3UIMA 5J79A 3ATTA 3QLGA 2RF9A 5EM8A 1CKJA 2JGZA 2PVLA 4J98A 4RJ4A 4HVSA 4BTFA 3QRIA 2XCHA 3ODZX 2QNJA 4FTQA 5HKMA 4L46A 1BKXA 3PUPA 2IPXA 1UVRA 3R1SA 5CQUA 4ZIMA 2LGCA 3EQDA 3GU5A 2PVFA 5HO7A 1CTPE 4BIDA 3BYUA 2QKWB 2QO9A 2YACA 3G90X 4FIHA 4WNPA 2B9FA 2OU7A 3BGPA 3VUMA 3I5ZA 2J9MA 4MTAA 5EK7A 1IEPA 1WCCA 4TWPA 2P0CA 3LCKA 3O8UA 1XKKA 5AV2A 3DK3A 4JQ7A 4AZFA 5K4JA 3ZUUA 4OTPA 5JFVA 4DFBA 3QA0A 2VWXA 2WB8A 4L68A 1LEWA 3OF0A 4XG3A 2ZB1A 1FMOE 3IG7A 3GNIB 4BBFA 2C30A 3U6HA 3MTLA 2QOIA 5J1WA 4DYMA 3RAHA 2WMQA 2FH9A 4D2SA 3LHJA 2ZDTA 5HE0A 3UZPA 3FSKA 4L3PA 3TXOA 4Z55A 3CBLA 3RPRA 2PL0A 3BE9A 3ERKA 4MBIA 2W96B 1E1XA 4J96A 4N6ZA 3RHKA 1PXKA 3EQRA 2JFMA 3RVGA 3UO4A 4O38A 3NVKI 2PE1A 3BGZA 4XG9A 5LMAA 3RNIA 4AGDA 2GHMA 2VTPA 3FMHA 4IJPA 4FV7A 2OK1A 1IAHA 4DT8A 1R0EA 3VBXA 2I1MA 2P4IA 4J8MA 4UB7A 5DR2A 3R9NA 3RWPA 5JN2A 3ROCA 1OGUA 5LARA 3PLAE 3R28A 5IUGA 3LCDA 3QHRA 5AR4A 5AX9A 4GCJA 5D10A 4J97A 5HU3A 4FX3A 2B55A 4NSTA 3SXRA 3B2TA 3LM5A 4G3DA 2X81A 2ITPA 4FKWA 4QP9A 2UVZA 2BVAA 2YABA 3HMIA 3K5UA 2R5TA 4EJ7A 2HW7A 4MH7A 4BCHA 4PP9A 5CT7A 3SOCA 4OR5A 4JX7A
chains in the Genus database with same CATH superfamily
4CV9A 5EYMA 5AR7A 3LFDA 5FP5A 4R6VA 5HCXA 3VUIA 3ZCLA 3W8QA 1UKIA 2QOQA 3FXWA 3LQ5A 4TPTA 3R83A 2XALA 3D7ZA 3SV0A 3DFCB 4E4XA 4AZEA 5IQHA 2OLCA 3QQGA 2VO0A 3AD5A 3AD6A 5CU2A 4BDJA 5EQYA 1P4OA 2Y4IC 4QP3A 1RDQE 4QO9A 4AQKA 4IB1A 4M13A 2GTMA 4YSMA 4RZWA 1ZY5A 3E3BX 2PTKA 5DT3A 4BKYA 4C4EA 4NL0A 2QOKA 3FC1X 3LXNA 1SVEA 1URWA 3K3JA 4TWNA 4FSNA 4E6DA 5FXRA 4EOMA 1Q97A 3MW1A 4X7QA 4JAIA 4GU6A 3F3ZA 3GC9A 3OS3A 4PTCA 3MN3A 3G0EA 3PYYA 4JG8A 2C3LA 2PE0A 3PIXA 4CFXA 5AFVA 1KE5A 3DY7A 3COIA 2ZV2A 1FBNA 2Z7LA 5KHXA 2C0OA 1PJKA 3FSFA 5FG8A 3TYKA 3NCZA 3LW0A 4O4DA 2A0CX 5EYDA 4BL1A 3V5TA 4RC2A 3U8WA 3WF8A 2NPQA 4BCPA 3NUSA 3QRJA 1ZMUA 4D2TA 4GUEA 3QX4A 5C01A 4J1RA 1M7QA 3W0MA 1ZYCA 5EW9A 4UMTA 3CJGA 3RAIA 4AUAA 4PV0A 3BQRA 3G33A 5EDPA 3E87A 3GP0A 5HD7A 4OTHA 3R8MA 4GFGA 4QMMA 5FEDA 4HPUE 2NO3A 4YZNA 2UW3A 3QQUA 4FK6A 5BMMA 4AX8A 4DGOA 4YPDA 3Q53A 5LVNA 4LMUA 3MV5A 2YLFA 4U8ZA 3OEZA 4D4VA 5BVFA 2E2BA 3JUHA 4WBBB 3KRRA 3EZRA 3OT3A 4C4FA 3TV7A 3CQEA 4WSYA 4EUTA 2JLDA 4E5AX 2PUPA 3HV6A 4WSQA 4EBWA 4OTGA 2W05A 4GEOA 3F69A 1PXPA 3CY2A 1YXSA 3KK8A 3ATSA 4D4SA 2VTRA 2PVHA 5E8TA 5K3YA 4DGGA 3PPZA 3UYTA 4M15A 5JH6A 5T6KA 4XX9A 4GJ3A 1Q4LA 1OBGA 2YWPA 4U81A 2XK4A 3QTUA 4CKIA 5DT0A 1HCLA 5M4CA 3ZLWA 2XIKA 5TOZA 4YJRA 2W17A 2XANA 4PL3A 1YI4A 2JDOA 5CI7A 3GFEA 4LFIA 5CTPA 3H9OA 2FSOX 1URCA 1WFCA 4IVDA 1OB3A 3ALNA 4QMPA 4Y85A 4AE6A 5L2IA 3VUTA 3E88A 3G51A 2W1IA 4MVFA 4WD5A 1H0VA 3I7CA 5HIDA 3EYGA 4UN0C 3GI3A 2PE2A 5DE2A 3P78A 5HLNA 1ND4A 3IONA 2BDWA 1YI6A 4FZ6A 1OIRA 3RM6A 4AOTA 5EFQA 3NAXA 4QQ5A 4ZSGA 4CTCA 2W1CA 4UYAA 3I6WA 4D55A 4YZMA 2IO6A 4IADA 1V0PA 3EN9A 4KBKA 3ANRA 4RC3A 3TMOA 3ACKA 1YI3A 4U9AA 3RJCA 1YHVA 4CZUA 1W8CA 3FHIA 4RIOA 3WF7A 2VWZA 3FPMA 1XHAA 4FUXA 4IW0A 4LV5A 2P2IA 2B53A 5HI2A 3VN9A 2GNLA 4DITA 5FD2A 3ZFXA 4JX3A 5ANEA 3MFUA 4F09A 4HW7A 2XS0A 5JGDA 5DYJA 3L9MA 4L9IA 4YJNA 4GK4A 4YJPA 3HGKA 2ESMA 5JMSA 2ZV9A 4DBXA 4BDHA 5BNJA 1ZYDA 2Y9QA 4BKZA 4OTQA 4DFYA 2ZM3A 4EKKA 1GOLA 2A4LA 5A46A 1NT2A 3FEGA 3D83A 1VYZA 2R7BA 3EWHA 3LOKA 4MYGA 3PXFA 4NIFB 3SRVA 1VR2A 5IG1A 4XS2A 1QPEA 5GIOE 3F3VA 4GG5A 5FXQA 2R3LA 3FWQA 1P2AA 5DVRA 2J5FA 4KIOA 5E92A 4PPAA 5CEMA 4TT7A 3NEWA 3CPCA 4GYIA 4EH4A 4LDTA 4DHJA 2X6EA 2Z2WA 2CDZA 5HTBA 2VX3A 3KVXA 2WMAA 3KC3A 5L2SA 3ANQA 3WBLA 1BX6A 3CGFA 2GFCA 1H1SA 4C57A 3C1XA 4FKRA 4BYIA 4CZYB 3CD3A 5ETFA 3TACA 2EXMA 4X3JA 4NEUA 3I0QA 3ZC5A 4F9YA 2IG7A 5J87A 2BDFA 2ITYA 1Q3WA 5J7HA 3EQCA 4GT5A 3R8PA 5LQFA 4PDOA 1ZARA 2E9NA 4ZLYA 3RPVA 1Y6AA 1WBSA 2BZKB 4IWQA 4UWBA 5IH5A 1S9IA 1UKHA 4MNFA 3UVPA 3CP9A 4NCTC 4KS8A 4I5PA 4YHJA 2XM8A 3V04A 4RT7A 2BIKB 3S4QA 5HNBA 4ALWA 4ANNA 4EI4A 2QOOA 5HESA 3E62A 4UXLA 4AN9A 2R9SA 3Q6WA 4E8AA 2PU8A 4FEUA 4Q2AA 4DINA 2PY3A 3DOGA 3C4FA 4C58A 5FDPA 2JKKA 4K2RA 3BZ3A 3NYOA 3OTVA 4WG3A 4XCUA 4O0XA 1Q62A 5BQ0A 2O63A 2P55A 1PXOA 3D5WA 3PXZA 3BE2A 3GCSA 4EOJA 2X8IA 1U5RA 3RK9A 3PRIA 5AUUA 2BILB 5D11A 4XV1A 3AC1A 5AEPA 2QQ7A 3QUPA 4BWPA 2QVSE 3NPCA 4YNEA 1G8KA 3Q52A 2XIYA 4H1JA 2R3NA 2XA4A 4IIRA 5EI2A 3PDTA 3LE6A 3DXPA 4C3PA 3KU2A 3E64A 3EFLA 4DEDA 4AT3A 3G0FA 4IZYA 3TNQB 1QL6A 4FTLA 4RC4A 4C2VA 4D4YA 3ZZEA 5A9UA 5H9BA 5JGBA 5GHVA 1OPKA 4JG6A 4PMTA 3ZH8A 4ZZMA 2OZAA 3W33A 2CCHA 4JJRA 4KBAA 3E8NA 3OP5A 4QP4A 5CLPA 1PY5A 4FTJA 1HCKA 3CEKA 4U97A 4CFVA 3QZIA 3ENHA 2UZEA 4HOKA 3U51A 2QU5A 4I23A 1ZXEA 4TRLA 3NIEA 3KVWA 3VO3A 2YIQA 4TYHB 4LMNA 2W9ZB 5H8GA 4ERWA 3GQLA 3DK6A 2XYNA 4I0TA 2PVJA 4ACDA 4FKVA 4EWHA 2YAAA 2HXQA 4C7TA 4NCTA 1DAYA 4ZTHA 4RBLA 4DTBA 3FHRA 5KBQA 3V8SA 3D7TB 2YA9A 4AW0A 5EI6A 3W1FA 1M17A 2W4JA 5EYKA 3UP7A 3O17A 4IFGA 4IQ6A 4O81A 4PNKA 5ANOA 5BVDA 4IJ9A 2C6DA 1PW2A 2X7FA 4B99A 4EK5A 5GINE 3U6IA 5JSMA 3OCBA 4BCJA 3UOKA 4D5KA 4AG8A 1YW2A 3A8XA 4DGMA 4HZRA 1S9JA 2YDJA 4Y46A 5BYZA 3IO7A 3GCPA 4G3CA 2XNOA 5G1XA 4E3CA 5J1VA 3LLAA 3PY1A 4G5JA 5A4TA 4O0WA 2YAKA 3LFNA 1DI9A 4H3PA 4M68A 1Y57A 3JPVA 4IM3A 3COHA 4BZOA 2ZFYA 1WBPA 3KF7A 4I5CA 2Y8OA 2WTWA 1YXVA 2XKDA 2BR1A 4RZVA 3GQIA 3T3UA 3TJDA 4MXXA 2DWBA 5E7RA 5AA9A 4ZP5A 3D5VA 3Q6UA 3VONA 3C4ZA 1OGYA 3BKBA 5HORA 4YJVA 3F5GA 3OOGA 2REIA 4C38A 4BJJB 2WD1A 3UDSA 3R9HA 2UZBA 4JDJA 4JVGA 2C6TA 2XJ1A 2XNMA 4PRJA 2C0TA 3UG1A 4D5HA 3PZEA 5LVOA 4YLKA 3MY1A 4RLLA 2XBJA 3T3VA 4E6QA 5FM2A 2CPKE 3IOKA 2PZRA 3W0QA 1GIIA 3IDCA 3V5PA 5HG5A 4UV0A 3U9CA 4DFXE 3F5XA 3VHEA 4EH3A 1UU8A 5CANA 3ZMMA 3NRMA 5CF4A 4GL9A 2VNWA 3ULZA 3JR1A 4PTEA 4NKSA 3KIOC 1B38A 4H1MA 4L00A 4B9DA 4U43A 4U40A 4I93A 2ITTA 2WFYA 3ZM4A 4I6BA 3R1YA 3TZ9A 4I0RA 3FMLA 2CNQA 3UNZA 4ZZOA 5B2MA 3R6XA 1VZOA 5DI1A 1NVRA 4PMPA 1XH8A 5DPVA 4E20A 1PMUA 3BIZA 2CMWA 3PTGA 4YR8A 3ZXTA 2WMSA 4IACA 1JLUE 3OW4A 1YQJA 4F9WA 2A98A 2BZIB 4G1WA 3H0YA 1MRYA 4ZTSA 4IDVA 4FG9A 2PVMA 4Q5EA 1XJDA 2UW5A 3ODYX 2H9VA 3P5JC 2YDIA 3TI1A 4F6WA 1OUYA 4YO4A 3TUBA 3Q9XA 2X9EA 3GXLA 5ANGA 4MF0A 4X21A 4C4GA 1J7UA 3UZRA 4L45A 1OPLA 4FT0A 3SG9A 5AP3A 4BZDA 5LVMA 4O7YA 4XLVA 3F2NA 3FLZA 5FDXA 4XH6A 3PA4A 4RIXB 5F4NA 4CSVA 4EH8A 3BEAA 4QYEA 4E73A 1NXKA 3F5UA 2OJ9A 3WZUA 2YIRA 4N57A 3MPTA 2OF2A 4TZRA 4C33A 4E1ZA 4YC6A 3D2KA 3IW4A 4PMSA 4EYMA 1KV1A 3MS9A 5IEVA 3PIYA 4AAYA 1GZKA 5EDQA 3HP5A 3VBWA 4BDDA 1XQZA 2B54A 2C6MA 3V51A 4WKQA 3QC9A 5HBJA 4FV3A 4R1YA 5LXMA 5IISA 3K3IA 4FODA 3NCGA 4L8MA 2E9VA 1NVQA 4X2KA 4A9RA 4B8MA 3Q5ZA 4JRVA 3V6RA 2X9FA 4FUYA 4FSRA 1F3MC 4C4HA 3DNDA 2ITVA 5GNKA 4IX5A 5BVKA 1OL6A 2W1FA 2Y4IB 4CCUA 5FEEA 4ANOA 3SC1A 3B8QA 3NS9A 4ASDA 3Q5IA 4ITHA 3RINA 2C5YA 2R3HA 3NGAA 2OH4A 2Y4PA 4IZ7A 4S34A 5IA5A 4M8TA 1YKRA 3A61A 3F2AA 3QTZA 2V22A 2W1EA 1VEBA 3EQIA 3NWWA 4MD9E 3ZXZA 5C8KA 4RQVA 4L01A 3A4OX 2QOCA 3VS1A 2A1AB 2W5BA 2X2KA 4EHZA 3W0NA 3UG2A 3KN6A 4MK0A 4Y8DA 1YWRA 5AUXA 3GCQA 3R71A 3WF9A 2UZWE 3PXRA 4DH3A 1YXXA 3PJ8A 2IVUA 3ZSGA 3O71A 4ACHA 4RMZA 1M52A 4G2FA 3FQEA 2HWPA 3TEIA 1PXJA 3C0IA 3SKCA 3BU5A 2PZPA 2YEXA 3DBFA 4CFMA 2BMCA 1REJA 4FTOA 3FY0A 1Q8YA 2ZMDA 2UW8A 1GJOA 2GPHA 3KCKA 5TE0A 3VJNA 4CYJA 1FVVA 5HBEA 4HYSA 4PPCA 4YMJA 3MDYA 3ZSHA 4EUUA 1AD5A 3FPQA 1RE8A 2IVTA 2X1NA 1PXMA 1UWHA 2FUMA 5M08A 4KKGA 3GCUA 5FRIA 5J95A 2W4KA 4FV8A 2GS6A 2FB8A 1J7IA 3CQWA 3FE3A 3I81A 3LFQA 4HCTA 2AEGA 3E93A 1GZOA 3DDQA 3ML1A 4DT9A 3N4TA 4IVAA 2I6LA 2XVDA 4I24A 2OFVA 4RX7A 3SLSA 5IA2A 4KNBA 1YVJA 1YWVA 1SNXA 2VV9A 4BCNA 4W9WA 2OG8A 3TKUA 3CTQA 2OXXA 4I22A 4M69B 4KSPA 4FIFA 3SXFA 4O7SA 5KMMA 4DLJA 3O8PA 3TL8A 5ETAA 1HOWA 4AOIA 2GU8A 3HV3A 3JS2A 4R7IA 2BFYA 4O86A 2O65A 2UZLA 3AC2A 4LRJA 5IDPA 4Y72A 3CC6A 1Q8UA 2UUEA 3BRBA 4D0XA 1OUKA 3B2WA 4EORA 4FJVA 2WU6A 3LXLA 3LPBA 3P0MA 3QKMA 4LGDA 3VIDA 1UWJA 1ZYLA 3A62A 3BEGA 3GOPA 3PXQA 5E8XA 5H2UA 5IA4A 4O7NA 2XIRA 3RALA 4JI9A 4CEGA 4MUQA 3PA5A 2YJRA 2C4GA 3CQUA 4BI1A 4QDEA 4EK6A 4IAFA 3PA3A 4BGQA 4IWDA 3FKLA 3QRUA 4U80A 4F0IA 4V0GB 5E90A 3WIKA 4HYUA 5JZJA 3RBWA 2VTMA 1L3RE 3TIYA 4WNOA 2YDKA 5AR3A 4EH6A 2UZUE 5HTCA 4H58A 3W2OA 4BZNA 2RIOA 2G01A 2WTJA 4S33A 4X3FC 4BBEA 4F7LA 4DH5A 3D5UA 2GQRA 3R8UA 3IQ7A 2R3PA 4QMWA 1JSVA 2PMOX 5DN3A 4LI5A 2XBAA 4AGUA 4XV3A 3FL5A 2QHMA 3FJQE 1JVPP 2PK9A 3GENA 3IK3A 2J0LA 1ZLTA 4IC7A 3M1SA 4GV1A 3UO6A 4PF4A 3TV6A 4M66A 4IAKA 4X2GA 2ZM1A 2GFSA 4L3LA 4O4BB 5LCKA 3SOAA 3GVUA 4PL4A 3NW5A 4EOQA 2WTKC 4BDCA 2W5AA 4YPSA 4CFUA 1QPJA 3H10A 1H01A 5L8JA 3ZLYA 4LRMA 3LMIA 1T46A 2XK8A 3VC4A 5C8NA 4DFUA 1NA7A 1PXIA 3IKAA 3ZRMA 4W4YA 3PRFA 3KK9A 4ZAUA 4IAZA 1BLXA 1UU3A 2GTNA 1TQMA 4UBAA 5JFXA 4JR3A 4BTKA 1W83A 3LCOA 5AA8A 3RNYA 3E8EA 4V01A 5L8LA 3ELJA 3NUXA 5HEZA 4RIWB 3ZZWA 1FPUA 4HGEA 3KRWA 4UWCA 4GG7A 1G8AA 1G8JA 3BHTA 2CLXA 4QYFA 2XUUA 2LAVA 3H9FA 4CTBA 1FMKA 3Q3BA 5AUTA 5F9EA 5IUHA 4ANLA 3AQVA 4MWIA 4FL1A 2UVYA 3NR9A 3VNTA 4QTEA 4ARKA 4JS8A 5CAPA 3DBQA 4Y83A 4S2ZA 3I6UA 2W0JA 1YDSE 2XCKA 1OZ1A 2C1AA 3P08A 4I94A 3KXXA 2C1BA 4RWKA 4PDYA 3DLSA 3IPHA 4UMQA 4G6OA 4YO6A 3P86A 4M84A 3EL7A 3GCVA 4N0SA 3W2SA 1OKVA 3MH2A 5HIEA 4DGLC 5D12A 5AUYA 5KUPA 3ZONA 1KV2A 3OW3A 3P7BA 3CIKA 4O22A 3GFWA 1W82A 4OAUC 4RJ3A 4UWYA 3EFJA 3QD4A 3AMYA 4HZSA 4ZSJA 3THBA 1SZMA 2OJGA 3JVRA 4TYHA 2OJJA 2WEIA 3NYNA 2E9UA 5KE0A 4C35A 3QUDA 4CCBA 1PRYA 1DI8A 5C4LA 4CVAA 4CXAA 4AZWA 2Z8CA 4RA4A 3VF9A 3AT4A 5DR9A 4ANSA 3VS2A 3ZUVA 2HK5A 3FAAA 3D7TA 3MVJA 5CX9A 2FYSA 3VVHA 4FVPA 4KKHA 2GS2A 2B9JA 5FTGA 2GDOA 2WTDA 3A8WA 5FBOA 5I9YA 3VS3A 4H05A 1U5QA 4XG7A 2H6DA 2R7IA 3DK7A 4BCOA 3C7QA 5GJGA 4XP0A 4ONAA 4QPSA 5I9ZA 4IX3A 5A4CA 4BY9E 2WKMA 4BCKA 4CQEA 1GNGA 3HECA 2AC5A 3MFRA 5ANKA 3D2IA 4HNFA 5L6WL 4V04A 4C36A 4ZY6A 4LL5A 5K0KA 4DFLA 5TR6A 4DDGA 5J9YA 3CCNA 2B52A 4W8DA 3DFAA 3RAKA 1ZY4A 2W06A 4TWCA 4GKIA 4DEHA 4RJ7A 4XLIA 4BJJA 1WBWA 3N51A 4AT5A 1ERKA 3HV5A 2O0UA 3HL7A 4IHPA 3HA6A 2H96A 4PUZA 3LXKA 4FL3A 3U55A 4DFZE 1U54B 4ZTQA 4FC0A 1ST0A 1E1VA 3MH1A 3BV2A 4P5ZA 3ORKA 2YERA 3AT2A 5M55A 4QYYA 1WBVA 4EH2A 2XB7A 3LJ2A 4H3QA 4ID7A 2WHBA 3TNIA 3D14A 2X8EA 4NUSA 3SW4A 2UV2A 3PSBA 5DRBA 3KN5A 3NNVA 4U3ZA 3MJ2A 5L6OA 3QHWA 2IZUA 1LEZA 2YLEA 3ZLXA 4BDGA 3UDTA 4L7FA 2DQ7X 3W2CA 2ZB0A 4YUQA 3UO5A 4HCUA 5F95A 3RGFA 2YWVA 3U54A 4A9YA 3JXWA 3AKLA 4W4XA 1KOBA 3A2CA 3ID6C 3G6HA 4P7EA 3M11A 5LCJA 2XAMA 1ATPE 2HW6A 1WZYA 3LFAA 4CFWA 1V1KA 4IAAA 4KINA 2VNYA 4QQTA 4QYHA 3POZA 3IW7A 1YDTE 3CKWA 4R7BA 5AIKA 1JQHA 4A07A 4O7RA 3RPSA 4FSUA 1P5EA 3CR0A 3ORXA 4FVRA 4OTRA 2PUUA 4I92A 4PP7A 5HQ0A 4MD8E 2I0YA 5CENA 5IEXA 5J9ZA 3S00A 5AR2A 4FRFA 3S3IA 1G5SA 1W84A 3EKKA 3FYKX 4QQJA 3POOA 3LCTA 3ZLSA 4MF1A 4N6YA 4O0TA 3W16A 2C0IA 4RIXA 2OH0E 4ASZA 3KULB 3FC2A 3PPJA 4C61A 4O96A 4YHTA 4U3YA 4XG2A 5AADA 3UOLA 3CS9A 5B2LA 2CNUA 3QALE 4QMOA 4Z16A 3ET7A 4I4EA 3K2LA 4F78A 3FZRA 3TZMA 3P23A 3CPBA 4FGRA 4WRSA 3FMDA 3HVCA 4GMYA 2C6KA 4YNOA 2J50A 2JDRA 4I3ZA 4RFYA 1QMZA 2Q0BA 4FYOA 3KA0A 4F1TA 4YTIA 2WMXA 4DEIA 2OIBA 4GH2A 3MB6A 4I6HA 2RFNA 2IZRA 2HZ4A 4OAVB 3MBLA 3Q96A 3LVPA 4J71A 3BWFA 3MIYA 2CKPA 4BICA 4HVDA 2BRBA 2EVAA 1Y91A 2FSTX 3PSCA 4XG6A 3ORNA 4O0RA 3DZQA 3TNPC 5LWMA 4G9CA 4BHZA 4ENXA 4CT1A 2FA2A 4FOBA 4AP7A 1FQ1B 3BHHA 5E8ZA 4W4WA 3OWLA 1DAWA 2Z60A 4FR4A 4WUAA 5AAEA 3HDNA 4XG4A 4KA3A 4J8NA 4XRJA 4U44A 4G31A 1J91A 2JAVA 3PP0A 4XUFA 3MYGA 5HG8A 4DEBA 3HV4A 3OY3A 3G9LX 1PKGA 4K0YA 4QMZA 5M56A 1J3HA 4QMTA 3E3PA 1LR4A 5HVJA 4JBOA 2VTIA 3Q2MA 5E9EA 2JDSA 4OTFA 2XP2A 4TYGA 3ZO2A 4AACA 3RP9A 4C3FA 1PMEA 3I4BA 4NFNA 4A4OA 4BN1A 4DHZA 2JFLA 4XMOA 1W2DA 2QO7A 4WG4A 2YCFA 2BAQA 3UMWA 2GNHA 5AMNA 2OWBA 4ITIA 5AP5A 2ONLC 2VTNA 5J7BA 5IQBA 3UODA 2PSQA 4O91A 2KTYA 5CXZA 4CKJA 3QKLA 4O27B 3O51A 4D2VA 4HCVA 2PMLX 2EU9A 3QYWA 4IM2A 3R7OA 5IQCA 3RAWA 3EZVA 4FTCA 3PXYA 3R0TA 4BCIA 2O2UA 2QODA 4W4VA 4M3QA 2YISA 3MH3A 4XG8A 4YC8A 3T9IA 3WZKA 3PJ1A 2BHHA 4RPVA 1H0WA 4GS6A 1UU9A 2HWOA 3QQFA 4PPBA 3MA6A 3UQCA 3E8CA 3EN6A 1WVWA 2X0GA 5CVHA 4BDFA 4BYJA 4JAJA 4RX5A 4F7JA 4P90A 4FT5A 5CF5A 1BI7A 4BFMA 4FMQA 5AM7A 3NFFB 3N4UA 5AV3A 2VTHA 3DTCA 4XEYA 4AWIA 2UW6A 5KMLA 1JKSA 4ALUA 2OZOA 4FTNA 4EQCA 4JL9A 3Q2JA 4M69A 4U79A 4AQCA 2XIXA 3QD0A 1OKZA 3R7YA 3WYYA 4BGHA 3HMNA 4EOIA 3PXKA 5E8YA 4YJTA 3ZFYA 3NNXA 3PVBA 4DEAA 4K6ZA 4X6RA 2J51A 4J7BA 4M0ZA 4R1VA 1Q24A 3O23A 4ZSAA 4F6UA 3MSSA 1KE9A 4CG8A 3OCGA 2R3JA 3MPMA 4A7CA 4AGCA 4C0TA 3E7VA 4IB3A 3QYZA 4WA9A 3PUFC 2VWIA 3KGAA 4R3PA 5AAGA 3U6JA 5ANDA 2OO8X 1ST4A 3DJ6A 4YLLA 4YJOA 2YJSA 4PDPA 4BC6A 3FV8A 3I60A 4YTFA 4YZ9A 2QO2A 3HRCA 4V0GA 5CSVA 4DTKA 2BRGA 2XEYA 3HA8A 1JKTA 4RRVA 1KE7A 4JBQA 2ONLA 4E5WA 5DR6A 1W98A 1H26A 4L3JA 3Q04A 3KCFA 4Z7GA 2JBOA 4KAOA 3EH9A 4FEXA 4O1PA 2ETKA 2QC6A 2WNTA 3FI3A 2ZV8A 4I1ZA 4QP1A 3VAPA 5M44A 3ZM9A 4L53A 2R2PA 3LZBA 4FV5A 3CSVA 5DRDA 5D41A 2GNFA 3EQHA 4IVBA 4C34A 4XOYA 5ETIA 2JAMA 5B7VA 3P1AA 5IA0A 3AMAA 2ITXA 3R2BA 2NNWB 3OUKA 2EWAA 5HG9A 3I5NA 3MFTA 4EHVA 5KCVA 3BLHA 3W0RA 1VLRA 3GU8A 3V5LA 1PF8A 2G1TA 1UNGA 1TFFA 4BHNA 5HG7A 2YCQA 3CJFA 4FNWA 4MQ2A 2C6OA 2FSMX 4EH5A 1JKKA 3KKVA 1EH4A 2CN5A 3DAEA 3VUGA 2UVXA 3RM7A 2ITWA 4E4LA 5GJDA 4F0GA 3EKNA 4BDKA 3OC1A 2X7GA 2QLUA 5BVNA 4BIEA 2VX0A 4RIWA 4D2PA 3MY5A 4IC8A 5FTQA 1GY3A 5BX0A 5DFPA 4L42A 3BLAA 3RWQA 1OIQA 3EOCA 4AW1A 4RX9A 4AOJA 1CSNA 2BZHB 5M4IA 2XK6A 3V5JA 3FDNA 4TWOA 2IW9A 4F65A 4FKPA 3L9NA 1CM8A 1JKLA 2ITNA 2PZIA 3KXMA 4GUBA 4RX8A 5HO6A 4AA0A 3VW6A 2BALA 2IN6A 1DS5A 4HJOA 1OPJA 3BHUA 2UW7A 1B6CB 5CSHA 4EHEA 4YTHA 4X3FB 2QI8A 4JDIA 4WIHA 3QQHA 1JWHA 2P3GX 5AM6A 3C0HA 2PZ5A 3DKGA 4LOOA 4NKAA 5GIPE 4EZ5A 1U46A 2HZNA 2C68A 4F64A 1YRPA 4I21A 4O0YA 5HIBA 2XK3A 3AC4A 1Z57A 4IEBA 3LXPA 1YXTA 4A9SA 4TNDA 2X0QA 5DLSA 4GIIA 4RQKA 2WTKB 2ZJWA 3UNJA 2F7XE 3L9PA 2PZYA 3C51A 4CRSA 4EKLA 4ZEGA 3FZSA 4FT7A 2VTOA 4MHAA 1OM1A 4JIAA 3MIAA 4TL0A 1BUHA 1TVOA 2WTIA 4Y73A 2P2HA 4E7WA 4LGGA 3H3CA 2C6LA 3W55A 3ZTXA 4QMQA 4NM0A 1VYWA 4XBRA 4PNIA 3HAVA 4FKJA 5CEKA 4J52A 4KRDA 2VRXA 2GHGA 3JYAA 3IW6A 3RZFA 3BYMA 2J0MB 3I7BA 2XKFA 5LVLA 3G9NA 2GMXA 4DAWA 2XIZA 4I6LA 4JQ8A 2RG5A 4FVQA 4KRCA 4U41A 4LM5A 3R7EA 3PVWA 2YIYA 2W4OA 2O8YA 4MX9A 5HNIX 2PPQA 5KBRA 4DHFA 1Y8YA 4YJSA 3FMJA 4DFNA 4FICA 3KF4A 3RKBA 4QP2A 5HGIA 4AZVA 5K4IA 2DYLA 2ZDUA 4ANQA 5CNNA 5ITAA 3D5XA 1H27A 3TZ7A 4O82A 5KO1A 1OECA 2CGVA 2OIQA 2HENA 2Z7QA 4F1MA 3PPKA 4UYNA 4C3RA 1U54A 1ZYJA 5HE1A 5DEWA 2XKEA 2R0UA 5CU3A 2XYUA 2GNIA 4QD6A 4W9XA 3OMVA 5HD4A 2BROA 4B7TA 3E8DA 1WVYA 3OWPA 2WMRA 3QCXA 4FTTA 3EYHA 3WF5A 3FMEA 3AGMA 1PYXA 3TUDA 4R78A 4ASXA 4F99A 4FK3A 4FV4A 4AXDA 5CU4A 2YHVA 2BIYA 5HE2A 4O21A 3A7IA 4S30A 5AP0A 5GZ8A 4JBPA 4LRKA 4QNAA 4ALVA 5IQIA 4FV9A 1IG1A 2HCKA 5KX8A 2RFDA 3SVVA 2VTJA 2PVNA 3L9LA 4QP8A 2UZTA 1YHWA 4GFOA 3A60A 3TZ8A 4IAIA 3GBZA 2RL5A 3JY9A 4FKOA 4D2WA 4F4PA 5J9LA 4O1OA 4H39A 4L7SA 3HX4A 1XO2B 5IU2A 5A54A 4ITJA 3COKA 4M7IA 2C6IA 4Z3VA 1FGKA 5AP4A 5HZNA 4P4CA 3NYVA 4NJ3A 2XAOA 4I41A 1IRKA 5ETCA 4QP6A 4DG3E 1IA8A 3FQSA 3KULA 3UVQA 2HY81 3R2YA 1IAJA 4DG0E 4FEWA 4XV9A