4D4VA

Focal adhesion kinase catalytic domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
272
structure length
256
Chain Sequence
YEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Allosteric Regulation of Focal Adhesion Kinase by Pip2 and ATP.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE
total genus 82
structure length 256
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d4vA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4d4vA01
2XYNA 3AC8A 2IW9A 2BROA 1J3HA 4TNBA 2C3IB 5BYYA 1REKA 2WMWA 3KFAA 4ANMA 3I5NA 1WBNA 2YITA 3VS3A 2HZIA 2B7AA 3GCSA 3DY7A 1OKVA 3ORMA 3RNYA 4D2VA 4QD6A 1TQMA 2WEIA 1PXMA 2LAVA 4RRVA 4DEIA 1IAJA 4I5CA 2BHEA 4FVRA 4AWIA 2AYPA 3GFWA 1LP4A 3LQ5A 3Q4UA 4X3FA 3UTOA 4EH7A 4MXYA 3KMMA 1WBSA 3C0GA 4I4EA 3ZXZA 3U8WA 1UKIA 5CEOA 5LVPA 2B9HA 5DWRA 3BQRA 1QPCA 2Z02A 2XK6A 3OCSA 3A7FA 4QMWA 4KRDA 3RWQA 4GRBA 3KEXA 4E6DA 4UMPA 2VWZA 3QKMA 4IXPA 4U80A 4R6VA 4JNWA 4X3FC 3RWPA 3O2MA 3UMWA 4DFLA 5AUWA 5CANA 5CZIA 3BIZA 5ITAA 2X2LA 4APPA 3GNIB 2IN6A 4EJ7A 5LCJA 3UPZA 3HMIA 4W4YA 2GQGA 1BI8A 3Q4ZA 4ID7A 4CYIA 5KHWA 1FGIA 3UZRA 4IZYA 3FMMA 3OEFX 4RIOA 3ZH8A 4S31A 2JFLA 5HE1A 4C4IA 3L8SA 2J4ZA 4KABA 3Q2MA 1OITA 3Q6WA 5DIAA 2ZM1A 3G5DA 2XF0A 3GCQA 3HRFA 4RIXA 5M4CA 3QD0A 2B1PA 4NFMA 4BTJA 5HE3A 4KIOA 2IO6A 3DJ5A 4FT9A 3CY2A 4ACCA 2IPXA 4ANQA 2JDVA 5I9XA 4C58A 3UIMA 5IF1A 4DCEA 2UW0A 3RPSA 5IUHA 2XK4A 2P2HA 1IEPA 2RG5A 4YJUA 5LMBA 3DBCA 2VX3A 4EH3A 4CRSA 4YNOA 3TNIA 4BCMA 3FMJA 3P4KA 4JAJA 4FTMA 4CCUA 3PVBA 4TYHB 4E3CA 3HYHA 3MPAA 4BIDA 4PL4A 1XWSA 2CJMA 5CVHA 3UG2A 1YQJA 4C0TA 4EOLA 3R7YA 4AGCA 1YDSE 3L9NA 4IMYA 2YCQA 3DAJA 4AW1A 5IA0A 2YABA 5E90A 4HYSA 2EU9A 4DA5A 3DT1A 3CQEA 5CQWA 5HGIA 3GGFA 4O0VA 2BDJA 1P5EA 3GCUA 2WMSA 3E88A 2ONLA 3MA6A 4JX7A 5M06A 5AUYA 2HZNA 2QOBA 2UZDA 4NCTA 5KMNA 1QL6A 4O0SA 3F2AA 1YWNA 5DNRA 5FLFA 4B6LA 5HORA 2XM9A 3E8CA 4QYFA 4USEA 5KKRC 1T46A 4AUAA 4NSTA 4NM5A 4U97A 3UPXA 4CGAA 5AUVA 4F0GA 3H9OA 3B2WA 4BWKA 2CGXA 3PZEA 1WBPA 3OS3A 3UO5A 4UN0C 4MAOA 5C4KA 3DKCA 5HESA 1E1XA 3PIXA 3QA8A 5B0XA 1GIIA 3IPHA 2HW7A 1JKSA 4XV1A 4CZTA 3QD4A 3S00A 4IIRA 3TV4A 4JBOA 4ASDA 3OP5A 4GYGA 4LUEA 4JQEA 4FYOA 5HOAA 4O0TA 5EOBA 1Q24A 4OTHA 3NCGA 2W1IA 4FT5A 5CVGA 4O1OA 2HWPA 3BBTB 3NNXA 5IQHA 3H0YA 2W1GA 2C0IA 2OGVA 1W7HA 4F6UA 1PMVA 5AUTA 5BPYA 3BWJA 2G15A 4G34A 3EL7A 4IHPA 2R3FA 5AM7A 4EOOA 2P55A 3FI2A 4DFXE 3B2TA 4IDTA 2R5TA 4MF1A 1XKKA 4F9CA 3AD5A 2GQRA 3F7WA 5TT7A 3ZFXA 4E93A 3F5UA 3AC4A 4PL5A 4QP3A 4DH3A 3L8XA 3W55A 4IWOA 3BI6A 4F6WA 3QX4A 3GQLA 2VWWA 4N0SA 4AN2A 1OI9A 4E4NA 4DEGA 2P33A 2YIYA 4DF3A 3DJ6A 3Q4TA 4QP9A 5TOZA 2CLQA 4MK0A 3UYSA 3EKNA 4DFZE 4FEVA 1Q8ZA 4C4JA 4TKSA 3O50A 3QAME 4U5JA 4UY9A 3W16A 3K2LA 4C4HA 2BAQA 5E8YA 5KMMA 4U6RA 2WMQA 4DGGA 3P23A 3RK5A 4YNEA 3VUIA 5IH6A 1YI3A 1OIUA 4ACMA 5IQBA 1SYKA 2OU7A 2Z8CA 5EM6A 2UZOA 2VRXA 4X2NA 4AOTA 4EOSA 2BZKB 3V04A 4APCA 3TJCA 2WMTA 3E62A 4HPUE 2XK3A 2VWIA 3HZTA 4U79A 3S3IA 3QHRA 3O71A 4MBIA 3SV0A 4E4LA 3U6IA 3C51A 4PMTA 4NJ3A 3EZVA 1TVOA 4P2KA 3A61A 3ALOA 1P4FA 3D4QA 2XJ0A 3ZRLA 2YWVA 3B8RA 4ZS0A 3WF6A 2GHGA 4RVTA 2Y6OA 1E1VA 3U4WA 4D9UA 2GS7A 3KF4A 3PP0A 4KD1A 2YDKA 3OFMA 4PUZA 3E8NA 2ETRA 3QTUA 3T3UA 3VUHA 1Y91A 2Y9QA 3QCXA 4E7WA 1IRKA 5GZ9A 3VS5A 3G51A 4GYIA 4UZHA 2QQ7A 3QZHA 3V5WA 4AZSA 5FM3A 1LR4A 5H2UA 3DBQA 1YXSA 2XK7A 4U45A 4Y72A 4YJVA 2WO6A 4CFXA 3R7IA 1YVJA 2ITWA 3IK3A 4OT6A 4EK8A 4G9RA 5DRBA 1BX6A 4RJ6A 2BAJA 1Y6BA 4D4SA 5J1WA 1ZRZA 3T3VA 3FE3A 4JIAA 3PRIA 3F3TA 4QQJA 5TE0A 2A0CX 2FGIA 2VTIA 3BZ3A 5CAUA 3WBLA 5EKNA 4FUYA 4F4PA 4L67A 4QPSA 1JKTA 2NNWB 3BGQA 4Y83A 4E6QA 4FV4A 2OF4A 4X6RA 3KRJA 3LFCA 3GP0A 3IOKA 1W0XC 2XIRA 4TTHB 2W1DA 5IA5A 3QTZA 4BI2A 4DYMA 5AIRA 1OUKA 5C03A 2JLDA 1XBCA 2JIUA 5J5TA 4OTGA 1JAMA 5IPJA 1W83A 3LAUA 1YWRA 3IGGA 4EEVA 4QMNA 2WU6A 3EN7A 4IJ9A 4QP7A 4BCIA 4HNIA 2BVAA 3RAWA 5BVFA 3QLFA 4GJ3A 2XS0A 3EN4A 3LXPA 3OUNB 4G9CA 3RCJA 5DMZA 5LARA 3ACKA 3HV7A 5CLPA 3D2IA 4O0UA 4XP2A 2CSNA 2XK8A 3HV4A 3F2RA 2OZOA 3OWLA 3UBDA 2HWOA 4YURA 4X2KA 5HLNA 4GU9A 3LFNA 2WTWA 2OH0E 2ERZE 2UZVA 4JVGA 5E8TA 1XH9A 4KIKB 3E7OA 4XBRA 4BDCA 3QX2A 4EH2A 1K9AA 4C7TA 1H24A 1GNGA 3MI9A 4BIBA 3RTPA 3LCOA 3FLYA 4M69B 4ZSAA 3LJ2A 4OBQA 2H9VA 2OWBA 4K8AA 3HMMA 4J8NA 3A4OX 4JBPA 4PTGA 3PXKA 3IG7A 3KU2A 3R0TA 2X81A 4XV9A 2PYWA 3KXNA 5AUZA 2R3MA 3KULA 3RNIA 3PP1A 1GIHA 3MY1A 1Y6AA 4AFEA 3TTJA 3PYYA 4KS7A 3Q9ZA 3T9IA 3BGZA 1FPUA 2CMWA 2PZ5A 5F95A 4MQ2A 3QC4A 3DLSA 1J1BA 3TJDA 1M14A 3UC3A 3IQ7A 4L52A 5AX3A 1NVQA 1URWA 4U9AA 3TDVA 4RJ8A 2W1HA 3OXZA 2CNQA 3TV6A 4YZCA 5I5ZA 4IAYA 3O51A 1UA2A 3PLSA 4G17A 3G15A 2UZEA 3ORIA 4GS6A 3PG3A 3ODYX 3MY0A 4GIIA 2CPKE 3ORKA 3VRZA 3NGAA 5HBHA 3R9OA 3PXFA 1W98A 3TZ7A 1NVSA 2I0YA 4XG3A 4OGRA 3WZKA 3FMEA 4O21A 3MS9A 3MVMA 3UDBA 4CQEA 4PDOA 3G33A 4E4XA 4XS2A 4FKOA 4PY1A 5EQPA 2C0OA 3WIGA 2H96A 2W7XA 5A4CA 2X8EA 3MN3A 3FY2A 4EH4A 3QUPA 3QA0A 3Q5ZA 5DBXA 3U6JA 1VJYA 3FXWA 1CM8A 4H58A 1OL5A 1OL1A 5CEPA 4UYAA 4Z7HA 2I0VA 4FTNA 3NS9A 2OZAA 4X3JA 4BTFA 4EQMA 1VYWA 3HRBA 2CN5A 3W2CA 4FODA 1XO2B 3EKKA 4CG9A 5FTGA 3PPZA 4H3PA 4ERKA 3IS5A 5DR9A 1OZ1A 3I6WA 4LMNA 4KKHA 5CXHA 5LVLA 4DFUA 3Q9XA 4QT1A 2Z7QA 3ELJA 4NUSA 4GT4A 2KTYA 4YSMA 1O6LA 4AGDA 5GNKA 2WTJA 4X2JA 3L8VA 2C6LA 1H0VA 2YEXA 3LVPA 4S33A 3EFJA 5EM7A 4M66A 1W8CA 4EH5A 4RJ4A 1OGUA 3AC3A 3DAEA 4FTUA 3ZBXA 3PE2A 3KRWA 3NUYA 3QGYA 3PSCA 3ZO3A 3RK7A 4BCJA 5HBJA 3OW3A 2ZV9A 4JAIA 4B8MA 5CSHA 2OIBA 3Q2JA 1WCCA 1U46A 4DINA 4HVIA 3QXOA 1AGWA 4HCTA 2E9OA 2R2PA 4AFJA 4I0RA 5E8VA 4YSJA 3UQFA 4U3ZA 4O82A 4DFBA 2XIXA 3NYOA 4P4CA 4YJNA 2YZLA 2XNBA 4QNYA 2HENA 4CG8A 3HP5A 1JSUA 4BDKA 4EHVA 4FKRA 2EB3A 3D83A 4FKVA 2YIXA 3PXZA 4B0GA 3TXOA 3DK6A 5AWMA 2I0EA 5D7VA 4FV5A 1APME 5L4QA 1HCKA 2C6MA 3FLWA 3VNTA 2HXQA 2CLXA 2OJIA 2C6TA 1Q5KA 4FV7A 2O2UA 4WNMA 1BUHA 1KE8A 2VUWA 3KK9A 2R3JA 3KRLA 3DXPA 2O5KA 4FTIA 4MWHA 3ULZA 2O64A 4GT3A 4RLKA 5AR3A 1ZMVA 3UE4A 5EDRA 3KRXA 3P7BA 3QQKA 4TYGA 5EHLA 4DTAA 4AW2A 1NY3A 5DI1A 3CY3A 3JVRA 2IJMA 5HLPA 4BCHA 4RGJA 3IW8A 2JGZA 1OL2A 2Q0BA 4RQKA 3COIA 5HO7A 3H10A 3SX9A 3K3JA 4F7JA 5HX8A 3OHTA 5CVFA 4RVMA 4M0ZA 3ENMA 5DG5A 5HLWA 5AUUA 4XYFA 3HECA 3VIDA 4FEWA 4CFUA 2QONA 4IX5A 4AN3A 1LEZA 4YZDA 4IADA 4WA9A 4DFNA 5EQEA 4FV6A 4BHZA 1H1WA 4F7SA 2E9PA 4JLCA 3MH1A 4EKKA 1Z5MA 5CAVA 3V5PA 4BCOA 4RWJA 4FIIA 4Y73A 3UOJA 3I60A 2X2KA 4KSPA 4A06A 3QQHA 4E26A 1H8FA 5KNJA 5C1QB 2JEDA 4UMUA 1QCFA 3NUAA 4FSQA 2C3LA 4XX9A 4FIGA 3U87A 1JQHA 2JIIA 3N4UA 1U5RA 2VU3A 1FGKA 5E1EA 3G0FA 5F94A 3TIZA 1WBVA 2QCSA 2Z7LA 2IVSA 3RM7A 4O7SA 2WIHA 5CT7A 4OAVB 5EYDA 4ZTQA 3FC2A 2F7EE 5KE0A 3UC4A 3F3ZA 4FNWA 3VJNA 4ASZA 2W4JA 3MPTA 1Z9XA 2C5OA 4ZTMA 4L3LA 2AC3A 5CY3A 3D5VA 2VWXA 2WQBA 4MYGA 5E7RA 3AG9A 2YACA 3SXFA 4QMSA 3LE6A 3RI1A 5B2KA 5B2MA 4FBXA 5HG8A 3H30A 3NUPA 3V3VA 5CNOA 3NDMA 5CU6A 5ETAA 5LVOA 2F7XE 4YBKA 3S4QA 4LGDA 4Y8DA 4QP6A 2VTLA 3ZZWA 4LOOA 3DU8A 2WMUA 2JDTA 2EXMA 3OCTA 4UX9A 5GINE 4G3FA 3AMAA 4ZP5A 2X6DA 3R9HA 3HV6A 4EOMA 4X7QA 3SKCA 2GS6A 3RCDA 4O2ZA 2QO2A 3R9RA 3FZ1A 4CZUA 2PUNA 3K5UA 3O8TA 4AACA 3O96A 4FICA 2UVZA 3EQCA 3ZMMA 4AOIA 3KN6A 4BDHA 4C36A 2FSTX 3COHA 4IJPA 5M4IA 3ROYA 5I0BA 1WBOA 2J51A 2YCFA 4D1ZA 5HO8A 3G2FA 4CYJA 3TNPC 2ZYBA 4TRLA 4AQCA 3NYXA 4AW5A 1V0OA 5AP4A 1A9UA 2X7FA 3AMBA 3R71A 4I1ZA 5M55A 1ZOHA 4QQTA 1YDRE 3ATSA 2ITXA 5HICA 1NA7A 2YIQA 2PSQA 2P4IA 5CEMA 4ONAA 4FEXA 4GEOA 3M11A 4RLLA 3OY3A 2WAJA 4CVAA 3HDMA 4FSYA 3IDBA 4I4FA 5HHWA 1IAHA 4IACA 4FKQA 2HY81 4EZ5A 3OD6X 3QQJA 4AGWA 4O83A 1B6CB 3N51A 1NXKA 1OIQA 3P9JA 2Z7RA 1HOWA 3GC9A 2UZTA 2YM7A 2OFUA 4X6QC 3CBLA 3ZCLA 4IZ5A 1TQIA 4MH7A 3NNUA 2B53A 4RIWA 4BICA 5CAPA 3GCVA 3FZRA 5CALA 1PMEA 4S32A 4F65A 3F69A 1J7IA 1XH8A 3ZO4A 5FP5A 4FEUA 4JR3A 2Y4IC 4JBQA 4E5BA 4WSYA 3VS7A 4AZEA 3O7LB 1SVHA 2HXLA 3DPKA 3QRIA 1Z57A 5BVDA 2IVVA 5CTPA 4IAFA 4FTLA 3O17A 3WI6A 3TM0A 2PTKA 3OXIA 4OTDA 4O27B 5HIBA 4FSTA 4NU1A 3KCFA 3C9WA 5HD7A 3MA3A 2V5QA 4O1PA 3FMHA 5DR6A 4GJ2A 3F5GA 4AA5A 4C4GA 3V5QA 5L2TA 3QD2B 2PULA 3VQUA 3HP2A 4CLIA 2G2IA 3DFAA 3Q32A 4F0IA 1JPAA 2CDZA 4OTIA 3PDTA 2WMBA 2XNGA 4ZY5A 4IVAA 5BQ0A 4OR5A 3ET7A 4WSQA 5H8GA 1GY3A 1U4DA 3PXYA 4G3GA 2O0UA 4O38A 1OPKA 3E8EA 3FHRA 3DV3A 4HOKA 5ETFA 4HVSA 1S9JA 1Q8UA 2ITNA 3KMWA 3UIXA 1OB3A 5CF6A 2X4ZA 2XNEA 4ZZNA 3BELA 5I3OA 3R7UA 1RW8A 3FC1X 4U0IA 3BEAA 3OWKA 4YGAA 4F9YA 5JFVA 3FZOA 3UIUA 1KOAA 4J97A 2OF2A 2PVNA 2VTJA 2WQOA 1P4OA 4FL3A 2VTQA 3PJ8A 4GFMA 4J98A 4LI5A 3WZUA 2J0KA 2FH9A 4KAOA 4DGNA 2WPAA 2H6DA 3GFEA 3VWAA 4ZZOA 5BVOA 3LJ1A 4YC8A 3ROCA 4A9RA 3MESA 5IA4A 4H05A 5IQIA 4USDA 4YJRA 5AJQA 3SAYA 3FBVA 4TWPA 4H36A 3ZTXA 4AG8A 5ANJA 5K4IA 2R9SA 2EUFB 3DQXA 4MQ1A 2FSOX 4DG0E 3BU3A 4XOYA 1JOWB 4XH6A 3TL8A 1JWHA 1ZYJA 4C8BA 4FG9A 4I0TA 1VR2A 2XUUA 4RC2A 3FXXA 4AT5A 4KA3A 2ITOA 3V6SA 3D7TB 5ACBC 5I9YA 1SMHA 4FZFB 3ZSHA 1Y8YA 1KE9A 3EFWA 5IEYA 3V5LA 3VUTA 4JG7A 3AT4A 3VS6A 5E8ZA 2JDOA 4EHZA 2XRUA 4O96A 2OLCA 5DA3A 3BPRA 2OXYA 3ZLWA 1DAWA 3FL4A 4XOZA 4MWIA 3VBTA 4H39A 3FI8A 4RT7A 3QKKA 3HA6A 3FZPA 4JDKA 4AU8A 2YM5A 3DZQA 2V0DA 5IKWA 3CLYA 4QP8A 3UQCA 3Q53A 1R0PA 3MBLA 4GKHA 5HNBA 3UOKA 4KINA 4BDEA 3U9NA 2BUJA 4QMXA 1CMKE 2R3PA 1ZAOA 3COKA 5HG7A 4PMMA 1DAYA 3KY2A 3TWJA 4M3QA 2OI4X 3P86A 2YM6A 4HGLA 5J79A 1F0QA 3GT8A 5C8MA 4FNXA 1KWPA 5J7BA 3UODA 3EH9A 4I23A 2R3RA 4BKYA 4NEUA 3WOWA 5J8IA 3W2PA 4E1ZA 5DOSA 4FVQA 4H3QA 3FLNC 4B4LA 5HI2A 4KNBA 4JRVA 2GNFA 3MH0A 1VYZA 3HX4A 2PUUA 4BTKA 4CCBA 4EK4A 3I0OA 4YUQA 4NJDA 3C5IA 3DKOA 5BNJA 5BUIA 3CS9A 3R7GA 3N9XA 4TL0A 4ZS4A 4I6HA 4EK5A 3CKWA 4MCVA 2OG8A 1A06A 2OH4A 4GK3A 3TNQB 3LMIA 1Q8WA 2JITA 3KXHA 4G3DA 3U51A 1BI7A 4DTKA 3A60A 1Q97A 3PJCA 3S0OA 2ZMCA 5EQYA 1R1WA 3SXSA 5BYLA 3OUKA 3TKHA 4A9YA 3WF9A 4QMUA 4N4SA 2X7OA 4RVLA 3POOA 2C4GA 4W8DA 3LIJA 3QF9A 3LXNA 1YHSA 3MTLA 4YJPA 4HGTA 4XLVA 3PA3A 5CNNA 4KS8A 4XV2A 2JAVA 2UW3A 4HJOA 4PNKA 1Q4LA 5J9ZA 4LYNA 4CLJA 5ETCA 4I92A 1JLUE 4EL9A 3DDPA 2UUEA 4EOQA 3FWQA 4JDHA 4F1MA 3HVCA 3NYNA 4XJ0A 2BFXA 3OW4A 3MYGA 4FV2A 4YZBA 5GZAA 4RWIA 2HYYA 4E73A 5HVKA 3NW7A 3RPVA 2FUMA 3RHKA 3D5WA 4F64A 2QU5A 4YC3A 4AX8A 4E6AA 3TG1A 3R30A 2C0TA 1GJOA 3O0GA 2F7ZE 4PDSA 5TO8A 3MB6A 2OW3A 2R3IA 4YJTA 3W2SA 3PJ2A 2VTAA 3PG1A 4RIYB 4BBMA 5AM6A 2PHKA 1PW2A 3UGCA 3NVKI 2XKEA 1QPEA 2QU6A 2R3LA 2C68A 3GXLA 3IKAA 1AQ1A 4JJRA 4U44A 3SXRA 4YO6A 2EB2A 3L1SA 5FBOA 1PXLA 4A9SA 1OPJA 2XEZA 2F2CB 5AV0A 4WG4A 3RKBA 1Y8GA 4LFIA 3VUGA 4C2WA 4JG6A 5LVMA 2CNUA 4K33A 2I1MA 4RIYA 2WD1A 2YIRA 3CIKA 5DVRA 2G2HA 2NRUA 3CE3A 5CSWA 2CKQA 3UZPA 2G2FA 4XRJA 5I9WA 3P1AA 2WOTA 3Q04A 4ITJA 4F9BA 3ZU7A 4I94A 5A4QA 4GW8A 5E8XA 5AADA 2VWYA 1MUOA 4V01A 5CZHA 4IZAA 2WIPA 4K1BA 1L8TA 2WZJA 3V51A 4DLJA 4WRGA 3CQUA 2GNHA 5LMKC 2OBJA 3WE4A 4EOPA 3FI4A 3DB8A 2Y0AA 1ZY4A 5K9IA 2WKMA 5LJJA 3UYTA 5L2IA 4DEDA 4HCUA 2R7IA 4E6CA 5M51A 1CKPA 3DZOA 3NR9A 3QYWA 4JXFA 4P90A 2JC6A 3MY5A 5CU3A 5DYJA 2GHMA 4DEAA 2AUHA 3QZIA 1K2PA 1MQ4A 2J5EA 4JBVA 3FPMA 3GU6A 5D7AA 2VX0A 4M97A 3REPA 1ZLTA 2ETKA 3BYUA 1J91A 4QP1A 5HNIX 5M07A 4FSRA 2DUVA 2ITUA 3KGAA 4XG8A 4Z16A 4EJNA 3EQPA 4CKJA 3NW6A 3PFQA 4PPAA 5CS6A 5I9ZA 2JAMA 4NK9A 2VO7A 3MDYA 4B7TA 4L46A 2C5VA 3QXPA 2QNJA 4PF4A 3KMUA 1T45A 5EDQA 4R7HA 4NW6A 2XCKA 4BGHA 3FKLA 4CFWA 3JY9A 4EK3A 3FSKA 4F6SA 2VD5A 5HBEA 1G5SA 2WTCA 3OEZA 4F7LA 4EONA 2QG7A 3BV3A 3DBDA 2GU8A 4XG9A 3NZ0A 2BCJA 4PRJA 1YDTE 4FTJA 1ZMWA 1YKRA 3FSFA 5DEYA 4CFVA 4B99A 4ZMEA 2LGCA 3KA0A 5LWNA 3RM6A 4RBLA 4MHAA 2YN8A 5AP2A 2A1AB 4PPBA 2YLEA 3LFEA 2RFNA 2XRWA 3PY1A 2GCDA 4G16A 4YC6A 3SA0A 4IX6A 2RL5A 2NO3A 2QR7A 5CSVA 4EHEA 3N4TA 1ND4A 4DH5A 4Q9SA 2BTRA 4YTCA 1WAKA 2RIOA 4BCFA 4O7LA 5HTCA 4EH8A 4CD0A 2XCHA 2OIDA 4GKIA 4AZWA 4G6NA 4YHJA 1Y57A 4L7SA 4LG4A 4MEDA 5D12A 2QURA 1WBTA 5KMJA 3FHIA 3ETAA 3EIDA 4QTCA 4UALA 2I6LA 3EQFA 1KUTA 2VGPA 3QCYA 3WZEA 4FOBA 5AR2A 3FYJX 2WEVA 5D10A 5A54A 2GMXA 4GSBA 4DH8A 5IQAA 2J90A 5HD4A 4AAAA 2GPHA 2J50A 4KBCA 2IZUA 3QCQA 5HIEA 1GZKA 2VTTA 5D41A 2YIWA 4Z3VA 1UV5A 3O8PA 3MFRA 4QO9A 5AR5A 3FMKA 1BLXA 5CQUA 5GZ8A 1QPJA 2YJSA 2PY3A 2PZIA 3BKBA 3CR0A 3E8DA 3MVHA 5ICPA 3O23A 1OUYA 3TDWA 3KVWA 3PVWA 4IC7A 4EHGA 1PXKA 3BX5A 2UVXA 2C6EA 4U81A 4M69A 1AD5A 3TN8A 4EORA 4FMQA 1G8SA 5AFVA 4EC9A 5BYZA 2JKQA 2X8IA 1R39A 1W82A 3ORZA 3DKFA 5IEVA 5M09A 4G2FA 5AV3A 3L9PA 3LCKA 4FSMA 5IG1A 5A46A 3A4PA 4PTEA 1PXJA 4Y46A 4Y85A 2V7OA 2RKUA 2YAKA 2R3QA 4QPAA 1XR1A 3SC1A 3II5A 2ZMDA 5G6VA 5FXQA 2F49A 5CU0A 4DC2A 4F09A 3BHVA 2R3HA 2PWLA 4TPTA 3VQHA 3DOGA 2UW8A 1WVXA 3E64A 4QRCA 4ZOGA 4FKGA 4D0XA 3FEGA 4BTMA 4AS0A 2RG6A 3HKOA 4WUNA 4ZJIA 5BX0A 2Y4PA 4BDDA 4EUTA 3JVSA 2P3GX 2O63A 4IB1A 4CT1A 2QD9A 2VN9A 3OTVA 5CEQA 4C3FA 3TUDA 1ZXEA 5TR6A 3BU6A 5JRSA 4CTCA 2F57A 2J0MB 2UZLA 5EG3A 5L3AA 2HELA 2QHMA 2B54A 5A6NA 4PDYA 1BL7A 2PMNX 1H0WA 1PYXA 3R8VA 4UBAA 5CU2A 4GVJA 4ANOA 5BMSA 4RX7A 5HTIA 3SVVA 3IGOA 5ANGA 2GNIA 3EN6A 4RJ5A 5KMOA 2CGVA 4FL1A 3EN9A 3G9NA 2BILB 4BKZA 3VN9A 3MJ2A 4TW9A 3C4CA 1UU8A 2PVHA 4JX3A 2BPMA 5BVWA 4WT6A 3VF9A 3WIKA 4ALVA 2UW4A 4MD9E 5K4JA 3R1YA 4RPVA 4TZRA 3DA6A 5I3RA 3LPBA 4HNFA 2E9VA 2I40A 4YLJA 3FI3A 4XHKB 4EYMA 4GT5A 5E8WA 3PA5A 2PVMA 4S34A 5BVKA 2EWAA 5IMEA 4UXQA 2WHBA 1NVRA 3IW4A 3RPRA 5L6WL 3TZMA 3RVGA 4D1XA 3KN5A 3BHHA 2WMXA 4RJ3A 5L8JA 3HNGA 4RA5A 1OL7A 3BYSA 4RVKA 4YTHA 5AEPA 3GU7A 4BCKA 4FX3A 5J9YA 1FVRA 4FTRA 4DH1A 3C0IA 4CKIA 4R1YA 4ZY6A 4JQ8A 1FBNA 1H26A 3EMGA 1ATPE 5L2QA 3DDQA 3QTXA 4HVDA 4II5A 4V0GB 3G0EA 3LJ0A 4G1WA 1IG1A 1RE8A 3P7CA 3C4EA 4ZTLA 4KSQA 2WELA 4CV8A 3OBJA 1PF8A 3E3PA 4HVHA 5C4LA 3LFAA 4C3RA 1GOLA 3MTFA 5M56A 2SRCA 5EI8A 4XNEA 5A4EA 2G9XA 1Q3DA 2WTDA 4K2RA 1QMZA 3QUEA 5FEEA 1R0EA 4BWPA 4BKJA 3S1HA 3FV8A 1CKIA 3R2YA 5FTQA 4IE9A 5AR8A 4O22A 4OUCA 5IMXA 1KV1A 1DS5A 2XIYA 3R01A 3PIZA 5T6KA 4FZDB 1ZMUA 4IM0A 2PL0A 5D11A 3FZSA 3RMFA 5KBQA 4V0GA 4FF8A 4O7TA 5CI6A 5A14A 3GU4A 1ERKA 2JIVA 3VULA 5H8EA 2GNJA 3BHTA 4LRMA 5EDPA 5HG9A 5KMKA 1UU7A 1E9HA 3TNHA 3HRCA 2B9FA 2WQMA 3COMA 3DB6A 4A7CA 1RJBA 2XM8A 3GOPA 1WZYA 4L01A 1X8BA 3JYAA 3DK7A 3PA4A 4ZTHA 4BCQA 3JUHA 3PY0A 4M12A 2OO8X 3VBYA 4NL0A 4J71A 4JDIA 4I21A 3M2WA 3MH3A 5ANIA 1R3CA 5AV4A 2YFXA 4EWQA 3OWPA 4ZSLA 3QHWA 5C8NA 1URCA 2YLFA 4KIQA 4TT7A 2PZRA 4FE2A 4O81A 4X0MA 1ZZLA 4BCGA 3OZ6A 1IR3A 4G3CA 2W1ZA 4KKGA 4QMOA 4D2WA 3F9NA 2I0HA 5CU4A 3H4JA 4G3EA 4R7BA 2JFMA 3QTIA 2GHLA 4M68A 3ANQA 3U55A 4G6OA 4M67A 4H3BA 4BHNA 4K77A 2CGUA 4PP7A 2C69A 3F6XA 3R02A 2XP2A 3QFVA 4WBBB 3TV7A 4D28A 1DM2A 2XKCA 3RGFA 1PXOA 4FV1A 2AC5A 2PE1A 4K11A 5HG5A 3WZDA 4E4MA 3QCSA 3F5XA 1FINA 3I79A 1YXVA 3ZO2A 3ZSGA 5FEQA 4DEBA 2R64A 4M84A 1V1KA 2OJGA 2FO0A 3BGPA 4PWNA 3Q5IA 5ETIA 3PY3A 1LEWA 4KBAA 4O0RA 5DT4A 3FMLA 4L00A 3R1QA 3BEGA 2UZNA 4IVCA 4EH9A 5J95A 2HOGA 5IUGA 2J0IA 2P2IA 3P0MA 3WILA 2JBPA 4FV8A 3ZRMA 2B55A 4MD7E 2HCKA 3NNWA 2WFYA 4IB3A 4UMRA 5IQDA 2ZV8A 4CMUA 3EYGA 3GENA 5EYMA 2BALA 4CXAA 1JKKA 1SZMA 1DI9A 4L9IA 3MW1A 5A6OA 4Z9LA 3OOMA 4XCUA 5E92A 3HMPA 2GTNA 3CD8A 2WQEA 3I0QA 4O7RA 4TYIA 4QMYA 1MRVA 5DH3A 3ZFYA 2B0QA 2C1AA 4MBJA 3F7ZA 3R28A 4Z55A 5CAQA 4UV0A 2GQSA 1OMWA 3GBZA 3I7BA 4C57A 4JOAA 3R04A 4Y5HA 4C4EA 3EWHA 3E93A 2VTOA 4DT8A 4R3CA 4DGMA 4BDJA 2OJJA 4ITIA 3LLTA 5EH0A 3TZ8A 4S30A 3FMDA 4F70A 1REJA 3FUPA 2QO7A 1BMKA 3OCGA 3ITZA 4GH2A 4IZ7A 2VWBA 3IECA 4FSZA 1P2AA 3MFSA 3AGLA 2HZ4A 2QKWB 4W9WA 4M14A 4EUUA 1BL6A 2J0LA 2IVTA 3HMOA 3C50A 3NRMA 4YJQA 4QMLA 4BBEA 4FZ7A 4U41A 1PMNA 3LW0A 4O91A 1K3AA 4XP3A 2B9JA 4D2TA 1SVGA 5DLSA 3SD0A 2VGOA 4PMPA 4DLIA 3HV5A 4WBOA 5EW3A 4B8LA 4HZSA 3V5JA 4IAZA 3VF8A 2FB8A 2IZSA 3C4XA 5DN3A 3D0EA 1UKHA 3TEIA 1HCLA 2VTNA 2OXXA 4R77A 1B39A 2XJ1A 4FUXA 1UU3A 3RZBA 3F3WA 5GJGA 4DT9A 2F9GA 4BC6A 4OTRA 2Y6MA 2B9IA 3ZO1A 5AP5A 3C4FA 4D2RA 2XK9A 3D5UA 4RFZA 2PMLX 2QR8A 5KZIA 3NVMB 3BYMA 1ZARA 2XBAA 2OZAB 4EK6A 4QYEA 3UNZA 2WU7A 4F99A 5AP6A 3R73A 4TXCA 1OVEA 4NCTC 4QQ5A 3PJ3A 2R3GA 4IWPA 2A2AA 3F61A 5A4LA 5IEXA 3NIZA 5A3XA 5E8SA 4C35A 1ZOEA 3HAVA 2EVAA 5AAEA 4FYNA 4OBOA 4V04A 3CC6A 3W10A 3ALNA 4UMTA 3UNJA 1IA8A 2PVLA 3NUXA 5EK7A 2ZB1A 4Q5HA 2X9FA 1XH7A 2XH5A 3BYOA 1UNHA 4IM3A 5IDPA 2BMCA 3BHUA 4IANA 3VBVA 4F63A 2XKFA 4I5MA 1PKGA 2PVFA 3MV5A 4PNIA 3ZHPC 2FVDA 2QG5A 4IAIA 1KE6A 1KE7A 5AV1A 1PY5A 4DBNA 3NCZA 4Z7GA 4LM5A 5IQFA 2PE2A 3CTJA 3CKXA 3PIYA 4IQ6A 5HCZA 4EBVA 2RGPA 4FKIA 5FXSA 4FI1A 2UW5A 3IW6A 3W32A 3QQUA 5JFXA 3H0ZA 3F88A 1L3RE 3POZA 4HGSA 2Y8OA 3FQHA 4AA4A 2ITYA 2DYLA 5IA2A 3I7CA 3E63A 1JSVA 2IWIA 5AP1A 1B38A 4ZMFA 4FSNA 3KXMA 4TY1A 4XG4A 4ZTSA 3AXWA 4Q9ZA 4FKPA 2QOFA 4O7YA 4CSVA 3DK3A 4ACGA 2BHHA 4YZNA 3KC3A 1M7QA 4PMSA 5E9EA 4LV5A 5CT0A 4ANSA 5B2LA 3TIYA 3ANRA 5IA3A 4HCVA 5JEBA 4FKWA 3SOAA 4NIFA 3S95A 4GV1A 5F1ZA 5HCYA 4AZTA 3A99A 3OOGA 5JGDA 3HDNA 4GFGA 5DEWA 1JBPE 1UNLA 4M7IA 4IW0A 3NEWA 1UNGA 1PXIA 4NM3A 4YZ9A 5H8BA 1RQQA 3THBA 4NTSA 1U59A 4UZDA 3FPQA 3SLSA 4FTOA 3HUCA 2BFYA 2XIZA 1M52A 3QGWA 5DPVA 5FGKA 5HNGA 4BCPA 4TWCA 4FIEA 1PYEA 5EW9A 3NLBA 4YTIA 4C59A 4AGUA 3R9NA 4G31A 2W1FA 3IW5A 3SG8A 5L8KA 1YRPA 3ZC6A 2C6DA 4QMMA 3VS0A 3GU8A 3L8PA 4I41A 5C01A 4J52A 1O9UA 4IBMA 4ITHA 5KHXA 2W5HA 3PZHA 1I09A 4FK3A 4NWMA 4I6FA 4W4VA 2PVJA 3QU0A 2XZSA 5GJDA 3VS1A 3VUKA 3SRVA 5F20A 2GDOA 2VAGA 2C5XA 3MWUA 4I3ZA 4FKJA 4EOIA 2ITQA 3FYKX 1GZOA 3IOPA 5JFSA 1ZZ2A 2HW6A 4F1TA 2QI8A 4LOPA 3QQGA 2QHNA 5IQCA 1EH4A 4N57A 5E8UA 1H25A 2E2BA 2NP8A 2VNYA 1H1PA 3R8ZA 3TT0A 4FG8A 2H34A 2WTVA 5FUTA 5K5NA 4HZRA 4EKLA 5AAFA 4MX9A 2A19B 4LL5A 3E7VA 3A8XA 4QTEA 5FG8A 3HAMA 5GHVA 1GAGA 3F82A 1UU9A 4ALUA 3AD4A 4U42A 4LL0A 4D5KA 5KMIA 3ZDIA 4RG0A 4JRNA 3WE8A 2CHLA 4ENYA 1UWJA 4BR3A 1JNKA 2BKZA 3T9TA 4C3PA 4KUJA 1YI4A 3KXXA 3NNVA 3Q96A 4FG7A 4O0WA 3LM0A 4OT5A 4F7NA 5J5SA 4DCAA 5L8LA 3ORXA 2OFVA 4M0YA 2XKDA 1VEBA 2GNGA 3KXZA 4FGBA 4QP4A 3P08A 5JGBA 2B4SB 2RSVA 2V22A 3QC9A 2C5YA 4AOJA 3D94A 3EQIA 3UVPA 2W1CA 2UW6A 4BZNA 4A4OA 4ZTRA 4ANBA 4QYGA 4ZXTA 2UVYA 4NFNA 3PJ1A 3HMNA 4CT2A 4AT3A 2QODA 5LQFA 3MFTA 1M2RA 3CEKA 5LXMA 2XYUA 4XG6A 5LVNA 2EXCX 5CEIA 2W17A 5CF8A 4D55A 4QQCA 5JFWA 3GB2A 3A7GA 3NW5A 3R7VA 3S2PA 5JT2A 3QKLA 5JSMA 3F3VA 4L3JA 4ZLOA 3LFDA 2H8HA 3LQ8A 3C4WA 5M53A 3L9MA 4BFMA 4F0FA 1BKXA 2C6IA 2RFSA 3EZRA 1PXPA 3R8MA 3HLLA 2C5NA 3TZ9A 3WARA 4N70A 4FT3A 2G1TA 2FSMX 4O6EA 1XJDA 4RC3A 4QMTA 4FKLA 3SGCA 3A7JA 5FRIA 3GQIA 4ANLA 3ZFMA 2QOCA 3Q52A 4WG5A 5DE2A 2J9MA 4NTTA 1S9IA 1WBWA 3MB7A 2RF9A 2R3NA 4RWKA 1PXNA 1YWVA 3W2QA 4D4YA 1YHVA 1IASA 4QMQA 4O7WA 3TKUA 3PUPA 4R5YA 5CXZA 2UW9A 3JPVA 4FTTA 2DWBA 3ZEWA 2X2MA 3C7QA 3OTUA 2BTSA 3U6HA 4H1JA 1M7NA 4I5PA 2O8YA 4IH8A 4L53A 3QALE 5ANKA 1KV2A 3MSSA 4FV0A 4K0YA 5AUXA 2C1BA 3R1SA 3BCEA 3ZS5A 4KKEA 3W1FA 4FL2A 4UWBA 4CFNA 1U5QA 4NH1A 4AXAA 2PUPA 3FLSA 5JN2A 3WF8A 4YPSA 1Q8TA 2IW8A 3O7LD 4J7BA 4C4FA 4HYIA 4I5HA 4ZSJA 3VUMA 3LFFA 2VO3A 4K6ZA 5AP3A 4AF3A 3QRUA 2Z2WA 3TUCA 4EH6A 4WOVA 4L3PA 4ASXA 4OBPA 4D0WA 1YXTA 4Y5QA 3R9DA 4FR4A 3NAXA 2C3JA 2QKRA 3ZLXA 4FTKA 5HX6A 4UYNA 3NX8A 3QRKA 4HPTE 4CEGA 4K18A 5J9LA 2J5FA 5EM8A 3KF7A 4A9UA 5FP6A 3CSVA 1PKDA 2UZUE 4GL9A 3HL7A 2X1NA 2GTMA 1FOTA 4MXOA 4UXLA 3P79A 4IDVA 4OTPA 4RFYA 4X2GA 3RAIA 4DFYA 4GUEA 4PDPA 4E20A 4FZAB 4GIHA 3A7IA 4L44A 2JKKA 4AN9A 4EQUA 5IISA 3QWJA 4AZVA 1YXUA 4HYUA 3LHJA 3RPOA 2O3PA 4IC8A 2ITTA 4YBJA 3KB7A 1H08A 3GC7A 4ZLZA 4B9DA 5CF5A 5HE2A 4N6YA 3V8SA 2R7BA 3PXRA 3OMVA 3PXQA 3AQVA 4R7IA 2W1EA 2IZRA 2HY0A 1YOLA 4IWQA 4TYHA 1RDQE 3U9CA 3BYVA 1SNUA 1MRUA 4BZDA 3R21A 3I1AA 5EM5A 4GU6A 3AC1A 3BU5A 4HW7A 3G90X 3FQEA 5HVYA 3LZBA 1TQPA 2JBOA 3RBWA 4R78A 4D5HA 1U54B 1ZYLA 3D5XA 4BF2A 1XBBA 2ZJWA 4MXCA 4MF0A 2ESMA 3ORLA 4J8MA 4RIXB 3UP2A 3DNDA 1MP8A 4MVFA 4GG5A 3R6XA 1J7UA 3BWFA 2XMYA 4RZVA 2ZAZA 4ZJJA 4EOKA 3RP9A 2PPQA 4YHFA 2YISA 1STCE 2PZYA 2W5BA 3KREA 3NWWA 5IU2A 3ZM9A 3Q9WA 1GZ8A 4R3RA 5IH4A 4ORKA 4BB4A 4LGHA 3QTWA 3QZFA 5BVEA 1V0BA 4RX5A 2QVSE 2UZWE 3BBWA 3SHEA 4XG2A 3D15A 5DRDA 3R7OA 3H9RA 3O8UA 3UJGA 4EC8A 4EZ7A 2BKKA 2XEYA 4P5QA 1Q41A 4O86A 3A7HA 3LQ3A 5EYCA 2FSLX 2ETMA 5J1VA 4X21A 3UQGA 1J7LA 5E1SA 3UIBA 2NPQA 4U7ZA 4HGEA 4DAWA 3V6RA 4LV8A 4YZMA 3V8WA 3FMNA 3GI3A 4QTDA 4FTAA 3FDNA 1XBAA 1OIYA 4WKQA 3ULIA 5KZ0A 4DBXA 1H00A 5EOLA 4QTBA 3M1SA 2YERA 3MIAA 2KULA 5C9CA 4C34A 4I6BA 5KMLA 2WMAA 2XNNA 4YO4A 5KCVA 4HYHA 2YDJA 4O2PA 4BYIA 4DE4A 5HO6A 4O0YA 3ERKA 4G5JA 5F9EA 5LMAA 3Q3BA 3GEQA 3EQGA 5CSXA 3VBWA 2V62A 3QTQA 2J2IB 4BDAA 5KBRA 3DQWA 5M4FA 4O7NA 1I44A 3RALA 3TTIA 3F5PA 3VS2A 2P0CA 5AA9A 3VJOA 3SW7A 4DEEA 4USFA 4IX3A 3V01A 5DT0A 3UOLA 4WD5A 3LM5A 5HKMA 4XV3A 5FEDA 3OT8A 2OJ9A 4CMTA 2EXEA 4Q2AA 3BQCA 3OY1A 3UG1A 5CF4A 4PP9A 5JK3A 4N6ZA 2W5AA 3TNWA 4A07A 5D9HA 3I4BA 4QOXA 4YR8A 1IA9A 4LGGA 4EOJA 5GJFA 4M13A 3P5KA 4R5SA 5K5XA 2BRHA 2WGJA 3QBNA 3VBQA 1XQZA 3LXKA 3VUDA 3MJ1A 4TYJA 2Q83A 2YCSA 1WFCA 3W2RA 4C2VA 3HGKA 4W4XA 1SNXA 1OBGA 1OIRA 1G3NA 2X8DA 3R2BA 4QMVA 3D14A 5FD2A 4NM7A 3VHKA 4EBWA 4QTAA 2HZ0A 3EOCA 3OWJA 4FZ6A 2W05A 3IDPA 4R3PA 5AR4A 4CMOA 2WMVA 4LRKA 4AZFA 3DTWA 3DGKA 3EB0A 4TWOA 2YDIA 2BAKA 2C30A 3V5TA 4UWCA 2W9ZB 4MD8E 3ZUVA 2OKRA 3VAPA 4ACHA 1DI8A 2JD5A 4YMJA 2OIQA 1U54A 4X2FA 4I22A 1OM1A 3NUNA 4FIHA 3BE9A 4QPMA 2CGWA 2W4OA 3K3IA 2Z7SA 4I0SA 4BWXA 5H3QA 4XBUA 4H1MA 2VO6A 3AC2A 3SOCA 1UVRA 3NSZA 5FWKK 2A27A 4U8ZA 5EI6A 5HIDA 4MTAA 3UO4A 4ZSEA 3PPJA 3A62A 4ZEGA 1ZY5A 2Y7JA 4J1RA 3RJCA 4D2PA 3ZOSA 2CCHA 4G5PA 3E87A 2VV9A 2ZB0A 3WYXA 4F9AA 2I7QA 4JR7A 4DTBA 3DNEA 2XBJA 5J7HA 1OKYA 3CPBA 2Y4IB 1GZNA 4WG3A 4WNKA 2OSCA 5DR2A 5C8KA 5I4NA 4NKAA 2CN8A 3QD3A 3ZSIA 4HVGA 1ZYDA 2ONLC 2ITZA 4DG3E 4XP0A 1M2QA 1F3MC 3IO7A 3BLHA 2ITVA 4WIHA 4LRJA 4D58A 4DITA 3U4UA 3C0HA 3HEGA 4IB0A 3FL5A 1YOMA 3P7AA 4I93A 2VTRA 3CTHA 4MKCA 4EYJA 2PVYA 3LFSA 4XRLA 3UP7A 1CKJA 1JSTA 4S2ZA 3WF5A 4UEUA 5IZFA 3NYVA 2PE0A 2CNVA 1H07A 4PL3A 2OXDA 3AT2A 3AGMA 3DBEA 4L42A 5EYKA 2QOKA 4JS8A 5K3YA 3ZUUA 2BR1A 1H1QA 3QLGA 5BUEA 3BV2A 2R4BA 5L6PA 3EQRA 3MGYA 4OTFA 3I81A 2B52A 3GVUA 4LUDA 4OW8A 3I6UA 5AA8A 3ZXTA 2OK1A 2J0JA 2RFEA 4L68A 1PHKA 5FXRA 4A4LA 4AE6A 3VHEA 3F66A 3G6HA 2QOQA 4YP8A 4FSUA 3UOHA 4RIWB 3T8OA 2VWUA 3ZDUA 3EN5A 2YA9A 5M57A 2V55A 4KRCA 2X4FA 3QYZA 4TYEA 3FLZA 5BMMA 2F4JA 4DG2E 5AIKA 3PWYA 3RAHA 4I24A 1KOBA 1TKIA 4FVPA 4AP7A 1XH6A 3ZLSA 1YW2A 4FT0A 4OLIA 4FC0A 1ZOGA 2W0JA 3SDJA 4OAUC 1J1CA 3DXNA 3Q60A 3RK9A 4BZOA 4R8QA 4C38A 2G01A 2WB8A 3QUDA 1PRYA 3QL8A 3H9FA 4G6LA 4MNFA 1H1SA 4TNDA 2VWVA 3AC5A 3R00A 3LFBA 4UMQA 2Q0NA 4RZWA 3ZEPA 3I5ZA 5ANOA 3PTGA 3OVVA 4W4WA 3K5VA 4XG7A 4FTQA 3G6GA 5FDXA 3TCPA 4MNEB 2BRGA 2VTPA 3OCBA 4F08A 3DTCA 3QQFA 3KL8A 4BI1A 2NRYA 4D9TA 4IX4A 3BLRA 5H9BA 3RZFA 3TKIA 4DEHA 4IWDA 4FKSA 3GOKA 3FJQE 4EZ3A 3LKMA 2R0IA 4CNHA 4D2SA 4MBLA 2E9UA 3DS6A 3GUBA 3EYHA 4C61A 5G1XA 5AX9A 4LMUA 4BYJA 5KX8A 4CTBA 3NUUA 3QTRA 4W8EA 5EHYA 5L2SA 3M42A 3Q4CA 3E3BX 3HUBA 2UV2A 2BDFA 3AMYA 3R83A 3RHXA 5IDNA 4NYEA 2FYSA 4ZSGA 4L6QA 4R1VA 2YM3A 5CEKA 4QMPA 3PPKA 5EFQA 2BZJA 4ZY4A 2XJ2A 4GUBA 3VW6A 4WHZA 3SG9A 4RJ7A 1ZYCA 4F1OA 2JDRA 3LMHA 3L9LA 3IONA 5KO1A 4BY9E 3FZTA 3LFQA 3HA8A 2WOUA 2YHVA 3G9LX 1H4LA 4I6QA 2PUIA 5C26A 1Q99A 3C4ZA 4IVBA 5JQ5A 4GMYA 3ZLYA 2QLUA 3KRRA 5JGAA 3R63A 1F5QA 5HEZA 2C47A 4BDBA 3ZM4A 5CAOA 1YHWA 3LXLA 3CXWA 2QOIA 1JKLA 4YLKA 3R1NA 5ACKA 4BDGA 3R8UA 4IEBA 4IB5A 4L45A 3CQWA 3KK8A 1BYGA 1H1RA 2CCIA 4BI0A 1OECA 2IW6A 2W96B 4ERWA 4WO5A 1FVVA 3CGFA 3QZGA 4PTCA 3E92A 4E8AA 3CPCA 3KXGA 3C1XA 5DT3A 3SRVB 4FA2A 2WTKB 5IQEA 1XH5A 4MXXA 5JKGA 4FKTA 1SM2A 4DHFA 4EQCA 1FMOE 3ATTA 5E4HA 3MIYA 2ERKA 4EWHA 2XB7A 5JRQA 3PE1A 4RSSA 4FEQA 1WMKA 5HU3A 1CTPE 3JS2A 4L43A 4V05A 5K0XA 4FIFA 2O65A 2ZDUA 5JZNA 2YJRA 3R22A 1MRYA 4JIKA 3DAKA 2X9EA 4FV9A 5DFPA 4K9YA 4YU2A 4WRSA 2YM8A 4CZYB 3PVUA 4MXZA 4KIKA 3MFUA 2E9NA 3W33A 4FIJA 4NT4A 3VRYA 4IM2A 4YJSA 2C6KA 1PJKA 5JZJA 3OF0A 3VBXA 1FVTA 1W84A 2PVRA 4KB8A 2W4KA 2BZHB 5FBNC 4XMOA 4BDFA 4EI4A 4JI9A 5IH5A 3UO6A 4FGRA 4YJOA 2ZM4A 3D9VA 3MVLA 3UVRA 5L6OA 3CJGA 2YM4A 2ZOQA 3EHAA 5AR7A 3QQLA 3ZUTA 4OTWA 4DGOA 3FXZA 3FQSA 4ZTNA 4FT7A 4J99A 3GC8A 4CFFA 3A8WA 1GIJA 2XNMA 2PK9A 3FKOA 5AP0A 3CP9A 5AAGA 1A48A 4NIFB 2UZBA 5I9VA 2DS1A 1H27A 4U3YA 3PVGA 5EW8A 5CENA 4D4RA 2GNLA 4GFOA 3RAKA 4BGQA 2VTHA 3R8PA 5F4NA 4MXAA 3VW8A 4ARKA 1MQBA 4XLIA 5HQ0A 3DFCB 2XA4A 5T68A 4PPCA 5FDPA 3D2KA 4PX6A 1YOJA 3GC0A 4GVAA 4J53A 4QMZA 3UZTA 2QC6A 2BRNA 5B7VA 3NMUF 3CTQA 3H3CA 1WVYA 4I20A 4XUFA 3CJFA 3QRTA 4QP2A 2QOLA 4E5AX 3PRFA 3EL8A 2VX1A 4Y95A 4J96A 2QO9A 3W8QA 5FQDC 4ANNA 5FTOA 3ID6C 2F2UA 3DBFA 1OL6A 5KKRB 1Q61A 4E5WA 2UW7A 1H01A 5DHJA 2XNOA 2HAKA 2RFDA 2WXVA 3AOXA 2VNWA 4KIPA 3VS4A 2PVKA 4M15A 2C3KA 3EQHA 3C5UA 3EFKA 3FLQA 2J7TA 3NUSA 4PQNA 5DGZA 2YCRA 1Q8YA 5BVNA 3UNKA 4A4XA 5GIOE 3JXWA 4C62A 5KUPA 4WNOA 2PMOX 4U40A 3ZZEA 3JR1A 3EQBA 4PV0A 5EKOA 2A4LA 4ZIMA 4O7VA 3LCSA 2WQNA 1FMKA 4CKRA 5IA1A 4L7FA 3B8QA 2R3KA 2YZAA 2X6EA 4ASEA 3AD6A 3DJ7A 5HVJA 4IVDA 2ZM3A 3DLZA 1NW1A 4UWYA 2XIKA 1NT2A 3ORNA 3N4VA 2FA2A 3LCDA 5LMKA 5K0KA 3TI1A 4CV9A 1KSWA 5CWZA 3NIEA 2VZ6A 4MNEA 4ZLYA 3OG7A 3Q6UA 5LWMA 5ANEA 1Q3WA 2REIA 4NM0A 4TWNA 5EI2A 3MVJA 3W8LA 4FOCA 5BUJA 4LOQA 4RQVA 3OXTA 4FK6A 4TN6A 5JMSA 3OBGA 4BN1A 2IZTA 3ODZX 3A2CA 2YWPA 3LOKA 1OKWA 3PSBA 1ZYSA 3EJ1A 4KWPA 3R8LA 3KCKA 4ZAUA 1VZOA 2WMRA 3ZRKA 4C33A 4ALWA 3LMGA 2JDSA 1XHAA 4FTCA 3ACJA 2VTMA 5L2WA 4WUAA 1XH4A 4UB7A 5GIPE 4W9XA 2DQ7X 3DXQA 3R7EA 3OC1A 3SQQA 2C6OA 3BE2A 1YXXA 3D7TA 3KULB 1JVPP 3EFLA 4JL9A 5FM2A 3TACA 4IAAA 2OICA 1ZWSA 4FV3A 5TF9A 4Q5EA 5CI7A 2BIKB 3K54A 5D1JA 5ANDA 5EHOA 4ZZMA 4BCNA 2X0GA 2HK5A 3F3UA 4NKSA 4FKUA 3PLAE 2YAAA 4XEYA 2BRBA 4ZJVA 3ORTA 4BVUA 5A9UA 3VVHA 5I9UA 2X7GA 4A9TA 3ZBFA 4ENXA 5CSPA 2XNPA 4D4VA 3WZJA 1OBDA 3IDCA 2ZDTA 3RPYA 3SW4A 4JQ7A 4AE9A 5JQ8A 2QOOA 4RFMA 3LLAA 1OKZA 2CKEA 2J6MA 4L8MA 1QPDA 3BHYA 3BRBA 3CGOA 3ORPA 2PZPA 4GCJA 4RMZA 5HE0A 3W2OA 2W06A 1YI6A 4JG8A 3VO3A 1WVWA 3UMXA 5LCKA 4D1SA 1R78A 3DKGA 1CDKA 1KE5A 2ZVAA 3HV3A 4KBKA 4LQMA 4OTQA 1O6YA 2JKMA 4RC4A 4C37A 2GS2A 2CKPA 4ACDA 3GU5A 4P5ZA 4AW0A 2QLQA 4U43A 5CX9A 4AT4A 5HU9A 4QNAA 5AV2A 3ZONA 3ENHA 2ACXA 3FY0A 4FSWA 4GG7A 3JY0A 3W18A 2BRMA 2ZV2A 2IG7A 4YHTA 3V8TA 2BIYA 5CYIA 4F9WA 5M4UA 4NZWB 1PMUA 2GFSA 1O6KA 1M17A 4BL1A 2GSFA 2PU8A 4NW5A 4IFCA 3UVQA 2X39A 3MPMA 3PSDA 1V0PA 5HCXA 4AA0A 2GFCA 4P7EA 5T3QA 4RWLA 4RX8A 5AMNA 4BRXA 3WYYA 3OROA 2PMIA 3FAAA 3OT3A 5HTBA 5J87A 4BIEA 3C13A 3CD3A 2JKOA 5JH6A 5A4TA 2W99B 4FNZA 3FKNA 3QWKA 3Q9YA 5AP7A 3RINA 4BBFA 3DCVA 4DGLC 2CKOA 3KKVA 4GK4A 1LPUA 2QOHA 3KQ7A 3GCPA 2BDWA 1H28A 3D7ZA 5IQGA 3E5AA 4FNYA 4C02A 2W9FB 3U54A 4BDIA 3AT3A 4O6LA 3ZYAA 5M08A 2R0UA 4CFMA 4RA4A 5C27A 4JDJA 4J95A 1LUFA 2IVUA 3QRJA 3TUBA 2WNTA 2WTIA 3NAYA 3P78A 4RX9A 4ZK5A 3QTSA 4YPDA 4DN5A 3WF7A 4CRLA 1P14A 4M8TA 3EQDA 1M2PA 4YTFA 2XVDA 1CSNA 5IUIA 2Z60A 1Q62A 3KVXA 5CASA 1UWHA 5LOHA 3PWDA 4O7ZA 1G8AA 2HIWA 4QYHA 3IW7A 3BLQA 3LCTA 4O84A 5TKDA 4WNPA 5E91A 5HZNA 3MH2A 2R3OA 4O0XA 3F2NA 4CQGA 1OPLA 4IFGA 2VO0A 3NPCA 4YLLA 2WTKC 4GK2A 4DH7A 3CCNA 2OJFE 2V7AA 2BZIB 4X3FB 3ZC5A 5M44A 2VTSA 2ZV7A 3VC4A 4JT3A 4IAKA 4QYYA 1SVEA 1FQ1B 4BGGA 2ITPA
chains in the Genus database with same CATH superfamily
2XYNA 3AC8A 2IW9A 2BROA 1J3HA 4TNBA 2C3IB 5BYYA 1REKA 2WMWA 3KFAA 4ANMA 3I5NA 1WBNA 2YITA 3VS3A 2HZIA 2B7AA 3GCSA 3DY7A 1OKVA 3ORMA 3RNYA 4D2VA 4QD6A 1TQMA 2WEIA 1PXMA 2LAVA 4RRVA 4DEIA 1IAJA 4I5CA 2BHEA 4FVRA 4AWIA 2AYPA 3GFWA 1LP4A 3LQ5A 3Q4UA 4X3FA 3UTOA 4EH7A 4MXYA 3KMMA 1WBSA 3C0GA 4I4EA 3ZXZA 3U8WA 1UKIA 5CEOA 5LVPA 2B9HA 5DWRA 3BQRA 1QPCA 2Z02A 2XK6A 3OCSA 3A7FA 4QMWA 4KRDA 3RWQA 4GRBA 3KEXA 4E6DA 4UMPA 2VWZA 3QKMA 4IXPA 4U80A 4R6VA 4JNWA 4X3FC 3RWPA 3O2MA 3UMWA 4DFLA 5AUWA 5CANA 5CZIA 3BIZA 5ITAA 2X2LA 4APPA 3GNIB 2IN6A 4EJ7A 5LCJA 3UPZA 3HMIA 4W4YA 2GQGA 1BI8A 3Q4ZA 4ID7A 4CYIA 5KHWA 1FGIA 3UZRA 4IZYA 3FMMA 3OEFX 4RIOA 3ZH8A 4S31A 2JFLA 5HE1A 4C4IA 3L8SA 2J4ZA 4KABA 3Q2MA 1OITA 3Q6WA 5DIAA 2ZM1A 3G5DA 2XF0A 3GCQA 3HRFA 4RIXA 5M4CA 3QD0A 2B1PA 4NFMA 4BTJA 5HE3A 4KIOA 2IO6A 3DJ5A 4FT9A 3CY2A 4ACCA 3AKKA 2IPXA 4ANQA 2JDVA 5I9XA 4C58A 3UIMA 5IF1A 4DCEA 2UW0A 3RPSA 5IUHA 2XK4A 2P2HA 1IEPA 2RG5A 4YJUA 5LMBA 3DBCA 2VX3A 4EH3A 4CRSA 4YNOA 3TNIA 4BCMA 3FMJA 3P4KA 4JAJA 4FTMA 4CCUA 3PVBA 4TYHB 4E3CA 3HYHA 3MPAA 4BIDA 4PL4A 1XWSA 2CJMA 5CVHA 3UG2A 1YQJA 4C0TA 4EOLA 3R7YA 4AGCA 1YDSE 3L9NA 4IMYA 2YCQA 3DAJA 4AW1A 5IA0A 2YABA 5E90A 4HYSA 2EU9A 4DA5A 3DT1A 3CQEA 5CQWA 5HGIA 3GGFA 4O0VA 2BDJA 1P5EA 3GCUA 2WMSA 3E88A 2ONLA 3MA6A 4JX7A 5M06A 5AUYA 2HZNA 2QOBA 2UZDA 4NCTA 5KMNA 1QL6A 4O0SA 3F2AA 1YWNA 5DNRA 5FLFA 4B6LA 5HORA 2XM9A 3E8CA 4QYFA 4USEA 5KKRC 1T46A 4AUAA 4NSTA 4NM5A 4U97A 3UPXA 4CGAA 5AUVA 4F0GA 3H9OA 3B2WA 4BWKA 2CGXA 3PZEA 1WBPA 3OS3A 3UO5A 4UN0C 4MAOA 5C4KA 3DKCA 5HESA 1E1XA 3PIXA 3QA8A 5B0XA 1GIIA 3IPHA 2HW7A 1JKSA 4XV1A 4CZTA 3QD4A 3S00A 4IIRA 3TV4A 4JBOA 4ASDA 3OP5A 4GYGA 4LUEA 4JQEA 4FYOA 5HOAA 4O0TA 5EOBA 1Q24A 4OTHA 3NCGA 2W1IA 4FT5A 5CVGA 4O1OA 2HWPA 3BBTB 3NNXA 5IQHA 3H0YA 2W1GA 2C0IA 2OGVA 1W7HA 4F6UA 1PMVA 5AUTA 5BPYA 3BWJA 2G15A 4G34A 3EL7A 4IHPA 2R3FA 5AM7A 4EOOA 2P55A 3FI2A 4DFXE 3B2TA 4IDTA 2R5TA 4MF1A 1XKKA 4F9CA 3AD5A 2GQRA 3F7WA 5TT7A 3ZFXA 4E93A 3F5UA 3AC4A 4PL5A 4QP3A 4DH3A 3L8XA 3W55A 4IWOA 3BI6A 4F6WA 3QX4A 3W0OA 3GQLA 2VWWA 4N0SA 4AN2A 1OI9A 4E4NA 4DEGA 2P33A 2YIYA 4DF3A 3DJ6A 3Q4TA 4QP9A 5TOZA 2CLQA 4MK0A 3UYSA 3EKNA 4DFZE 4FEVA 1Q8ZA 4C4JA 4TKSA 3O50A 3QAME 4U5JA 4UY9A 3W16A 2NYAA 3K2LA 4C4HA 2BAQA 5E8YA 5KMMA 4U6RA 2WMQA 4DGGA 3P23A 3RK5A 4BJJB 4YNEA 3VUIA 5IH6A 1YI3A 1OIUA 4ACMA 5IQBA 1SYKA 2OU7A 2Z8CA 5EM6A 2UZOA 2VRXA 4X2NA 4AOTA 4EOSA 2BZKB 3V04A 4APCA 3TJCA 2WMTA 3E62A 4HPUE 2XK3A 2VWIA 3HZTA 4U79A 3S3IA 3QHRA 3O71A 4MBIA 3SV0A 4E4LA 3U6IA 3BL9A 3C51A 2IF8A 4DHJA 4PMTA 4NJ3A 3EZVA 1TVOA 4P2KA 3A61A 3ALOA 1P4FA 4QDEA 3D4QA 2XJ0A 3ZRLA 2YWVA 3B8RA 4ZS0A 3WF6A 2GHGA 4RVTA 2Y6OA 1E1VA 3U4WA 4D9UA 2GS7A 3KF4A 3PP0A 4KD1A 2YDKA 3OFMA 4PUZA 3E8NA 2ETRA 3QTUA 3T3UA 3VUHA 1Y91A 2Y9QA 3QCXA 4E7WA 1IRKA 5GZ9A 3VS5A 3G51A 3KIOC 4GYIA 4UZHA 2QQ7A 3QZHA 3V5WA 4AZSA 5FM3A 1LR4A 5H2UA 3DBQA 1YXSA 2XK7A 4U45A 4Y72A 4YJVA 2WO6A 4CFXA 3R7IA 1YVJA 2ITWA 3IK3A 4OT6A 4EK8A 4G9RA 5DRBA 1BX6A 4RJ6A 2BAJA 1Y6BA 4D4SA 5J1WA 1ZRZA 3T3VA 3FE3A 4JIAA 2XANA 3PRIA 3F3TA 4QQJA 5TE0A 2A0CX 3BZ3A 2FGIA 2VTIA 5CAUA 3WBLA 5EKNA 4FUYA 3NFFB 4F4PA 4L67A 4QPSA 1JKTA 2NNWB 3BGQA 4Y83A 4E6QA 4FV4A 2OF4A 4X6RA 3KRJA 3W0RA 3LFCA 3GP0A 3IOKA 1W0XC 2XIRA 4TTHB 2W1DA 5IA5A 3QTZA 4BI2A 4DYMA 5AIRA 1OUKA 5C03A 4DDGA 2JLDA 1XBCA 2JIUA 5J5TA 4OTGA 1JAMA 5IPJA 1W83A 3LAUA 1YWRA 3IGGA 4EEVA 4QMNA 2WU6A 3EN7A 4IJ9A 4QP7A 4BCIA 4HNIA 2BVAA 3RAWA 5BVFA 3QLFA 4GJ3A 2XS0A 3EN4A 3LXPA 3OUNB 4G9CA 3RCJA 5DMZA 3TMOA 5LARA 3ACKA 3HV7A 5CLPA 3D2IA 4O0UA 4XP2A 2CSNA 2XK8A 3HV4A 3F2RA 2OZOA 3OWLA 3UBDA 2HWOA 4JMQA 4YURA 4X2KA 5HLNA 4GU9A 3LFNA 2WTWA 2OH0E 2ERZE 2UZVA 4JVGA 5E8TA 1XH9A 4KIKB 3E7OA 4XBRA 4BDCA 3QX2A 4EH2A 1K9AA 4C7TA 1H24A 1GNGA 3MI9A 4BIBA 3RTPA 3LCOA 3FLYA 4M69B 4ZSAA 3LJ2A 4OBQA 2H9VA 2OWBA 4K8AA 3HMMA 4J8NA 3A4OX 4JBPA 4PTGA 3PXKA 3IG7A 3KU2A 3R0TA 2X81A 4XV9A 2PYWA 3KXNA 5AUZA 2R3MA 3KULA 3RNIA 3PP1A 1GIHA 3MY1A 1Y6AA 4AFEA 3TTJA 3PYYA 4KS7A 3Q9ZA 3T9IA 3BGZA 1FPUA 2CMWA 2PZ5A 5F95A 4MQ2A 3QC4A 3DLSA 1J1BA 3TJDA 1M14A 3UC3A 3IQ7A 4L52A 5AX3A 1NVQA 1URWA 4U9AA 3TDVA 4RJ8A 2W1HA 3OXZA 2CNQA 3TV6A 4YZCA 5I5ZA 4IAYA 3O51A 1UA2A 3PLSA 4G17A 3G15A 2UZEA 3ORIA 4GS6A 3PG3A 3ODYX 3MY0A 4GIIA 2CPKE 3ORKA 4O4DA 3NGAA 5HBHA 3R9OA 3VRZA 3PXFA 1W98A 3TZ7A 1NVSA 2I0YA 4XG3A 4OGRA 3WZKA 3FMEA 4O21A 3MS9A 3MVMA 3UDBA 4CQEA 4PDOA 3G33A 4E4XA 4XS2A 4FKOA 4PY1A 5EQPA 2C0OA 3WIGA 2H96A 2W7XA 5A4CA 2X8EA 3MN3A 3FY2A 4EH4A 3QUPA 3QA0A 3Q5ZA 5DBXA 1ST0A 3U6JA 1VJYA 3FXWA 1CM8A 4H58A 1OL5A 1OL1A 5CEPA 4UYAA 4Z7HA 2I0VA 4FTNA 3NS9A 2OZAA 4X3JA 4BTFA 4EQMA 1VYWA 3HRBA 2CN5A 3W2CA 4FODA 1XO2B 3EKKA 4CG9A 5FTGA 3PPZA 4H3PA 4ERKA 3IS5A 5DR9A 1OZ1A 3I6WA 4LMNA 4KKHA 4BJJA 5CXHA 5LVLA 4DFUA 3Q9XA 4QT1A 2Z7QA 3ELJA 4NUSA 4GT4A 2KTYA 4YSMA 1O6LA 4AGDA 5GNKA 2WTJA 4X2JA 3L8VA 2C6LA 1H0VA 2YEXA 3LVPA 4S33A 3EFJA 5EM7A 4M66A 1W8CA 4EH5A 4RJ4A 1OGUA 3AC3A 3DAEA 4FTUA 3ZBXA 3PE2A 3KRWA 3NUYA 3QGYA 3PSCA 3ZO3A 3RK7A 4BCJA 5HBJA 3OW3A 2ZV9A 4JAIA 4B8MA 5CSHA 2OIBA 3Q2JA 1WCCA 1U46A 4DINA 4HVIA 3QXOA 1AGWA 4HCTA 2E9OA 2R2PA 4AFJA 4I0RA 5E8VA 4YSJA 3UQFA 4U3ZA 4O82A 4DFBA 2XIXA 3NYOA 4P4CA 4YJNA 2YZLA 2XNBA 4QNYA 2HENA 4CG8A 3HP5A 1JSUA 4BDKA 4EHVA 4FKRA 2EB3A 3D83A 4FKVA 2YIXA 3PXZA 4B0GA 3TXOA 3DK6A 5AWMA 2I0EA 5D7VA 4FV5A 1APME 5L4QA 1HCKA 2C6MA 3FLWA 3VNTA 2HXQA 2CLXA 2OJIA 2C6TA 1Q5KA 4FV7A 2O2UA 4WNMA 1BUHA 1KE8A 2VUWA 3KK9A 2R3JA 3KRLA 3DXPA 2O5KA 4FTIA 4MWHA 3ULZA 2O64A 4GT3A 4RLKA 5AR3A 1ZMVA 3UE4A 5EDRA 3KRXA 3P7BA 3QQKA 4TYGA 5EHLA 4DTAA 4F78A 4AW2A 1NY3A 5DI1A 3CY3A 3JVRA 2IJMA 5HLPA 4BCHA 4RGJA 3IW8A 2JGZA 1OL2A 2Q0BA 4RQKA 3COIA 5HO7A 3H10A 3SX9A 3K3JA 4F7JA 5HX8A 3OHTA 5CVFA 4RVMA 4M0ZA 3ENMA 5DG5A 3BL7A 5HLWA 5AUUA 4XYFA 3HECA 3VIDA 4FEWA 4CFUA 2QONA 4IX5A 4AN3A 1LEZA 4YZDA 4IADA 4WA9A 4DFNA 5EQEA 4FV6A 4BHZA 1H1WA 4F7SA 2E9PA 4JLCA 3MH1A 4EKKA 1Z5MA 5CAVA 3V5PA 4BCOA 4RWJA 4FIIA 4Y73A 3UOJA 3I60A 2X2KA 4KSPA 4A06A 3QQHA 4E26A 1H8FA 5KNJA 5C1QB 2JEDA 4UMUA 1QCFA 3NUAA 4FSQA 2C3LA 4XX9A 4FIGA 3U87A 1G8JA 1JQHA 2JIIA 3N4UA 1U5RA 2VU3A 1FGKA 5E1EA 3G0FA 5F94A 3TIZA 1WBVA 2QCSA 2Z7LA 2IVSA 3RM7A 4O7SA 2WIHA 5CT7A 4OAVB 4DHIB 5EYDA 4ZTQA 3FC2A 2F7EE 5KE0A 3UC4A 3F3ZA 4FNWA 3VJNA 4ASZA 2W4JA 1XMLA 3MPTA 1Z9XA 2C5OA 4ZTMA 4L3LA 2AC3A 5CY3A 3D5VA 2VWXA 2WQBA 4MYGA 5E7RA 3AG9A 2YACA 3SXFA 4QMSA 3LE6A 3TDWA 3RI1A 5B2KA 5B2MA 4FBXA 5HG8A 3H30A 3NUPA 3V3VA 5CNOA 3NDMA 5CU6A 5ETAA 5LVOA 2F7XE 4YBKA 3S4QA 4LGDA 4Y8DA 4QP6A 2VTLA 3ZZWA 4LOOA 3DU8A 2WMUA 2JDTA 2EXMA 3OCTA 4UX9A 5GINE 4G3FA 3AMAA 4ZP5A 2X6DA 3R9HA 3HV6A 4EOMA 4X7QA 3SKCA 2GS6A 3RCDA 4O2ZA 2QO2A 3R9RA 3FZ1A 4CZUA 2PUNA 3K5UA 3O8TA 4AACA 3O96A 4FICA 2UVZA 3EQCA 3ZMMA 4AOIA 3KN6A 4BDHA 4C36A 2FSTX 3COHA 4IJPA 5M4IA 3ROYA 5I0BA 1WBOA 2J51A 2YCFA 4D1ZA 5HO8A 3G2FA 4CYJA 3TNPC 2ZYBA 4TRLA 4AQCA 3NYXA 4AW5A 1V0OA 5AP4A 1A9UA 2X7FA 3AMBA 3R71A 4I1ZA 5M55A 1ZOHA 4QQTA 1YDRE 3ATSA 2ITXA 5HICA 1NA7A 3TYKA 2YIQA 2PSQA 2P4IA 5CEMA 4ONAA 4FEXA 4GEOA 3M11A 4RLLA 1TFFA 3OY3A 2WAJA 4CVAA 3HDMA 4FSYA 3IDBA 4I4FA 5HHWA 1IAHA 4IACA 4FKQA 2HY81 4EZ5A 3OD6X 3QQJA 4AGWA 4O83A 1B6CB 2XARA 3N51A 1NXKA 1OIQA 3P9JA 2Z7RA 1HOWA 3GC9A 2UZTA 2YM7A 2OFUA 4X6QC 3CBLA 3ZCLA 4IZ5A 1TQIA 4MH7A 3NNUA 2B53A 4RIWA 4BICA 5CAPA 3GCVA 3FZRA 5CALA 1PMEA 4S32A 4F65A 3F69A 1J7IA 1XH8A 3ZO4A 5FP5A 4FEUA 4JR3A 2Y4IC 4JBQA 4E5BA 4WSYA 3VS7A 4AZEA 3O7LB 1SVHA 2HXLA 3DPKA 3QRIA 1Z57A 5BVDA 2IVVA 5CTPA 4IAFA 4FTLA 3O17A 3WI6A 3TM0A 2PTKA 3OXIA 4OTDA 4O27B 5HIBA 4FSTA 4NU1A 3KCFA 3C9WA 5HD7A 3MA3A 2V5QA 4O1PA 3FMHA 5DR6A 4GJ2A 3F5GA 4AA5A 4LV7A 4C4GA 3V5QA 5L2TA 3QD2B 2PULA 3VQUA 3HP2A 4CLIA 2G2IA 3DFAA 3Q32A 4F0IA 3BLAA 1JPAA 2CDZA 4OTIA 3PDTA 2WMBA 2XNGA 4ZY5A 4IVAA 5BQ0A 4OR5A 3P5JC 3ET7A 4WSQA 5H8GA 1GY3A 1U4DA 3PXYA 4G3GA 2O0UA 4O38A 1OPKA 3E8EA 3FHRA 3DV3A 4HOKA 5ETFA 4HVSA 1S9JA 1Q8UA 2ITNA 3KMWA 3UIXA 1OB3A 5CF6A 2X4ZA 2XNEA 4ZZNA 3BELA 5I3OA 3R7UA 1RW8A 3FC1X 4U0IA 3BEAA 3OWKA 4YGAA 4F9YA 5JFVA 3FZOA 3UIUA 3NFGB 1KOAA 4J97A 2OF2A 2PVNA 2VTJA 2WQOA 1P4OA 4FL3A 2VTQA 3PJ8A 4GFMA 4J98A 4LI5A 3WZUA 2J0KA 2FH9A 4KAOA 4DGNA 2WPAA 2H6DA 3GFEA 3VWAA 4ZZOA 5BVOA 3LJ1A 4YC8A 3ROCA 4A9RA 3MESA 5IA4A 4DHZA 4H05A 5IQIA 4DDIA 4USDA 4YJRA 5AJQA 3SAYA 3FBVA 4TWPA 4H36A 3ZTXA 4AG8A 5ANJA 5K4IA 2R9SA 2EUFB 3DQXA 4MQ1A 2FSOX 4DG0E 3BU3A 4XOYA 1JOWB 4XH6A 3TL8A 1JWHA 1ZYJA 4C8BA 4FG9A 4I0TA 4O4CA 1VR2A 2XUUA 4RC2A 3FXXA 4AT5A 4KA3A 2ITOA 3V6SA 3D7TB 5ACBC 5I9YA 1SMHA 4FZFB 3ZSHA 1Y8YA 1KE9A 3EFWA 5IEYA 3V5LA 3VUTA 4JG7A 3AT4A 3VS6A 5E8ZA 2JDOA 4EHZA 2XRUA 4O96A 2OLCA 5DA3A 3BPRA 2OXYA 3ZLWA 1DAWA 3FL4A 4XOZA 4MWIA 3VBTA 4H39A 3FI8A 4RT7A 3QKKA 3HA6A 3FZPA 4JDKA 4AU8A 2YM5A 3DZQA 2V0DA 5IKWA 3CLYA 4QP8A 3UQCA 3Q53A 1R0PA 3MBLA 4GKHA 5HNBA 3UOKA 4KINA 4BDEA 3U9NA 2BUJA 4QMXA 1CMKE 2R3PA 1ZAOA 3COKA 5HG7A 4PMMA 1DAYA 3KY2A 3TWJA 4M3QA 2OI4X 3P86A 2YM6A 4HGLA 5J79A 1F0QA 3GT8A 5C8MA 4FNXA 1KWPA 5J7BA 3UODA 3EH9A 4I23A 2R3RA 4BKYA 4NEUA 3WOWA 5J8IA 3W2PA 4E1ZA 5DOSA 4FVQA 4H3QA 3FLNC 4B4LA 5HI2A 4KNBA 4JRVA 2GNFA 3MH0A 1VYZA 3HX4A 2PUUA 4BTKA 4CCBA 4EK4A 3I0OA 4YUQA 4NJDA 3C5IA 3DKOA 5BNJA 5BUIA 3CS9A 3R7GA 3N9XA 4TL0A 4ZS4A 4I6HA 4EK5A 3CKWA 4MCVA 2OG8A 1A06A 2OH4A 4GK3A 3TNQB 3LMIA 1Q8WA 2JITA 3KXHA 4G3DA 3U51A 1BI7A 2IEWA 4DTKA 3A60A 1Q97A 3PJCA 3S0OA 2ZMCA 5EQYA 1R1WA 3SXSA 5BYLA 3OUKA 3TKHA 4A9YA 3WF9A 4QMUA 4N4SA 2X7OA 4RVLA 3POOA 2C4GA 4W8DA 3LIJA 3QF9A 3LXNA 1YHSA 3MTLA 4YJPA 4HGTA 4XLVA 3PA3A 5CNNA 4KS8A 4XV2A 2JAVA 2UW3A 4HJOA 4PNKA 1Q4LA 5J9ZA 4LYNA 4CLJA 5ETCA 4I92A 1JLUE 4EL9A 3DDPA 2UUEA 4EOQA 3FWQA 4JDHA 4F1MA 3HVCA 3NYNA 4XJ0A 2BFXA 3OW4A 3MYGA 4FV2A 4YZBA 5GZAA 4RWIA 2HYYA 4E73A 5HVKA 3NW7A 3RPVA 2FUMA 3RHKA 2X0PA 2XAOA 3D5WA 4F64A 4MUQA 2QU5A 4YC3A 4AX8A 4E6AA 3TG1A 3R30A 2C0TA 1GJOA 3O0GA 2F7ZE 4PDSA 5TO8A 3MB6A 2OW3A 2R3IA 4YJTA 3W2SA 3PJ2A 2VTAA 3PG1A 4RIYB 4BBMA 5AM6A 2PHKA 1PW2A 3UGCA 3NVKI 2XKEA 1QPEA 2QU6A 2R3LA 2C68A 3GXLA 3IKAA 1AQ1A 4JJRA 4U44A 3SXRA 4YO6A 2EB2A 3L1SA 5FBOA 1PXLA 4A9SA 1OPJA 2XEZA 2F2CB 5AV0A 4WG4A 3RKBA 1Y8GA 4LFIA 3VUGA 4C2WA 4JG6A 5LVMA 2CNUA 4K33A 2I1MA 4RIYA 2WD1A 2YIRA 3CIKA 5DVRA 2G2HA 2NRUA 3CE3A 5CSWA 2CKQA 3UZPA 2G2FA 4XRJA 5I9WA 3P1AA 2WOTA 3Q04A 4ITJA 4F9BA 3ZU7A 4I94A 5A4QA 4GW8A 5E8XA 5AADA 2VWYA 1MUOA 4V01A 5CZHA 4IZAA 2WIPA 4K1BA 1L8TA 2WZJA 3V51A 4DLJA 4WRGA 3CQUA 2GNHA 5LMKC 2OBJA 3WE4A 4EOPA 3FI4A 3DB8A 2Y0AA 1ZY4A 5K9IA 2WKMA 5LJJA 3UYTA 5L2IA 4DEDA 4HCUA 2R7IA 4E6CA 5M51A 1CKPA 3DZOA 3NR9A 3QYWA 4JXFA 4P90A 2JC6A 3MY5A 5CU3A 5DYJA 2GHMA 4DEAA 2AUHA 3QZIA 1K2PA 1MQ4A 2J5EA 4JBVA 3FPMA 3GU6A 5D7AA 2VX0A 4M97A 3REPA 1ZLTA 2ETKA 3BYUA 1J91A 4QP1A 5HNIX 5M07A 4FSRA 2DUVA 2ITUA 3KGAA 4XG8A 4Z16A 4EJNA 3EQPA 4CKJA 3NW6A 3PFQA 4PPAA 5CS6A 5I9ZA 2JAMA 4NK9A 2VO7A 3MDYA 4B7TA 4L46A 2C5VA 3QXPA 2QNJA 4PF4A 3KMUA 1T45A 5EDQA 4R7HA 4NW6A 2XCKA 4BGHA 3FKLA 4CFWA 3JY9A 4EK3A 3FSKA 4F6SA 2VD5A 5HBEA 1G5SA 2WTCA 3OEZA 4F7LA 4EONA 2QG7A 3BV3A 3DBDA 2GU8A 4XG9A 3NZ0A 2BCJA 4PRJA 1YDTE 4FTJA 1ZMWA 1YKRA 3FSFA 5DEYA 4CFVA 4B99A 2AQXA 4ZMEA 2LGCA 3KA0A 5LWNA 3RM6A 4RBLA 4AAYA 4MHAA 2YN8A 5AP2A 2A1AB 4PPBA 2YLEA 3LFEA 2RFNA 2XRWA 3PY1A 2GCDA 4G16A 4YC6A 3SA0A 4IX6A 2RL5A 2NO3A 2QR7A 5CSVA 4EHEA 3N4TA 1ND4A 4DH5A 4Q9SA 2BTRA 4YTCA 1WAKA 2RIOA 4BCFA 4O7LA 5HTCA 4LDTA 4EH8A 4CD0A 3UDSA 2XCHA 2OIDA 4GKIA 4AZWA 4G6NA 4YHJA 1Y57A 4L7SA 4LG4A 4MEDA 5D12A 2QURA 1WBTA 5KMJA 3FHIA 3ETAA 3EIDA 4QTCA 4UALA 2I6LA 3EQFA 1KUTA 2VGPA 3QCYA 3WZEA 4FOBA 5AR2A 3FYJX 2WEVA 5D10A 5A54A 2GMXA 1VLRA 4GSBA 4DH8A 5IQAA 2J90A 5HD4A 4AAAA 2GPHA 2J50A 4KBCA 2IZUA 3QCQA 5HIEA 1GZKA 2VTTA 5D41A 2YIWA 4Z3VA 1UV5A 3O8PA 3MFRA 4QO9A 5AR5A 3FMKA 1BLXA 5CQUA 5GZ8A 1QPJA 2YJSA 2PY3A 2PZIA 3BKBA 3CR0A 3E8DA 3MVHA 5ICPA 3O23A 1OUYA 4QDVA 3KVWA 3PVWA 4IC7A 4EHGA 1PXKA 3BX5A 2UVXA 2C6EA 4U81A 4M69A 1AD5A 3TN8A 4EORA 4FMQA 1G8SA 5AFVA 4EC9A 5BYZA 2JKQA 2X8IA 1R39A 1W82A 3ORZA 3DKFA 5IEVA 5M09A 4G2FA 5AV3A 3L9PA 3LCKA 4FSMA 5IG1A 5A46A 3A4PA 4PTEA 1PXJA 4Y46A 4Y85A 2V7OA 2RKUA 2YAKA 2R3QA 4QPAA 1XR1A 3SC1A 3II5A 2ZMDA 5G6VA 5FXQA 2F49A 5CU0A 4DC2A 4F09A 3BHVA 2R3HA 2PWLA 4TPTA 3VQHA 3DOGA 2UW8A 1WVXA 3E64A 4QRCA 4ZOGA 4FKGA 4D0XA 3FEGA 4BTMA 4AS0A 2RG6A 3HKOA 4WUNA 4ZJIA 5BX0A 2Y4PA 4BDDA 4EUTA 3JVSA 2P3GX 2O63A 4IB1A 4CT1A 2QD9A 2VN9A 3OTVA 5CEQA 4C3FA 3TUDA 1ZXEA 2ZFYA 5TR6A 3BU6A 5JRSA 4CTCA 2F57A 2J0MB 2UZLA 5EG3A 5L3AA 2HELA 2QHMA 2B54A 5A6NA 4PDYA 3W0SA 1BL7A 2PMNX 1H0WA 1PYXA 3R8VA 4UBAA 5CU2A 4GVJA 4ANOA 5BMSA 4RX7A 5HTIA 3SVVA 3IGOA 5ANGA 2GNIA 3EN6A 4RJ5A 5KMOA 2CGVA 4FL1A 3EN9A 3G9NA 2BILB 4BKZA 3VN9A 3MJ2A 4TW9A 3C4CA 1UU8A 2PVHA 4JX3A 2BPMA 5BVWA 4WT6A 3VF9A 3WIKA 4ALVA 2UW4A 4MD9E 5K4JA 3R1YA 4RPVA 4TZRA 3DA6A 5I3RA 3LPBA 4HNFA 2E9VA 2I40A 4YLJA 3FI3A 4XHKB 4EYMA 4GT5A 5E8WA 3PA5A 2PVMA 4S34A 5BVKA 2EWAA 5IMEA 4UXQA 2WHBA 1NVRA 3IW4A 3RPRA 5L6WL 3TZMA 3RVGA 4D1XA 3KN5A 3BHHA 2WMXA 4RJ3A 5L8JA 3HNGA 1W2CA 1OL7A 3BYSA 4RA5A 4RVKA 4YTHA 5AEPA 3GU7A 4BCKA 4FX3A 5J9YA 1FVRA 4FTRA 4DH1A 3C0IA 4CKIA 4R1YA 4ZY6A 4JQ8A 1FBNA 1H26A 3EMGA 1ATPE 5L2QA 3DDQA 3QTXA 4HVDA 4II5A 4V0GB 3G0EA 3LJ0A 4G1WA 1IG1A 1RE8A 3P7CA 3C4EA 4ZTLA 4KSQA 2WELA 4CV8A 3OBJA 1PF8A 3E3PA 4HVHA 5C4LA 3LFAA 4C3RA 1GOLA 3MTFA 5M56A 2SRCA 5EI8A 4XNEA 5A4EA 2G9XA 1Q3DA 2WTDA 4K2RA 1QMZA 3QUEA 5FEEA 1R0EA 4BWPA 4BKJA 3S1HA 3FV8A 1CKIA 3R2YA 5FTQA 4IE9A 5AR8A 4O22A 4OUCA 5IMXA 1KV1A 1DS5A 2XIYA 3R01A 3PIZA 5T6KA 4FZDB 1ZMUA 4IM0A 2PL0A 5D11A 3FZSA 3RMFA 5KBQA 4V0GA 4FF8A 4O7TA 5CI6A 5A14A 3GU4A 1ERKA 2JIVA 3VULA 5H8EA 2GNJA 3BHTA 4LRMA 5EDPA 5HG9A 5KMKA 1UU7A 1E9HA 3TNHA 3W0QA 3HRCA 2B9FA 2WQMA 3COMA 3DB6A 4A7CA 1RJBA 2XM8A 3GOPA 1WZYA 4L01A 1X8BA 3JYAA