4D4VA

Focal adhesion kinase catalytic domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
272
structure length
256
Chain Sequence
YEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE
publication title Allosteric Regulation of Focal Adhesion Kinase by Pip2 and ATP.
pubmed doi rcsb
source organism Gallus gallus
total genus 82
structure length 256
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d4vA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4d4vA01
1XH5A 4F64A 5A6OA 3E7VA 2ERZE 2DQ7X 2VGPA 4LL5A 4OR5A 3DBQA 5JFWA 3KGAA 3W32A 2IVSA 5BUJA 3RHXA 3HZTA 4NZWB 4AWIA 4G3FA 4AA0A 4ANNA 4X0MA 4XV3A 2XNBA 3N51A 2X9FA 5I9XA 3FMHA 5IMEA 2GNJA 3MVHA 4ACMA 5IISA 4TY1A 5CVGA 1XBAA 4PNKA 4K0YA 3TNQB 4HNIA 2HYYA 1MUOA 1H1WA 1ZZLA 5IUIA 4YJQA 3O7LB 2QR8A 2BRGA 3QFVA 4HVGA 2CKPA 4D2PA 3ELJA 3FWQA 4IM3A 1OKVA 4S30A 3EQHA 3JY0A 2B9FA 1BKXA 2VTNA 4MXXA 4XG2A 3UO5A 2OH0E 5KZIA 4E4XA 4HGEA 2PYWA 4CXAA 3LFQA 3PVUA 3ZDUA 5HIBA 4QMMA 5FRIA 4U43A 4EHZA 3F9NA 4BIDA 5I9VA 2RG5A 3A7JA 4BWPA 1U5QA 3QD0A 5ETIA 4C7TA 4ASEA 2YAAA 5HE3A 3P5KA 5T68A 5FDXA 4ANQA 3VHEA 1HCLA 2PUUA 3E92A 2I0YA 3GT8A 4QP2A 4EZ5A 1R3CA 5CSWA 5IF1A 2R3KA 3O23A 4IFGA 3EZRA 4GT3A 4ZS0A 1J1CA 2W5AA 2UZUE 3PPKA 4RIYA 5IA4A 3ZSGA 5I5ZA 4YC3A 4EWHA 2RFSA 3L8XA 2X1NA 3VQUA 4PV0A 2O64A 2BTSA 2WMSA 4QMTA 5IU2A 1YWNA 4YUQA 3GU8A 2UZDA 1W83A 3VUTA 3UOJA 4IIRA 3NAXA 4FIIA 4BI0A 3AGLA 3O17A 5CAOA 3G2FA 3PWDA 3A61A 1PYEA 3BYVA 4MF1A 4XBRA 3BHHA 5HX6A 5EYMA 4E7WA 2EWAA 2NP8A 4GL9A 4GFGA 4OBPA 3DAKA 3GU4A 5DRBA 1KE7A 1VYWA 3LCTA 3NPCA 5KMJA 4GT5A 3VRYA 3K5UA 3PY3A 5FQDC 3EN9A 1NY3A 3PJ3A 3ZYAA 4BGHA 3AT2A 4U45A 5HCYA 1XH7A 3S4QA 2QOHA 2J0JA 3MB6A 4UMQA 3VULA 2IZSA 4ALUA 4XG6A 3DQWA 2BALA 3DKOA 1PKGA 3GVUA 3RINA 3P7AA 4QQJA 3N4VA 3OZ6A 3AC2A 3ZC6A 4UZDA 3QL8A 3U6JA 4D2SA 4FV2A 4LOQA 4QMXA 3TDVA 3W2SA 4BL1A 2J0KA 5JRSA 2PZYA 5C03A 3DTWA 3E3PA 5CSHA 4GYIA 3ZUUA 2JLDA 5HIDA 5CEMA 5C26A 4Q5EA 3HV6A 2BDJA 4S31A 4U3ZA 4C2WA 5EW8A 4YSJA 2W1FA 4EEVA 1GIJA 4OTPA 1SZMA 2WU7A 3R8LA 3H0YA 3IW8A 5FM3A 2OI4X 3TV4A 1J7UA 4E6QA 3QC9A 5DT0A 3PY0A 4QP6A 2NNWB 5CWZA 3R7IA 4P7EA 4Z55A 2WOTA 3T3UA 2R3OA 3TL8A 2I7QA 3A7FA 1XHAA 3OWKA 5DOSA 5KE0A 4EH8A 2X2LA 3O71A 4IDVA 1ZYDA 4Q2AA 4RVMA 4WG5A 4XV1A 4AP7A 5M53A 3OCBA 2QOIA 2XBAA 3D83A 4I92A 1XH4A 3H30A 2OFUA 4L53A 4YZBA 3RM7A 2XKCA 2VWUA 4IACA 4QMLA 4I41A 3UNJA 3HV3A 4AZSA 4CMOA 4ZZNA 3WF6A 4RQVA 4H3PA 3VRZA 1O6YA 5BNJA 3OEFX 3ACKA 4ZS4A 3MI9A 4O6EA 5DR2A 3KRRA 3D2IA 3NW7A 1KUTA 4UWBA 4H3QA 5E8SA 3V04A 3NMUF 2JBOA 1REKA 4MTAA 3ZLXA 3C0GA 5HG8A 4EH7A 1YW2A 3HX4A 3NUXA 3LCSA 2XB7A 3W8LA 1T45A 2W9FB 3PTGA 2XNGA 2BKZA 1NXKA 4ZP5A 4O0TA 2CDZA 2R64A 2QOFA 3GC8A 3HKOA 4X2GA 4B0GA 2OXXA 4J97A 5KMNA 4FOCA 5HLWA 2G01A 3MH3A 5I3RA 3PJ2A 3JUHA 2EXMA 2XH5A 2GMXA 1BUHA 3RKBA 3DU8A 4RC3A 4DTKA 4ZSLA 4ZAUA 4IC7A 3GOPA 2RFNA 4NCTC 1KE9A 1TQIA 4IFCA 3R1NA 4BYIA 3IGOA 5AMNA 5CSPA 3NYVA 4PMSA 3DNEA 4B6LA 3A8XA 3E3BX 3NUSA 4YNOA 4YJPA 1WAKA 4Z3VA 4GS6A 3GC0A 3UMWA 2CKQA 3DDPA 2BTRA 3MTFA 4HW7A 3F2RA 4P90A 4RX7A 2OIDA 1W0XC 4UYAA 2O65A 3V5PA 4NTSA 4LQMA 4C36A 5A4QA 1PXMA 3VS4A 4X21A 4PF4A 4EK4A 4MD7E 2CNQA 5HTCA 1T46A 4L7SA 2DYLA 4WRGA 5IZFA 1YXXA 4WBOA 2UVZA 3GFEA 4JJRA 4DFZE 4U42A 1GJOA 1PXLA 3VBYA 3CC6A 5M56A 2ZYBA 3BWJA 3OWJA 4DGNA 5E8YA 4UBAA 4UZHA 5KMOA 1RJBA 4DH1A 4FKJA 3A4PA 4FSZA 5KMIA 5CYIA 4J98A 2W9ZB 3FE3A 5JQ8A 4C3PA 5CQWA 2XK4A 4RIWA 2G9XA 2XEYA 5DA3A 4EOPA 5KKRB 5BYZA 3MY5A 3CY3A 2PVYA 4ACDA 2GHMA 4ZJVA 4XX9A 4CFWA 4XV9A 4FYNA 4B4LA 4FEXA 4A7CA 4F09A 4TNBA 5CSXA 4RC2A 4BN1A 2WIHA 5EKNA 3PWYA 3MB7A 4EORA 3DB8A 4XLIA 2J2IB 3GQIA 3U9CA 2CNVA 4MWIA 5L6PA 4PPBA 4QMYA 2WMQA 2GNLA 4A9TA 1JBPE 5L2QA 4AW2A 4UMTA 5DPVA 4B8MA 5A4CA 5A4LA 4O84A 3GQLA 5J9ZA 1ZOGA 5M55A 2VUWA 4BCIA 4JI9A 3ANRA 5GZAA 4ZIMA 3Q4UA 3QKKA 2W5BA 2CN8A 3L8PA 1H1RA 2R0UA 4APCA 3CP9A 3FI2A 3HP5A 4YZ9A 4CRSA 5CU0A 2WKMA 4FKOA 3FV8A 4ASDA 4PL4A 4CT1A 2UZTA 3GENA 4GVAA 2GNFA 2CN5A 4KBAA 3V5QA 4BRXA 2V7AA 4LRJA 1F0QA 4DITA 3PXRA 2QU6A 3QQJA 3VUHA 3FMNA 4U97A 3G9LX 4IB5A 5EQPA 3KMMA 5M57A 2GS2A 5ANDA 1M2QA 2BAKA 4JLCA 4ZSJA 2VTTA 3FHRA 5TE0A 4J1RA 4RA5A 2BCJA 4DYMA 2WFYA 4I6FA 4AZWA 4Y85A 4EUUA 5GINE 3FZOA 3OFMA 3TG1A 3A7HA 5H9BA 4DH5A 5J7BA 3EQIA 2WIPA 3QKLA 1CKJA 4GVJA 3OUNB 3WF5A 4YZNA 5D10A 4BB4A 4YBJA 4AE6A 3KL8A 4IWDA 2CCIA 3R04A 5GJGA 1R0EA 4F6WA 3TKIA 2A4LA 5FD2A 3S1HA 1A06A 4FTOA 4D28A 4DLIA 4KAOA 3ZO2A 1QPCA 4F0IA 2OJIA 3C4EA 3FQSA 3W2PA 4NU1A 5BVKA 4HCTA 3R8VA 2YCQA 4KD1A 3FLQA 5DFPA 5AUZA 3R9OA 3BI6A 5LVNA 5L6WL 2W4KA 5EHOA 4EJ7A 3AOXA 5J79A 2VAGA 2OZAB 3SXFA 4H39A 1M14A 5CU2A 2FVDA 3PA3A 3KMUA 5HCZA 2F7ZE 2WMBA 3ZU7A 3WE4A 1Y8YA 4TYHB 3NSZA 2HW6A 4YBKA 1PMEA 4DA5A 3B2TA 4FNYA 4IDTA 3UC3A 4IVAA 4DCEA 2YM7A 2C5XA 4K6ZA 4NT4A 5J5TA 1HCKA 2XMYA 3IW4A 4QRCA 4IB3A 4Y46A 3W2RA 3U6HA 3IG7A 2GHGA 4IAAA 1KSWA 1PMUA 4C4IA 4DFBA 5JT2A 2XK9A 1GZKA 5CEOA 4CQEA 4KRDA 5JK3A 5IA2A 3SOAA 4PMMA 1WBWA 4CV9A 4BDFA 4J8MA 4G3CA 4UYNA 3HVCA 3BE2A 4JDIA 4RLKA 2CCHA 3GP0A 1L8TA 1G8SA 1J7IA 5AV1A 3ZLYA 1U5RA 1TKIA 4L45A 3BBTB 2XUUA 2W4JA 4TW9A 2J5FA 2E2BA 4TPTA 4S34A 1SVHA 2O5KA 4EK5A 3S00A 2YIXA 4EK6A 2X9EA 3W2CA 1S9JA 4ARKA 1H27A 4EWQA 5M51A 2VWVA 5HEZA 5HO7A 3R73A 4MAOA 3NWWA 3TIZA 3VS7A 3NLBA 3W2QA 2PVNA 4W4XA 4M66A 3PXFA 4J52A 3KXZA 3MESA 2EVAA 4OTDA 4FMQA 2E9UA 1YDRE 3A99A 4TYEA 4BBEA 3ATTA 2Y4IB 1ZAOA 4OTGA 4KS8A 3ORMA 3LMIA 5HE0A 4XMOA 3KXMA 5GJDA 5AFVA 3BLHA 4DH8A 2Z2WA 4F7LA 3D2KA 4QPAA 5KCVA 2IPXA 1V0PA 3FMMA 5DH3A 1OKYA 5AUYA 4R78A 4O82A 2WQBA 5M07A 2VX1A 4QMWA 1E1XA 2BRBA 2Q0BA 2YJRA 4X7QA 5AR8A 3T9IA 2C0OA 5CS6A 3MH1A 4AAAA 2XZSA 2QOBA 4ZZMA 3K2LA 4ANMA 2F9GA 4AZFA 3PY1A 3P23A 4LGHA 4J7BA 4FT3A 3JS2A 3HUCA 3KF7A 3L9PA 1Q3DA 4YLLA 1OL6A 2YWPA 1ZXEA 3F88A 1Q8UA 1V1KA 2W1CA 2UZBA 3POZA 1E9HA 1Z57A 4W8DA 4V01A 5DNRA 4I5MA 4EYJA 4OLIA 3BLQA 4KIKB 2ITYA 4X3FC 2A27A 4YTFA 3AC4A 3FMEA 4S32A 3BQRA 4N70A 1YXVA 2BRHA 2F7EE 2VO0A 3U4WA 3R0TA 4GV1A 2I1MA 1UU8A 3MW1A 4CKJA 3BHVA 2ESMA 4ASZA 1ZOEA 4W4VA 4IX3A 3ZO1A 5AR3A 4MD8E 4W4WA 4EK8A 3VUDA 4G3GA 5IA0A 5EW3A 1CKPA 2ACXA 2VTSA 4RA4A 3VW6A 3W1FA 4BHNA 4FGRA 4K8AA 5FEEA 3IDPA 2UVYA 3MFRA 2QHNA 4QMPA 1BL6A 3T8OA 1URWA 5EHLA 3HV5A 5LMBA 3QUEA 5L2IA 4O7NA 3CBLA 3RAIA 3WI6A 1SYKA 4BDIA 4D5HA 3DXNA 3OY3A 5IQCA 2JIIA 4EOKA 2VNYA 2HZIA 5AP2A 3BBWA 4NFNA 1ZMVA 2BDFA 4G6NA 5CU6A 4BCJA 3QCQA 4QD6A 2XM8A 4IBMA 4PMPA 4M0ZA 4Y83A 4J71A 3I0QA 4NK9A 3BCEA 4CV8A 4EOLA 4AU8A 4QMSA 1OVEA 3FZRA 3ZS5A 1WZYA 1WCCA 4F9BA 3Q3BA 5JSMA 3ANQA 4FV1A 4FYOA 4LOOA 5E8VA 3SV0A 4EBVA 3KKVA 1XBCA 2ITTA 1FMOE 2UW7A 5M4UA 2ZAZA 3AT4A 3CLYA 4L3PA 4GK3A 3ZFMA 5L2WA 2BZKB 2VWZA 2OK1A 1SVEA 4E20A 3Q04A 4BI2A 3OWLA 3MJ2A 4FK3A 3MIAA 4BYJA 2QG7A 2BZIB 3PVWA 2Y6MA 3EMGA 2WQOA 1SMHA 4MEDA 1WVWA 3ZO4A 2VTAA 2OLCA 4DLJA 4MH7A 4RJ8A 2GQGA 3BYUA 4HCUA 1DI9A 2FH9A 3FY0A 1OIYA 4QP7A 3HMIA 1CKIA 2OZAA 4NFMA 4FA2A 4DTAA 4U44A 5GHVA 4EQCA 5KBQA 1GZOA 2ITUA 4TYHA 4F63A 3OWPA 1YI6A 3OT3A 4GCJA 3GU5A 4DGGA 4G5PA 4UXLA 2H34A 3FL5A 4IQ6A 4YO4A 3FZSA 4ZY6A 4BCFA 3QX4A 4Y5QA 4S33A 3UGCA 5AV4A 3TUBA 2CKOA 1NW1A 4MXCA 5G6VA 5LMKC 1BMKA 2V0DA 3BLRA 4QO9A 2IG7A 3QQGA 5E8TA 4FKVA 2BHEA 4I6HA 4D9TA 1Q61A 3RK5A 1Y57A 3D15A 4DC2A 4BR3A 4RPVA 5HVYA 3UP2A 4PQNA 4CRLA 3LZBA 3E8NA 4ACHA 3ZUTA 5T6KA 1NVQA 3UVRA 4ACCA 3D4QA 2VWBA 2C5YA 3V8SA 5HG7A 2OJ9A 4JIKA 4FV5A 4N6ZA 5KX8A 4AXAA 1JKKA 3I1AA 3CXWA 2W1ZA 3NCZA 3UOLA 3P78A 4IM2A 3PJ8A 5LXMA 4O0VA 4W4YA 4QYGA 5JZNA 3FXWA 5ETFA 5E8WA 5CF6A 4KKEA 5CF8A 4UMPA 3KK9A 2ITPA 3F2NA 4H1JA 5BPYA 4JAIA 5D1JA 3C5IA 4U81A 3ZONA 5CT0A 3NR9A 4Q5HA 3ZXTA 3AGMA 4JX3A 2HK5A 4QYFA 1PF8A 2BFXA 2YACA 4JIAA 5HNGA 5ACKA 3QA0A 4GG7A 4JAJA 4J8NA 4KBCA 1UWJA 3O8PA 3QWJA 4EH2A 3VC4A 4M84A 4FEQA 4FV9A 4IHPA 4YNEA 1AGWA 3WBLA 4AUAA 3R01A 4BKJA 4USEA 3VNTA 2UW4A 3R9RA 1UNGA 1ND4A 3QTQA 4IEBA 2YCFA 4FI1A 4CZYB 3G33A 2OJFE 5AX9A 5AP3A 3ZRKA 1QCFA 3FYKX 3UC4A 5KBRA 3LXLA 4I4FA 3TACA 1Q8YA 5ANJA 5C27A 3LLAA 3WILA 4HZRA 4EC9A 4FGBA 3NUUA 4LL0A 3FLWA 2E9OA 3OBJA 5LMAA 2GNGA 4J99A 2GTMA 1U54B 3KCKA 4GT4A 5D9HA 5LVLA 4FTJA 4CLJA 2PE0A 2J0MB 1V0OA 2P2IA 3EFWA 4WUNA 4ITHA 4RQKA 3KREA 5E1SA 3F2AA 2WQEA 2GTNA 5IH4A 3DXPA 2RL5A 4H58A 3RPRA 1JVPP 4C35A 4PDSA 3A4OX 2PUIA 2VU3A 5CQUA 2YM5A 2IN6A 4L3LA 2X8IA 2JFMA 3DPKA 4MNEB 4R1YA 4ZTSA 1VZOA 3MVLA 4OTHA 1CMKE 3UG1A 4WSQA 1OBDA 2H6DA 4BCOA 4RJ6A 2A2AA 2YM4A 4H05A 3RAWA 5C1QB 4EOOA 5CF4A 3KFAA 2XKDA 2E9VA 3LOKA 5CASA 3MWUA 3LFDA 4BKZA 2W5HA 2R3RA 3NZ0A 3TZ8A 4RWIA 3W10A 4BZDA 4CFXA 5BVDA 1BX6A 1ZOHA 4TWPA 3GU6A 3KEXA 2XK7A 3HRBA 3NNXA 3O2MA 2IZTA 3AMYA 2IW6A 4UY9A 2BAQA 1WBPA 4BGGA 2BHHA 4IAIA 2OGVA 3MFSA 4CYJA 2OJGA 2G1TA 3G15A 2C47A 3RALA 3NDMA 3W2OA 4D55A 5M4CA 4RX5A 3G9NA 2UV2A 1A9UA 3UIXA 3U6IA 4K11A 4MXAA 4O1OA 2YAKA 4E73A 3OTUA 2I40A 3EQPA 4N0SA 5J7HA 1IASA 3VN9A 1ZYCA 1OPKA 4C8BA 1Z5MA 2WO6A 3UQGA 5HI2A 3NVKI 3F7ZA 3UNKA 4CFUA 4O1PA 5LMKA 4DH3A 3ZMMA 1SVGA 1FVTA 2YIWA 4WRSA 4F7JA 2GNIA 3Q96A 5HZNA 3QZGA 1W84A 2F4JA 5KO1A 5AUWA 2OU7A 4IW0A 4FIGA 3MGYA 4DN5A 3LJ1A 4AE9A 4TNDA 3PRIA 5DBXA 1JLUE 1JPAA 2XYUA 2XNNA 1O9UA 3UNZA 5J9LA 2R3QA 2J90A 3GU7A 3R7GA 3OHTA 4KIOA 2R3MA 5IQEA 3TUCA 2G2HA 2E9NA 3UPXA 4ZLYA 2REIA 3S0OA 1KE8A 3HRCA 3FDNA 5F95A 3QUPA 4NM7A 3DJ7A 2PE2A 4CFMA 4KKGA 4CGAA 3FLYA 3S95A 4B9DA 4IANA 5E90A 3BE9A 2B9JA 4OTWA 2JD5A 4FV8A 4XRJA 5IQDA 5DGZA 3FYJX 3KU2A 3DNDA 3OBGA 2X8DA 4JRNA 1RW8A 2PY3A 4PWNA 3QTWA 4MD9E 1IAHA 3QLFA 4RMZA 4LYNA 5EDQA 4UMRA 2PMIA 1JNKA 3MJ1A 3NGAA 4FKWA 3V8WA 3ZFYA 3DQXA 2R9SA 4M8TA 4JQ7A 3VUGA 4AZVA 4V0GB 2VN9A 2VTIA 5BYLA 3TI1A 2ETRA 2YABA 3NUYA 4G1WA 2J7TA 2OO8X 2VZ6A 2XNEA 4DEAA 4G34A 1ZMWA 4QOXA 5KMMA 2I0HA 2Z02A 3V8TA 1I09A 3WZUA 4C3FA 1UKIA 5J95A 3AD4A 4DEIA 3KN5A 4O96A 4BCPA 2VV9A 1OZ1A 1P4OA 3VF9A 3VUIA 3VO3A 5E92A 4AW0A 2FSTX 3FLZA 2QOCA 3R2BA 4RIWB 5K0KA 1PXIA 3D7ZA 2RIOA 3BYSA 4FIFA 3OEZA 4CCBA 2WEVA 3Q6WA 3GC7A 1OM1A 3Q5ZA 4FT5A 4QPMA 3BEGA 3HMMA 3UODA 4G6LA 3RCJA 2B7AA 3LAUA 2WTKC 3AG9A 4OT5A 3HAVA 1WBOA 2EB2A 5BMMA 2FSMX 2GS7A 3C4XA 3F82A 4F99A 5BUEA 5HVKA 4R1VA 5L8JA 4G3EA 2OG8A 3R9DA 3R83A 3Q5IA 3R2YA 4D2RA 4E93A 5BYYA 2BRMA 2PU8A 4Z16A 5HHWA 3EB0A 1YVJA 5DWRA 3Q6UA 3I6UA 3R63A 3LFFA 1FBNA 1U54A 4YU2A 2CSNA 4U6RA 2WQNA 1UU3A 2X2KA 1LEZA 3SX9A 4FNZA 3VBQA 3LW0A 4UWCA 1KWPA 4GKIA 4FTLA 4M13A 4FG8A 3MVJA 4HZSA 1YWRA 2ITOA 4KS7A 4MNEA 4O0WA 5CEKA 2P2HA 4RFZA 3TEIA 1TQPA 3R8PA 5ANGA 4A9UA 4BCQA 4EZ7A 3ZEPA 3NYOA 4OTIA 5A4EA 3R1SA 1B39A 3OD6X 2J6MA 3CPCA 3H9RA 3BYMA 4USDA 1PJKA 4E6AA 1UA2A 2C6IA 3CTQA 3GBZA 4IE9A 4RGJA 5FXRA 4CSVA 3IW6A 1APME 4WKQA 3K3IA 2RGPA 3AD5A 5M44A 3SQQA 4FZDB 4WBBB 4BDCA 4EOMA 3FSKA 4ERKA 4MKCA 1J1BA 4EKLA 1UWHA 3BGPA 1RQQA 4I5CA 1PMVA 4UMUA 4LMNA 3O51A 1LEWA 4RT7A 2BR1A 5I9UA 3FL4A 4QTDA 4E5BA 3WF9A 2AUHA 5CXZA 4E1ZA 5IG1A 3Q52A 1M2RA 2W06A 2PHKA 3K3JA 4O91A 4BDEA 4F0FA 5LWMA 3GCSA 3Q4CA 5IQHA 2QD9A 3JY9A 4L01A 4RFYA 3DKCA 4QP9A 2X0GA 3ALOA 3ZLSA 4PX6A 4F6SA 5CU3A 5DT3A 3RAHA 4X3JA 4E4NA 1H4LA 2UZEA 4II5A 4Z7HA 3QZHA 3IDBA 4X2KA 4ZTQA 3F5PA 2FSLX 3LFEA 3JVRA 3NRMA 5HE2A 3DK7A 5AP7A 1PXPA 3MPAA 4MBIA 2R7IA 4QQTA 3MA3A 4LFIA 1ZYSA 3R1YA 4PDYA 3EHAA 5EQEA 1ZYJA 4CG8A 2OZOA 4IJ9A 4PY1A 2OXYA 3EOCA 3E93A 2ZB0A 4YMJA 2JKKA 4B7TA 4LV8A 3MSSA 4FSYA 3CTJA 3ZM4A 2HELA 1MQBA 1LP4A 3OTVA 4MXOA 4R7HA 4Y95A 3RJCA 3FMKA 3FUPA 5HE1A 4QMNA 5IQAA 5AA9A 3NIZA 3R8MA 1GZNA 4JL9A 4KA3A 4KKHA 4TTHB 2F2CB 3SG9A 5EM5A 4O7WA 4C33A 3GC9A 3NUPA 3PP1A 3BHTA 3R1QA 1KV2A 1SNUA 3QRKA 4L7FA 3Q32A 4M0YA 3R8ZA 1OIRA 4YJSA 3LQ3A 3VS0A 2QO7A 4FEUA 3BU6A 3GCUA 3H4JA 4XP3A 1PXNA 4U7ZA 4FT9A 2I0EA 3MPMA 3UYTA 3MV5A 3F66A 4TN6A 4XG3A 2IW9A 4EHVA 5BX0A 2RG6A 4G17A 2Z7SA 4R3CA 3Q4TA 5CENA 3ROYA 5DI1A 3PP0A 3SRVB 4JT3A 5F4NA 4RFMA 5G1XA 3BHUA 3BV3A 2OSCA 2PZ5A 3Q9WA 4O86A 4ACGA 2WMAA 2WMUA 2ETKA 2JEDA 4QTEA 4I20A 3CJGA 4V0GA 4IXPA 3EQRA 4WOVA 2QVSE 2C5OA 3I60A 3UZRA 3FLNC 4AN2A 1YHVA 3R02A 4QYYA 5J1VA 5FGKA 3AQVA 2HENA 4JQEA 2XK3A 3SHEA 4BGQA 4XRLA 3EZVA 3A60A 4FBXA 2ZM3A 3M42A 1EH4A 5KMKA 1YXTA 5CSVA 1JKSA 2C6OA 5IUHA 2O3PA 2DUVA 2RF9A 4ITIA 3WF8A 1S9IA 3FHIA 3RK7A 3ZH8A 4FODA 2PUPA 3TZMA 1XH9A 4FX3A 5JQ5A 5ITAA 3TTJA 3LCKA 2JIVA 4PUZA 4Y8DA 4DT9A 3I4BA 4F9AA 1KOBA 5ACBC 5LVMA 4NJDA 3DFAA 1Q5KA 5HX8A 4U41A 3F3UA 3UG2A 3P0MA 5EW9A 4F08A 3PJ1A 4E5AX 4HPTE 5LCJA 3DA6A 2RKUA 4O7RA 3IW7A 3DCVA 3EN4A 2CGXA 4OBOA 3FI4A 4LRMA 3NNWA 3D5VA 3G6GA 2VO7A 3F3ZA 4GIIA 3Q2MA 4C4EA 3UIUA 3MA6A 3G6HA 4QYHA 4AT4A 5CEPA 5AR5A 4R3RA 1MQ4A 1ERKA 2FO0A 2Q0NA 2RFEA 4RZVA 4U40A 4YLJA 4ZXTA 2V22A 5FDPA 1CTPE 4GG5A 2JDTA 5AM7A 3TWJA 2J0LA 1L3RE 3ERKA 2OIQA 3M11A 2C6EA 4L44A 1Q97A 2HY81 3EN6A 4P5ZA 3TZ7A 3T9TA 2VTPA 5AIKA 4TYGA 4C02A 2QLUA 3R30A 3EQFA 1WBVA 3UO6A 3LIJA 4BDDA 5I0BA 4PP9A 2UZOA 4OAUC 4ZTHA 2WXVA 5BMSA 4H3BA 4RVLA 3LJ2A 4ZLOA 2UW9A 4IAKA 4YGAA 2AC5A 2X7OA 5LJJA 2Y9QA 1OUYA 3ID6C 5M09A 4XJ0A 4K33A 3Q60A 2WD1A 2C6LA 3NEWA 5DRDA 3W18A 1H1SA 1DI8A 2GFSA 5IPJA 1URCA 2XM9A 3LCDA 3WZJA 1OKWA 4YC6A 1BI8A 5AEPA 1DS5A 4UEUA 5HESA 4GJ3A 2XNOA 4V05A 4ZLZA 2YWVA 3FMLA 4X2JA 4G9RA 3PE1A 2QHMA 2QOOA 4M69B 3EL8A 3PZEA 3QTXA 3GCQA 4IJPA 3TZ9A 3IDCA 3DXQA 4BTJA 5HLPA 5CVFA 4OUCA 4ASXA 5K9IA 5IEYA 5CEQA 4YHTA 2GSFA 4OTRA 1VYZA 2YISA 3E62A 2OJJA 2JGZA 3COIA 4H1MA 4NKAA 3TKHA 4D2WA 3TNWA 1WFCA 1AQ1A 5CU4A 5FEQA 4K1BA 4TT7A 3DBDA 3QQHA 3NUAA 4KB8A 5D41A 5BVNA 1IG1A 5KZ0A 4AOTA 2CJMA 1PHKA 3UOHA 2PZPA 4AFEA 3R71A 2XIRA 4WNOA 2BVAA 3VF8A 1WBTA 4JS8A 4NCTA 5C8NA 3DV3A 2VTMA 3WE8A 4DFLA 4XH6A 3C4FA 4M15A 3EKKA 2OICA 1PXKA 3I0OA 4LI5A 1FVVA 3G51A 1RDQE 2BZHB 3DK6A 2C6TA 3VBXA 1PKDA 4C58A 4G16A 4ZK5A 2QLQA 2B9HA 1Q8ZA 3ULIA 3D7TB 3RNYA 2O2UA 4M3QA 2YDIA 3QTUA 4JR3A 4AGDA 4K9YA 5KNJA 2VO3A 4YJTA 4AS0A 4C34A 4R5YA 2QC6A 3WF7A 2XCHA 2HOGA 4D4VA 1H28A 5F1ZA 1XH8A 4F9CA 3PIYA 2GCDA 4TRLA 4CMUA 4B8LA 4RRVA 3UVQA 3CD8A 4D0WA 2WMWA 5E4HA 2W1EA 3ZUVA 5K4IA 4ITJA 4LM5A 5IQBA 4YC8A 4HYIA 2UW6A 5I3OA 3SRVA 4ZMFA 2C3KA 3ZRMA 2IJMA 4E5WA 3B8RA 1YKRA 2XIZA 4AN3A 2UW5A 4WSYA 3ZC5A 5IKWA 3PLAE 2OXDA 4O7YA 3WYXA 2W0JA 3L8VA 5AUUA 3KVXA 5K4JA 3LLTA 3HL7A 3BIZA 1GNGA 4CEGA 1K9AA 2QO9A 3ALNA 3QGWA 3CQEA 4RWJA 3KRJA 2EB3A 4FV4A 3IO7A 3HAMA 2HW7A 2KTYA 4XS2A 3PG1A 2O63A 2XEZA 2B9IA 4XCUA 1X8BA 3QRUA 5C8KA 3R7UA 3AC1A 3UZPA 5AAGA 5EHYA 3LJ0A 1UU7A 5H8BA 4AOIA 4X3FB 1BL7A 3V6SA 2VTOA 4ANBA 4NUSA 2R7BA 4D4SA 1ZZ2A 2P0CA 3H10A 2XKFA 4FZFB 4K2RA 1Z9XA 2QR7A 4PL3A 3DJ6A 3LQ5A 5FG8A 4AT3A 4AT5A 3CEKA 3UPZA 2YERA 2HWPA 3PA5A 4E4MA 2HY0A 2CHLA 3LHJA 4LV5A 3V01A 3ORNA 3KULB 4WA9A 3RPYA 4DG3E 4EKKA 4ZSEA 3DGKA 3CS9A 1ZY5A 3ENHA 1JAMA 2PMLX 4JRVA 3ORTA 3EYHA 4IVCA 5CT7A 3HDMA 2BPMA 4FKSA 3KXGA 4D1SA 4KWPA 2C1BA 2R3IA 4L43A 5IA3A 1H24A 2EU9A 4ENXA 4C62A 4NYEA 1NVRA 2ONLC 5AUVA 1DM2A 3QQLA 5AM6A 3DT1A 4EHGA 2PE1A 4FTTA 4FV7A 1K2PA 4Y5HA 5AR4A 2FA2A 3RP9A 4BDGA 3CD3A 3QALE 1YHSA 1U46A 5AA8A 5JFSA 2KULA 2R3FA 3RHKA 1W82A 2JAVA 3SD0A 1XBBA 5EM7A 4QMVA 2Z7RA 4NTTA 3WIKA 3VJOA 5A9UA 1Y8GA 2P33A 2WMRA 3DKFA 3BWFA 3SG8A 4PRJA 3KRXA 3E64A 2R0IA 4X2FA 2WEIA 2V7OA 3OXTA 4L68A 4MX9A 4BCMA 4DEEA 2XIYA 5IMXA 5K5NA 2XIXA 4UWYA 3DBCA 3LFNA 4IWPA 3EJ1A 4U79A 5B2KA 5C9CA 1ZRZA 3ENMA 4PTEA 2V62A 3QCXA 4FV3A 5DG5A 4C0TA 2P4IA 3ZLWA 4A9RA 5KUPA 1KE6A 3C0HA 3RPSA 3HMOA 3H0ZA 4BTFA 4PMTA 3ZZEA 2G15A 4AN9A 2ZM4A 5HNIX 5AP6A 2PVKA 4IZ5A 1XQZA 5EOBA 1QMZA 1QPJA 3P7CA 2XNPA 3LE6A 3T3VA 3KY2A 4M69A 4C61A 4PDPA 3QRJA 4BCKA 4C57A 3HDNA 2CGUA 2PVHA 4O7VA 4PPCA 4G5JA 1OIUA 3F7WA 4XP2A 2IW8A 3WZKA 3QU0A 3U54A 4FTRA 3RNIA 5JZJA 5ETAA 2BAJA 3EWHA 3PVGA 3OY1A 1HOWA 4DH7A 4I1ZA 5ICPA 4NM3A 5FUTA 2JIUA 4NIFA 4UV0A 2PVJA 4ORKA 3C4ZA 3OOMA 1KOAA 2IVTA 3EN7A 4FF8A 4FVRA 4EK3A 3PUPA 2IZUA 3KB7A 2UZNA 3R7OA 3TUDA 3D5UA 1SNXA 5ANKA 2VGOA 3CGFA 3E63A 4QQ5A 1A48A 2W7XA 4FSMA 2UZWE 4HVHA 4HGLA 4LOPA 2FGIA 2BMCA 2YIQA 2WTJA 4G9CA 5JKGA 2W99B 3UO4A 4GRBA 3RM6A 5JFVA 2EXCX 4AW1A 2FB8A 2WNTA 2WMXA 4MNFA 3ZDIA 4DGOA 3D7TA 3DS6A 2W1IA 2X7GA 3SA0A 4O7SA 4ERWA 2BDWA 1Q8WA 4ZTRA 2WTIA 1M2PA 3S2PA 5IUGA 5EFQA 2QOQA 4I4EA 3AC5A 4MYGA 3NX8A 2IVUA 2ETMA 2JITA 3G0FA 4GUEA 5FTOA 5AUTA 4ZY5A 1JOWB 3QX2A 4E4LA 1O6LA 3PDTA 2G2IA 3ACJA 3Q53A 2B54A 5CXHA 2SRCA 2NPQA 4JXFA 4NM5A 4I94A 1OIQA 2OBJA 2B55A 2LGCA 1QPDA 3WOWA 2GHLA 2W17A 2BKKA 1WBNA 3DY7A 5JMSA 4FEWA 5CNNA 2X39A 5M08A 2PVLA 2R3GA 4M12A 5T3QA 3SKCA 4XNEA 4XG8A 2XRUA 4CKRA 4JDKA 3W16A 4IVBA 4RBLA 2PZIA 5EG3A 2OF2A 3U51A 3R00A 5TO8A 2C3LA 1FINA 4FTIA 5K3YA 4HGSA 3D94A 5BVEA 3FBVA 2OF4A 4I0TA 2QONA 3SAYA 4FL3A 4Q9SA 3UVPA 3LXPA 3B2WA 4A9SA 1H25A 2H8HA 5EYKA 5HG9A 2J0IA 5TKDA 1JSVA 4MQ1A 3TJDA 4CFVA 4X3FA 5DIAA 2GQSA 3IPHA 3TV7A 3E8DA 3OC1A 4PL5A 2Q83A 3MN3A 3N9XA 4E6CA 3ZCLA 1BLXA 2OKRA 4NEUA 1Q8TA 5CF5A 4H36A 3QUDA 5BUIA 2CNUA 3RAKA 3QKMA 2BILB 3UBDA 4EQMA 1YOJA 2YHVA 2AYPA 3KULA 4BDAA 4F7SA 4MK0A 2JDOA 4A4XA 5TR6A 4BDBA 2PULA 3ULZA 2RSVA 1YRPA 4GK4A 5DR6A 1ZLTA 2W1DA 3FKOA 4IB1A 2R4BA 3M1SA 4JDHA 2J9MA 3L8SA 3QHRA 3PIXA 3FI8A 3VS1A 4GYGA 2X2MA 3Q4ZA 5L2TA 5LVOA 3PZHA 4IC8A 3NNVA 1TQMA 5CAUA 2BRNA 3C50A 2W1HA 3F5UA 4JBOA 4NW5A 3CJFA 1QL6A 1OL5A 3FLSA 4BFMA 3UQFA 4DT8A 1FVRA 2H96A 3V5WA 2WU6A 4MXZA 3UDBA 2VTHA 2H9VA 4BIBA 3C7QA 2J51A 4BZOA 3DAEA 3DK3A 5EDPA 2PK9A 4FV6A 4D2TA 3TXOA 4R6VA 3H9OA 5HD7A 3IGGA 5IEVA 3TNHA 3I6WA 5AJQA 4EZ3A 4QP3A 4RWLA 3QGYA 4TXCA 2X4FA 4R3PA 4QMQA 4DG0E 3NS9A 1YXSA 3BU3A 3FJQE 2Z60A 3QCSA 4XUFA 2C5NA 4Y73A 5EOLA 3R7VA 3FZPA 4FKRA 4MBLA 2VWWA 4HVDA 1REJA 3HLLA 3U9NA 3IS5A 2GDOA 1OL2A 2QI8A 5LCKA 5FXSA 5TT7A 2YLEA 3JPVA 1F3MC 4XHKB 3QTIA 2XA4A 4XOYA 4Z7GA 3CR0A 4EQUA 5GIPE 4GU6A 2ERKA 4JQ8A 2B0QA 3F69A 2JDRA 4XOZA 4CG9A 3QQKA 3C4CA 5HLNA 4HCVA 4JBVA 4PDOA 3CIKA 3TKUA 4AW5A 3LXNA 3I7CA 3Q9XA 2BFYA 2BZJA 5EM6A 4CFFA 2WB8A 1H0VA 4GJ2A 2R3HA 1JSTA 3B8QA 2XJ0A 5DE2A 4MXYA 2CLQA 5L6OA 4BBFA 1UVRA 4C4GA 4CZUA 1Y91A 4BZNA 5L3AA 4TWCA 3F3TA 3ODZX 1OL1A 4U8ZA 4EL9A 3UZTA 4OGRA 5L8LA 3LMGA 3E5AA 4A07A 4CKIA 3CSVA 4FR4A 2C1AA 1VEBA 3I5ZA 3TV6A 3DBEA 3QWKA 5I9ZA 4I0RA 5ANEA 5AWMA 3PE2A 3OXIA 4OBQA 4YTCA 3UTOA 5J1WA 2YCRA 3LVPA 1JSUA 3OT8A 4YSMA 2G2FA 4FNWA 2HWOA 3II5A 4A4LA 2O8YA 2QNJA 3DB6A 4FV0A 1M17A 4YJRA 5LOHA 3D5XA 4FEVA 2QOLA 1PXJA 5J8IA 3UYSA 3KC3A 4WT6A 3DDQA 4O7LA 4ZTMA 5FTQA 2F7XE 2YIYA 4L46A 4O38A 4QTAA 1OGUA 4HYSA 2ZDTA 2X7FA 1SM2A 5HKMA 2WTCA 5CI7A 4FKLA 3KCFA 3R21A 3S3IA 4BI1A 3FSFA 2VD5A 1UNLA 2W96B 4CQGA 4DTBA 3PIZA 4GW8A 4QP4A 4PNIA 3FPQA 5JN2A 2WGJA 3PSCA 5A54A 3R9NA 3SVVA 5DMZA 4NL0A 3DJ5A 4BDHA 4L9IA 3MTLA 4ALWA 2YZLA 4F1MA 1Q24A 5DR9A 3QQUA 4ZZOA 2AC3A 3QZFA 5DT4A 1G8AA 3MDYA 5A4TA 3NCGA 2VWIA 1PRYA 3W8QA 4I5PA 3IKAA 4P4CA 4I5HA 4EI4A 3BYOA 4QMZA 3RGFA 4W9XA 4YPSA 4ZY4A 5TOZA 5H3QA 1GAGA 4JOAA 3VBTA 3AT3A 2WTKB 4FL1A 2C0TA 4WUAA 4YZDA 1MRUA 1TVOA 3ZFXA 4C59A 3EH9A 2PMOX 3I7BA 2ZMDA 3KA0A 4QYEA 5E7RA 5KHWA 5BVOA 4BTMA 3VVHA 4I93A 2IO6A 3NYNA 3C13A 4I22A 4FKGA 3F6XA 2XKEA 2R3LA 2XVDA 4IWOA 4WIHA 3VUMA 4XG9A 3BU5A 4P2KA 4EUTA 3LQ8A 3G90X 3PPJA 2YM8A 4FSRA 4O0UA 4P5QA 3RI1A 3RVGA 3FQEA 4F65A 5BVFA 5GJFA 1YOLA 4O7ZA 2YJSA 4IAFA 4ANLA 3POOA 4FSQA 2VWYA 3EQDA 3HEGA 4DEDA 4YTHA 1IA8A 4I6QA 4LRKA 5DYJA 3A8WA 5CAVA 3HNGA 2PUNA 4IX6A 3OMVA 4J53A 1JKTA 3D9VA 4A9YA 4D4RA 3VBVA 3QYWA 2VRXA 2CLXA 3P7BA 5JGBA 4O2ZA 4BF2A 1KV1A 4U5JA 1YHWA 4C2VA 3MY0A 4RIXB 1VR2A 3HP2A 2C0IA 4HPUE 2WTVA 2DWBA 2ZB1A 3RZBA 3H3CA 4ZMEA 4FIHA 3IOPA 3R8UA 3EQCA 3FMDA 4AGWA 5GZ8A 2I0VA 3IW5A 3MY1A 3ITZA 2B4SB 5E8XA 3I79A 4JVGA 4QT1A 5L4QA 5CTPA 4JX7A 3PXZA 1YI4A 1IEPA 5KHXA 3C4WA 2JBPA 4FT7A 1LUFA 5JGAA 4M67A 3SDJA 2J5EA 1ZYLA 4TWOA 3TDWA 5C4LA 2JAMA 4I23A 4LGGA 4JG7A 4O22A 2IVVA 3C51A 4FL2A 4FSWA 3CGOA 4OT6A 5GIOE 3VJNA 5HQ0A 4I0SA 4ALVA 3WIGA 4AZEA 4FTCA 3OXZA 2WTDA 4PP7A 5IQGA 5AP5A 2VTLA 5GZ9A 2JKQA 3M2WA 2BIYA 1OB3A 4RZWA 4YTIA 5AAEA 4HNFA 3ATSA 3BPRA 4E8AA 2PL0A 3FC1X 4BCNA 3PSDA 4EONA 5LWNA 4DEBA 3D0EA 3QD3A 4O2PA 3UMXA 4HYUA 5J5SA 4BDKA 3MFUA 4QTCA 2VX0A 3BHYA 4U9AA 5CI6A 2ZMCA 4FTKA 2OWBA 5D7AA 1GIHA 4CTBA 3IK3A 5IA1A 4O7TA 3MFTA 1XH6A 3DZQA 5FBOA 2YZAA 4RWKA 5K0XA 4C38A 2YLFA 3MPTA 1STCE 4KINA 4XP0A 4CD0A 1CSNA 4IMYA 5EI8A 3KQ7A 4YR8A 4B99A 3GCVA 3H9FA 4KRCA 3AC8A 3ZSIA 5EK7A 4AF3A 4IM0A 1H8FA 4BWXA 2NO3A 1YI3A 4AX8A 1BI7A 3C5UA 3UJGA 3Q9YA 3FXXA 2C3IB 2HZ4A 3PVBA 5K5XA 3RPVA 1IRKA 4F9WA 3ZM9A 3L9LA 4R8QA 4UXQA 4RG0A 1UNHA 2PVRA 2ZV2A 3PPZA 4X6QC 3UOKA 4O27B 3DAJA 4ID7A 5GNKA 4D1ZA 4S2ZA 5AADA 3IECA 1J7LA 3F61A 4FC0A 4EOJA 5HU9A 3U55A 3ODYX 5FP6A 3QTZA 5HO8A 4JBQA 3PG3A 4TYJA 3PYYA 4F7NA 4RX9A 3LFAA 2C5VA 4FG9A 1FGIA 1WVYA 3HECA 4GFMA 4U3YA 4FTNA 4F70A 5IQIA 4LUEA 2WMVA 3FMJA 2GFCA 3PJCA 5AV2A 4M68A 4FUXA 4QMOA 4DAWA 4AA5A 3G0EA 5FEDA 2YIRA 4CNHA 2R3NA 2QOKA 4G6OA 4O0SA 3MS9A 3IONA 4FIJA 5AV3A 4M14A 4HVIA 2X4ZA 4L6QA 4USFA 2Z7LA 4AOJA 5EM8A 3RZFA 4RLLA 2XJ2A 5F20A 4C3RA 4QNAA 2F49A 1H01A 3NW6A 3U87A 1GZ8A 4IWQA 3BZ3A 3MBLA 3PXYA 4LUDA 4HJOA 2C3JA 3COHA 4FIEA 4U0IA 3BKBA 4WG4A 4YHFA 4EYMA 2GPHA 4CVAA 2HIWA 2XK6A 3GUBA 4IH8A 3P9JA 4RSSA 4DINA 3ORLA 5J9YA 2CGVA 3D5WA 4AFJA 1MRYA 2PSQA 3ORZA 4R7IA 5AIRA 3GXLA 4KSPA 3RBWA 3VW8A 4DE4A 5EYDA 2ZOQA 3Q2JA 4R77A 5FM2A 3ORPA 4K77A 1H00A 4EOQA 3L9MA 2P55A 1Q99A 2Y4PA 2HCKA 2EUFB 3OW4A 4FVPA 4X6RA 3ORKA 5DEYA 5DHJA 4AA4A 5C4KA 4GEOA 4NW6A 4N6YA 5HBHA 3DZOA 4TYIA 2FUMA 3KRLA 3VS6A 1OKZA 4FICA 4DEHA 3FEGA 3OCSA 4RVKA 4RX8A 3TNIA 3WYYA 1QPEA 5JEBA 2VX3A 2ITQA 4XEYA 4DBXA 5DLSA 3ROCA 5E1EA 3R6XA 3OCTA 2NRUA 5AR2A 4CZTA 3CTHA 3E7OA 2XNMA 2GS6A 4MBJA 5DEWA 5AR7A 3RCDA 3SXRA 3JXWA 5HBJA 3LMHA 4BCHA 3LFSA 5EDRA 5FP5A 4O81A 2JDVA 2WOUA 2YEXA 2Z7QA 3C1XA 3LCOA 4RIXA 4MHAA 1MP8A 1WMKA 2JDSA 2XF0A 3LM5A 3MH2A 3O8TA 3I81A 1LPUA 4QP1A 5D7VA 4ZTNA 1OBGA 1PXOA 3BRBA 4FSUA 5AP1A 3K54A 4O21A 5HD4A 2ZJWA 1P14A 1NA7A 2B1PA 3RTPA 3QYZA 4K18A 3TT0A 3UQCA 3GOKA 3F3WA 1VJYA 2YN8A 3P79A 4G2FA 5LVPA 3KK8A 3OUKA 5IDPA 5B0XA 3MVMA 3REPA 2ITWA 3A7GA 4OW8A 5KKRC 3PA4A 2Z8CA 4ONAA 3FKNA 4F0GA 4IVDA 3DBFA 3PXKA 4FSNA 5D12A 1GIIA 2PPQA 4FTQA 3RMFA 4NH1A 5E9EA 2XYNA 5HORA 4XG7A 4Q9ZA 4XLVA 5FXQA 3ZZWA 2UZVA 3E8CA 4I24A 4XV2A 3ZOSA 4FKUA 2YCSA 3KXXA 4ZSGA 2WZJA 4CCUA 5CZIA 1XKKA 4JR7A 3BEAA 4ZJIA 3WZDA 2QU5A 1Q3WA 3ZXZA 4D0XA 4FZAB 4EBWA 3VQHA 1DAWA 4ANSA 4BIEA 5CALA 2JC6A 1E1VA 3WARA 3L1SA 3FI3A 4GMYA 3I5NA 1H26A 5E8ZA 4G3DA 4QMUA 3V5JA 3OROA 2OFVA 4ZTLA 3TTIA 5LARA 3VAPA 5HBEA 3BELA 2UW0A 3HMPA 3QTRA 3ZBFA 5CAQA 3C0IA 1YDSE 4NIFB 1R0PA 5HGIA 1YQJA 3G5DA 3DLZA 2XJ1A 3HA6A 5I9YA 1FPUA 2V5QA 4FZ6A 2C4GA 2QKRA 2F57A 1FOTA 1W8CA 3FY2A 3OW3A 5HCXA 4N4SA 2B52A 3ORIA 5HNBA 2X81A 2Y7JA 3DLSA 4JNWA 4FNXA 4W8EA 4FTAA 3PRFA 2OW3A 1RE8A 4ZJJA 3COKA 3TN8A 4ENYA 1MRVA 4AQCA 3JVSA 2JKOA 4EH3A 3P86A 3E88A 4I6BA 4QP8A 2EXEA 5FLFA 5CEIA 4D5KA 5LQFA 1Y6AA 1BYGA 4ZEGA 5M4IA 3GB2A 3ET7A 3NIEA 4QTBA 4W9WA 3HGKA 3O0GA 5M06A 3FAAA 3LKMA 3CQUA 4F9YA 4EH5A 2BUJA 4JDJA 4JG8A 2PZRA 3QRTA 4O6LA 3VBWA 1R1WA 3QLGA 4DFNA 1F5QA 2XCKA 3CKWA 2CKEA 3V6RA 4NJ3A 5E8UA 1U4DA 1O6KA 4JBPA 2XBJA 4DFUA 2JKMA 4GSBA 1V0BA 3DTCA 5CAPA 3UE4A 1YXUA 1IAJA 3SOCA 4KSQA 3LM0A 2WAJA 1YOMA 5IQFA 5JRQA 3ZHPC 3QCYA 2A19B 3EFJA 3HYHA 1WBSA 4M7IA 2E9PA 5KMLA 4GU9A 4AGCA 4A06A 1J3HA 4UALA 4L8MA 4YP8A 3TJCA 1P2AA 4M97A 4F1OA 3THBA 4O0YA 2VTRA 4D58A 3LXKA 5JFXA 3N4TA 5C01A 1OMWA 3AD6A 5EI2A 4AZTA 5CANA 3V51A 5AUXA 2ITZA 4OTFA 3GI3A 2FYSA 4EH6A 5DVRA 3VS2A 2UZLA 5IDNA 2YM6A 4FZ7A 2XIKA 3R7YA 2YDJA 4HVSA 3VUKA 3WZEA 2Y0AA 4OAVB 4V04A 4BBMA 5J87A 1CDKA 2ITXA 5AAFA 1W7HA 4Y72A 3QXOA 4YJUA 5HTBA 1B38A 2PMNX 1LR4A 2VO6A 2HXQA 1ZMUA 1FMKA 3GCPA 2R3JA 3F5XA 3FZTA 2XRWA 4MWHA 4FSTA 2WTWA 5A3XA 4CT2A 4TZRA 3VIDA 2I6LA 4I3ZA 3QD2B 3GEQA 3V5LA 5ANIA 2GNHA 4IAYA 4KUJA 3HA8A 1UU9A 2ZV8A 4YURA 3AMAA 3P08A 2R2PA 4UB7A 4O83A 4GH2A 4BKYA 3QC4A 5BVWA 1ZWSA 4IB0A 3QD4A 3HMNA 4KBKA 1G5SA 4KIQA 4AG8A 3CCNA 1H0WA 4L00A 1YDTE 2Y4IC 4I21A 5EYCA 2V55A 2YITA 3FQHA 4AACA 4F1TA 5F94A 3UP7A 4MCVA 3FXZA 5L8KA 2C6KA 4DG2E 3OG7A 4MVFA 4FKPA 1H1PA 4IZ7A 3N4UA 3DOGA 1WVXA 1JWHA 2C30A 1AD5A 4CMTA 1Q41A 5ANOA 1Y6BA 4BC6A 4D4YA 3FKLA 2ITVA 5ETCA 3ZTXA 4DF3A 3FPMA 5BQ0A 4BCGA 2BROA 3D14A 3EKNA 4PTCA 3R9HA 4EH4A 5IH6A 5DN3A 4XG4A 2FSOX 5CLPA 5CX9A 5EKOA 4UX9A 4EOIA 3ETAA 4GK2A 5HU3A 4GFOA 2ITNA 3SW4A 1DAYA 1M7QA 4MQ2A 3FZ1A 3A62A 4FT0A 2F2UA 5B7VA 3CPBA 5IH5A 1OL7A 4PPAA 4YPDA 3V5TA 3K5VA 3IQ7A 5AP0A 4J96A 1XJDA 1GOLA 5E91A 3PXQA 3QAME 4FUYA 5IEXA 5M4FA 4GKHA 1UV5A 4DGLC 4EHEA 5AP4A 4L42A 1YWVA 4HYHA 4KABA 1FGKA 3QTSA 3EFLA 4FTMA 4NM0A 4NSTA 3NUNA 2OH4A 4XBUA 3GGFA 5FWKK 3TCPA 1ZARA 2R5TA 2J4ZA 3TIYA 5F9EA 3OOGA 4LG4A 3EQBA 5IA5A 5JH6A 3ORXA 3CKXA 3LFCA 3SLSA 1XO2B 4YZMA 1JKLA 3COMA 4U80A 4BHZA 2C69A 4IAZA 1H07A 3BGQA 3OS3A 4FKIA 3OF0A 4ZOGA 1IA9A 3OCGA 4FTUA 3NNUA 4RVTA 5C8MA 3SC1A 4BWKA 1P4FA 2ZV7A 3HV4A 1NT2A 3RPOA 2QG5A 4ANOA 3P4KA 4TKSA 5HG5A 4D1XA 1H08A 5CY3A 3LPBA 4R7BA 1CM8A 3R7EA 4F6UA 2O0UA 1OITA 3F3VA 3Q9ZA 1UKHA 3ZSHA 2W05A 2NRYA 4A4OA 4IZAA 4PTGA 3V3VA 3P1AA 4C4JA 5EH0A 4FE2A 1XWSA 2ZM1A 3JR1A 4HOKA 2HZNA 3TM0A 1G3NA 2J50A 5CNOA 2HAKA 2VTJA 3TNPC 5JGDA 3BQCA 3KMWA 2UVXA 4RC4A 3BX5A 5A14A 1R39A 3KN6A 1PW2A 4L67A 4FVQA 1PY5A 1GY3A 4BDJA 3MH0A 5EI6A 5A46A 5FBNC 4ZSAA 3BV2A 4RJ4A 1XR1A 4YHJA 5CVHA 5H8GA 3E8EA 3GFWA 3ZEWA 3QBNA 3MYGA 4WNMA 3JYAA 4IX4A 3NYXA 4IADA 4RJ7A 3R22A 4D2VA 2QKWB 4D9UA 3IOKA 3QQFA 5HIEA 4KNBA 2A1AB 2C68A 2P3GX 2ZVAA 2C6DA 4HGTA 2QQ7A 5HICA 4X2NA 2PWLA 4R5SA 3C9WA 2YA9A 4QNYA 3FC2A 4F4PA 2PVMA 2GQRA 2BIKB 5I9WA 1M7NA 1PYXA 3HV7A 3SXSA 4WHZA 3OVVA 5HO6A 4IX5A 4YJVA 2GU8A 3HUBA 2XP2A 4MF0A 4DCAA 2LAVA 2B53A 4AGUA 4CTCA 3NVMB 3CY2A 3E87A 2ONLA 2ZV9A 2IZRA 2WELA 3UIMA 4YO6A 3RWQA 2IWIA 3CQWA 2HXLA 2XS0A 4L52A 4OTQA 3ZBXA 3SGCA 4IZYA 1P5EA 3W33A 3AXWA 3KXHA 4BICA 1H1QA 4N57A 3KF4A 3O8UA 3QZIA 4WD5A 2Y8OA 5CZHA 2RFDA 3DFCB 4RIYB 4DEGA 4RJ3A 3KRWA 4XYFA 3A2CA 4WNPA 3UIBA 3F5GA 1J91A 4YLKA 3EYGA 3NW5A 1JQHA 2UW3A 5HVJA 3VS5A 1U59A 1W98A 4E3CA 4NWMA 4YJOA 2WMTA 4TWNA 2WQMA 4GIHA 3PLSA 3AMBA 4RIOA 4DHFA 2X6DA 5L2SA 4J95A 1K3AA 3QA8A 3EIDA 4E26A 5H8EA 4DFYA 5FTGA 2XK8A 4KIKA 4Z9LA 3HRFA 1Q4LA 4FKQA 4YZCA 4EH9A 4O0RA 3RWPA 3QRIA 5A6NA 2CPKE 4WG3A 5B2LA 3PFQA 3QHWA 1M52A 4TL0A 4EC8A 4UN0C 2UW8A 3U4UA 2YFXA 1OPLA 2WPAA 1OUKA 2C6MA 4CYIA 1Q62A 5AX3A 3DKGA 5HOAA 3O96A 2X6EA 2QURA 4C4FA 2QODA 3BGZA 2JFLA 3O7LD 2W4OA 2Y6OA 1OPJA 4FG7A 5HTIA 3VHKA 3EQGA 1KE5A 3KXNA 3ZRLA 3U8WA 3VS3A 4RJ5A 2OIBA 2YDKA 4FKTA 5TF9A 2PTKA 3A7IA 5I4NA 3PSBA 2QO2A 1ATPE 5EQYA 2VNWA 3EL7A 4NKSA 5AV0A 2ZDUA 4G31A 3LFBA 4CFNA 2CMWA 3KVWA 1ZY4A 2X8EA 3VWAA 4O0XA 3L9NA 5B2MA 4EOSA 2R3PA 4JG6A 2YM3A 1NVSA 2VWXA 4DBNA 4KIPA 3AC3A 4BTKA 4BY9E 4DGMA 2UUEA 3GNIB 5D11A 3R28A 4WO5A 4YJNA 1OI9A 4DFXE 3EFKA 2CGWA 2WHBA 1PMNA 2VTQA 3CE3A 3ZO3A 4E6DA 1OECA 3OP5A 1I44A 4WNKA 4C37A 4LGDA 5H2UA 4CLIA 1B6CB 2HZ0A 3EN5A 4QQCA 4LMUA 2QCSA 4L3JA 3W55A 4APPA 4GUBA 2DS1A 3QXPA 1IR3A 4QPSA 2PVFA 1FQ1B 2A0CX 4C4HA 3SW7A 4FK6A 2W1GA 3MIYA 1R78A 3NAYA 3QF9A 4FOBA 3RK9A 4EJNA 4BVUA 3O50A
chains in the Genus database with same CATH superfamily
1XH5A 4F64A 5A6OA 3E7VA 2ERZE 2DQ7X 2VGPA 4LL5A 4OR5A 3DBQA 5JFWA 3KGAA 3W32A 2IVSA 5BUJA 1G8JA 3RHXA 3HZTA 4NZWB 4AWIA 4G3FA 4AA0A 4ANNA 4X0MA 4XV3A 2XNBA 3N51A 2X9FA 5I9XA 3FMHA 5IMEA 2GNJA 3MVHA 4ACMA 5IISA 4TY1A 5CVGA 1XBAA 4PNKA 4K0YA 3TNQB 4HNIA 2HYYA 1MUOA 1H1WA 1ZZLA 5IUIA 4YJQA 3O7LB 2QR8A 2BRGA 3QFVA 4HVGA 2CKPA 4D2PA 3ELJA 3FWQA 4IM3A 1OKVA 4S30A 3EQHA 3JY0A 2B9FA 1BKXA 2VTNA 4MXXA 4XG2A 3UO5A 2OH0E 5KZIA 4E4XA 4HGEA 2PYWA 4CXAA 3LFQA 3PVUA 3ZDUA 5HIBA 4QMMA 5FRIA 4U43A 4EHZA 3F9NA 4BIDA 5I9VA 2RG5A 3A7JA 4BWPA 1U5QA 3QD0A 5ETIA 4C7TA 4ASEA 2YAAA 5HE3A 3P5KA 5T68A 5FDXA 4ANQA 3VHEA 1HCLA 2PUUA 3E92A 2I0YA 3GT8A 4QP2A 4EZ5A 1R3CA 5CSWA 5IF1A 2R3KA 3O23A 4IFGA 3EZRA 4GT3A 4ZS0A 1J1CA 2W5AA 2UZUE 3PPKA 4RIYA 5IA4A 3ZSGA 5I5ZA 4YC3A 4EWHA 2RFSA 3L8XA 2X1NA 3VQUA 4PV0A 2O64A 2BTSA 2WMSA 4QMTA 5IU2A 1YWNA 4YUQA 3GU8A 2UZDA 1W83A 3VUTA 3UOJA 4IIRA 3NAXA 4FIIA 4BI0A 3AGLA 3O17A 5CAOA 3G2FA 3PWDA 3A61A 1PYEA 3BYVA 4MF1A 4XBRA 3BHHA 5HX6A 5EYMA 4E7WA 2EWAA 2NP8A 4GL9A 4GFGA 4OBPA 3DAKA 3GU4A 5DRBA 1KE7A 1VYWA 3LCTA 3NPCA 5KMJA 4GT5A 3VRYA 3K5UA 3PY3A 5FQDC 3EN9A 1NY3A 3PJ3A 3ZYAA 4BGHA 3AT2A 4U45A 5HCYA 1XH7A 3S4QA 2QOHA 2J0JA 3MB6A 4UMQA 3VULA 2IZSA 4ALUA 4XG6A 3DQWA 2BALA 3DKOA 1PKGA 3GVUA 3RINA 3P7AA 4QQJA 3N4VA 3OZ6A 3AC2A 3ZC6A 4UZDA 3QL8A 3U6JA 4D2SA 4FV2A 4LOQA 4QMXA 3TDVA 3W2SA 4BL1A 2J0KA 5JRSA 2PZYA 5C03A 3DTWA 3E3PA 5CSHA 4GYIA 3ZUUA 2JLDA 5HIDA 5CEMA 5C26A 4Q5EA 3HV6A 2BDJA 4S31A 4U3ZA 4C2WA 5EW8A 4YSJA 2W1FA 4EEVA 1GIJA 4OTPA 1SZMA 2WU7A 3R8LA 3H0YA 3IW8A 5FM3A 2OI4X 3TV4A 1J7UA 4E6QA 3QC9A 5DT0A 3PY0A 4QP6A 2NNWB 5CWZA 3R7IA 4P7EA 4Z55A 2WOTA 3T3UA 2R3OA 3TL8A 2I7QA 3A7FA 1XHAA 3OWKA 5DOSA 5KE0A 4EH8A 2X2LA 3O71A 4IDVA 1ZYDA 4Q2AA 4RVMA 4WG5A 4XV1A 4AP7A 5M53A 3OCBA 2QOIA 2XBAA 3D83A 4I92A 1XH4A 3H30A 2OFUA 4L53A 4YZBA 3RM7A 2XKCA 2VWUA 4IACA 4QMLA 4I41A 3UNJA 4BJJA 3HV3A 4AZSA 4CMOA 4ZZNA 3NFGB 3WF6A 4RQVA 4H3PA 3VRZA 1O6YA 5BNJA 3OEFX 3ACKA 4ZS4A 3MI9A 4O6EA 5DR2A 3KRRA 3D2IA 3NW7A 1KUTA 4UWBA 4H3QA 5E8SA 3V04A 3NMUF 2JBOA 1REKA 4MTAA 3ZLXA 3C0GA 5HG8A 4EH7A 1YW2A 3HX4A 3NUXA 3LCSA 2XB7A 3W8LA 1T45A 2W9FB 3PTGA 2XNGA 2BKZA 1NXKA 4ZP5A 4O0TA 2CDZA 2R64A 2QOFA 3GC8A 3HKOA 4X2GA 4B0GA 2OXXA 4J97A 5KMNA 4FOCA 5HLWA 2G01A 3MH3A 5I3RA 3PJ2A 3JUHA 2EXMA 2XH5A 2GMXA 1BUHA 3RKBA 3DU8A 4RC3A 4DTKA 4ZSLA 4ZAUA 4IC7A 3GOPA 2RFNA 4NCTC 1KE9A 1TQIA 4IFCA 3R1NA 4BYIA 3IGOA 5AMNA 5CSPA 3NYVA 4PMSA 3DNEA 4B6LA 3A8XA 3E3BX 3NUSA 4YNOA 4YJPA 1WAKA 4Z3VA 4GS6A 3GC0A 3UMWA 2CKQA 3DDPA 2BTRA 3MTFA 4HW7A 3F2RA 4P90A 4RX7A 2OIDA 1W0XC 4UYAA 2O65A 3V5PA 4NTSA 4LQMA 4C36A 5A4QA 1PXMA 3VS4A 4X21A 4PF4A 4EK4A 4MD7E 4AXCA 2CNQA 5HTCA 1T46A 4L7SA 2DYLA 4WRGA 5IZFA 1YXXA 4WBOA 2UVZA 3GFEA 4JJRA 4FJVA 4DFZE 4U42A 1GJOA 1PXLA 3VBYA 3CC6A 5M56A 2ZYBA 3BWJA 3OWJA 4DGNA 5E8YA 4UBAA 4UZHA 5KMOA 1RJBA 4DH1A 4FKJA 3A4PA 4FSZA 5KMIA 5CYIA 4J98A 2W9ZB 3FE3A 5JQ8A 4C3PA 5CQWA 2XK4A 4RIWA 2G9XA 2XEYA 5DA3A 4EOPA 5KKRB 5BYZA 3MY5A 3CY3A 2PVYA 4ACDA 2GHMA 4ZJVA 2A98A 4XX9A 4CFWA 4XV9A 4FYNA 4B4LA 4FEXA 4A7CA 4F09A 4TNBA 5CSXA 4RC2A 4BN1A 2WIHA 5EKNA 3PWYA 3MB7A 4EORA 3DB8A 4XLIA 2J2IB 3GQIA 3U9CA 2CNVA 4MWIA 5L6PA 4PPBA 4QMYA 2WMQA 2GNLA 4A9TA 1JBPE 5L2QA 4AW2A 4UMTA 5DPVA 4B8MA 5A4CA 5A4LA 4O84A 3GQLA 5J9ZA 1ZOGA 5M55A 2VUWA 4BCIA 4JI9A 3ANRA 5GZAA 4ZIMA 3Q4UA 3QKKA 2W5BA 2CN8A 3L8PA 1H1RA 2R0UA 4APCA 3CP9A 3FI2A 3HP5A 4YZ9A 4CRSA 5CU0A 2WKMA 4FKOA 3FV8A 4ASDA 4PL4A 4CT1A 2UZTA 3GENA 4GVAA 4DHZA 2GNFA 2CN5A 4KBAA 3V5QA 4BRXA 2V7AA 4LRJA 1F0QA 4DITA 3PXRA 2QU6A 3QQJA 3VUHA 3FMNA 4U97A 3G9LX 4IB5A 5EQPA 3KMMA 5M57A 2GS2A 5ANDA 1M2QA 2BAKA 4JLCA 4ZSJA 2VTTA 3FHRA 5TE0A 4J1RA 4RA5A 2BCJA 4DYMA 2WFYA 4I6FA 4AZWA 4Y85A 4EUUA 5GINE 3FZOA 3OFMA 3TG1A 3A7HA 5H9BA 4DH5A 5J7BA 3EQIA 2WIPA 3QKLA 1CKJA 4GVJA 3OUNB 3WF5A 4YZNA 5D10A 4BB4A 4YBJA 4AE6A 3KL8A 4IWDA 2CCIA 3R04A 5GJGA 1R0EA 4F6WA 3TKIA 2A4LA 5FD2A 3S1HA 1A06A 4FTOA 4D28A 4DLIA 4KAOA 3ZO2A 1QPCA 4F0IA 2OJIA 3C4EA 3FQSA 3W2PA 4NU1A 5BVKA 4HCTA 3R8VA 2YCQA 4KD1A 3BL7A 3FLQA 5DFPA 5AUZA 3R9OA 3BI6A 5LVNA 5L6WL 2W4KA 5EHOA 4EJ7A 3AOXA 5J79A 2VAGA 2OZAB 3SXFA 4H39A 1M14A 5CU2A 2FVDA 3PA3A 3KMUA 5HCZA 2F7ZE 2WMBA 3ZU7A 3WE4A 1Y8YA 4TYHB 3NSZA 2HW6A 4YBKA 1PMEA 4DA5A 3B2TA 4FNYA 4IDTA 3UC3A 4IVAA 4DCEA 2YM7A 2C5XA 4K6ZA 4NT4A 5J5TA 1HCKA 2XANA 2XMYA 3IW4A 4QRCA 4IB3A 4Y46A 3W2RA 3U6HA 3IG7A 2GHGA 4IAAA 1KSWA 1PMUA 4C4IA 4DFBA 5JT2A 2XK9A 1GZKA 5CEOA 4CQEA 4KRDA 5JK3A 5IA2A 3SOAA 4PMMA 1WBWA 4CV9A 4BDFA 4J8MA 4G3CA 4UYNA 3HVCA 3BE2A 4JDIA 4RLKA 2CCHA 3GP0A 1L8TA 1G8SA 1J7IA 5AV1A 3ZLYA 1U5RA 1TKIA 4L45A 3BBTB 2XUUA 2W4JA 4TW9A 2J5FA 2E2BA 4TPTA 4S34A 1SVHA 2O5KA 4EK5A 3S00A 2YIXA 4EK6A 2X9EA 3W2CA 1S9JA 4ARKA 1H27A 4EWQA 5M51A 2VWVA 5HEZA 5HO7A 3R73A 4MAOA 3NWWA 3TIZA 3VS7A 3NLBA 3W2QA 2PVNA 4W4XA 4M66A 3PXFA 4J52A 3KXZA 3MESA 2EVAA 4OTDA 4FMQA 2E9UA 1YDRE 3A99A 4TYEA 4BBEA 3ATTA 2Y4IB 1ZAOA 4OTGA 4KS8A 3ORMA 3LMIA 5HE0A 4XMOA 3KXMA 5GJDA 5AFVA 1XMLA 3BLHA 4DH8A 2Z2WA 4F7LA 3D2KA 4QPAA 5KCVA 2IPXA 1V0PA 3FMMA 5DH3A 1OKYA 5AUYA 4R78A 4O82A 2WQBA 5M07A 2VX1A 4QMWA 1E1XA 2BRBA 2Q0BA 2YJRA 4X7QA 5AR8A 3T9IA 2C0OA 5CS6A 3MH1A 4AAAA 2XZSA 2QOBA 4ZZMA 3K2LA 4ANMA 2F9GA 4AZFA 3PY1A 3P23A 4LGHA 4J7BA 4FT3A 3JS2A 3HUCA 3KF7A 3L9PA 1Q3DA 4YLLA 1OL6A 2YWPA 1ZXEA 3F88A 1Q8UA 1V1KA 2W1CA 2UZBA 3POZA 1E9HA 1Z57A 4W8DA 4V01A 5DNRA 4I5MA 4EYJA 4OLIA 3BLQA 4KIKB 4AXDA 2ITYA 4X3FC 2A27A 4YTFA 3AC4A 3FMEA 4S32A 3BQRA 4N70A 1YXVA 2BRHA 2F7EE 2VO0A 3U4WA 3R0TA 4GV1A 2I1MA 1UU8A 3MW1A 4CKJA 3BHVA 2ESMA 4ASZA 1ZOEA 4W4VA 4IX3A 3ZO1A 5AR3A 4MD8E 4W4WA 4EK8A 3VUDA 4G3GA 5IA0A 5EW3A 1CKPA 2ACXA 2VTSA 4RA4A 3VW6A 3W1FA 2ZFYA 4BHNA 4FGRA 4K8AA 5FEEA 3IDPA 2UVYA 3MFRA 2QHNA 4QMPA 1BL6A 3T8OA 1URWA 5EHLA 3HV5A 5LMBA 3QUEA 5L2IA 4O7NA 3CBLA 3RAIA 3WI6A 1SYKA 4BDIA 4D5HA 3DXNA 3OY3A 5IQCA 2JIIA 4EOKA 2VNYA 2HZIA 5AP2A 3BBWA 4NFNA 1ZMVA 2BDFA 4G6NA 5CU6A 4BCJA 3QCQA 4QD6A 2XM8A 4IBMA 4PMPA 4M0ZA 4Y83A 4J71A 3I0QA 4NK9A 3BCEA 4CV8A 4EOLA 1ST0A 4AU8A 4QMSA 1OVEA 3FZRA 3ZS5A 1WZYA 1WCCA 4F9BA 3Q3BA 5JSMA 3ANQA 4FV1A 4FYOA 4LOOA 5E8VA 3SV0A 4EBVA 3KKVA 1XBCA 2ITTA 1FMOE 2UW7A 5M4UA 2ZAZA 3AT4A 3CLYA 4L3PA 4GK3A 3ZFMA 5L2WA 2BZKB 2VWZA 2OK1A 1SVEA 4E20A 3Q04A 4BI2A 3OWLA 3MJ2A 4FK3A 3MIAA 4BYJA 2QG7A 2BZIB 3PVWA 2Y6MA 3EMGA 2WQOA 1SMHA 4MEDA 1WVWA 3ZO4A 2VTAA 2OLCA 4DLJA 4MH7A 4RJ8A 2GQGA 3BYUA 4HCUA 1DI9A 2FH9A 3FY0A 1OIYA 1ST4A 4QP7A 3HMIA 1CKIA 2OZAA 4NFMA 4FA2A 4DTAA 4U44A 5GHVA 4EQCA 5KBQA 1GZOA 2ITUA 4TYHA 4F63A 3OWPA 1YI6A 3OT3A 4GCJA 3GU5A 4DGGA 4G5PA 4UXLA 2H34A 3FL5A 4IQ6A 4YO4A 3FZSA 4ZY6A 4BCFA 3QX4A 4Y5QA 4S33A 3UGCA 5AV4A 3O5AA 3TUBA 2CKOA 1NW1A 4MXCA 5G6VA 5LMKC 1BMKA 2V0DA 3BLRA 4QO9A 2IG7A 3QQGA 5E8TA 4FKVA 2BHEA 4I6HA 4D9TA 1Q61A 3RK5A 1Y57A 3D15A 4DC2A 4BR3A 4RPVA 5HVYA 3UP2A 4PQNA 4CRLA 3LZBA 3E8NA 4ACHA 3ZUTA 5T6KA 1NVQA 3UVRA 4ACCA 3D4QA 2VWBA 2C5YA 3V8SA 5HG7A 2OJ9A 4JIKA 4FV5A 4N6ZA 5KX8A 4AXAA 1JKKA 3I1AA 3CXWA 2W1ZA 3NCZA 3UOLA 3P78A 4IM2A 3PJ8A 5LXMA 4O0VA 4W4YA 4QYGA 5JZNA 3FXWA 5ETFA 5E8WA 5CF6A 4KKEA 5CF8A 4UMPA 3KK9A 2ITPA 3F2NA 4H1JA 5BPYA 4JAIA 5D1JA 3C5IA 4U81A 3ZONA 5CT0A 3NR9A 4Q5HA 3ZXTA 3AGMA 4JX3A 2HK5A 4QYFA 1PF8A 2BFXA 2YACA 4JIAA 5HNGA 5ACKA 3QA0A 4GG7A 4JAJA 4J8NA 4KBCA 1UWJA 3O8PA 3QWJA 4EH2A 3VC4A 4M84A 4FEQA 4FV9A 4IHPA 4YNEA 1AGWA 3WBLA 4AUAA 3R01A 4BKJA 4USEA 3VNTA 2UW4A 3R9RA 1UNGA 1ND4A 3QTQA 4IEBA 2YCFA 4FI1A 4CZYB 3G33A 2OJFE 5AX9A 5AP3A 3ZRKA 1QCFA 3FYKX 3UC4A 5KBRA 3LXLA 4I4FA 3TACA 1Q8YA 5ANJA 5C27A 3LLAA 3WILA 4HZRA 4EC9A 4FGBA 3NUUA 4LL0A 3FLWA 2E9OA 3OBJA 5LMAA 2GNGA 4J99A 2GTMA 1U54B 3KCKA 4GT4A 5D9HA 5LVLA 4FTJA 4CLJA 2PE0A 2J0MB 1V0OA 2P2IA 3EFWA 4WUNA 4ITHA 4RQKA 3KREA 5E1SA 3F2AA 2WQEA 2GTNA 5IH4A 3DXPA 2RL5A 4H58A 3RPRA 1JVPP 4C35A 4PDSA 3A4OX 2PUIA 2VU3A 5CQUA 2YM5A 2IN6A 4L3LA 2X8IA 2JFMA 3DPKA 4MNEB 4R1YA 4ZTSA 1VZOA 3MVLA 4OTHA 1CMKE 3UG1A 4WSQA 1OBDA 2H6DA 4DDIA 4BCOA 4RJ6A 2A2AA 2YM4A 4H05A 3RAWA 5C1QB 4EOOA 5CF4A 3KFAA 2XKDA 2E9VA 3LOKA 5CASA 3MWUA 3LFDA 4BKZA 2W5HA 3W0MA 2R3RA 3NZ0A 3TZ8A 4RWIA 3W10A 4BZDA 4CFXA 5BVDA 1BX6A 1ZOHA 4TWPA 3GU6A 3KEXA 2XK7A 3HRBA 3NNXA 3O2MA 2IZTA 3AMYA 2IW6A 4UY9A 2BAQA 1WBPA 4BGGA 2BHHA 4IAIA 2OGVA 3MFSA 4CYJA 2OJGA 2G1TA 3G15A 2C47A 3RALA 3NDMA 3W2OA 4D55A 5M4CA 4RX5A 3G9NA 2UV2A 1A9UA 3UIXA 3U6IA 3W0OA 4K11A 4MXAA 4O1OA 2YAKA 4E73A 3OTUA 2I40A 3EQPA 4N0SA 5J7HA 1IASA 3VN9A 1ZYCA 1OPKA 4C8BA 1Z5MA 2WO6A 3UQGA 5HI2A 3NVKI 3F7ZA 3UNKA 4CFUA 4O1PA 5LMKA 4DH3A 3ZMMA 1SVGA 1FVTA 2YIWA 4WRSA 4F7JA 2GNIA 3Q96A 5HZNA 3QZGA 1W84A 3W0RA 2F4JA 5KO1A 5AUWA 2OU7A 4IW0A 4FIGA 3MGYA 4DN5A 3LJ1A 4AE9A 4TNDA 3PRIA 5DBXA 1JLUE 1JPAA 2XYUA 2XNNA 1O9UA 3UNZA 5J9LA 2R3QA 2J90A 3GU7A 3R7GA 3OHTA 4KIOA 2R3MA 5IQEA 3TUCA 2G2HA 2E9NA 3UPXA 4ZLYA 2REIA 3S0OA 1KE8A 3HRCA 3FDNA 5F95A 3QUPA 4NM7A 3DJ7A 1XMMA 2PE2A 4CFMA 4KKGA 4CGAA 3FLYA 3S95A 4B9DA 4IANA 5E90A 3BE9A 2B9JA 4OTWA 2JD5A 4FV8A 4XRJA 5IQDA 5DGZA 3FYJX 3KU2A 3DNDA 3OBGA 2X8DA 4JRNA 1RW8A 2PY3A 4PWNA 3QTWA 4MD9E 1IAHA 3QLFA 4RMZA 4LYNA 5EDQA 4UMRA 2PMIA 1JNKA 3MJ1A 3NGAA 4FKWA 3V8WA 3ZFYA 3DQXA 2R9SA 4M8TA 4JQ7A 3VUGA 4AZVA 4V0GB 2VN9A 2VTIA 5BYLA 4MUQA 3TI1A 2ETRA 2YABA 3NUYA 4G1WA 2J7TA 2OO8X 2VZ6A 2XNEA 4DEAA 4G34A 1ZMWA 4QOXA 5KMMA 2I0HA 2Z02A 3V8TA 1I09A 3WZUA 4C3FA 1UKIA 5J95A 3AD4A 4DEIA 3KN5A 4O96A 4BCPA 2VV9A 1OZ1A 1P4OA 3VF9A 3VUIA 3VO3A 5E92A 4AW0A 2FSTX 3FLZA 2QOCA 3R2BA 4RIWB 5K0KA 1PXIA 2X0QA 2RIOA 3D7ZA 3BYSA 4FIFA 3OEZA 4CCBA 2WEVA 3Q6WA 3GC7A 1OM1A 3Q5ZA 4FT5A 4QPMA 3BEGA 3HMMA 3UODA 4G6LA 3RCJA 2B7AA 3LAUA 2WTKC 3AG9A 4OT5A 3HAVA 1WBOA 2EB2A 5BMMA 2FSMX 2GS7A 3C4XA 3F82A 4F99A 5BUEA 5HVKA 4R1VA 5L8JA 4G3EA 2OG8A 3R9DA 3R83A 3Q5IA 3R2YA 4D2RA 4E93A 5BYYA 2BRMA 2PU8A 4Z16A 5HHWA 3EB0A 1YVJA 5DWRA 3Q6UA 3I6UA 3R63A 3LFFA 1FBNA 1U54A 4YU2A 2CSNA 4U6RA 2WQNA 1UU3A 2X2KA 1LEZA 3SX9A 4FNZA 3VBQA 3LW0A 4UWCA 1KWPA 4GKIA 4FTLA 4M13A 4O4FA 4FG8A 3MVJA 4HZSA 1YWRA 2ITOA 4KS7A 4MNEA 4O0WA 5CEKA 2P2HA 4RFZA 3TEIA 1TQPA 3R8PA 5ANGA 4A9UA 4BCQA 3W0SA 4EZ7A 3ZEPA 3NYOA 4OTIA 5A4EA 3R1SA 1B39A 3OD6X 2J6MA 3CPCA 3H9RA 3BYMA 4USDA 1PJKA 4E6AA 1UA2A 2C6IA 3CTQA 3GBZA 4IE9A 4RGJA 5FXRA 4CSVA 3IW6A 1APME 4WKQA 3K3IA 2RGPA 3AD5A 5M44A 1VLRA 3SQQA 4FZDB 4WBBB 4BDCA 3W0QA 4EOMA 3FSKA 4ERKA 4MKCA 1J1BA 4EKLA 1UWHA 3BGPA 1RQQA 4I5CA 1PMVA 4UMUA 4LMNA 3O51A 1LEWA 4RT7A 2BR1A 5I9UA 3FL4A 4QTDA 4E5BA 3WF9A 2AUHA 5CXZA 4E1ZA 5IG1A 3Q52A 1M2RA 2W06A 2PHKA 3K3JA 4O91A 4BDEA 4F0FA 5LWMA 3GCSA 3Q4CA 5IQHA 3AKKA 2QD9A 3JY9A 4L01A 4RFYA 3DKCA 4QP9A 2X0GA 3ALOA 3ZLSA 4PX6A 4F6SA 5CU3A 5DT3A 3RAHA 4X3JA 4E4NA 1H4LA 2UZEA 4II5A 4Z7HA 3QZHA 3IDBA 4X2KA 4ZTQA 3F5PA 2FSLX 3LFEA 3JVRA 3NRMA 5HE2A 3DK7A 5AP7A 1PXPA 3MPAA 4MBIA 2R7IA 4QQTA 3MA3A 4LFIA 1ZYSA 3R1YA 4PDYA 3EHAA 5EQEA 1ZYJA 4CG8A 2OZOA 4IJ9A 4PY1A 2OXYA 3EOCA 3E93A 2ZB0A 4YMJA 2JKKA 4B7TA 4LV8A 4DHJA 3MSSA 4FSYA 3CTJA 3ZM4A 2HELA 1MQBA 1LP4A 3OTVA 4MXOA 4R7HA 4Y95A 3RJCA 3FMKA 3FUPA 5HE1A 4QMNA 5IQAA 5AA9A 3NIZA 3R8MA 1GZNA 4JL9A 4KA3A 4KKHA 4TTHB 2F2CB 3SG9A 5EM5A 4O7WA 4C33A 3GC9A 3NUPA 3PP1A 3BHTA 3R1QA 1KV2A 1SNUA 3QRKA 4L7FA 3Q32A 4M0YA 3R8ZA 1OIRA 4YJSA 3LQ3A 3VS0A 2QO7A 4FEUA 3BU6A 3GCUA 3H4JA 4XP3A 1PXNA 4U7ZA 4FT9A 2I0EA 3MPMA 3UYTA 3MV5A 3F66A 4TN6A 4XG3A 2IW9A 4EHVA 5BX0A 2RG6A 4G17A 2Z7SA 4R3CA 3Q4TA 5CENA 3ROYA 5DI1A 3PP0A 3SRVB 4JT3A 5F4NA 4RFMA 5G1XA 3BHUA 3BV3A 2OSCA 2PZ5A 3Q9WA 4O86A 4ACGA 2WMAA 2WMUA 2ETKA 2JEDA 4QTEA 4I20A 3CJGA 4V0GA 4IXPA 3EQRA 4WOVA 2QVSE 2C5OA 2AQXA 3I60A 3FLNC 4AN2A 1YHVA 3R02A 4QYYA 5J1VA 5FGKA 3AQVA 2HENA 4JQEA 2XK3A 3SHEA 4BGQA 4XRLA 1TFFA 3EZVA 3A60A 4FBXA 2ZM3A 3M42A 1EH4A 5KMKA 1YXTA 5CSVA 1JKSA 2C6OA 5IUHA 2O3PA 2DUVA 2RF9A 4ITIA 3WF8A 1S9IA 3FHIA 3RK7A 3ZH8A 4FODA 2PUPA 3TZMA 1XH9A 4FX3A 5JQ5A 5ITAA 3TTJA 3LCKA 2JIVA 4PUZA 4Y8DA 4DT9A 3I4BA 4F9AA 1KOBA 5ACBC 5LVMA 4NJDA 3DFAA 1Q5KA 5HX8A 4U41A 3F3UA 3UG2A 3P0MA 5EW9A 4F08A 3PJ1A 4E5AX 4HPTE 5LCJA 3DA6A 2RKUA 4O7RA 3IW7A 3DCVA 3EN4A 2CGXA 4OBOA 3FI4A 4LRMA 3NNWA 3D5VA 3G6GA 2VO7A 3F3ZA 4GIIA 3Q2MA 4C4EA 3UIUA 3MA6A 3G6HA 4QYHA 4AT4A 5CEPA 5AR5A 4R3RA 1MQ4A 1ERKA 2FO0A 2Q0NA 2RFEA 4RZVA 4U40A 4YLJA 4ZXTA 2V22A 5FDPA 1CTPE 4GG5A 2JDTA 5AM7A 3TWJA 2J0LA 1L3RE 3ERKA 2OIQA 3M11A 2C6EA 4L44A 1Q97A 2HY81 3EN6A 1G8KA 4P5ZA 3TZ7A 3T9TA 2VTPA 5AIKA 4TYGA 4C02A 2QLUA 3R30A 3EQFA 1WBVA 3UO6A 3LIJA 4BDDA 5I0BA 4PP9A 2UZOA 4OAUC 4ZTHA 2WXVA 5BMSA 4H3BA 4RVLA 3LJ2A 4ZLOA 2UW9A 4IAKA 4YGAA 2AC5A 2X7OA 5LJJA 2Y9QA 1OUYA 3ID6C 5M09A 3UDSA 4XJ0A 4K33A 3Q60A 2WD1A 2C6LA 3NEWA 5DRDA 3W18A 1H1SA 1DI8A 2GFSA 5IPJA 1URCA 2XM9A 3LCDA 3WZJA 1OKWA 4YC6A 1BI8A 5AEPA 1DS5A 4UEUA 5HESA 4GJ3A 2XNOA 4V05A 4ZLZA 2YWVA 3FMLA 4X2JA 4G9RA 3PE1A 2QHMA 2QOOA 4M69B 3EL8A 3PZEA 3QTXA 3GCQA 4IJPA 3TZ9A 3IDCA 3DXQA 4BTJA 3PUFC 5HLPA 5CVFA 4OUCA 4ASXA 5K9IA 5IEYA 5CEQA 4YHTA 2GSFA 4OTRA 1VYZA 2YISA 2XARA 3E62A 2OJJA 2JGZA 3COIA 4H1MA 4NKAA 3TKHA 4D2WA 3TNWA 1WFCA 1AQ1A 5CU4A 5FEQA 4K1BA 4TT7A 3DBDA 3QQHA 3NUAA 4KB8A 5D41A 5BVNA 1IG1A 5KZ0A 4AOTA 2CJMA 1PHKA 3UOHA 2PZPA 4AFEA 3R71A 2XIRA 4WNOA 2BVAA 3VF8A 1WBTA 4JS8A 4NCTA 5C8NA 3DV3A 2VTMA 3WE8A 4DFLA 4XH6A 3C4FA 4M15A 3EKKA 2OICA 1PXKA 3I0OA 4LI5A 1FVVA 3G51A 1RDQE 2BZHB 3DK6A 2C6TA 3VBXA 1PKDA 4C58A 4G16A 4ZK5A 2QLQA 2B9HA 1Q8ZA 3ULIA 4QDEA 3D7TB 3RNYA 2O2UA 4M3QA 2YDIA 3P5JC 3QTUA 4JR3A 4AGDA 4K9YA 5KNJA 2VO3A 4YJTA 4AS0A 4C34A 4R5YA 2QC6A 3WF7A 2XCHA 2HOGA 4D4VA 4LV7A 1H28A 5F1ZA 1XH8A 4F9CA 3PIYA 2GCDA 4TRLA 4CMUA 4B8LA 4RRVA 3UVQA 3CD8A 4D0WA 2WMWA 5E4HA 2W1EA 3ZUVA 5K4IA 4ITJA 4LM5A 5IQBA 4YC8A 4HYIA 2UW6A 5I3OA 3SRVA 4ZMFA 2C3KA 3ZRMA 2IJMA 4E5WA 3B8RA 1YKRA 2XIZA 4AN3A 2UW5A 4WSYA 3ZC5A 5IKWA 3PLAE 2OXDA 4O7YA 3WYXA