1LP4A

Crystal structure of a binary complex of the catalytic subunit of protein kinase ck2 with mg-amppnp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
327
structure length
327
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein kinase CK2
publication title Inclining the purine base binding plane in protein kinase CK2 by exchanging the flanking side-chains generates a preference for ATP as a cosubstrate.
pubmed doi rcsb
source organism Zea mays
total genus 108
structure length 327
sequence length 327
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1lp4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1lp4A01
1IR3A 3FAAA 3O2MA 4FTIA 4LGGA 4OT6A 4YSJA 1JPAA 3F9NA 3AG9A 1Q61A 3OWLA 4YC6A 4BYIA 5C1QB 3MFSA 4FSMA 4ZY6A 1YXTA 3PA3A 4KIQA 4XYFA 3UP7A 2X9EA 3K5VA 4YLLA 4C7TA 2JBOA 3SVVA 3KN6A 4O1OA 2OWBA 3ZO4A 2YJSA 2W9ZB 5FDPA 4FV2A 1FBNA 4G1WA 2GHMA 3AC4A 2F2CB 2UZVA 2C0OA 3C4EA 2I0EA 3KK8A 3ORKA 3PZHA 4HCVA 4RJ6A 3FMEA 4RZWA 4NU1A 4EK6A 5IEXA 2WMTA 1XQZA 5IUGA 2XYNA 3W2OA 3CTQA 1F3MC 4O7YA 4FKQA 4DFLA 4XBRA 3THBA 3P78A 4BTFA 4N6YA 3D9VA 4D2VA 2YDJA 4H3QA 1GNGA 4BBFA 2B9HA 2VO0A 4MBLA 2IW8A 4NKAA 4R3PA 1OBGA 3UNZA 2CGXA 3NYOA 4QMPA 3PXKA 4F1MA 3AT4A 5FTQA 5BQ0A 2GNLA 5IU2A 2W4JA 2C5VA 5M55A 4BKYA 4CFFA 2Z7RA 4B99A 1OKWA 3LMHA 2QCSA 3NVKI 1JLUE 4BDHA 4A7CA 4IJPA 2ZDUA 2WEIA 5CT7A 4FBXA 4CCBA 1JKTA 4QP3A 4F6SA 4QQ5A 3UVRA 2OF4A 4HVSA 3TV7A 4BCPA 3ROCA 3DZQA 3R02A 5LVPA 4FT9A 5T6KA 2YERA 1YQJA 3TEIA 2V7AA 2OKRA 2XMYA 3FI3A 4QMNA 2FSTX 2XIXA 4IBMA 3VS4A 4FEUA 3FY2A 4C36A 3PIXA 3SOCA 2W1GA 4GCJA 4L7FA 3I6UA 4F0IA 4IADA 3NUYA 2ZB0A 3OZ6A 4YHJA 3R7UA 4ACGA 3TUBA 4V0GA 5FP5A 3CKXA 4IE9A 3TNWA 4K6ZA 3KC3A 1M52A 5IQEA 2QI8A 1Q3WA 2YA9A 3DBFA 3EL7A 2HWOA 4CSVA 5DR9A 5ANIA 3WE8A 3AD4A 4YHFA 1OL7A 2RG6A 3ALNA 1QPEA 4PTEA 3CD8A 1H1QA 3FV8A 2P33A 3VJOA 4BZDA 4BIBA 4U79A 3BQRA 1W82A 5AFVA 4GL9A 4IEBA 2ITUA 2QHMA 2ACXA 5HBEA 4DFNA 4LOQA 4PMSA 3OD6X 1R78A 2W99B 4JRVA 3EL8A 5FBOA 4YHTA 2XJ1A 3DAJA 2XNEA 4D2SA 3ZYAA 4NIFA 4YJPA 4L3JA 4FKSA 1BL6A 3IW6A 4WSYA 3GCSA 3OMVA 3DZOA 3PWDA 3V5LA 3FMDA 3M2WA 4MXCA 5L4QA 4F7LA 2E9UA 3A7IA 4FKWA 4EH2A 5GZ8A 2NRYA 2XCKA 3CS9A 3KXHA 3PE2A 4QP8A 4F70A 1PKGA 4F63A 3NW5A 5EFQA 1Y8YA 3D15A 1ZZLA 4C34A 3R8ZA 3H3CA 3K3JA 4AZVA 4K8AA 2VWYA 2B9JA 3EKNA 4XCUA 4I1ZA 4XNEA 5HX8A 2J4ZA 4EQMA 4F1OA 3ZH8A 2DQ7X 3AGMA 1M7QA 2JIVA 3DNDA 3FMJA 3NCZA 4XG7A 3WYXA 3EN5A 3ZM4A 3DAEA 4TYHB 1H25A 5BNJA 4JQ7A 4USFA 2FA2A 5CVGA 3VBTA 3GC9A 2ZJWA 3GC8A 4D9TA 1Y6BA 4X2GA 1YXSA 5K4JA 4CXAA 3MH3A 3V51A 3BCEA 5DG5A 5CEIA 5DR6A 3QD0A 3QXOA 3PJ8A 3VVHA 1J91A 1PXPA 1TQIA 1WBOA 1ZXEA 4M12A 3EQBA 5FBNC 1XH6A 4ZXTA 3QQHA 4EJNA 4F64A 4ASDA 1YWNA 2HYYA 3MA3A 3SA0A 3BHHA 4A9TA 5FD2A 2V0DA 4O2ZA 3TL8A 3QL8A 2XEZA 2ZMCA 4H36A 3V6RA 4XEYA 4XJ0A 2PPQA 4O7VA 2WQEA 1IG1A 2ITOA 3BHYA 2VTTA 2ZAZA 5ANKA 1OL5A 3QUDA 3IG7A 3S95A 3PY0A 2H6DA 4JAJA 2J0MB 4L3PA 2BCJA 5ACBC 4QTAA 3DDPA 4M8TA 4O1PA 4TZRA 4Z7HA 3QX2A 2ITVA 3KMWA 3TJDA 1QL6A 4CV9A 3TV4A 1WBVA 4HVIA 3EN4A 3KCKA 3BKBA 3HGKA 5EDQA 5FQDC 2YLFA 3HMOA 1OUYA 4I24A 5IEVA 4JIKA 3TUCA 2JITA 3UO5A 1JAMA 3L9MA 3KXZA 1FPUA 3T9IA 3LFQA 4EH3A 2UZLA 4I0SA 3EZRA 1SNXA 4FTNA 4CGAA 3BYVA 5A4EA 4GFMA 4BWXA 3FLZA 4Q5HA 5LMKA 3V8WA 4YJNA 5HBHA 5TOZA 2W1HA 4YZCA 2WQMA 2PVMA 5FWKK 3LCDA 4XP3A 4D58A 2RFDA 5GHVA 2O5KA 4AE9A 2EXCX 3DLZA 1KE7A 2CPKE 2GCDA 3HECA 3QWJA 5HTCA 1J7UA 3FZRA 3KRXA 4HOKA 3IW5A 3FZTA 4I20A 2WMUA 2CSNA 2X2KA 4FI1A 3UG1A 4O0SA 4ZTQA 2CN8A 4TN6A 3OW4A 2CDZA 4BY9E 4YC8A 2OBJA 4LFIA 2W17A 1BYGA 1PXOA 2X4FA 2AC5A 3MTLA 3OUKA 3R1SA 4LMNA 4O0VA 4CMUA 2ZVAA 1LP4A 4OTPA 2O0UA 2UZTA 2XIRA 4FMQA 4O27B 5HCZA 5HG7A 1NW1A 2X39A 2WMQA 4RX7A 3NAYA 3F6XA 1LPUA 5AIRA 5D7VA 2BALA 4TPTA 3VWAA 2W1ZA 4DCAA 5DRBA 5K0XA 4U45A 3ZZWA 4AGWA 3CBLA 5FTGA 4O6LA 5AR7A 4NH1A 2X6DA 4LUDA 5JGAA 4PTCA 1H4LA 2RFEA 3F2AA 4B0GA 4TNBA 4V0GB 4LRKA 4FC0A 1UU7A 4IHPA 3Q9XA 5AP4A 3CY3A 3F5PA 1GZNA 5AP7A 3TKIA 3VQHA 1M2RA 1ZOHA 4JAIA 4ZEGA 5KKRB 3UBDA 5BVKA 2Q0BA 4LOOA 3KVWA 2IN6A 4O21A 2PVJA 4U5JA 4D4SA 4A9SA 1G8SA 2V55A 4FV1A 3ZOSA 3G0FA 5M4FA 5J9LA 2R64A 2I7QA 3UG2A 4UX9A 2QR8A 2OFUA 3FHIA 3P23A 2BIKB 3SRVA 2QODA 4YO4A 5HI2A 2PVNA 3LFDA 4C3PA 4CFVA 3JXWA 5L2SA 4DGMA 5BVNA 3C51A 3OXZA 3D4QA 4IB5A 4WRGA 5AUVA 2GQRA 1TKIA 4GYGA 4BI1A 4R5YA 4GU6A 4X3JA 3UIUA 4W4WA 5ANJA 4Z55A 5DMZA 2VZ6A 4NIFB 4XG6A 3MFTA 2YHVA 4O0UA 4TWPA 4GRBA 5IDNA 3LFSA 1B38A 4IDVA 4TYIA 1NVQA 1MRUA 3WIGA 3A62A 3B8QA 3UC4A 4DH3A 3EQGA 3FLNC 3TT0A 3FMKA 2R3GA 2W5BA 3F61A 3P86A 3D5XA 4CCUA 4QQTA 3FMMA 5CU3A 2ZDTA 5HGIA 4QMWA 4RVKA 3FZOA 3QHWA 5CI7A 3PXZA 5DT4A 3RPVA 2IVVA 3R7GA 4HYUA 3WF5A 2C68A 1VJYA 3OROA 1NVSA 4PMMA 2P55A 1U46A 3NWWA 3QWKA 5J87A 2JIIA 3SOAA 2CNUA 4RIXA 3QQGA 2BPMA 2SRCA 3E92A 3BV2A 3UIXA 4D28A 1JOWB 4QMSA 5HLPA 4ANNA 3FYJX 4QYYA 3BHUA 1W7HA 3E8NA 2GPHA 3LFEA 4KUJA 2UW5A 3C9WA 5DI1A 5IQIA 3ELJA 3PTGA 4IVDA 3MTFA 5KMMA 4U3YA 4RPVA 4QTBA 4RWLA 2VGOA 3B2WA 2VNWA 3EQHA 5FM2A 3ZLXA 2UW8A 5J1VA 4BI0A 3LFAA 4JDIA 1XR1A 3I0QA 4C61A 4I5HA 2OJGA 3Q9ZA 4FSQA 4OR5A 2PHKA 2WB8A 3NW7A 3TG1A 1PHKA 4FL2A 4U40A 4QPMA 4IVAA 3HDMA 4KINA 4N4SA 4KKHA 2PMNX 2HK5A 4O38A 4EWHA 5HIEA 3KVXA 4DC2A 2C47A 3AC3A 1GIIA 3FXWA 4JDKA 4QT1A 5E8SA 5EM8A 3R9NA 4AA0A 4O7ZA 3NS9A 3OS3A 4X7QA 5HESA 4BCGA 4AZWA 4CZUA 3D2IA 4KIKA 1IASA 5IA5A 5ETFA 3R7YA 1RE8A 3C4XA 3GNIB 4AP7A 5JRQA 3COMA 2BZJA 2Y7JA 4KSQA 3UZPA 3R7EA 4AGUA 4I93A 3BE2A 1I09A 2WMAA 2XK7A 3U51A 4JBVA 2PVHA 3GOKA 1J3HA 4G9CA 4O2PA 3DB6A 1IAJA 2UW3A 4HGEA 3PPJA 5DFPA 3V5JA 2XB7A 1ZZ2A 3VUMA 3MV5A 4E5WA 1M7NA 4QMXA 3RALA 1M2QA 3L8XA 3NRMA 1PRYA 3MPTA 4C4JA 4G2FA 2WTVA 5C01A 2J0IA 3O0GA 3KXNA 4OTHA 4QTCA 2XJ0A 5DNRA 1CMKE 1YI4A 2J2IB 3W8LA 4KRDA 4EOPA 3Q53A 3DK6A 5HCXA 5JZNA 3I5ZA 4BDGA 4ANOA 5CAQA 4RJ4A 5EW3A 1IA8A 1Q62A 4OLIA 3EZVA 2PUIA 5CYIA 2WO6A 5BVDA 1OUKA 4KA3A 4W9XA 3UVPA 4ENXA 1H27A 3BYSA 4FV4A 4QOXA 5ETIA 4CT2A 2GMXA 3WF7A 3RNIA 4IAYA 5TE0A 3UP2A 2OH4A 2PK9A 4TRLA 2X1NA 3OG7A 2YDKA 2CJMA 3TNPC 3ACKA 3Q32A 4RFZA 4I22A 4X0MA 2XIZA 3DFAA 5IUHA 4BDBA 3DXPA 2AC3A 3PJ3A 3M1SA 4C2WA 5A6NA 5AR4A 1CKIA 1G8AA 2XBAA 2ITQA 3LJ1A 3CEKA 2CKQA 3CSVA 2HWPA 4RJ8A 4XV9A 4L7SA 4C62A 5HLWA 4GJ2A 4DEDA 2BRBA 5ANGA 3W2RA 2Y4IB 3I1AA 1OKVA 4IB0A 4APCA 4QNYA 5G6VA 3S3IA 2C6IA 3QD4A 5AMNA 2VWIA 4PTGA 2PVFA 4HCTA 5JFVA 1Z57A 4A06A 3HP2A 3RBWA 2RSVA 5IH5A 3PP0A 3FLSA 4ARKA 1SVGA 3ORLA 2A1AB 1DAYA 2BIYA 4QD6A 4UV0A 3HMNA 3BEAA 4RIWA 5DH3A 2WMXA 4QNAA 3ORTA 4ZSAA 4W4YA 5BVWA 3M42A 3MB7A 3CY2A 5AP6A 3RP9A 4ZZNA 3SRVB 2YM7A 2X4ZA 2OZAB 1YHSA 3PIYA 1J7LA 4K18A 4C8BA 1TQMA 3LQ3A 2IZUA 4KRCA 1Q5KA 2OLCA 5FEDA 1GAGA 5KMLA 2BROA 2YZAA 1W0XC 3TTJA 3LZBA 4B6LA 4M68A 4GIIA 2XIYA 3D83A 3VULA 1Q8TA 2Y6MA 1O9UA 3RPSA 3SKCA 3K3IA 3TNHA 4IACA 5M56A 5GNKA 3ZSHA 4IZAA 5JT2A 4AA5A 3FL4A 2WTJA 5M4CA 2WTKB 4RT7A 2XM9A 4ALWA 4MK0A 3PLSA 2IW9A 4OTIA 4O7WA 4C33A 4FEWA 4EONA 5KKRC 4FV6A 2WU7A 3ACJA 2IZTA 2QD9A 2FSOX 3GU5A 2J5EA 2B53A 2R2PA 3I6WA 4ZZMA 2IJMA 1OIRA 5LXMA 1OIYA 3BX5A 2PMLX 3PE1A 3AXWA 4NWMA 1YHWA 4QMUA 4WKQA 2UW0A 2HZ0A 3BWFA 3PRIA 4I6FA 3DB8A 3P79A 2F7EE 3TXOA 4MNEA 4KD1A 4UZHA 5AM7A 3ET7A 4NW5A 4HYSA 3JS2A 3RWQA 3ZO3A 1E1XA 5A4QA 4RIXB 5IKWA 1CTPE 3REPA 4KSPA 3HA8A 2QO9A 3NYXA 1CKJA 4PRJA 5BVOA 4AOTA 2VX3A 2QO2A 3OVVA 4FX3A 3VUIA 3H0YA 2C6OA 4BC6A 3V01A 3KB7A 4U42A 3KREA 3C13A 2Y9QA 1RDQE 5E90A 4J1RA 4A9YA 4EH7A 4AFJA 5GINE 5TR6A 5E8TA 2JKKA 3AD6A 4DE4A 2XNNA 2JAVA 1W84A 2J6MA 3NUUA 1FQ1B 4M66A 4MQ1A 4PV0A 5IA4A 5M4IA 5EDRA 1H00A 2XNMA 4BTJA 3KRJA 4FL1A 3FE3A 2OW3A 3QQKA 4TWCA 3COIA 1GJOA 1R1WA 2JDRA 4IAZA 5TF9A 2ZB1A 3UO6A 5JEBA 2H34A 4BCNA 1GZKA 4G17A 4PQNA 1VYZA 3KY2A 3SD0A 2YCSA 4FTUA 3GU7A 4QP9A 5CEKA 5E8ZA 3OCGA 3OXIA 2OJFE 4FKUA 4I4FA 2QOCA 4WIHA 3OY1A 2EB3A 2R3RA 3N9XA 3OCSA 4NEUA 4DH5A 5AJQA 3GOPA 4KIKB 3WZKA 1V0BA 3EQDA 5IISA 1XO2B 5AP2A 1WBSA 4KS8A 2B9FA 1NXKA 3GP0A 3ORIA 3KXXA 4RIOA 3ZZEA 1X8BA 3G5DA 3VC4A 4DEEA 3A8XA 5DWRA 5I4NA 3F2RA 1AGWA 5EYMA 3KMUA 4APPA 4R5SA 1NY3A 4V05A 3R7IA 3EB0A 4L44A 3FZPA 4BIEA 5AUZA 3ZO1A 2VTRA 4IZYA 2OU7A 4UBAA 5AAFA 3HA6A 4FG9A 3FBVA 3ZEWA 3MYGA 1DS5A 4FGBA 4G9RA 4GVAA 1JKKA 4ITIA 5AP5A 3WF8A 4OT5A 3ZM9A 1FOTA 3VRZA 3R2YA 1BKXA 3P4KA 4CD0A 3ORMA 3MVHA 2GHGA 4GUEA 4JR3A 3RHKA 5FDXA 1E1VA 5CU2A 3HRCA 3ORZA 3QTIA 3E8DA 4WRSA 4ANBA 4EL9A 5E8WA 1OVEA 3ANRA 1KOAA 5AX3A 1J1CA 3COKA 3FC1X 3FZSA 3EN6A 4IM0A 1PF8A 2HW6A 4ZTMA 4A07A 1ATPE 3MH1A 3POZA 3R2BA 5ACKA 5IMEA 3IOPA 4IC7A 3EYGA 4LL0A 3NIEA 2F57A 4U0IA 4L67A 4JDJA 5FM3A 3UO4A 4GH2A 4K77A 3TM0A 5TT7A 4UXQA 4RGJA 1JSVA 3FMNA 3MVJA 4E20A 2JIUA 5F9EA 3WIKA 5CAOA 4G16A 4G34A 3MFRA 4U41A 4E5AX 3KEXA 4HJOA 4EK4A 3F5XA 4UZDA 2WTIA 1Q8YA 1PXJA 5D11A 5DA3A 3QC9A 4FTCA 4JT3A 4L8MA 5J7BA 5CALA 3UNKA 1U4DA 1FMOE 5CAVA 4MD7E 3VIDA 2F9GA 3VS0A 2BILB 4FKGA 4XP0A 4YJVA 3OCBA 1OPLA 4Q9ZA 4MQ2A 2C6MA 2F2UA 2BVAA 2VO6A 5I3OA 3H9OA 4DH1A 3GGFA 4FUYA 4HVGA 3AC2A 3R9HA 5HICA 2BR1A 4RIWB 5IPJA 4CT1A 2W4OA 2VGPA 4OBPA 5BX0A 4ALVA 3V8TA 4QMMA 4GFGA 1YW2A 2V5QA 2WXVA 3ITZA 4G6LA 3TN8A 4M13A 4O22A 3AGLA 3UE4A 3FYKX 4FEQA 1JSTA 5EHOA 5DYJA 3OT3A 4FV9A 3U6HA 3T8OA 3TKUA 1VYWA 2WQBA 4LL5A 3L8SA 1Q97A 3KRWA 4JDHA 3AMAA 4XG3A 2OFVA 3O71A 4GK4A 3HV4A 4AW2A 2QR7A 2Y4IC 3MVLA 2IO6A 5IDPA 1PKDA 4UXLA 3PJCA 5AV2A 3PDTA 3BU5A 5CZIA 3FY0A 2VTPA 1TVOA 3U87A 5TKDA 4TL0A 3NMUF 3TNIA 5CASA 5GJGA 2X7GA 4UY9A 4M84A 2J0JA 4HVDA 4CNHA 2X8DA 1MRYA 3QQUA 4M97A 3K54A 3E64A 4CLIA 4BDJA 4KKGA 2OSCA 4PP7A 1KE6A 3W2CA 1YHVA 3MA6A 3OC1A 5E9EA 3MJ2A 4MNEB 3BHVA 3LXNA 4JVGA 2VWZA 5T3QA 4EOQA 4FNWA 2YM4A 4EC9A 4H1MA 4NK9A 3SC1A 3TCPA 4QPSA 5KX8A 3NUXA 4YTHA 3GVUA 3KN5A 3Q4ZA 4EH4A 2QO7A 2QOLA 2XA4A 3I60A 4FODA 3R9OA 4FTAA 4I23A 1S9IA 4RC2A 5A4TA 4BL1A 4FSWA 3F66A 3SV0A 1ZY5A 2WTKC 3QCXA 3WZJA 5CANA 2QHNA 3A2CA 2PUNA 4FTTA 4F65A 4QO9A 2OXYA 4KNBA 3BYOA 5H8GA 2OG8A 3LXLA 2DYLA 5CENA 1YWVA 5E4HA 4YR8A 5C8KA 5HX6A 3CE3A 4IDTA 2OJJA 3QAME 4XH6A 4M7IA 5A46A 4ZMEA 3UOJA 3AC5A 3U6JA 3LXPA 4AT3A 5IA2A 3BPRA 3DNEA 4QMLA 2R3HA 5IA0A 2PUPA 4BFMA 4MXAA 5FEEA 3P5KA 5EQYA 5DEWA 2BDWA 3WZEA 3OFMA 3RAKA 2ZV8A 3RCJA 1A06A 5AP3A 4D2TA 5HNIX 4TY1A 3MGYA 2NNWB 3TIYA 4O96A 4CFXA 3VF9A 3L9LA 4EORA 3UOHA 1H1PA 2BRGA 3GBZA 5BYZA 4EUTA 2I40A 4FR4A 4YTFA 2IG7A 2VTAA 3N51A 3LPBA 2Y6OA 4PPCA 1PXMA 3I0OA 4E8AA 2GFCA 2P2IA 4WNPA 3C0HA 4EHZA 2HAKA 3AQVA 4J99A 2GNFA 5KMNA 2C30A 4LGHA 3Q6WA 5JN2A 2XYUA 1WMKA 4CRSA 3LJ2A 4O7LA 5HZNA 3HV3A 5BUEA 1XBCA 4J7BA 4PP9A 3ZRKA 3Q52A 2J9MA 2EU9A 4FYOA 4EHEA 5CXZA 4J8MA 3Q5ZA 5CNNA 3ATSA 4IW0A 4MXOA 2VX0A 2RL5A 4EOIA 3SGCA 3NNXA 4FGRA 3UZRA 2WFYA 3QQLA 4RWIA 1ZWSA 4FKJA 3SDJA 3DLSA 3EJ1A 4WD5A 4Z7GA 5AEPA 3B2TA 1OL1A 2XF0A 4Y73A 5GIPE 2PZYA 2I1MA 2BHHA 4S33A 2OJ9A 3QTSA 2PZIA 2QOFA 5LWNA 5M08A 1H1WA 2IVUA 1P5EA 2B54A 1PW2A 1QPJA 4QYFA 4DFBA 4NCTA 3EHAA 4FA2A 3VBWA 3P7CA 1R0PA 3VBVA 4O91A 1XHAA 4Q5EA 4ZLOA 4LQMA 5LCJA 3N4TA 5CLPA 4ACDA 2XEYA 4FL3A 4GV1A 4LGDA 1VZOA 1YVJA 3DBQA 3E88A 4QP7A 2VX1A 4RSSA 4AN3A 4BCKA 3CLYA 3HNGA 1MRVA 4XV1A 4ZY5A 3VUTA 4NYEA 3S2PA 3QALE 4BGGA 4JS8A 1YDSE 2QQ7A 5KMKA 2QG7A 4MVFA 3ZBFA 4DHFA 4FTQA 4QMOA 4ID7A 1GOLA 4KABA 3SXFA 4WUNA 4KBAA 3DY7A 5H8EA 1DI9A 3WBLA 5L8KA 1FINA 2H96A 4QMQA 3VUHA 4ZMFA 2A4LA 1KV1A 4BWPA 4MYGA 2R3IA 5HIDA 5C03A 1WVWA 4C2VA 1B6CB 5B7VA 4AW5A 3BE9A 4GG7A 5HBJA 3QA0A 3EQPA 3W33A 4R1VA 5L8JA 2EXMA 3ZLSA 4GS6A 4BICA 3AT2A 4F4PA 4YJRA 3NIZA 4EOLA 4II5A 1FMKA 1H0WA 1Q4LA 3IGOA 3T3UA 3FHRA 1ZOEA 4DFXE 2CN5A 3FPMA 3EOCA 4X2KA 2W0JA 3ZDIA 5JQ5A 3CC6A 4KIOA 3ZRMA 2UW9A 3UMXA 3ETAA 4D0XA 5CU0A 4C0TA 3P7AA 4N70A 3TIZA 3TUDA 3QTQA 5HNGA 3RM6A 4MCVA 3LKMA 2FGIA 3Q2MA 2ONLC 5L6OA 5JKGA 2PWLA 4C3FA 3R28A 4JX3A 1XBBA 2JFMA 3Q2JA 3A7JA 3ZFYA 2WU6A 5EG3A 4GK3A 2WQNA 1GY3A 3R83A 5EKOA 3GU4A 3GENA 3EKKA 1ZYSA 4OGRA 5CSHA 5LMBA 3A4PA 3R0TA 4UMRA 3GT8A 3PYYA 2J0LA 4EQUA 3U9NA 4IFCA 4X21A 3FI4A 3JY9A 4D2WA 3NNUA 3Q9YA 3R00A 3HAMA 4HGSA 4KS7A 3DKOA 3KL8A 4ZLZA 4G5JA 4DEGA 3E7VA 4CFUA 3O8TA 5A6OA 4MAOA 3ZSGA 4U97A 2ZM4A 3ZUVA 5AA9A 3R71A 4RQVA 3IECA 3FKLA 3OOGA 2Q83A 5KUPA 3ZEPA 2YAAA 1XH4A 4LI5A 1DI8A 2F7ZE 4NSTA 4R3CA 4FG7A 3R73A 4L52A 4BYJA 4F9CA 3FUPA 5AR3A 5CF6A 4Z16A 4DBXA 1JKLA 2WTWA 4QP4A 1QPDA 4O0TA 3R8PA 3BYUA 3SLSA 3GC0A 4CYJA 1U54A 4RWJA 4FV5A 5AUTA 4ANSA 1PXIA 2V7OA 2VU3A 3QC4A 4EZ3A 3W16A 2WOTA 5HD4A 2CNQA 2VN9A 2QOOA 3WF9A 4JBPA 3GCPA 3VBQA 3OOMA 3RI1A 4DAWA 4ASXA 3NVMB 4YZNA 4DEBA 3KRLA 3ZTXA 1RJBA 4JX7A 3BLQA 2WMRA 2A19B 2BUJA 2FSMX 2C4GA 3DXNA 3EN9A 3IS5A 5ICPA 3PJ1A 3W18A 2CCIA 5L2IA 3TZMA 4O81A 4RX8A 1KE9A 3QTUA 5I9YA 4YO6A 4JQ8A 4AZFA 4QYGA 1H1SA 1V1KA 3HL7A 2OI4X 4UN0C 5JFSA 1ZMVA 3R8MA 2PU8A 1OZ1A 1OI9A 2W1FA 4QYEA 4JG7A 3OTVA 3VS7A 1YOJA 2HXQA 2PY3A 3KK9A 2VWBA 2WD1A 2VTMA 3TDWA 4AE6A 3HRBA 1P14A 3PZEA 4TYEA 5IZFA 3MN3A 4DEAA 2KULA 1BMKA 1H26A 4FE2A 4ZSEA 4UMPA 5EQPA 3GUBA 3HRFA 3NDMA 1BL7A 3FL5A 5ETCA 4A4OA 5IQGA 2VTIA 5EW8A 3F69A 4FSRA 5M4UA 4OAVB 1FGKA 3AD5A 3RPRA 4LYNA 4F7SA 2YN8A 3UPZA 2VD5A 5HD7A 4NT4A 1YDRE 3O96A 2ZM1A 3E93A 4FZFB 3WZDA 2XUUA 3PXQA 4G3FA 4HYIA 2YIWA 1PMNA 2VO7A 3D5WA 2BDFA 4V04A 4FICA 4CG8A 2OXXA 4YBKA 2CLQA 4GVJA 5FXSA 1WVYA 4EQCA 2VV9A 3JUHA 3LJ0A 4IAIA 3W2QA 4C59A 3FQEA 2OIBA 3RHXA 3ZLYA 4EH6A 4EOKA 3O7LB 4NM5A 3GB2A 1BI7A 1WBNA 3C4ZA 4GSBA 2GDOA 2C6EA 4XOZA 5D7AA 5J5SA 5AV4A 5E91A 2WTCA 4MD9E 2OF2A 2WZJA 4UWBA 3OUNB 4J95A 1V0PA 4FK6A 3IKAA 4L43A 5HO6A 5LMAA 4ACCA 3E5AA 3UQCA 3QRTA 3IDBA 1WBTA 4P5QA 5A3XA 4EOJA 1H07A 5BMSA 5LQFA 3D7TA 5CAUA 4KBCA 1YXXA 3CQWA 4IWDA 2QVSE 3DCVA 3L9NA 1WBWA 4E4XA 5JFXA 3VUDA 2VTSA 3F3TA 4DT9A 3U4WA 2GNHA 3LAUA 4DG3E 4ZTSA 2J0KA 1E9HA 3RCDA 4GT5A 3FJQE 4PNIA 4AGDA 2WPAA 1K3AA 2W1EA 3GFWA 4BZOA 3RK9A 4E5BA 5CAPA 3A99A 4QTEA 1IA9A 3FSKA 4CYIA 3I7CA 4AACA 4R77A 4NFNA 4FV8A 4EUUA 2PMOX 2UZBA 3A7FA 4BTKA 3OCTA 2CMWA 4FV0A 4DFUA 3W10A 3LHJA 3ZBXA 3KKVA 1MQBA 3EIDA 5E92A 5EI8A 5M06A 4MH7A 5D9HA 2C6TA 3CP9A 3C0GA 2PSQA 4V01A 5J79A 3QQFA 5HG5A 3LCOA 3ZONA 5HKMA 2YABA 2G2FA 5C4LA 2C3LA 5IH4A 4ALUA 3CJGA 4AGCA 3MY1A 3UIMA 2R3KA 3OEFX 4Y8DA 4BDFA 3V5QA 3F3VA 1URWA 2P0CA 4E93A 5JK3A 3JR1A 1KWPA 5AUXA 4U44A 4YZ9A 4BDKA 2IWIA 2UVZA 5DN3A 4ZY4A 4U43A 5IG1A 3FPQA 4DYMA 4XV3A 3TTIA 3P08A 5I0BA 5IQDA 1FGIA 2Y0AA 3FLWA 5B2KA 3DJ7A 2WIPA 2J51A 4BCJA 2DS1A 4C4EA 1VEBA 3FKNA 1XH7A 4Z3VA 2XIKA 4PDSA 1I44A 5EHYA 2YLEA 1OIUA 3W2PA 5EK7A 4FSTA 3DKFA 3GQIA 4IX6A 3VQUA 5KNJA 4X3FA 3NSZA 4HPUE 3C50A 3OBGA 4MXYA 3R1QA 2P2HA 3KCFA 4FSUA 5HEZA 3FXZA 4ASZA 5J8IA 1EH4A 3Q4CA 4UMUA 4EJ7A 4B9DA 4DH7A 4UMQA 5B0XA 2CKPA 2YACA 4EC8A 2OIDA 4DN5A 4J52A 3R22A 4ACMA 3Q6UA 3LQ5A 4F6WA 2CKOA 1OPJA 1UU3A 1REJA 2JDTA 1YXVA 2FUMA 2XNGA 2XVDA 5K0KA 3QYZA 3JVSA 3NEWA 5CU4A 5DPVA 4DLIA 4RJ5A 1PMVA 1U54B 3F5GA 4UALA 3E8CA 4MX9A 4D1SA 3PSDA 4ZS0A 2G01A 3ZHPC 1UNGA 4U80A 1CKPA 2YDIA 4OTWA 5AIKA 2W1IA 2XKFA 2CGWA 3HMMA 3KXMA 3P7BA 4E6AA 4F7JA 5IEYA 4AUAA 3LFNA 1OL6A 4YNOA 4BB4A 4W4VA 2ONLA 5KE0A 3MH0A 4NFMA 4OTGA 1FVRA 1YI3A 4OTFA 5CEQA 3P1AA 5AV0A 3G0EA 3A61A 3AMYA 5LWMA 4JJRA 2JDSA 2QONA 3UPXA 4IC8A 1ZYJA 3IO7A 1F0QA 2UW7A 1SVEA 4XX9A 4YUQA 2X8IA 4YZBA 5BMMA 4I94A 2PVRA 3CTJA 3DDQA 5L8LA 4LMUA 2LAVA 4XBUA 2BRNA 4TYJA 4D5HA 2B0QA 4FTRA 3FXXA 3MBLA 5JRSA 3TZ9A 3EFLA 5CNOA 4J71A 4BCOA 3QKMA 4M0YA 5F94A 4G6OA 2PE2A 4FKTA 5HVYA 2FB8A 3D5VA 5ANEA 2XRWA 4RRVA 1J1BA 4AQCA 2WMWA 4CFMA 2YIYA 4G3DA 3Q4UA 2CLXA 4FOCA 3TDVA 3Q3BA 3R21A 2BZIB 1SYKA 3NPCA 3MPMA 2YM8A 4BKJA 2I6LA 3RWPA 1PMEA 5KHXA 1WVXA 4RWKA 4B7TA 2E9VA 4XUFA 1QPCA 5DE2A 2DWBA 4NW6A 4PL3A 5EYKA 5HVJA 4CKIA 3NW6A 2UZUE 3F3ZA 3II5A 3QZGA 4ZS4A 1S9JA 3KQ7A 3QD2B 2P3GX 3R1NA 4WBOA 4BGQA 3QZHA 2JKMA 3VHEA 2ZV2A 4XMOA 4FIJA 3FMLA 2B4SB 1CSNA 2BRMA 5HE1A 3RPOA 5I9UA 5J7HA 3V5WA 2BAKA 2YM6A 3QKKA 2JD5A 4IWOA 3FLYA 4M14A 1H28A 4PUZA 2EWAA 4ZAUA 4GU9A 5HG9A 3RAIA 4D2RA 4QRCA 2PVLA 3I81A 3ZFMA 4CQGA 4IM3A 2E2BA 1NA7A 4RIYA 3WOWA 4NL0A 3HLLA 5HO8A 1H8FA 4ZJJA 2NPQA 2CGUA 2X7OA 3BHTA 4FTMA 4ZSJA 3V6SA 2GNJA 2Y8OA 3HEGA 2QG5A 3D7TB 1YDTE 3QTZA 4LM5A 2UVYA 4Y5QA 4D5KA 5CU6A 5M51A 3CGOA 3OEZA 2FO0A 4AZSA 4J98A 4PL5A 5HQ0A 2KTYA 3O7LD 3VS6A 1KV2A 4F9BA 4FT0A 4IIRA 3VBYA 2GQSA 1K9AA 4GFOA 2GU8A 2QC6A 3H9RA 2BFYA 5AAGA 4ITJA 4C35A 3OWKA 4KB8A 3NCGA 4TW9A 5CI6A 3SXSA 4NCTC 4AN9A 3FC2A 3Q60A 4EYJA 5JFWA 1DM2A 3PPZA 2XZSA 3G51A 1IEPA 3C4FA 3GXLA 4N6ZA 4C4HA 5EW9A 2B7AA 1WZYA 3U9CA 3TJCA 3UODA 3ZC6A 4FZDB 4DGNA 4P5ZA 3LM5A 4WA9A 2YCQA 4I21A 2QURA 3LLAA 4WG3A 4CZYB 4IWPA 4PX6A 5AP0A 3OHTA 4FKOA 4RG0A 4FKLA 4O0XA 2ZV9A 3DQXA 2YCFA 3HZTA 4NJDA 2HELA 5CQUA 4EH8A 1H01A 4I4EA 4LV8A 3UOKA 1M17A 4PPAA 5D1JA 5CF4A 4P2KA 2H9VA 5E8UA 3VNTA 3ATTA 4R6VA 5AR8A 5BVFA 4BZNA 3QYWA 3OBJA 3K2LA 2IVTA 3HP5A 2Y4PA 3QCSA 4EH5A 5AAEA 5D41A 4I41A 4NZWB 4XHKB 2OK1A 4DF3A 3BWJA 3O23A 3SXRA 5KBRA 4FYNA 3EN7A 3BELA 3EFWA 2R3FA 4EOOA 2QLQA 4FZ7A 4R1YA 4TTHB 4BBMA 3DTCA 3D7ZA 1U59A 2OIQA 3PSBA 4YURA 3L8PA 4IZ5A 1P4FA 4QPAA 1UV5A 3E7OA 3TZ7A 4DEIA 4HNIA 4BCIA 4F0GA 4O0RA 2C1BA 4X3FB 5C4KA 5FUTA 4WUAA 2ITWA 3P9JA 4KIPA 4RVLA 4IAFA 4FIIA 3OF0A 3M11A 3QF9A 3C0IA 3PA4A 3FQSA 4YP8A 2PVKA 4P4CA 4O84A 2XNPA 4JR7A 5EYDA 2XKCA 2NRUA 3PXRA 2YM3A 4RA4A 4U6RA 3W8QA 4DITA 3C5IA 1JKSA 1Y91A 4QMVA 5HE2A 3DQWA 3W2SA 3MS9A 5AWMA 4C57A 2FSLX 3F7ZA 4NM3A 5F95A 3DV3A 4HGLA 2P4IA 5E8VA 4S31A 4BVUA 1UU8A 3FKOA 4Y5HA 2F4JA 3PVBA 4JOAA 3SW4A 4ACHA 4FV7A 5HO7A 3G90X 2UVXA 3AT3A 2OXDA 3NUNA 3EFJA 3QX4A 3LMIA 4CV8A 2IPXA 1H24A 2Z60A 1O6LA 2WQOA 2X6EA 3CTHA 4FVRA 4AU8A 5HVKA 2RGPA 2C5OA 3LFBA 4FSYA 4GJ3A 4MNFA 3F7WA 2OZOA 2W05A 3BYMA 3MH2A 4B8MA 3EFKA 3G15A 2YIXA 3ULZA 3GC7A 5L2QA 2WEVA 4AS0A 3R8UA 4IWQA 2C3IB 3UJGA 1M14A 3ZU7A 2GS7A 4OW8A 4AG8A 4BRXA 5A9UA 1JBPE 3ID6C 4S32A 3BLRA 1R39A 5ANDA 3BZ3A 3QLGA 3CXWA 5KHWA 2J7TA 2QU6A 4YJOA 4YZMA 3F82A 3O51A 3UDBA 2XP2A 1T46A 3RMFA 1UNLA 3SQQA 4L53A 4L01A 3NUSA 3PXYA 1XH8A 5CX9A 2VTJA 4E6DA 4CMTA 4O7RA 4PY1A 5IA1A 3LQ8A 4MF1A 2X0GA 1OIQA 3V04A 3ZC5A 4E3CA 3H4JA 1H1RA 4AOIA 3UYTA 4DGLC 1SZMA 5BUJA 2HZ4A 4RVMA 3VUGA 5CEOA 3EQCA 3CGFA 4ZJVA 3BI6A 2HY81 2XKDA 4DGOA 2ITZA 3NGAA 3R04A 4K11A 4M15A 3MIYA 2X81A 4GIHA 4O7TA 3JPVA 5CT0A 5A54A 2PZ5A 3GCUA 5I9VA 5IQAA 3ALOA 4X2FA 1SVHA 5IQFA 4TT7A 1V0OA 1OB3A 5EH0A 4USDA 5I9ZA 2RKUA 2GNGA 3IW7A 4U8ZA 4FK3A 4FNXA 4WHZA 3ZMMA 1RW8A 1O6YA 5D12A 2ITYA 4BDDA 5AX9A 2JBPA 4RIYB 2OICA 1G5SA 4ZTRA 2HZIA 3UNJA 3UYSA 4BTMA 1LEWA 1XWSA 4JI9A 2BHEA 4FSZA 1Q3DA 3AMBA 4YPDA 1ND4A 1YWRA 4QYHA 4YLJA 4YTIA 4F7NA 4FF8A 5KBQA 5L2TA 3U55A 3WF6A 2EXEA 4I6BA 4YZDA 3S00A 3PA5A 3OY3A 3ZLWA 3L8VA 4NM0A 2PZRA 3D0EA 3QRKA 3KULA 5DVRA 5CF5A 4G3CA 4E7WA 2E9NA 2EUFB 5B2MA 3Q5IA 4JL9A 4CFNA 5IH6A 3ULIA 2ETMA 1GZOA 4RQKA 3RAHA 2EB2A 2QOHA 4HPTE 4XG8A 3LIJA 5CTPA 4C3RA 2H8HA 2PZPA 3VAPA 1ZYDA 4Q2AA 3H0ZA 5AUYA 5IQCA 5EHLA 1UA2A 2YIRA 4DGGA 4FEVA 4P90A 4YBJA 4R3RA 4EZ5A 4AOJA 5LOHA 4ZIMA 1P4OA 2WGJA 2LGCA 2J5FA 5K9IA 5L6WL 4N57A 4XLVA 3GCQA 1Y6AA 3P0MA 2G15A 3LMGA 4JIAA 3HV6A 5I3RA 3RZBA 2GTNA 4DH8A 4GG5A 4L6QA 4BDIA 2OO8X 3NUPA 3LFFA 3QZFA 2O65A 4NTTA 5H2UA 5JMSA 3KU2A 3LFCA 1YI6A 3BIZA 3FI8A 3E8EA 1IRKA 5FTOA 4Y85A 3VO3A 1M2PA 3PP1A 5DOSA 5DR2A 3LXKA 4TXCA 1XBAA 1T45A 2W9FB 2O8YA 2WAJA 1HCKA 3OWPA 4JG6A 2R9SA 4F99A 3SW7A 4QMYA 4HYHA 3IDCA 2JKOA 4LOPA 1L8TA 1ZARA 3VUKA 3DBEA 4ZTHA 4C4FA 3DOGA 5KMOA 2BAJA 3T3VA 4FOBA 4OTRA 5FXQA 5AM6A 2ITNA 5H3QA 5CSPA 4ONAA 1OKZA 3VJNA 2BMCA 5EQEA 5FP6A 4TWOA 4L42A 3MJ1A 1Z5MA 4RJ7A 3O8PA 2HXLA 1KOBA 2VTOA 3WI6A 2QOBA 5EYCA 5T68A 2VTHA 2AYPA 4YJTA 1F5QA 4DINA 4YC3A 3KGAA 5EOLA 1OBDA 4YU2A 4RMZA 3G33A 2C6LA 3CQUA 5LARA 3DJ5A 3D14A 3ORXA 2JLDA 5EI2A 4F9YA 4QP2A 4MXXA 4FKPA 4XG2A 3TNQB 1PMUA 1B39A 4X2NA 2PVYA 4EHGA 4D4YA 4RLLA 4QQJA 4WNOA 2ESMA 2GS6A 2UV2A 5KO1A 4CQEA 4R78A 2YWPA 4DT8A 2R7BA 5M44A 3RPYA 4UMTA 3NUAA 3I79A 3PSCA 4H05A 3MW1A 5CY3A 3UTOA 4AA4A 5EKNA 1OITA 5DGZA 2XNOA 1UWJA 3G9NA 1FVVA 3VHKA 1UKIA 3EQRA 5C27A 4R7IA 4C38A 4GT4A 2X2MA 3DFCB 3O8UA 4RC4A 3W55A 3LE6A 3H30A 3E3PA 3GQLA 3LW0A 3PXFA 4AW1A 3UZTA 4DTAA 3IQ7A 1QMZA 3CR0A 4O7SA 4LV5A 3E3BX 2GQGA 4Q9SA 4O6EA 3OWJA 3IOKA 2Z8CA 5EM7A 3MI9A 4UYNA 2B52A 4X3FC 2JDOA 4IANA 4HNFA 4FVPA 2C1AA 2PUUA 5DRDA 3KMMA 4BBEA 3PG1A 3E63A 3ZRLA 4L68A 2ITTA 4LUEA 3KFAA 4OBQA 3RINA 4D1ZA 1JWHA 3C1XA 3F2NA 3CJFA 4XV2A 4PWNA 4YNEA 5HU9A 5LVNA 4DLJA 4EKKA 5CSWA 1BX6A 2Z7SA 5IA3A 3E62A 3W32A 1Y8GA 2ETKA 3QBNA 4F08A 2DUVA 3R30A 5E1EA 3W1FA 3D2KA 3QXPA 3BEGA 4IVCA 1JSUA 2FYSA 1REKA 2J50A 3UQGA 4A4LA 2QOQA 3IGGA 4BGHA 5J9ZA 2XM8A 2QLUA 5CZHA 4AX8A 2R4BA 3G9LX 3H9FA 3WILA 4AZEA 2PE1A 3VN9A 1OKYA 4S2ZA 5LVOA 5CEPA 5DEYA 3QTRA 2CNVA 1SNUA 4UYAA 1KE5A 4I6QA 2Z2WA 2WNTA 4FTJA 4CMOA 2NO3A 1AQ1A 2UZWE 4QQCA 4XRLA 5AV1A 5AV3A 4C4GA 3QKLA 5E7RA 2O64A 2BZHB 4FUXA 4AT5A 2C5YA 5FGKA 4BKZA 5AA8A 2VTQA 2QKRA 4IAKA 4ASEA 2C5NA 3DKGA 3C4WA 2RFNA 2CGVA 4M0ZA 1RQQA 4JLCA 2R3QA 1PXLA 3HUCA 5C9CA 3PVGA 3JY0A 4L00A 4O7NA 1Q8ZA 3K5UA 3R7OA 1XH9A 2QU5A 1BUHA 2YITA 5HE3A 4AN2A 5C8NA 4GKIA 4I3ZA 4H58A 3U4UA 4CKJA 3ORNA 2ITXA 5TO8A 4A4XA 2O63A 3HKOA 4X6RA 1G3NA 2BKZA 3BBTB 3JVRA 5HNBA 3EMGA 4K33A 3FDNA 2OJIA 3WYYA 1NVRA 3OTUA 4W9WA 4AWIA 4E6QA 1MQ4A 4H3PA 2WHBA 4D1XA 3ANQA 3FEGA 5ITAA 4HW7A 2ERZE 3V5PA 4PPBA 1URCA 4FKVA 1ZY4A 3PY3A 4J96A 4WO5A 2Z7QA 5I9XA 4R7BA 4F0FA 1W98A 4FKRA 2BAQA 5E8YA 3U8WA 4N0SA 4D9UA 2R3OA 1KSWA 1FVTA 2HENA 1QCFA 4IAAA 3OXTA 1XKKA 3BV3A 3R63A 5DHJA 5I9WA 5J9YA 4ANLA 3C5UA 3GU8A 1PY5A 3KULB 5GZ9A 4YJUA 5CSVA 3R9RA 4Y46A 3SAYA 4F9AA 5C26A 3OW3A 4JXFA 4IZ7A 3MPAA 3PY1A 3COHA 4QP1A 1WAKA 2O2UA 3N4UA 4FTOA 2I0YA 3BU3A 4NJ3A 1PXKA 3SX9A 2Z7LA 4EOMA 2VO3A 3LOKA 4ZTLA 5F1ZA 4EKLA 3MESA 2JKQA 3HYHA 4G5PA 4BI2A 3GEQA 2XK4A 4E1ZA 3BRBA 4GK2A 4BIDA 4FT5A 3NX8A 5AR5A 1AD5A 4XOYA 3VRYA 2BFXA 2PTKA 4CKRA 2A27A 5LVLA 3QGYA 3HAVA 3SHEA 3HX4A 3FLQA 4LRJA 5FG8A 4JG8A 1R3CA 2C5XA 1W83A 3MVMA 3E87A 5JH6A 3CPCA 4MD8E 1BI8A 4FEXA 3QCQA 4L3LA 4X2JA 4U3ZA 4A9UA 1YOLA 3Q4TA 3BQCA 1ZOGA 5BPYA 2WMVA 3I4BA 3NNWA 1WFCA 2XK9A 3IDPA 3ODZX 4EK5A 2BKKA 2R5TA 3HV5A 4FVQA 3DA6A 2AUHA 4CVAA 4BDCA 2W1CA 1Q8UA 2XK6A 4HZSA 4GKHA 2B9IA 5AR2A 4C4IA 2UZNA 4D55A 4WNMA 3QU0A 4RA5A 2ZM3A 3EWHA 3QRUA 4MXZA 5H9BA 4IM2A 3S0OA 3HMPA 4S30A 2VNYA 2XK3A 4NTSA 4WOVA 4USEA 2YWVA 5GIOE 4KBKA 1O6KA 1U5RA 3DU8A 4ZTNA 4FT3A 4AF3A 4BCFA 5KMJA 3AOXA 3RZFA 5L3AA 4ZK5A 4BDEA 4Y83A 4BWKA 2OZAA 4K1BA 3F3UA 5KCVA 3I5NA 4ZP5A 5JGBA 2BZKB 1PJKA 4RX9A 4D0WA 4ERKA 3S1HA 4DA5A 2XJ2A 2CCHA 4FT7A 4R8QA 5L6PA 2ETRA 1NT2A 4MBIA 5HU3A 2GNIA 2HW7A 4JNWA 1Z9XA 3VS2A 2C6KA 3OP5A 3IW8A 4EK8A 4ENYA 2QOIA 2IVSA 3ENMA 3GU6A 3NNVA 4EYMA 5A14A 2W5HA 4DTBA 4CZTA 1CDKA 4IQ6A 1H0VA 4L9IA 3CCNA 3DK7A 3NLBA 2GFSA 1WBPA 4H1JA 3VBXA 3WZUA 4F9WA 3ERKA 3BGPA 1P2AA 2X2LA 4XLIA 1R0EA 4PDYA 4EBVA 2HIWA 2GS2A 3LCTA 3PUPA 3TWJA 3POOA 4M69A 2YFXA 3PJ2A 3PFQA 4ZSGA 5DIAA 3G6HA 5GZAA 1UU9A 3MWUA 5AADA 1LR4A 2RG5A 4FIFA 4UEUA 4XG9A 2C0TA 2ZOQA 2R3LA 3NYNA 4I0TA 4IB1A 3TKHA 4BCQA 2B55A 3DJ6A 4RFYA 5F20A 4E4NA 2WKMA 3DBDA 1KE8A 1YKRA 1STCE 5FXRA 4YGAA 3QUEA 4PDPA 3UMWA 4MTAA 3T9TA 2YZLA 1OGUA 4TYGA 5HTBA 4GEOA 1JQHA 2VWXA 4QP6A 1APME 3UOLA 1KUTA 2C3JA 4G6NA 4FSNA 4M3QA 5FLFA 2W06A 3VS5A 3TACA 5K5NA 4EZ7A 4F1TA 4K9YA 4AAAA 4PNKA 2BTSA 3A7HA 3BU6A 4I0RA 1GIHA 2EVAA 2QKWB 2A2AA 3MDYA 3UC3A 1IAHA 3SG8A 1YRPA 4C58A 3NR9A 1UKHA 1YOMA 4XRJA 3TV6A 4W8EA 3RNYA 3GI3A 2GHLA 4FKIA 4Z9LA 3F88A 4M67A 5HIBA 4IH8A 1ZMUA 2ERKA 2G9XA 2UUEA 2PYWA 5HHWA 1VR2A 4JBOA 3D5UA 4W4XA 3HDNA 4ZJIA 2F7XE 3FSFA 2XS0A 4AT4A 4GUBA 4E4LA 3OT8A 3QCYA 1OM1A 4KKEA 4LRMA 2OGVA 4MKCA 3V5TA 5L2WA 2W4KA 5M07A 5DT0A 2VRXA 4L45A 3TI1A 4U81A 1K2PA 3N4VA 4BHNA 3RVGA 3G6GA 3QHRA 4PF4A 4OBOA 3HVCA 4MEDA 3RK5A 4HVHA 5A4CA 3ENHA 4G3EA 4IX4A 4CTBA 1TQPA 4RC3A 5IQHA 3IPHA 3PVWA 5HLNA 5K5XA 3MY0A 4B4LA 2R7IA 4E6CA 4PMTA 1ERKA 3WARA 2C0IA 4RBLA 5M09A 3A60A 1OPKA 3C7QA 1WCCA 5CVHA 3IW4A 4CEGA 3VW8A 4RX5A 3A7GA 3LVPA 4IVBA 4IMYA 5HTIA 2W96B 2ITPA 3Q04A 4LG4A 4NKSA 2W7XA 3KRRA 4YSMA 5IF1A 1GZ8A 4UB7A 3LLTA 4ORKA 1UVRA 1Q24A 3ZDUA 2REIA 4CG9A 3ROYA 4O0WA 4S34A 3QA8A 5A4LA 5LJJA 5EOBA 1JVPP 2A0CX 2X8EA 2VUWA 2RF9A 2O3PA 2I0HA 1MP8A 4DG2E 3R8VA 4O83A 4K0YA 2ZYBA 1GIJA 3FZ1A 4PDOA 1HOWA 1SMHA 1UNHA 1U5QA 3FWQA 5K3YA 3BBWA 3V8SA 3DT1A 4ZZOA 3FI2A 4L46A 4MF0A 2BTRA 2RIOA 3D94A 1BLXA 4E26A 4G3GA 4OUCA 3LM0A 2VTNA 4EI4A 3DPKA 2B1PA 4ZOGA 5CVFA 2UZDA 4AW0A 3VS1A 5DT3A 3WE4A 5JZJA 2VWVA 3EQFA 4WSQA 4DEHA 5KZ0A 5J95A 4FZAB 5D10A 4B8LA 2V22A 4H3BA 3BGZA 4J53A 2G2HA 1ZAOA 3R01A 4FNYA 4FNZA 3HMIA 2VWUA 4GMYA 5DLSA 2PL0A 3QRIA 4FG8A 2C3KA 2FH9A 3VF8A 3KA0A 4BF2A 2XH5A 4KWPA 3ZXZA 4EBWA 2R3PA 2W1DA 2WMSA 4GW8A 4XG4A 4WBBB 4ZSLA 4QMZA 4DTKA 5IUIA 5KMIA 3ZO2A 4AFEA 1MUOA 4BR3A 2J90A 3QD3A 4I5MA 3A4OX 2XKEA 4I5CA 2WTDA 4QMTA 4WG5A 2XBJA 5HG8A 3PIZA 2G1TA 3QFVA 4I92A 3MSSA 3DKCA 4IFGA 4J8NA 5G1XA 3LCSA 4O86A 4GT3A 2Q0NA 4H39A 2JDVA 2C6DA 4RVTA 1ZMWA 2FVDA 5ANOA 3UGCA 3R8LA 3IONA 4ANQA 2JC6A 3EH9A 5BYYA 3CD3A 3UQFA 3QRJA 4O82A 3RK7A 4YMJA 5CSXA 1PYEA 4DBNA 1ZLTA 4IX5A 4WNKA 2GTMA 3NZ0A 3G2FA 4YJQA 3Q96A 3QTXA 4U7ZA 3GCVA 3ZFXA 4EHVA 5K4IA 2W5AA 3QTWA 2UW6A 4M69B 1HCLA 2WELA 2PULA 2NP8A 3IK3A 4CFWA 4F09A 3RKBA 3ORPA 3ZS5A 3PPKA 4TNDA 1ZRZA 5JQ8A 5EM5A 5GJDA 2YISA 3ODYX 4AXAA 3DXQA 5JSMA 4OTQA 5F4NA 5CQWA 5HOAA 3NYVA 4XP2A 4HGTA 2YIQA 3FMHA 5B2LA 3V3VA 4AZTA 2UW4A 5LVMA 2GSFA 4TWNA 3AC8A 2R0IA 2HZNA 4FIEA 3VW6A 2IW6A 3QGWA 1LUFA 3AC1A 5EI6A 2JGZA 5FRIA 2YM5A 2Z02A 5AUWA 4YTCA 1J7IA 1XJDA 3KXGA 4DG0E 4F6UA 2E9OA 3L9PA 1Q8WA 2WIHA 4ITHA 4IXPA 4U9AA 5BUIA 4DFYA 1PXNA 3LCKA 3VS3A 4D4VA 5CS6A 1Q41A 2CHLA 3HUBA 3PG3A 4I5PA 4E73A 3F3WA 4EOSA 3I7BA 3L1SA 3R7VA 2ZMDA 4RLKA 3U6IA 2XK8A 4CRLA 3CPBA 5HORA 2E9PA 1Y57A 2G2IA 3DK3A 3GFEA 3CKWA 4X6QC 3CQEA 1OMWA 2JAMA 3O50A 4I6HA 4WT6A 4XS2A 4DFZE 1DAWA 3QQJA 1SM2A 4E4MA 5IQBA 1OL2A 4IB3A 5EM6A 4R7HA 5CXHA 5KZIA 5C8MA 3U54A 3DGKA 5HCYA 4J97A 4BCMA 2JEDA 1CM8A 2YEXA 3KF4A 2BDJA 1A48A 3KF7A 3QLFA 4NM7A 4HZRA 2UZOA 4FTKA 5ETAA 5BYLA 4A9RA 4RJ3A 5GJFA 3ZSIA 4JBQA 3R1YA 4ZLYA 4CLJA 4BCHA 3EQIA 4YPSA 1LEZA 4MHAA 4OTDA 5E8XA 3JYAA 4FV3A 5CWZA 4G31A 2QOKA 2VWWA 3DAKA 4BHZA 4EH9A 4IX3A 3DS6A 2OH0E 2WMBA 3DTWA 4FIHA 2UZEA 4NUSA 4QTDA 4C02A 4MWIA 2WOUA 5E1SA 5CF8A 2XNBA 4FZ6A 2YAKA 3QZIA 5JGDA 4RZVA 2VTLA 5HE0A 5CEMA 1W8CA 1ZYLA 4FTLA 5M57A 2ZV7A 4PMPA 5AP1A 4O0YA 4BN1A 4OAUC 1ZYCA 2C69A 4EK3A 5J1WA 2PE0A 3RGFA 2HOGA 3MIAA 1A9UA 3A8WA 2JFLA 3UIBA 5J5TA 2HCKA 2X7FA 4HCUA 4PL4A 3DBCA 3TZ8A 4ANMA 4FIGA 2I0VA 1H08A 1PYXA 2IZRA 3QUPA 4MBJA 3R9DA 5H8BA 3BLHA 4D4RA 3PRFA 3Q9WA 4GYIA 4RFMA 1OECA 3EYHA 2R0UA 3MFUA 2RFSA 2VAGA 3RJCA 5DBXA 3UVQA 5AUUA 5EDPA 2PMIA 5M53A 3B8RA 2XCHA 4C37A 1UWHA 4TYHA 2CKEA 2F49A 2R3NA 3FQHA 4UWCA 3RTPA 4BDAA 5IMXA 1XH5A 1Q99A 3O17A 5FEQA 5LMKC 2R3MA 4WG4A 4UWYA 3SG9A 3HV7A 4W8DA 3PWYA 3PVUA 4K2RA 4JQEA 4D2PA 4EWQA 3S4QA 3CIKA 3RM7A 5I5ZA 2YJRA 4DCEA 1L3RE 5BVEA 4TKSA 2XRUA 4YJSA 3ZUUA 2R3JA 4MWHA 4YLKA 3RAWA 2V62A 3H10A 4Y95A 4ERWA 1JNKA 3R6XA 4CTCA 3ZCLA 4EEVA 2HY0A 2BRHA 1YXUA 2IZSA 3ZUTA 3F5UA 2QNJA 3MB6A 4KAOA 4Y72A 4P7EA 3BGQA 4JRNA 4IJ9A 3C4CA 3MY5A 2YCRA 3PLAE 3ZXTA 5LCKA 3NAXA 2X9FA
chains in the Genus database with same CATH superfamily
1IR3A 3FAAA 3O2MA 4FTIA 4LGGA 4OT6A 4YSJA 1JPAA 3F9NA 3AG9A 1Q61A 3OWLA 4YC6A 4BYIA 5C1QB 3MFSA 4FSMA 4ZY6A 1YXTA 3PA3A 4KIQA 4XYFA 3UP7A 2X9EA 3K5VA 4YLLA 4C7TA 2JBOA 3SVVA 3KN6A 4O1OA 2OWBA 3ZO4A 2YJSA 2W9ZB 5FDPA 4FV2A 1FBNA 4G1WA 2GHMA 3AC4A 2F2CB 2UZVA 2C0OA 3C4EA 2I0EA 3KK8A 3ORKA 3PZHA 4HCVA 4RJ6A 3FMEA 4RZWA 4NU1A 4EK6A 5IEXA 2WMTA 1XQZA 5IUGA 2XYNA 3W2OA 3CTQA 1F3MC 4O7YA 4FKQA 4DFLA 4XBRA 3THBA 3P78A 4BTFA 4N6YA 3D9VA 4D2VA 2YDJA 4H3QA 1GNGA 4BBFA 2B9HA 2VO0A 4MBLA 2IW8A 4NKAA 4R3PA 1OBGA 3UNZA 2CGXA 3NYOA 4QMPA 3PXKA 4F1MA 3AT4A 5FTQA 5BQ0A 2GNLA 5IU2A 2W4JA 2C5VA 5M55A 4BKYA 4CFFA 2Z7RA 4B99A 1OKWA 3LMHA 2QCSA 3NVKI 1JLUE 4BDHA 4A7CA 4IJPA 2ZDUA 4LV7A 2WEIA 5CT7A 4FBXA 4CCBA 1JKTA 4QP3A 4F6SA 4QQ5A 3UVRA 2OF4A 4HVSA 3TV7A 4BCPA 3ROCA 3DZQA 3R02A 5LVPA 4FT9A 5T6KA 2YERA 1YQJA 3TEIA 2V7AA 2OKRA 2XMYA 3FI3A 4QMNA 2FSTX 2XIXA 4IBMA 3VS4A 4FEUA 3FY2A 4C36A 3PIXA 3SOCA 2W1GA 4GCJA 4L7FA 3I6UA 4F0IA 4IADA 3NUYA 2ZB0A 3OZ6A 4YHJA 3R7UA 4ACGA 3TUBA 4QDEA 4V0GA 5FP5A 3CKXA 4IE9A 3TNWA 4K6ZA 3KC3A 1M52A 5IQEA 2QI8A 1Q3WA 2YA9A 3DBFA 3EL7A 2HWOA 4CSVA 5DR9A 5ANIA 3WE8A 3AD4A 4YHFA 1OL7A 2RG6A 3ALNA 1QPEA 4PTEA 3CD8A 1H1QA 3FV8A 2P33A 3VJOA 4BZDA 4BIBA 4U79A 3BQRA 1W82A 5AFVA 4GL9A 4IEBA 2ITUA 2QHMA 2ACXA 5HBEA 4DFNA 4LOQA 4PMSA 3UDTA 3OD6X 1R78A 2W99B 4JRVA 3EL8A 5FBOA 4YHTA 2XJ1A 3DAJA 2XNEA 4D2SA 3ZYAA 4NIFA 4YJPA 4L3JA 4FKSA 1BL6A 3IW6A 4WSYA 3GCSA 3OMVA 3DZOA 3PWDA 3V5LA 1TZDA 3FMDA 3M2WA 4MXCA 5L4QA 4F7LA 2E9UA 3A7IA 4FKWA 4EH2A 5GZ8A 2NRYA 2XCKA 3CS9A 3KXHA 3PE2A 4QP8A 4F70A 1PKGA 4F63A 3NW5A 5EFQA 1Y8YA 3D15A 1ZZLA 4C34A 3R8ZA 3H3CA 3K3JA 4AZVA 4K8AA 2VWYA 2B9JA 3EKNA 4XCUA 4I1ZA 4XNEA 5HX8A 2J4ZA 4EQMA 4F1OA 3ZH8A 2DQ7X 3AGMA 1M7QA 2JIVA 3DNDA 3FMJA 3NCZA 4XG7A 3WYXA 3EN5A 3ZM4A 3DAEA 4TYHB 1H25A 5BNJA 4JQ7A 4USFA 2FA2A 5CVGA 3VBTA 3GC9A 2ZJWA 3GC8A 4D9TA 1Y6BA 4X2GA 1YXSA 5K4JA 4CXAA 3MH3A 3V51A 3BCEA 5DG5A 5CEIA 5DR6A 3QD0A 3QXOA 3PJ8A 3VVHA 1J91A 1PXPA 1TQIA 1WBOA 1ZXEA 4M12A 3EQBA 5FBNC 1XH6A 4ZXTA 3QQHA 4EJNA 4F64A 4ASDA 1YWNA 2HYYA 3MA3A 3SA0A 3BHHA 5BV3A 4A9TA 5FD2A 2V0DA 4O2ZA 3TL8A 3QL8A 2XEZA 2ZMCA 4H36A 3V6RA 4XEYA 4XJ0A 2PPQA 4O7VA 2WQEA 1IG1A 2ITOA 3BHYA 2VTTA 2ZAZA 5ANKA 1OL5A 3QUDA 3IG7A 3S95A 4DHZA 3PY0A 2H6DA 4JAJA 2J0MB 4L3PA 2BCJA 5ACBC 4QTAA 3DDPA 4M8TA 4O1PA 4TZRA 4Z7HA 3QX2A 2ITVA 3KMWA 3TJDA 1QL6A 4CV9A 3TV4A 1WBVA 4HVIA 3EN4A 3KCKA 3BKBA 3HGKA 5EDQA 5FQDC 2YLFA 3HMOA 1OUYA 4I24A 5IEVA 4JIKA 3TUCA 2JITA 3UO5A 1JAMA 3L9MA 3KXZA 1FPUA 3T9IA 3LFQA 4EH3A 2UZLA 4I0SA 3EZRA 1SNXA 4FTNA 4CGAA 3BYVA 5A4EA 4GFMA 4BWXA 3FLZA 4Q5HA 2XAMA 5LMKA 3V8WA 4YJNA 5HBHA 5TOZA 2W1HA 4YZCA 2WQMA 2PVMA 5FWKK 3LCDA 4XP3A 4D58A 2RFDA 5GHVA 2O5KA 4AE9A 2EXCX 3DLZA 1KE7A 2CPKE 2GCDA 3HECA 3QWJA 5HTCA 1J7UA 3FZRA 3KRXA 4HOKA 3IW5A 3FZTA 4I20A 2WMUA 2CSNA 2X2KA 4FI1A 3UG1A 4O0SA 4ZTQA 2CN8A 4TN6A 3OW4A 2CDZA 4BY9E 4YC8A 2OBJA 4LFIA 2W17A 1BYGA 1PXOA 2X4FA 2AC5A 3MTLA 3OUKA 3R1SA 4LMNA 4O0VA 4CMUA 2ZVAA 1LP4A 4OTPA 2O0UA 2UZTA 2XIRA 4FMQA 4O27B 5HCZA 5HG7A 1NW1A 2X39A 2WMQA 4RX7A 3NAYA 3F6XA 1LPUA 5AIRA 5D7VA 2BALA 4TPTA 3VWAA 2W1ZA 4DCAA 5DRBA 5K0XA 4U45A 3ZZWA 4AGWA 3CBLA 5FTGA 4O6LA 5AR7A 4NH1A 2X6DA 4LUDA 5JGAA 4PTCA 4AXDA 1H4LA 2RFEA 3F2AA 4B0GA 4TNBA 4V0GB 4LRKA 4FC0A 1UU7A 4IHPA 3Q9XA 5AP4A 3CY3A 3F5PA 1GZNA 5AP7A 3TKIA 3VQHA 1M2RA 1ZOHA 4JAIA 4ZEGA 5KKRB 3UBDA 5BVKA 2Q0BA 4LOOA 3KVWA 2IN6A 4O21A 2PVJA 4U5JA 4D4SA 4A9SA 1G8SA 2V55A 4FV1A 3ZOSA 3G0FA 5M4FA 5J9LA 2R64A 2I7QA 3UG2A 4O4BB 4UX9A 2QR8A 2OFUA 3FHIA 3P23A 2BIKB 3SRVA 2QODA 4YO4A 5HI2A 2PVNA 3LFDA 4C3PA 4CFVA 3JXWA 5L2SA 4DGMA 5BVNA 3C51A 3OXZA 3D4QA 4IB5A 4WRGA 5AUVA 2GQRA 1TKIA 4GYGA 4BI1A 4R5YA 4GU6A 4X3JA 3UIUA 4W4WA 5ANJA 4Z55A 5DMZA 2VZ6A 4NIFB 4XG6A 3MFTA 2YHVA 4O0UA 4TWPA 4GRBA 5IDNA 3LFSA 1B38A 4IDVA 4TYIA 1NVQA 1MRUA 3WIGA 3A62A 3B8QA 3UC4A 4DH3A 3EQGA 3FLNC 3TT0A 3FMKA 2R3GA 2W5BA 3F61A 3P86A 3D5XA 4CCUA 4QQTA 3FMMA 5CU3A 2ZDTA 5HGIA 4QMWA 4RVKA 3FZOA 3QHWA 5CI7A 3PXZA 5DT4A 3RPVA 2IVVA 3R7GA 4HYUA 3WF5A 2C68A 1VJYA 3OROA 1NVSA 4PMMA 2P55A 1U46A 3NWWA 3QWKA 5J87A 2JIIA 3SOAA 2CNUA 4RIXA 3QQGA 2BPMA 2SRCA 3E92A 3BV2A 3UIXA 4D28A 1JOWB 4QMSA 5HLPA 4ANNA 3FYJX 4QYYA 3BHUA 1W7HA 3E8NA 2GPHA 3LFEA 4KUJA 2UW5A 3C9WA 5DI1A 5IQIA 3ELJA 3PTGA 4IVDA 3MTFA 3TMOA 5KMMA 4U3YA 4RPVA 4QTBA 4RWLA 2VGOA 3B2WA 2VNWA 3EQHA 5FM2A 3ZLXA 2UW8A 5J1VA 4BI0A 3LFAA 4JDIA 1XR1A 3I0QA 4C61A 4I5HA 2OJGA 3Q9ZA 4FSQA 4OR5A 2PHKA 2WB8A 3NW7A 3TG1A 1PHKA 4FL2A 4U40A 4QPMA 4IVAA 3HDMA 4KINA 4N4SA 4KKHA 2PMNX 2HK5A 4O38A 4EWHA 5HIEA 3KVXA 4DC2A 2C47A 3AC3A 1GIIA 3FXWA 4JDKA 4QT1A 5E8SA 5EM8A 3R9NA 4AA0A 4O7ZA 3NS9A 3OS3A 4X7QA 5HESA 4BCGA 4AZWA 4CZUA 3D2IA 4KIKA 1IASA 5IA5A 5ETFA 3R7YA 1RE8A 3C4XA 3GNIB 4AP7A 5JRQA 3COMA 2BZJA 2Y7JA 4KSQA 3UZPA 3R7EA 4AGUA 4I93A 3BE2A 1I09A 2WMAA 2XK7A 3U51A 4JBVA 2PVHA 3GOKA 1J3HA 4G9CA 4O2PA 3DB6A 1IAJA 2UW3A 4HGEA 3PPJA 5DFPA 3V5JA 2XB7A 1ZZ2A 3VUMA 3MV5A 4E5WA 1M7NA 4QMXA 3RALA 1M2QA 3L8XA 3NRMA 1PRYA 3MPTA 4C4JA 4G2FA 2WTVA 5C01A 2J0IA 3O0GA 3KXNA 4OTHA 4QTCA 2XJ0A 5DNRA 1CMKE 1YI4A 2J2IB 3W8LA 4KRDA 4EOPA 3Q53A 3DK6A 5HCXA 5JZNA 3I5ZA 4BDGA 4ANOA 5CAQA 4RJ4A 4FRFA 5EW3A 1IA8A 1Q62A 4OLIA 3EZVA 2PUIA 5CYIA 2WO6A 5BVDA 1OUKA 4KA3A 4W9XA 3UVPA 4ENXA 1H27A 3BYSA 4FV4A 4QOXA 5ETIA 4CT2A 2GMXA 3WF7A 3RNIA 4IAYA 5TE0A 3UP2A 2OH4A 2PK9A 4TRLA 2X1NA 3OG7A 2YDKA 2CJMA 3TNPC 3ACKA 3Q32A 4RFZA 4I22A 4X0MA 2XIZA 3DFAA 5IUHA 4BDBA 3DXPA 2AC3A 3PJ3A 3M1SA 4C2WA 5A6NA 5AR4A 1CKIA 1G8AA 2XBAA 2ITQA 3LJ1A 3CEKA 2CKQA 3CSVA 2HWPA 4RJ8A 3W0OA 4XV9A 4L7SA 4C62A 5HLWA 4GJ2A 4DEDA 2BRBA 5ANGA 3W2RA 2Y4IB 3I1AA 1OKVA 4IB0A 4APCA 4QNYA 5G6VA 3S3IA 2C6IA 3QD4A 5AMNA 2VWIA 4PTGA 2PVFA 4HCTA 5JFVA 1Z57A 4A06A 3HP2A 3RBWA 2RSVA 5IH5A 3PP0A 3FLSA 4ARKA 1SVGA 3ORLA 2A1AB 1DAYA 2BIYA 4QD6A 4UV0A 3HMNA 3BEAA 4RIWA 5DH3A 2WMXA 4QNAA 3ORTA 4ZSAA 4W4YA 5BVWA 3M42A 3MB7A 3CY2A 5AP6A 3RP9A 4ZZNA 3SRVB 2YM7A 2X4ZA 2OZAB 1YHSA 3PIYA 1J7LA 4K18A 4C8BA 1TQMA 3LQ3A 2IZUA 4KRCA 1Q5KA 2IF8A 2OLCA 5FEDA 1GAGA 5KMLA 2BROA 2NYAA 2YZAA 1W0XC 3TTJA 3LZBA 4B6LA 4M68A 4GIIA 2XIYA 3D83A 3VULA 1Q8TA 2Y6MA 1O9UA 3RPSA 3SKCA 3K3IA 3TNHA 4IACA 5M56A 5GNKA 3ZSHA 4IZAA 5JT2A 4AA5A 3FL4A 2WTJA 5M4CA 2WTKB 4RT7A 2XM9A 4ALWA 4MK0A 3PLSA 2IW9A 4OTIA 4O7WA 4C33A 4FEWA 4EONA 5KKRC 4FV6A 2WU7A 3ACJA 2IZTA 2QD9A 2FSOX 3GU5A 2J5EA 2B53A 2R2PA 3I6WA 4ZZMA 2IJMA 1OIRA 5LXMA 1OIYA 3BX5A 2PMLX 3PE1A 3AXWA 4NWMA 1YHWA 4QMUA 3W0SA 4WKQA 2UW0A 2HZ0A 3BWFA 3PRIA 4I6FA 3DB8A 3P79A 2F7EE 3TXOA 4MNEA 4KD1A 4UZHA 5AM7A 3ET7A 4NW5A 4HYSA 3JS2A 3RWQA 3ZO3A 1E1XA 5A4QA 4RIXB 5IKWA 1CTPE 3REPA 4KSPA 3HA8A 2QO9A 3NYXA 1CKJA 4PRJA 5BVOA 4AOTA 2VX3A 2QO2A 3OVVA 4FX3A 3VUIA 3H0YA 2C6OA 4BC6A 3V01A 3KB7A 4U42A 3KREA 3C13A 2Y9QA 1RDQE 5E90A 4J1RA 4A9YA 4EH7A 4AFJA 5GINE 5TR6A 5E8TA 2JKKA 3AD6A 4DE4A 2XNNA 2JAVA 1W84A 2J6MA 3NUUA 1FQ1B 4M66A 4MQ1A 4PV0A 5IA4A 5M4IA 5EDRA 1H00A 2XNMA 4BTJA 3KRJA 4FL1A 3FE3A 2OW3A 3QQKA 4TWCA 3COIA 1GJOA 1R1WA 2JDRA 4IAZA 5TF9A 2ZB1A 3UO6A 5JEBA 2H34A 4BCNA 1GZKA 4G17A 4PQNA 1VYZA 3KY2A 3SD0A 2YCSA 4FTUA 3GU7A 4QP9A 5CEKA 5E8ZA 3OCGA 3OXIA 2OJFE 4FKUA 4I4FA 2QOCA 4WIHA 3OY1A 2EB3A 2R3RA 3N9XA 3OCSA 4NEUA 1W2DA 4DH5A 5AJQA 3GOPA 4KIKB 3WZKA 1V0BA 3EQDA 5IISA 1XO2B 5AP2A 1WBSA 4KS8A 2B9FA 1NXKA 3GP0A 3ORIA 3KXXA 4RIOA 3ZZEA 1X8BA 3G5DA 3VC4A 4DEEA 3A8XA 5DWRA 5I4NA 3F2RA 1AGWA 5EYMA 3KMUA 4APPA 4DDIA 4R5SA 1NY3A 4V05A 3R7IA 3EB0A 4L44A 3FZPA 4BIEA 5AUZA 3BL7A 3ZO1A 2VTRA 4IZYA 2OU7A 4UBAA 5AAFA 3HA6A 4FG9A 3FBVA 3ZEWA 3MYGA 1DS5A 4FGBA 4G9RA 4GVAA 1JKKA 4ITIA 5AP5A 3WF8A 4OT5A 3ZM9A 1FOTA 3VRZA 3R2YA 1BKXA 3P4KA 4CD0A 3PUFC 3ORMA 3MVHA 2GHGA 4GUEA 4JR3A 3RHKA 5FDXA 1E1VA 5CU2A 3HRCA 3ORZA 3QTIA 3E8DA 4WRSA 4ANBA 4EL9A 5E8WA 1OVEA 3ANRA 1KOAA 5AX3A 1J1CA 3COKA 3FC1X 3FZSA 3EN6A 4IM0A 1PF8A 2HW6A 4ZTMA 4A07A 1ATPE 3MH1A 3POZA 3R2BA 5ACKA 5IMEA 3IOPA 4IC7A 3EYGA 4LL0A 3NIEA 2F57A 4U0IA 4L67A 4JDJA 5FM3A 3UO4A 4GH2A 4K77A 3TM0A 5TT7A 4UXQA 4RGJA 1JSVA 3FMNA 3MVJA 4E20A 2JIUA 5F9EA 3WIKA 5CAOA 4G16A 4G34A 3MFRA 4U41A 4E5AX 3KEXA 4HJOA 4EK4A 3F5XA 4UZDA 2WTIA 1Q8YA 1PXJA 5D11A 5DA3A 3QC9A 4FTCA 4JT3A 4L8MA 5J7BA 5CALA 3UNKA 1U4DA 1FMOE 5CAVA 4MD7E 3VIDA 2F9GA 3VS0A 2BILB 4FKGA 4XP0A 4YJVA 3OCBA 1OPLA 4Q9ZA 4MQ2A 2C6MA 2F2UA 2BVAA 2VO6A 5I3OA 3H9OA 4DH1A 3GGFA 4FUYA 4HVGA 3AC2A 3R9HA 5HICA 2BR1A 4RIWB 5IPJA 4CT1A 2W4OA 2VGPA 4OBPA 5BX0A 4ALVA 3V8TA 4QMMA 4GFGA 1YW2A 2V5QA 2WXVA 3ITZA 4G6LA 3TN8A 4M13A 4O22A 3AGLA 3UE4A 3FYKX 4FEQA 1JSTA 5EHOA 5DYJA 3OT3A 4FV9A 3U6HA 3T8OA 3TKUA 1VYWA 2WQBA 4LL5A 3L8SA 1Q97A 3KRWA 4JDHA 3AMAA 4XG3A 2OFVA 3O71A 4GK4A 3HV4A 4AW2A 2QR7A 2Y4IC 3MVLA 2IO6A 5IDPA 1PKDA 4UXLA 3PJCA 5AV2A 3PDTA 3BU5A 5CZIA 3FY0A 2VTPA 1TVOA 3U87A 5TKDA 4TL0A 3NMUF 3TNIA 5CASA 5GJGA 2X7GA 4UY9A 4M84A 2J0JA 4HVDA 4CNHA 2X8DA 1MRYA 3QQUA 4M97A 3K54A 3E64A 4CLIA 4BDJA 4KKGA 2OSCA 4PP7A 1KE6A 3W2CA 1YHVA 3MA6A 3OC1A 5E9EA 3MJ2A 4MNEB 1ST0A 3BHVA 3LXNA 4JVGA 2VWZA 5T3QA 4EOQA 4FNWA 4AQKA 2YM4A 4EC9A 4H1MA 4NK9A 3SC1A 3TCPA 4QPSA 5KX8A 2XAOA 3NUXA 4YTHA 3GVUA 3KN5A 3Q4ZA 4EH4A 2QO7A 2QOLA 2XA4A 3I60A 4FODA 3R9OA 4FTAA 4I23A 1S9IA 4RC2A 5A4TA 4BL1A 4FSWA 3F66A 3SV0A 1ZY5A 2WTKC 3QCXA 3WZJA 5CANA 2QHNA 3A2CA 2PUNA 4FTTA 4F65A 4QO9A 2OXYA 3AKKA 4KNBA 3BYOA 5H8GA 2XANA 3AKLA 2OG8A 3LXLA 2DYLA 5CENA 1YWVA 5E4HA 4O4EA 4YR8A 5C8KA 5HX6A 3CE3A 4IDTA 2OJJA 3QAME 4XH6A 4M7IA 5A46A 4ZMEA 3UOJA 3AC5A 3U6JA 3LXPA 4AT3A 5IA2A 3BPRA 3DNEA 4QMLA 2R3HA 5IA0A 2PUPA 4BFMA 4MXAA 5FEEA 3P5KA 5EQYA 5DEWA 2BDWA 3WZEA 3OFMA 3RAKA 2ZV8A 3RCJA 1A06A 5AP3A 4D2TA 5HNIX 4TY1A 3MGYA 2NNWB 3TIYA 4O96A 4CFXA 3VF9A 3L9LA 4EORA 3UOHA 3BLAA 1H1PA 2BRGA 3GBZA 5BYZA 4EUTA 2I40A 4FR4A 4YTFA 2IG7A 2VTAA 3N51A 3AKJA 3LPBA 2Y6OA 4PPCA 1PXMA 3I0OA 4E8AA 2GFCA 2P2IA 4WNPA 3C0HA 4EHZA 2HAKA 3AQVA 4J99A 2GNFA 5KMNA 2C30A 4LGHA 3Q6WA 5JN2A 2XYUA 1WMKA 4CRSA 3LJ2A 4O7LA 5HZNA 3HV3A 5BUEA 1XBCA 4J7BA 4PP9A 3ZRKA 3Q52A 2J9MA 2EU9A 4FYOA 4EHEA 5CXZA 4J8MA 3Q5ZA 1XMLA 5CNNA 3ATSA 4IW0A 4MXOA 2VX0A 2RL5A 4EOIA 3SGCA 3NNXA 4FGRA 3UZRA 2WFYA 3QQLA 4RWIA 1ZWSA 4FKJA 3SDJA 3DLSA 3EJ1A 4WD5A 4Z7GA 5AEPA 3B2TA 1OL1A 2XF0A 4Y73A 5GIPE 2PZYA 1ST4A 2I1MA 2BHHA 4S33A 2OJ9A 3QTSA 2PZIA 2QOFA 5LWNA 5M08A 1H1WA 2IVUA 1P5EA 2B54A 1PW2A 1QPJA 4QYFA 4DFBA 4NCTA 3EHAA 4FA2A 3VBWA 3P7CA 1R0PA 3VBVA 4O91A 1XHAA 4Q5EA 4ZLOA 4LQMA 5LCJA 3N4TA 5CLPA 4ACDA 2XEYA 4FL3A 4GV1A 4LGDA 1VZOA 1YVJA 3DBQA 3E88A 4QP7A 2VX1A 4RSSA 4AN3A 4BCKA 3CLYA 3HNGA 1MRVA 4XV1A 4ZY5A 3VUTA 4NYEA 3S2PA 3QALE 4BGGA 4JS8A 2AEGA 1YDSE 2QQ7A 5KMKA 2QG7A 4MVFA 3ZBFA 4DHFA 4FTQA 4QMOA 4ID7A 1GOLA 4KABA 3SXFA 4WUNA 4KBAA 3DY7A 5H8EA 1DI9A 3WBLA 5L8KA 1FINA 2H96A 4QMQA 3VUHA 4ZMFA 2A4LA 1KV1A 4BWPA 4MYGA 2R3IA 5HIDA 5C03A 1WVWA 4C2VA 1B6CB 5B7VA 4AW5A 3BE9A 4GG7A 5HBJA 3QA0A 3EQPA 3W33A 4R1VA 5L8JA 2EXMA 3ZLSA 4GS6A 4BICA 3AT2A 4F4PA 4YJRA 3NIZA 4EOLA 4II5A 1FMKA 1H0WA 1Q4LA 3IGOA 3T3UA 3FHRA 1ZOEA 4DFXE 4BJJA 2CN5A 3FPMA 3EOCA 4X2KA 2W0JA 3ZDIA 5JQ5A 3CC6A 4KIOA 3ZRMA 2UW9A 4I6LA 3UMXA 3ETAA 4D0XA 5CU0A 4C0TA 3P7AA 4N70A 3TIZA 3TUDA 3QTQA 5HNGA 3RM6A 4MCVA 3LKMA 2FGIA 3Q2MA 2ONLC 5L6OA 5JKGA 2PWLA 3O5AA 4C3FA 3R28A 4JX3A 1XBBA 2JFMA 3Q2JA 3A7JA 3ZFYA 2WU6A 5EG3A 4GK3A 2WQNA 1GY3A 3R83A 5EKOA 3GU4A 3GENA 3EKKA 1ZYSA 4OGRA 5CSHA 5LMBA 3A4PA 3R0TA 4UMRA 3GT8A 3PYYA 2J0LA 4EQUA 3U9NA 4IFCA 4X21A 3FI4A 3JY9A 4D2WA 3NNUA 3Q9YA 3R00A 3HAMA 4HGSA 4KS7A 3DKOA 3KL8A 4ZLZA 4G5JA 4DEGA 3E7VA 4CFUA 3O8TA 5A6OA 4MAOA 3ZSGA 4U97A 2ZM4A 3ZUVA 5AA9A 3R71A 4RQVA 3IECA 3FKLA 3OOGA 2Q83A 5KUPA 3ZEPA 2YAAA 1XH4A 4LI5A 1DI8A 2F7ZE 4NSTA 4R3CA 4FG7A 3R73A 4L52A 1G8JA 4BYJA 4F9CA 3FUPA 5AR3A 5CF6A 4Z16A 4DBXA 1JKLA 2WTWA 4QP4A 1QPDA 4O0TA 3R8PA 3BYUA 3SLSA 3GC0A 4CYJA 1U54A 4RWJA 4FV5A 3UDSA 5AUTA 4ANSA 1PXIA 2V7OA 2VU3A 3QC4A 4EZ3A 3W16A 2WOTA 5HD4A 2CNQA 2VN9A 2QOOA 3WF9A 4JBPA 3GCPA 3VBQA 3OOMA 3RI1A 4DAWA 4ASXA 3NVMB 4YZNA 4DEBA 3KRLA 3ZTXA 1RJBA 4JX7A 3BLQA 2WMRA 2A19B 2BUJA 2FSMX 2C4GA 3DXNA 3EN9A 3IS5A 5ICPA 4DHIB 3PJ1A 3W18A 2CCIA 5L2IA 3TZMA 4O81A 4RX8A 1KE9A 3QTUA 5I9YA 4YO6A 4JQ8A 4AZFA 4QYGA 1H1SA 1V1KA 4DHJA 3HL7A 2OI4X 2X0QA 4UN0C 5JFSA 1ZMVA 3R8MA 2PU8A 1OZ1A 1OI9A 2W1FA 4QYEA 4JG7A 3OTVA 3VS7A 1YOJA 2HXQA 2PY3A 3KK9A 2VWBA 2WD1A 2VTMA 3TDWA 4AE6A 3HRBA 1P14A 3PZEA 4TYEA 5IZFA 3MN3A 4DEAA 2KULA 1BMKA 1H26A 4FE2A 4ZSEA 4UMPA 5EQPA 2X0OA 3GUBA 3HRFA 3NDMA 1BL7A 3FL5A 5ETCA 4A4OA 5IQGA 2VTIA 5EW8A 3F69A 4FSRA 5M4UA 4OAVB 1FGKA 3AD5A 3RPRA 4LYNA 4F7SA 2YN8A 3UPZA 2VD5A 5HD7A 4NT4A 1YDRE 3O96A 2ZM1A 3E93A 4FZFB 3WZDA 2XUUA 3PXQA 4G3FA 4HYIA 2YIWA 1PMNA 2VO7A 3D5WA 2BDFA 4V04A 4FICA 4CG8A 2OXXA 4YBKA 2CLQA 4GVJA 5FXSA 1WVYA 4EQCA 2VV9A 3JUHA 3LJ0A 4IAIA 3W2QA 4C59A 3FQEA 2OIBA 3RHXA 3ZLYA 4EH6A 4EOKA 3O7LB 4NM5A 3GB2A 1BI7A 1WBNA 3C4ZA 4GSBA 2GDOA 2C6EA 4XOZA 5D7AA 5J5SA 5AV4A 5E91A 2WTCA 4MD9E 2OF2A 2WZJA 4UWBA 3OUNB 4J95A 1V0PA 4FK6A 3IKAA 4L43A 5HO6A 5LMAA 4ACCA 3E5AA 3UQCA 3QRTA 3IDBA 1WBTA 4P5QA 5A3XA 4EOJA 1H07A 5BMSA 5LQFA 3D7TA 5CAUA 4KBCA 1YXXA 3CQWA 4IWDA 2QVSE 3DCVA 3L9NA 1WBWA 4E4XA 5JFXA 3VUDA 2VTSA 3F3TA 4DT9A 3U4WA 2GNHA 3LAUA 4DG3E 4ZTSA 2J0KA 1E9HA 3RCDA 4GT5A 3FJQE 4PNIA 4AGDA 2WPAA 1K3AA 2W1EA 3GFWA 4BZOA 3RK9A 4E5BA 5CAPA 3A99A 4QTEA 1IA9A 3FSKA 4CYIA 3I7CA 4AACA 4R77A 4NFNA 4FV8A 4O4DA 4EUUA 2PMOX 2UZBA 3A7FA 4BTKA 3OCTA 2CMWA 4FV0A 4DFUA 3W10A 3LHJA 3ZBXA 3KKVA 1MQBA 3EIDA 5E92A 5EI8A 5M06A 4MH7A 5D9HA 2C6TA 3CP9A 3C0GA 2PSQA 4V01A 5J79A 3QQFA 5HG5A 3LCOA 3ZONA 5HKMA 2YABA 2G2FA 5C4LA 2C3LA 5IH4A 4ALUA 3CJGA 4AGCA 3MY1A 3UIMA 2R3KA 3OEFX 4Y8DA 4BDFA 3V5QA 3F3VA 1URWA 2P0CA 4E93A 5JK3A