3HP5A

Crystal structure of human p38alpha complexed with a pyrimidopyridazinone compound
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
347
structure length
330
Chain Sequence
PTFYRQELNKTIWEVPERYQNLSPVGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Discovery of N-substituted pyridinones as potent and selective inhibitors of p38 kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 106
structure length 330
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hp5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hp5A01
3JY0A 2B7AA 4IXPA 2H6DA 2C5VA 3B8QA 4MBJA 1R3CA 4UALA 3TJCA 2EU9A 3U87A 2YA9A 4BDAA 3CKXA 1YDSE 3KCFA 5CNOA 3OG7A 1ZARA 5JQ5A 1X8BA 1BKXA 1K2PA 4R3CA 2VTRA 5IISA 4YPDA 4BDFA 1UKHA 3EHAA 4QTCA 1QL6A 2H8HA 2ITVA 2YN8A 4KKEA 4OTDA 3QQKA 3LFCA 3A7HA 5I9XA 5LXMA 3KQ7A 3LIJA 4GRBA 3U9NA 2WIPA 3UE4A 1DI8A 5IH6A 3LJ0A 4MAOA 4DFNA 3DAKA 3Q5IA 2PVFA 5E1EA 2ACXA 5L6WL 4DN5A 3SXSA 4NKSA 4FKGA 4WA9A 4EC9A 2VWZA 4KA3A 5DNRA 4ARKA 4YC3A 4O7LA 4DH5A 3LFBA 4MQ1A 4RPVA 4U3ZA 2HWOA 3NUAA 3PFQA 2R3HA 4U79A 3DLSA 2G1TA 2W1ZA 1YOMA 5A6OA 5HZNA 3BI6A 3UC4A 4QQTA 4RIYA 4BY9E 2YFXA 3DKFA 3Q9WA 2OW3A 2RFSA 2OO8X 2UZEA 2VTPA 4Y73A 4ZY5A 2YIXA 4OBOA 1H1RA 4DTAA 4PTCA 4F64A 4AT3A 1VYZA 3U6HA 2QNJA 3HKOA 1J1CA 2CCHA 2E9PA 1U5RA 3REPA 1OBGA 5LVMA 3WZDA 5EHYA 4F99A 4PUZA 4F9BA 3QYWA 2CN5A 3NDMA 1RJBA 4G6NA 5E7RA 4QTDA 3QCQA 3WF6A 3R02A 4DT9A 2P55A 4AT5A 4NFMA 5G6VA 2UVXA 1H4LA 4LG4A 4FZAB 2GS6A 3BEGA 4TWOA 4DGGA 3FI3A 2CKOA 2R5TA 2F9GA 4GSBA 4KB8A 3UPZA 3FI8A 3TDVA 4I6QA 4O7WA 5EM5A 1XKKA 4EONA 3WIGA 4PRJA 3LZBA 4DFXE 3VUMA 1O6YA 4IX3A 3OCSA 2J50A 3RK5A 4EOMA 3HX4A 2IZUA 4XG7A 4RVKA 3F5GA 3UVQA 4QP6A 4DTKA 1OL5A 4QNYA 4RG0A 3OOMA 3BX5A 4AE6A 3I79A 2OIDA 3DXQA 4QYFA 3M42A 3QD0A 3RKBA 3O8TA 5BUJA 4DGLC 4EOQA 3FLZA 3NYOA 3VW6A 3MS9A 1PMEA 3E8CA 2W96B 3A7GA 4XP3A 2ZM4A 2XYUA 1Z57A 2YM6A 4IDTA 4O6EA 2HZ0A 4EL9A 3LM5A 4GK3A 3QRIA 1SVHA 3VS4A 5CS6A 5IUHA 4E93A 4IB3A 4N4SA 3FPMA 3ORNA 2WMTA 3BLRA 3EKKA 4X3FB 4BTMA 1H0WA 2BZKB 3DKOA 4FSWA 4ALWA 2WPAA 4DBNA 4NTSA 5L4QA 2B9JA 4XP2A 3QCYA 3QYZA 4FEWA 5DHJA 1T46A 4A7CA 1WMKA 4JDKA 3QCSA 2OICA 3O2MA 4QP9A 3RI1A 4AA0A 2JD5A 5AUYA 3ULZA 4R3PA 4FK6A 5CAVA 3M11A 2QHMA 3PDTA 4O83A 4FT3A 4TWCA 4L67A 5H8EA 4EHVA 4PF4A 5LWNA 1XBAA 5JGBA 1KOBA 3C51A 2WO6A 3NUSA 4PP9A 4PQNA 3NMUF 4BDIA 2VO3A 4C8BA 5CYIA 4LFIA 5BVDA 4WUAA 5CU4A 5BUEA 1PXLA 4O86A 3KRXA 2W4OA 4CFXA 3OW3A 3A7IA 4MXXA 2ONLC 3FV8A 1ZYJA 3TV6A 5CEMA 4I4EA 3TXOA 3EKNA 3RPOA 1TVOA 2FB8A 4BDGA 3P0MA 3VN9A 4YTFA 3WF9A 4HGSA 4AACA 4G6LA 4NM5A 4BCFA 3T9TA 3UIBA 5JMSA 4XLIA 1RW8A 2WNTA 3PVUA 4FTAA 5GNKA 4GH2A 2Z2WA 3ZSGA 3UIXA 2OBJA 1LR4A 2PVMA 4I5PA 4YJNA 1OPLA 5EDRA 2B0QA 2W05A 1KE5A 3GNIB 3JUHA 4BCHA 5A4LA 1OPKA 3QA8A 3GCQA 3KN5A 4GV1A 3FLNC 4H05A 4BHZA 3RZBA 2Q83A 3OWKA 1KWPA 2VGOA 3PE1A 4A9RA 3QLFA 2JDOA 1FMOE 2GQGA 4YZDA 1IAHA 2XS0A 4BR3A 2IJMA 4FT9A 4WBBB 3ZOSA 4BBEA 4FNYA 4FTKA 2V55A 3DKCA 4UZHA 4O84A 4FKSA 4U0IA 3RP9A 3SQQA 2E9VA 3DTCA 5H9BA 1UU9A 2X1NA 2J5FA 2YCQA 4AZFA 3H9OA 1TKIA 4Q9SA 1ZRZA 1ZYSA 3U4WA 4YZMA 1OGUA 2BZJA 4IW0A 4QMNA 1FVVA 2I40A 4JOAA 3OWPA 3R9HA 4YR8A 3HMMA 2JIUA 2X39A 4D2WA 1FPUA 3MVHA 3N9XA 5CWZA 4KD1A 4Z9LA 3ZDUA 1PRYA 1Z5MA 4JX3A 2W99B 5LVNA 3IW5A 4FT5A 4A9TA 2F7ZE 4CG9A 2Y0AA 2WXVA 4HPUE 2YAKA 4JX7A 3FQEA 2ZV8A 5KMMA 3L8VA 4IE9A 3UNZA 4JG7A 2IVSA 2IG7A 3DJ5A 2C4GA 5LARA 3ORZA 5BMSA 3CTHA 4QMOA 3ZFYA 3CGFA 4GFMA 2I1MA 2R0IA 4XV3A 4K8AA 4IAAA 3OHTA 4KWPA 1I09A 2OJ9A 3I4BA 5D12A 3MA3A 2QCSA 3PVWA 3GT8A 4O91A 4FL3A 3OF0A 5JT2A 5ANEA 2UW4A 4BDJA 5IKWA 4NEUA 3NUUA 3ATTA 2IW6A 3I7CA 3FMHA 3AD4A 4AG8A 4FTJA 3FKLA 2JLDA 3MPTA 4ZJJA 4BZDA 2YWPA 4JDIA 5I3OA 4BCIA 1KE7A 3PWYA 3LXPA 4ZS0A 4P5ZA 3MSSA 4HZSA 3L9MA 5JFWA 3LXNA 5ITAA 5B2LA 1XH7A 2NO3A 2OWBA 4V01A 4KSQA 4TYIA 2R3JA 3SAYA 1SNXA 4GEOA 1TQPA 3TV4A 2O3PA 1H1QA 2W06A 3GCUA 3A7JA 5J9ZA 1XQZA 4XCUA 5H2UA 4QD6A 4TZRA 3ZRKA 4IC7A 5HCZA 4L68A 3MFSA 2VNWA 3ZLSA 2C5YA 2QHNA 4K18A 2JAVA 4L01A 3TNIA 2OFUA 2CLQA 5ACKA 4RJ7A 2QR7A 4AW5A 2R2PA 2DYLA 1OL6A 2R0UA 4O7ZA 3O7LB 4O82A 3GI3A 3EYHA 4RWIA 4HCVA 4IX6A 3DB6A 4TNBA 5DI1A 4CRSA 2HAKA 5ANGA 4GK2A 1RDQE 3DZOA 4ZZOA 2J6MA 3AT4A 5GHVA 5G1XA 4FEUA 2W1CA 5GJDA 3LFQA 4FR4A 4YC8A 3CP9A 4NM0A 3BWFA 3IK3A 4IJ9A 5IA2A 5IQHA 3A4OX 2JC6A 5DA3A 4AU8A 3TL8A 5AP5A 5A6NA 5EQYA 5LVOA 2EB2A 1GIJA 2R3LA 1Q8UA 5I9YA 3QKKA 3Q5ZA 4ITIA 4EH6A 3FZOA 3GCPA 1GNGA 2RFEA 3FI4A 4BYIA 4FV0A 4BIDA 4E6CA 4FV3A 1NVRA 4G34A 4BCMA 4Q5EA 1P2AA 2BAKA 4NYEA 2CDZA 4KIPA 4ZTLA 4C4GA 4EHZA 4RJ5A 3LAUA 2ETMA 3ELJA 2CGVA 2XNMA 3SW7A 2XUUA 2XRWA 4LV5A 3ZS5A 3GP0A 3V5LA 4YJPA 4M14A 3D5XA 3UG1A 3FEGA 2XBAA 3L9LA 2Z02A 5EQEA 3MGYA 3PTGA 3ZC6A 4I1ZA 2Y9QA 4LMNA 5IA4A 4HZRA 5LJJA 4LI5A 3C13A 4XJ0A 5E8ZA 3C0GA 3IONA 2OU7A 2WQOA 3DT1A 3LQ8A 4RVMA 2XKEA 4ANBA 2ERZE 2X2MA 3IW7A 3MJ2A 3NS9A 5A46A 2JBOA 4YLLA 4FTNA 3NNXA 3GFWA 4HYIA 2VRXA 4I0TA 5FWKK 4TT7A 4AS0A 4PNIA 1REKA 3QL8A 3EFKA 2XEZA 2O0UA 4RRVA 3I60A 4CKJA 1J7IA 5HQ0A 3VQUA 3BYVA 3E92A 2UZTA 4CFNA 4CQGA 2NP8A 3KXNA 3K3JA 3RJCA 4YU2A 3QQHA 1ZMWA 2I0VA 2JKOA 2YDIA 3F3VA 3MWUA 3UJGA 3VJNA 4G3DA 5GIOE 2BRGA 3FAAA 3MVLA 5HO8A 5IDPA 3F7ZA 3UTOA 3C1XA 4GT5A 3OW4A 4FMQA 2R9SA 2V62A 4ERWA 1YXTA 3UOKA 3QQJA 3V51A 2QOOA 4IAYA 3MVJA 4EOOA 1URCA 3Q9ZA 4ONAA 5I5ZA 3MY1A 4JI9A 4EZ5A 1PJKA 5F9EA 3QU0A 1XH8A 4FSMA 4PV0A 3OXZA 4W9WA 5HESA 4ASZA 3RK9A 4KINA 3E8EA 4X3FC 1Q97A 4FX3A 2RG6A 4XS2A 1OI9A 3C4EA 2BILB 4YJOA 4E5BA 1H8FA 4EOIA 5DR9A 2WIHA 3NAXA 3T3UA 2ZOQA 4IC8A 3TIYA 1NXKA 4KS8A 5K0XA 3R7VA 2UZBA 3CJFA 2QKWB 5I9VA 4LYNA 3W2OA 3PIXA 4D2PA 5DYJA 2OFVA 2GFCA 2VU3A 4A4XA 4FYOA 1H00A 3V6RA 3EIDA 4S2ZA 3HRCA 4HVIA 5K4JA 1ZOHA 3PY3A 4FL1A 2PZRA 2VWIA 4QPMA 3BHUA 1ZOEA 2VV9A 2WELA 3SOCA 4CMTA 2BAQA 3RM6A 3QQUA 4PPAA 3FZTA 3UYTA 5AMNA 4R1VA 3EFWA 3G90X 4S34A 2UV2A 4Z55A 3QTIA 4FSUA 4ACMA 4KSPA 4U9AA 4QP1A 4WNPA 3E8DA 2NNWB 2CNVA 4R7HA 2C6EA 5HVJA 3KY2A 2QC6A 3BHHA 3BYUA 4JR7A 4C2WA 4OTQA 1PXPA 5F95A 4F1OA 1SVGA 4OTWA 3V5PA 5C8KA 2XIZA 1GAGA 1F5QA 4QYEA 4C61A 4RIOA 1IRKA 2LGCA 3C4ZA 3E8NA 5HG5A 5HLWA 3IW4A 2YEXA 3DU8A 3W16A 4C4IA 4RIWB 2CKEA 3ZLYA 3FC2A 3FLSA 3HP5A 5KMOA 2WMSA 2CGUA 3BQRA 4G31A 4QMUA 4QMLA 3VUIA 3NCGA 3ZZWA 2PSQA 5HICA 3FZSA 1JKLA 4EH5A 5IEYA 3FE3A 3E3PA 3GC7A 3TACA 3UBDA 1W8CA 3OUKA 4GYGA 4IVBA 4CZUA 3R21A 4FTCA 1KV2A 4JL9A 3CPBA 3QLGA 1WBOA 4M66A 1IA8A 4YJRA 1UA2A 2BVAA 2JAMA 2J2IB 4HPTE 4O7YA 4IAFA 3RAHA 2SRCA 4AZEA 2WD1A 2VTLA 3COHA 3DLZA 4L3PA 5DWRA 2ZDTA 3DKGA 4MBIA 4TXCA 2J0MB 4MXYA 4F70A 4O0YA 2C0TA 5CT7A 5CZHA 3DY7A 3OBGA 4EOSA 5EDPA 3LQ5A 1YDRE 2UZWE 5CEOA 1MQBA 4M12A 3E5AA 3G5DA 4BRXA 1H28A 4DLJA 1WAKA 3LJ1A 4IAIA 4XBRA 2WEVA 3R01A 1JVPP 2VX1A 1Q41A 2B52A 3FKOA 3PXKA 3NZ0A 5JRQA 2ZV7A 1VYWA 1W7HA 2PL0A 3PPJA 2YM3A 2YIYA 5D9HA 2YAAA 1MRUA 4W4YA 3IS5A 4G3GA 4YBKA 3R7EA 5HX6A 3ZRLA 5JN2A 3LFEA 3VHEA 5GJFA 3G6HA 3UP2A 1BYGA 3MBLA 5E8SA 2VNYA 3C50A 2QOIA 4QT1A 4C3RA 4BICA 2QOHA 2WMRA 3TJDA 3GU4A 4RIXA 2QU5A 3IQ7A 4GT4A 3U55A 4F9YA 5AIRA 3DNDA 3RNIA 3W55A 3UQCA 3FMNA 3R83A 5JFXA 3R7YA 4H3BA 2X2KA 2WKMA 3Q04A 1XH9A 3S95A 3TTJA 4DFYA 4L45A 3MESA 1G5SA 2F57A 4LOQA 4GT3A 4DCAA 2XBJA 2EWAA 3G15A 3T9IA 4ACCA 4HVHA 4ZJIA 2XCHA 4JDHA 3ORIA 4ZTHA 4ASDA 1XJDA 2C5XA 4UMPA 2JBPA 4AXAA 3WIKA 5HTCA 3D0EA 3MH2A 3QD4A 5D1JA 4M3QA 4FKQA 3UO4A 2IZSA 5M07A 3PJ2A 3ZC5A 5HO7A 3ID6C 4NIFA 2VTHA 2JKQA 2DQ7X 4OBQA 5C27A 3UOLA 1WBWA 4ZSAA 3CQWA 1IASA 1YDTE 2IPXA 3A2CA 2CLXA 4DITA 3ZMMA 2BALA 4EK6A 5AV1A 2ITPA 4QMYA 4Z16A 5C03A 1J1BA 3OT8A 4CFVA 4MKCA 1YXUA 4L53A 4X7QA 3I0OA 4F1MA 2XEYA 4NKAA 4GS6A 3VW8A 4BCPA 3D7TA 2G2FA 3QZFA 3UG2A 4BDKA 3NYNA 3LMHA 2WB8A 5AUVA 5EM8A 3ZUUA 1M2PA 2RGPA 2UW3A 3GCVA 3UOHA 3WZJA 4EK4A 3OCGA 3ZCLA 2EVAA 4KKGA 4N0SA 1H07A 1UV5A 3MPMA 5KNJA 2WMAA 3MVMA 2W5AA 4RFMA 3FWQA 3UIUA 4ACHA 4GL9A 3QUPA 3N51A 2YZLA 4K11A 2WTDA 3VAPA 1NVQA 4QMMA 4UYNA 2WTKC 3SV0A 4X21A 3KREA 1IA9A 2R3GA 3PP1A 4FVQA 4O7RA 3OC1A 3NUPA 1WBSA 5HE1A 2F2CB 5EOLA 4EUUA 1HOWA 4C36A 4N6ZA 4RJ4A 4CXAA 1OIRA 4G9CA 5GIPE 4BCGA 5AR5A 3L9PA 5D41A 3R8ZA 4TL0A 2BHHA 4BTKA 4MNEA 4IIRA 5CT0A 1F0QA 4YC6A 5KMNA 5ETFA 3K54A 4PDOA 4ZTNA 3O50A 3RPVA 3DDQA 3RPSA 3R63A 4F4PA 3BPRA 3UO5A 2GTNA 2ZV9A 3CXWA 5L6OA 1V0PA 1GIHA 2QI8A 5CQUA 2ETRA 3LJ2A 3KF7A 4C35A 3LPBA 4EQMA 2XK8A 4FZFB 4EYJA 4BDBA 5IQDA 2WTIA 1V1KA 3R2BA 4ZIMA 5HG7A 3R7IA 4DEIA 4TRLA 5KBRA 2QKRA 2O5KA 4EOKA 4ZLZA 4ZXTA 3KCKA 1BI7A 4FI1A 4IANA 4QYHA 4B0GA 4CGAA 1ZYLA 3HA6A 2A1AB 5J8IA 3FYJX 4LUEA 2C3KA 4XNEA 4XRLA 4UEUA 3H10A 4CKIA 3TCPA 2JDSA 1Q24A 3R00A 4D28A 2VWXA 2P4IA 3R73A 3EH9A 3PJ3A 2Z8CA 5L2SA 2X2LA 4L43A 5CENA 4I94A 5GJGA 4BIEA 4D4VA 4EBVA 5C4LA 1JOWB 1XBCA 2W17A 3PXYA 4P7EA 3KRLA 4BN1A 4FE2A 3C4FA 3ENMA 4JAJA 3COKA 4FV1A 1Q8YA 2Y4IC 4EWQA 2XKCA 1PXNA 3A61A 3F2AA 2IWIA 5IH4A 2O8YA 3EQFA 4GKHA 5AUXA 1URWA 3R2YA 2PPQA 4XUFA 1YXSA 4QPSA 5K4IA 2RSVA 3QXOA 4EH9A 4QRCA 3FY2A 5CF6A 4DF3A 5A4QA 4RZWA 4KBCA 4YSJA 3TUCA 4YJSA 1J7UA 3SD0A 3UNJA 4EH2A 2V22A 4CTCA 5CSHA 3SRVB 2OK1A 2DUVA 3QC9A 3U4UA 3PIZA 2Y8OA 4YURA 4B8MA 3QRUA 2JDRA 3EQGA 4B9DA 3U8WA 2UVZA 4H58A 2BTRA 4JG6A 3O96A 4U43A 5TKDA 3R8MA 3OMVA 4UWCA 1OPJA 3W32A 4C59A 2R3OA 2ZM3A 4ASXA 3BYSA 5F94A 3EN9A 2BZHB 3G0EA 4FTMA 3DK3A 5CVHA 5AIKA 3KULA 4ZLOA 4O7VA 3LCTA 1FBNA 5KCVA 3DB8A 5CI6A 5TF9A 4A4LA 3VC4A 3VRYA 5CU0A 3EJ1A 5J79A 2HZ4A 1W0XC 4F0FA 4J8MA 5AP3A 3EL8A 5EG3A 3HV6A 4C2VA 2H9VA 3DFCB 3ALOA 4O2PA 3RMFA 3ZFMA 3VS2A 3KVXA 2ITWA 4O0SA 1G3NA 3P08A 4FTOA 3JYAA 5AUZA 2HELA 3G51A 2ITQA 4MNFA 3FUPA 2B54A 3LMIA 5C8MA 4EJ7A 4E4LA 5AP0A 3OXIA 5EHOA 4BIBA 3Q32A 5LMKC 4HCUA 3EOCA 1Q8ZA 4FNXA 2QG7A 4EOJA 5IMXA 4U7ZA 4XRJA 4PTEA 1OIYA 3F88A 3Q60A 2J51A 4G16A 1LPUA 4FZ7A 3POZA 2ZMDA 4J95A 3O71A 4XV1A 5HG8A 3V04A 4C34A 3WOWA 3WZUA 5CZIA 5DLSA 2UW0A 4B4LA 4E6QA 1XH4A 4PMMA 4U97A 4LOPA 4GUEA 2OXXA 4RMZA 2ZMCA 3MIYA 3LMGA 3RGFA 2J4ZA 1MP8A 2WTVA 3VNTA 4H1MA 1CM8A 3CTJA 3RNYA 4FGRA 4BYJA 3R9RA 4QYGA 3NX8A 4I3ZA 3QHWA 3WE4A 1PMNA 2FVDA 2XCKA 5AAFA 3O23A 5EI8A 4LMUA 1XH6A 2BUJA 2FH9A 3BU6A 1OKWA 4CYIA 5HTBA 2R3NA 5L2TA 2YCRA 4M67A 4EUTA 1H27A 3LOKA 5HNGA 4FV7A 2DWBA 3FDNA 3LXLA 1H1PA 1NY3A 2QR8A 2KULA 3TNQB 3FHRA 5E8VA 3MFRA 2WQEA 1H25A 2V7OA 3CY3A 2VTTA 3OXTA 4RJ3A 4XMOA 3U54A 2W1IA 4X6RA 5AV4A 4DE4A 4L6QA 2J0KA 5K0KA 3HMPA 1U54A 1Q8TA 2GPHA 4FV6A 4J8NA 4GG7A 3R7OA 3GC0A 4CZYB 1ZWSA 5EM7A 1O6KA 3ZU7A 3F5UA 1LUFA 5H3QA 3KKVA 3OUNB 4EI4A 4FKRA 1G8AA 4F0GA 3BV3A 3HAVA 5AX9A 3GU6A 3ACKA 4K2RA 4C4FA 4AOIA 2ZVAA 4FTIA 1QPEA 2FA2A 3ATSA 2QOQA 1OL7A 3E7OA 3ZRMA 5HKMA 4UXQA 4CNHA 1TQMA 2P0CA 4C4EA 2IZRA 2B4SB 2E9UA 2HCKA 1SMHA 3QAME 2ZDUA 5FM3A 4DC2A 5BYYA 1UU8A 3SG8A 2XRUA 2YHVA 4XG9A 1FINA 4AZWA 2JKMA 3I6WA 5T6KA 3FL5A 3HVCA 3IDCA 4IX5A 3RWQA 3HA8A 4DFUA 3VBXA 4IX4A 4UMRA 5DR2A 1M7QA 2XVDA 4NFNA 4Y8DA 2GNIA 4LL0A 1L8TA 2CKPA 4R5SA 5ANJA 4YHTA 2X4ZA 3B2WA 3EWHA 4ZOGA 4ZSLA 2P3GX 1JPAA 1Y6AA 3R7UA 4CLJA 4EK8A 1ZOGA 4NM7A 3LFDA 3WZEA 3CTQA 2HK5A 2X7FA 2IVTA 4IB0A 4F9AA 2WTJA 1O6LA 2EXCX 2ITOA 2GNJA 3P7AA 4YZ9A 4D1XA 4UBAA 3D9VA 1VJYA 4MD7E 3I5ZA 4BZNA 3ZO4A 4ANNA 4F9WA 2YM8A 3BCEA 4QP4A 4ANSA 5GZAA 5J1WA 2OH0E 4FSYA 3MIAA 4JIKA 4BCNA 3EZVA 3HGKA 4UB7A 3R71A 4YHFA 3TT0A 1JSUA 5L2IA 3UMXA 5DEYA 3ACJA 2UW8A 1GY3A 2WQMA 1DAYA 4DAWA 5JH6A 3R8PA 5M4UA 3H30A 4DGOA 1ATPE 4G2FA 3CJGA 4F7SA 5IEXA 2HW7A 4A9SA 4RVLA 1I44A 2PUUA 5A3XA 4KIQA 4DG2E 5FUTA 1YW2A 4DHFA 1M2QA 3FXZA 5M06A 4G3CA 2X4FA 4BBMA 2YM4A 5CF4A 2O64A 4E6DA 1SZMA 4D4YA 3TKIA 4BVUA 4H1JA 3DBQA 1KUTA 2YERA 3HECA 4H3PA 3OFMA 2J0LA 5TOZA 4IVDA 4V0GB 4ZTQA 5C1QB 4ALVA 2X6DA 2LAVA 4BB4A 5FBOA 4MYGA 2XNEA 1NT2A 2XF0A 4OTFA 5F4NA 3T3VA 3K5VA 3VVHA 2NRUA 4R5YA 4D55A 3EQCA 2GMXA 3ZLXA 4BWPA 4MF0A 4IHPA 5FXRA 5JFSA 3GU5A 2VZ6A 2XA4A 2UZUE 4AW0A 4CEGA 4USEA 4BWKA 4HW7A 4J96A 3V5QA 4AGDA 3C4WA 4JR3A 4BKYA 5J7HA 3WYYA 4FG9A 3QTUA 5LVPA 4O7TA 4FUXA 3A4PA 2ONLA 3E3BX 3GENA 1LEWA 4JDJA 3S4QA 1CKPA 2WOTA 3TZMA 3V8TA 3WZKA 4B6LA 3BQCA 2J0IA 5AUUA 3V8SA 3BE2A 3ZUTA 4RC4A 1ZY4A 4M97A 5BMMA 1AGWA 2VTJA 4KIKA 3RALA 3DPKA 3H0ZA 4FG7A 5AAGA 3ORTA 5L2WA 4GG5A 5CEPA 2CMWA 2AC5A 2WTWA 3TV7A 4ACGA 1UVRA 2OF4A 5BUIA 1AD5A 2VWYA 3OD6X 4Q2AA 4DEHA 1DAWA 3QD3A 3C4XA 3DTWA 4II5A 4ZSJA 3W10A 2J90A 3MH1A 3QWJA 3KXHA 3ORMA 5DVRA 3OWLA 2UVYA 2P2IA 2UW9A 1ERKA 4D2SA 4O0WA 5BYLA 3ORXA 4TNDA 4XLVA 4F65A 3LVPA 1ZXEA 3FLWA 1STCE 2F49A 4ITHA 4C38A 4MBLA 3BU3A 3VS0A 5HU3A 1JNKA 3BLHA 4DEBA 4NUSA 4FBXA 3SGCA 1PXKA 4GFOA 5ANIA 4BTJA 2PZYA 4RBLA 4DLIA 3A60A 2B9FA 3F5PA 4NCTA 2IW8A 2C0OA 3KK9A 4PL3A 3UZPA 4AP7A 5J9YA 1IR3A 4RX7A 2HYYA 4NW5A 4AQCA 3F2NA 2YCSA 3FZ1A 4X0MA 5C9CA 5HD4A 4K33A 4YTCA 4G5PA 3FJQE 3MFUA 5CXHA 1UWJA 2C3JA 3GU8A 4X2GA 4PX6A 3S2PA 5JSMA 2Y4PA 2OH4A 4WO5A 4MX9A 5IQGA 2XNOA 5LCKA 3BLQA 4TYHB 4P4CA 4HOKA 4EH7A 4NU1A 5JKGA 4NL0A 2C3IB 4UZDA 5EI6A 3S3IA 4XV9A 4EORA 3E64A 5KMIA 3L8SA 4N6YA 2Z7LA 4U41A 3QUDA 3CKWA 5FLFA 3G2FA 4XG6A 3ZUVA 3NUYA 2VUWA 4LOOA 4KAOA 4R7IA 4PMSA 3ZEPA 4BL1A 3CS9A 2P2HA 4IADA 3ZONA 4JBPA 1IAJA 4WUNA 3BYOA 1CKIA 3SOAA 5I4NA 4J7BA 2R3FA 4ZTMA 4ERKA 2JFMA 4OW8A 2AC3A 3P7BA 3OCTA 5CAPA 5IUGA 3CPCA 4FEXA 2QQ7A 3BHVA 3A62A 4GFGA 3RPRA 3EQHA 4EOLA 4FZDB 4FSRA 4G3EA 3VBYA 5HLNA 2WOUA 3P7CA 3QRKA 3UVPA 2C5OA 2VX3A 3NIEA 2I0YA 3VJOA 5DR6A 1LP4A 3DJ7A 4YLKA 1E1VA 5M53A 2PVNA 4JQ7A 3D7ZA 5EK7A 3KN6A 4M69B 4L52A 4AW2A 3HRFA 1OIQA 2BFYA 4QP2A 2EUFB 4IACA 4X2KA 5FM2A 4C3PA 3HYHA 4F08A 2WTKB 4UYAA 4H39A 2YISA 4FL2A 3TDWA 2QU6A 3L8PA 1W84A 4JJRA 4TYJA 4L8MA 4CLIA 2QOCA 4F7JA 3SG9A 3UZRA 2A0CX 4Y95A 1Q3DA 2PMLX 3RBWA 3T8OA 2RFNA 3FL4A 2JITA 3NR9A 1OUYA 3FSKA 3CY2A 1Q62A 1QPDA 2XM8A 1WFCA 3TUDA 4C4HA 3DFAA 3F6XA 3ODZX 4RJ8A 3EN6A 2VWBA 3RZFA 5BNJA 3HV3A 5KUPA 3C4CA 4CZTA 3PXQA 2OXDA 4QMWA 3TEIA 3SC1A 3FQSA 4PWNA 5BVFA 3IPHA 3FQHA 3QCXA 4IWDA 4BDEA 4C7TA 3IOPA 3OCBA 4YJQA 1JKKA 4DCEA 3PA4A 4GU9A 2I0EA 4QP3A 5HE0A 5IU2A 2X8EA 2JFLA 3QX2A 3NVKI 3HNGA 2OZAB 3BHYA 2Q0BA 3K2LA 3QA0A 4MWIA 1W98A 3Q4UA 3RCJA 5FXSA 4MD9E 2FSOX 2YWVA 4O38A 4BGQA 2VAGA 2JKKA 1Q8WA 3D5WA 4DBXA 3I81A 5DRBA 1V0BA 3JXWA 2ITTA 2YIWA 1M2RA 4MXAA 2XIRA 2BIYA 3PRIA 4FF8A 5ETIA 2Y4IB 4ZSEA 3W2RA 4UMUA 2UW7A 2OJJA 3VS3A 4D9TA 5FTQA 4ZY4A 5LQFA 4DH7A 4WNMA 3R1NA 4X3JA 2OJGA 3ETAA 2C30A 3QXPA 4ACDA 4Z7GA 4ZTSA 1F3MC 1FVTA 5TO8A 3FLQA 5CTPA 4D5HA 3CBLA 3ZZEA 4FZ6A 3DBFA 2C3LA 2ITNA 4HNFA 4FVRA 4EZ7A 3ERKA 3ENHA 1B6CB 3BBTB 1T45A 3UIMA 3IOKA 4GK4A 1OUKA 3A8WA 3MYGA 1OKVA 3BHTA 3UQGA 1REJA 2O63A 2YABA 4U40A 4X6QC 3WARA 2IVVA 2PE0A 3F69A 2WZJA 3C9WA 3F7WA 3N4TA 2B1PA 5M56A 2BDJA 2BPMA 1PKGA 5IG1A 5AADA 1IG1A 4YP8A 3PJ1A 5DH3A 5FP6A 4NM3A 5EW9A 2VX0A 3KA0A 5FGKA 3DBCA 4K0YA 4AAAA 4E3CA 3FMJA 4FYNA 4IZAA 2I7QA 4MF1A 3CQUA 2GHGA 4APPA 3AD6A 2X7GA 1CSNA 3QZGA 5KO1A 4I92A 4HGLA 4RIYB 1UWHA 4FSZA 4EK5A 4WG5A 3OWJA 3PUPA 4MQ2A 3U6JA 3N4VA 4D4SA 4O0TA 5ICPA 1MUOA 3GEQA 2B53A 1Y6BA 2BRMA 4AFEA 2C6DA 2CHLA 3PSBA 3F3WA 4BI2A 4FTLA 3R1QA 3CR0A 4CFWA 4IZ5A 4X3FA 4YJVA 4NW6A 2GNGA 5DE2A 3W2CA 1J7LA 3PJCA 1U5QA 5IUIA 1H1WA 2YZAA 1FOTA 2R3RA 1VEBA 5CEKA 1ZYCA 2XJ0A 1UU7A 4YO6A 4BCQA 4DINA 2BTSA 2W4JA 2AYPA 2W5BA 2CGXA 2HY0A 4YZCA 3SLSA 3ZDIA 2QOLA 2O65A 5K5XA 4OT6A 4E1ZA 4IAKA 4FV5A 3LM0A 5J1VA 2PE1A 4XH6A 2VN9A 1GZKA 4FT0A 4MD8E 4Y46A 3PXZA 5DOSA 3ZO3A 4HYUA 4OT5A 2JEDA 4LRMA 5I9WA 2FGIA 4LRJA 5CAOA 3C7QA 3Q2MA 4I6FA 4YZBA 4LQMA 3VBQA 3W8LA 3WI6A 5JK3A 4D2RA 3ODYX 4QYYA 5IQAA 2PUPA 4DEGA 1U59A 5EW3A 3F82A 4FOCA 2WQBA 2GNHA 5E1SA 2FO0A 2RL5A 3LE6A 4GYIA 4BHNA 4D1ZA 2HZNA 3KMUA 3KRJA 5C8NA 2Y7JA 4F1TA 3RAWA 3VUDA 3DQXA 4CSVA 3OZ6A 3P5KA 5LMAA 1MRYA 1ZAOA 1JQHA 3LCKA 4GKIA 1WBVA 3HUCA 2OJFE 2WTCA 2ZYBA 5AA9A 5JZNA 3FHIA 1Y8YA 5DIAA 2CPKE 4C33A 5KMJA 5ANOA 2A2AA 1UNHA 4AF3A 3OT3A 2CN8A 4MXCA 4N70A 5AV0A 4OR5A 4DG0E 3CIKA 4O22A 2ITYA 3K3IA 1KV1A 3F66A 3PXRA 1CDKA 2BROA 3HLLA 3MDYA 3HUBA 5EW8A 3EMGA 1XWSA 5E9EA 5DPVA 1ZZ2A 3FMDA 4AOJA 1QMZA 3JR1A 4QMTA 4YBJA 4EQCA 2XMYA 4FSQA 5BVOA 1NW1A 2VWUA 4ZZNA 3HV4A 4DT8A 4C0TA 4J52A 5EYKA 5HD7A 2RF9A 2W1FA 1MRVA 3DDPA 2ERKA 2E9NA 3SHEA 1R78A 4FKJA 1OKYA 4CV9A 1OBDA 5K5NA 3F5XA 2WU7A 2WAJA 4NT4A 4X2JA 5E8WA 4ID7A 3KK8A 3ZXZA 4I6BA 1ND4A 1Z9XA 5KZIA 2HY81 2BDWA 3KXZA 3MH0A 2HWPA 1JKTA 1Y8GA 2OGVA 3O8UA 4I5CA 4JXFA 4O6LA 4QMPA 3NLBA 2PWLA 3VO3A 3WE8A 5HTIA 1QCFA 4P2KA 5D10A 3TNHA 3DCVA 1PHKA 3UOJA 3AMBA 3ZHPC 2C68A 3VUTA 2W7XA 5AX3A 2XKFA 4L44A 2QOKA 2XKDA 4HYHA 3PSCA 5IQIA 4GUBA 5IQCA 3QZIA 4C4JA 3MW1A 1QPJA 2XJ2A 4H3QA 5AP4A 4CQEA 4LGGA 1OL2A 4BKZA 4AZTA 3MFTA 5IA0A 2OKRA 5BVKA 2YIRA 1XHAA 3EQDA 4TWPA 4UMQA 5ETCA 4EHGA 4ZK5A 5JGDA 2PUNA 3HRBA 1JSVA 4WD5A 5C26A 1A06A 2YITA 4O0RA 1ZLTA 2AUHA 4CFUA 4RA4A 3A8XA 4C57A 3IKAA 2WMVA 4FIGA 3HDMA 4RA5A 4Y72A 2QO9A 4EH4A 4K9YA 5KKRB 3GOKA 1XH5A 3SXRA 5CNNA 5K9IA 2VTIA 1W83A 5ACBC 2PVKA 2XH5A 2ETKA 3KMWA 4QNAA 5HBEA 4YJUA 4CD0A 1PXJA 3KF4A 4DYMA 2ESMA 1SYKA 2ZM1A 2RKUA 5HI2A 5AUTA 3G33A 3EQIA 3UDBA 4MTAA 1HCLA 4AFJA 4JBQA 2BHEA 4ZSGA 3QTXA 3GBZA 2GFSA 2VTSA 3UGCA 4USDA 4JQEA 2CNUA 4BC6A 4HVDA 4AWIA 4FKPA 3FZRA 3TN8A 2PY3A 3UNKA 2G2HA 2YDKA 2WMWA 2XIYA 3DAJA 3GQIA 3ALNA 1NA7A 3KGAA 5AWMA 2X0GA 4Y83A 3D2IA 4AN3A 2V5QA 4JBVA 3ZBXA 4ALUA 4J71A 4P5QA 5FBNC 2VWWA 4QQCA 4M8TA 2P33A 5B0XA 3PA5A 4U81A 5AUWA 5L8JA 3OEFX 4FIHA 3SXFA 4EH3A 3DQWA 4Q9ZA 3BYMA 2YJRA 3F61A 3KU2A 2EB3A 1Q61A 5GINE 4FTRA 3W2SA 3EZRA 3GGFA 2BKZA 4OLIA 5DG5A 2QO2A 5F1ZA 3DA6A 2Z7RA 4FIJA 3A99A 5EKOA 4D4RA 4O96A 5FP5A 2GS7A 2W1DA 3GB2A 1YOJA 3DV3A 2A4LA 5CEIA 4D0XA 2W1GA 3ZM4A 4FC0A 5J9LA 4CFFA 4GMYA 2B9IA 2ITXA 3H0YA 4IWQA 4AE9A 3C5UA 3W1FA 2I0HA 3KB7A 5KMKA 5CLPA 4OTIA 3MB6A 5AEPA 4HJOA 4YSMA 5F20A 4NSTA 4HGEA 1GJOA 3O51A 4X2FA 3RPYA 2W4KA 2YLEA 3VS5A 1YHWA 3PRFA 4EKKA 4ZAUA 3S1HA 3ZXTA 5C4KA 3AMYA 2IVUA 3KRRA 2ITZA 3EN4A 4FICA 5EYMA 5IEVA 5JEBA 2QONA 1YKRA 4O21A 3IO7A 2HXLA 2QOBA 1PYXA 3V5WA 1JLUE 5LWMA 1JAMA 3MY0A 3NWWA 4ANMA 4PY1A 1ZMVA 2XIKA 2YJSA 3MI9A 2QOFA 2PZIA 4JVGA 5JRSA 5M08A 1M52A 2H34A 3PXFA 5FEEA 4XP0A 3ZO1A 4I22A 4M0ZA 3DS6A 5A9UA 4TKSA 3QC4A 3ROYA 3RVGA 2XK9A 1H24A 5EOBA 1RQQA 4AZSA 4D0WA 2DS1A 5FDPA 2UZLA 4W8DA 1WVWA 3NEWA 4DGNA 1J91A 2XNGA 4G9RA 2GSFA 3DK7A 3VBWA 2BCJA 4I4FA 5IQFA 5GZ8A 4Y5QA 4A06A 3BZ3A 1Q4LA 3NYXA 3CLYA 3PSDA 4BCKA 4IMYA 5B7VA 2QG5A 4YTHA 3N4UA 4S33A 4FIIA 4CFMA 2OLCA 2R7IA 1KE9A 1PXMA 2OIQA 1P14A 3NUNA 3S00A 1GZ8A 5HCXA 4ASEA 3GFEA 3KXGA 2ZV2A 4FKIA 2VWVA 4KKHA 3UP7A 3UQFA 3QQLA 4GJ3A 3QX4A 3MPAA 3AG9A 4RT7A 4CMUA 1SVEA 1WZYA 3R7GA 4FOBA 4C02A 3QGWA 5HBHA 4I5MA 3FI2A 4U3YA 2QVSE 4OTHA 4C62A 2A27A 4GIHA 4HCTA 2PU8A 2JIVA 4Y5HA 3QKLA 5AV3A 2XM9A 4HVGA 5M09A 2PULA 1SNUA 4LGDA 1UKIA 4AA5A 1PMUA 3U51A 5A4TA 5AP2A 1MQ4A 5H8BA 5CSWA 1KE6A 3AQVA 3V3VA 4IFGA 4FV9A 4QMZA 3HZTA 3O17A 3R1SA 3BE9A 4S32A 5DGZA 4J99A 3VUGA 3VS6A 3JVRA 5IMEA 4TW9A 4IZ7A 4J1RA 1KE8A 5BQ0A 3GXLA 4IM2A 3EFJA 3ULIA 2GNLA 3OEZA 5EI2A 1H26A 4WHZA 4CCUA 4WSQA 5ETAA 3R1YA 4YUQA 2X9FA 2F7EE 3QTZA 4P90A 3KC3A 3RHKA 5LMBA 5EFQA 3UZTA 2GU8A 4KNBA 3QWKA 3TNPC 5CU3A 3OP5A 4JIAA 5FTGA 2PUIA 5LMKA 4IFCA 2R7BA 5CU6A 2VTNA 4QMQA 4BDHA 3OROA 4RWKA 4RIWA 3ZYAA 5A54A 4FKWA 4DTBA 2PK9A 3P79A 3KVWA 4L7FA 5KE0A 3DXPA 3D2KA 5HIEA 4A9UA 4CCBA 3RINA 5CF8A 5IA3A 2YM7A 3TZ9A 4PDYA 5E92A 4EHEA 2PVYA 3EQPA 3PA3A 3LCOA 3E87A 2WU6A 3ZLWA 3ZBFA 3AC4A 2OI4X 3COMA 3PVGA 4XG2A 3Q4CA 2XYNA 1Q99A 3AGLA 3DOGA 1PY5A 1ZY5A 3HL7A 4FKLA 4O1OA 5KZ0A 3QRTA 1PXOA 3UVRA 3AC1A 3GCSA 4ZJVA 1SM2A 1M14A 4LV8A 5HCYA 3NGAA 4B99A 3WBLA 4FT7A 1CMKE 3R0TA 5AR4A 3ROCA 3TNWA 4F6WA 3QALE 4OAUC 2VTOA 1WVXA 3ANRA 4DFZE 1DM2A 3IGGA 4L3LA 4ZTRA 4CT2A 2R3MA 3LCDA 4BF2A 4O0UA 3TZ7A 3CCNA 1OITA 3R6XA 4EJNA 4CG8A 2WMBA 5EM6A 5I9ZA 2CGWA 3W2QA 2EXEA 4QTEA 1OM1A 4FVPA 2I6LA 5TR6A 1R39A 2XJ1A 2WEIA 3NW6A 1R0PA 4C3FA 5HVKA 5HEZA 1BUHA 4YTIA 3FXXA 3NAYA 5AP6A 1V0OA 4UX9A 5HHWA 4JNWA 3AXWA 2QO7A 5J5TA 5JZJA 5D7VA 4KBKA 3WILA 5KMLA 1YWVA 1K9AA 4RFZA 2WHBA 3BU5A 4HYSA 2UW5A 3HMOA 4KIOA 4O27B 2J7TA 5HO6A 4E26A 3C0IA 1YOLA 4ORKA 4ENYA 3MA6A 2GQRA 3WF8A 2JGZA 5KKRC 1PMVA 5IH5A 3CEKA 1PXIA 3QBNA 4L3JA 4V04A 5CSVA 2YDJA 3BGPA 4RWJA 3NW5A 2VD5A 2W0JA 2Z7SA 3BWJA 4U45A 5AV2A 4CYJA 2R3IA 5FEQA 5M51A 2FUMA 4BDCA 1R0EA 4G1WA 5DMZA 4J98A 2YM5A 4DH3A 2H96A 3FBVA 3VS7A 2R64A 1H1SA 3PVBA 5JGAA 3PY1A 3UMWA 4K1BA 3ZM9A 3EQBA 5KX8A 4L42A 1DS5A 4RX9A 4EZ3A 5AP7A 3JY9A 5J5SA 3EB0A 5L6PA 3ZO2A 5E4HA 4JRVA 2XNPA 3RTPA 1FGKA 2UZOA 3DXNA 4D9UA 1VZOA 3PY0A 4NJDA 3LFAA 4O7SA 2ZB1A 4JLCA 4RFYA 4RX8A 2BRNA 4ITJA 3R9NA 2BR1A 3VHKA 2HW6A 3R8LA 3MB7A 2E2BA 2OSCA 2YCFA 4I20A 4ZP5A 4BCJA 1WBPA 4V05A 3FMMA 4I0RA 3NRMA 4IZYA 3CD3A 4RIXB 4PL5A 4PP7A 4M15A 3W18A 4R78A 4IM0A 5IF1A 4JBOA 4AOTA 5JQ8A 3ORLA 1YQJA 4QO9A 3G9LX 5T3QA 4NCTC 5EHLA 3SX9A 3VS1A 2ZJWA 5HVYA 3E7VA 4E4MA 4EBWA 3VF9A 4BTFA 5BYZA 1CKJA 3PP0A 2HOGA 4U5JA 4BI0A 2C1AA 3F9NA 2WGJA 2FSMX 4QTAA 2OF2A 2QURA 4NWMA 5B2MA 2R3KA 4H36A 4I6HA 3ZH8A 1OL1A 3VUKA 3ORPA 5HE2A 1PF8A 2F2UA 3Q4ZA 3F2RA 1JBPE 5AP1A 4KBAA 3BGQA 5CSXA 3SW4A 4R7BA 4QQJA 3D94A 3I6UA 3GUBA 4G3FA 4NIFB 5AFVA 3R22A 2OZOA 3F3UA 3FMEA 4FSTA 4QMXA 3CGOA 5L8LA 4DFBA 1GZOA 3Q4TA 4NJ3A 5HBJA 5CXZA 1FQ1B 1YI3A 4FKOA 3VRZA 3B8RA 2BZIB 3DK6A 2XNNA 3F3ZA 4HNIA 1E9HA 4NTTA 4ENXA 1S9IA 5HIDA 4O81A 4D1SA 3CQEA 5E8XA 5FDXA 4PNKA 1UU3A 2UUEA 2O2UA 3COIA 3QF9A 4M7IA 3HP2A 3ZTXA 5CSPA 5KBQA 3NVMB 4FV2A 4EYMA 3I0QA 3LLTA 3UYSA 2Z7QA 3D7TB 4YJTA 4FV4A 4UWBA 5HX8A 3D4QA 4HGTA 4AGCA 2GNFA 4DEEA 2G2IA 1JSTA 3AD5A 4E6AA 5HNIX 4FNWA 3RWPA 4BDDA 3Q3BA 5D7AA 3OTUA 4MK0A 4BGGA 2WQNA 3PZHA 2GDOA 5HLPA 4I21A 1FGIA 4M13A 3R9OA 2CNQA 4E4NA 5EDQA 4F9CA 1M17A 2HIWA 3AC2A 3NNWA 4B8LA 3PPKA 2GCDA 3SKCA 4Z3VA 1TQIA 5BPYA 4MXOA 5IPJA 3D14A 2XZSA 4FIEA 4XG4A 4JT3A 3EYGA 4DEAA 2XIXA 3OTVA 4I0SA 1M7NA 2C6LA 2PZ5A 3DZQA 1DI9A 4EH8A 2GHMA 2WMQA 3SA0A 4HVSA 3HAMA 4EK3A 2PTKA 4YNEA 4MNEB 4CT1A 3GU7A 3OY1A 4XV2A 3P78A 5J7BA 5A14A 5M4IA 4DH1A 5FQDC 5AAEA 1PYEA 3SRVA 3TTIA 3RM7A 4QP7A 4OBPA 3DBEA 4XEYA 4WSYA 2J5EA 2WFYA 4WOVA 1BLXA 4JS8A 4RC2A 5AR7A 3LFFA 1FVRA 2PYWA 3OVVA 4FTQA 4TPTA 5JFVA 1AQ1A 3O7LD 3F3TA 4F7NA 5AR8A 4U44A 3V5TA 4GU6A 3Q2JA 3M2WA 4MXZA 3ZFXA 2ITUA 3ZSHA 1BI8A 3BBWA 4IBMA 2W9FB 2NRYA 3IW6A 2J9MA 3I5NA 4YO4A 4FIFA 5K3YA 3O0GA 1JWHA 2YACA 2R4BA 5CVGA 3HMIA 5E8UA 3V8WA 3EL7A 3JPVA 3FLYA 3G0FA 4JQ8A 3OS3A 5AM6A 3ZEWA 3FMKA 4E4XA 3LCSA 3D83A 5AA8A 3L1SA 5TT7A 4MCVA 5CI7A 4F7LA 4PMPA 3R04A 3NSZA 4FKVA 5AR3A 4ZS4A 3BELA 4F0IA 2E9OA 4K6ZA 3IG7A 4QQ5A 4BCOA 2GS2A 2CSNA 3R8UA 4L9IA 3NYVA 4ANQA 1YXVA 3VIDA 4NK9A 3LXKA 1XR1A 1IEPA 2R3QA 5M55A 1YHVA 2B55A 4XHKB 3P23A 4MHAA 4BZOA 5CAQA 4M84A 4U8ZA 1YXXA 4LM5A 3MJ1A 4FTUA 4EQUA 2BDFA 4XBUA 4BGHA 3QKMA 4FEVA 4ZZMA 4WIHA 4IWOA 4QTBA 1KSWA 2C0IA 5FEDA 2IW9A 3TKHA 4CTBA 3BV2A 1O9UA 4UV0A 4A07A 3IECA 2W5HA 2C6OA 5FTOA 4E73A 5M4FA 4EWHA 1YI4A 3UPXA 3Q96A 2B9HA 4G5JA 4M68A 4TYEA 3KULB 3QZHA 1U46A 3OOGA 4YZNA 5T68A 4OTPA 3THBA 2G15A 3LHJA 4LRKA 4GW8A 3IDPA 3LFNA 2C1BA 3TKUA 5ANKA 3PWDA 4WG4A 4XOZA 3Q6WA 3NNVA 4RZVA 3NW7A 4BBFA 3V6SA 3AC3A 3I7BA 3QGYA 4RGJA 3U9CA 3LLAA 2PZPA 4L46A 4IVAA 4R3RA 3ZSIA 3BKBA 4AN2A 2JDVA 3VWAA 4IAZA 3D5VA 4QP8A 5CALA 4Z7HA 3C5IA 3QTWA 3C0HA 2NPQA 4KABA 5M44A 5BVNA 5EQPA 2PE2A 4I24A 4RLLA 5M4CA 4R6VA 2FSTX 2BRHA 4OGRA 2PVHA 4FUYA 5LVLA 3TUBA 5IZFA 4I5HA 3VULA 2C6TA 5LCJA 2VTMA 4L7SA 4PL4A 4U6RA 2VTQA 2VO0A 1P5EA 4MEDA 4YMJA 2C6MA 5IQBA 4UY9A 3V5JA 3IGOA 5ANDA 4TY1A 3AC5A 4MVFA 3PG1A 5HOAA 3GQLA 4K77A 4FODA 1BL7A 1G8SA 3MH3A 3FC1X 4TN6A 2C6IA 5BX0A 4RLKA 1LEZA 2XK3A 2X6EA 3Q6UA 5DBXA 5E8TA 4NH1A 4ZEGA 1WBTA 3VUHA 5I3RA 2XK6A 5HIBA 4KRDA 4CMOA 3R28A 3UO6A 1H01A 3MV5A 2OXYA 3UODA 1K3AA 3JS2A 4A9YA 4YNOA 1EH4A 2W9ZB 3AGMA 4GCJA 4GVAA 3LFSA 3G9NA 4RVTA 1YHSA 2EXMA 4BFMA 2OG8A 4FV8A 2QODA 4RWLA 2Y6MA 2PVJA 2BKKA 2FYSA 1BL6A 3Q9YA 4YHJA 3MTLA 3RK7A 4PPBA 1S9JA 3NNUA 3OY3A 4AGWA 5CF5A 4WRSA 4AGUA 3D5UA 5E91A 5AM7A 3Q9XA 4KRCA 4TTHB 3KRWA 4E20A 5IQEA 3K5UA 3QQFA 2F4JA 4R8QA 1YI6A 1U54B 2QD9A 3ANQA 3E63A 4FKTA 4LL5A 4R1YA 1WCCA 4ANLA 1P4OA 3A7FA 3QUEA 1UNGA 4GIIA 4RSSA 4CV8A 3TIZA 4WNOA 4XX9A 2WMUA 4DEDA 2WMXA 3DBDA 2VTAA 4C37A 2BAJA 5CQWA 1Q3WA 4RX5A 3EN5A 3H9RA 3PLSA 3Q53A 4GJ2A 4AT4A 3POOA 4N57A 2RFDA 4CVAA 3OBJA 3HV5A 4E5WA 3BGZA 4QPAA 1PW2A 4WKQA 4MWHA 2PVLA 1OMWA 2X81A 5GZ9A 5HG9A 2QLQA 4G17A 4AUAA 3EFLA 2PMNX 4J53A 5DEWA 3EN7A 2KTYA 2ZAZA 4OTGA 4USFA 5KHWA 1ZYDA 2JIIA 1A48A 3TM0A 3AT3A 5H8GA 5E90A 3NIZA 5FXQA 3AOXA 4O0XA 3TWJA 1Q5KA 3I1AA 4FGBA 4MH7A 5E8YA 2Q0NA 3FYKX 5L2QA 5A4EA 2C6KA 4AX8A 3GOPA 2YIQA 2J0JA 4XYFA 2W1EA 4ZMEA 3CE3A 4L00A 3IW8A 3VBVA 4D5KA 4F09A 5CAUA 4W4WA 5CY3A 4XG8A 4UMTA 3TZ8A 4U42A 3S0OA 4O7NA 2X8IA 3BRBA 2RIOA 1OKZA 4FSNA 4V0GA 4B7TA 4DGMA 3QFVA 5KHXA 5L3AA 4OAVB 5HNBA 1OIUA 3DJ6A 4IH8A 4LUDA 2IN6A 3FSFA 2BMCA 4I93A 4PPCA 1WVYA 1NVSA 2W1HA 5IA1A 3FXWA 5CU2A 4BWXA 4R77A 4WRGA 3MTFA 2UZNA 4IWPA 3II5A 3DGKA 3RCDA 2XP2A 4BI1A 3NPCA 4E5AX 3G6GA 3RAIA 2UW6A 3CD8A 4PDPA 4IEBA 3VF8A 5CVFA 3QHRA 4JG8A 3PZEA 4M0YA 5C01A 3H4JA 3AT2A 3BEAA 3ORKA 4A4OA 4IVCA 4ZY6A 3KFAA 3E62A 2UZVA 2VGPA 2Y6OA 5J87A 4EEVA 5DT3A 1H08A 4CKRA 3RAKA 2BIKB 3WF7A 3FY0A 5M57A 4QMSA 4EOPA 4F63A 5CX9A 2IO6A 5AR2A 3KXMA 3W8QA 3HV7A 1J3HA 2UZDA 1GZNA 4AZVA 3P9JA 2V7AA 4S30A 1WBNA 4WNKA 1RE8A 4NZWB 3PIYA 4DG3E 4KS7A 4ZMFA 1HCKA 4EC8A 1OECA 2X8DA 3U6IA 1YVJA 4XOYA 3HEGA 3M1SA 3O8PA 3TI1A 1Y91A 4JAIA 2HZIA 2Z60A 3QD2B 3UC3A 2OJIA 2RG5A 3KXXA 2C69A 4D58A 4E8AA 5EKNA 5B2KA 4FTTA 3E88A 4FNZA 3LW0A 1H0VA 3BIZA 5AJQA 5A4CA 4WBOA 3QTQA 4AW1A 5EYCA 2C47A 4FG8A 1OB3A 3R8VA 3GC8A 4FEQA 1B38A 5FD2A 5DN3A 4IM3A 4LGHA 1OZ1A 2C5NA 3NCZA 3FKNA 4TYHA 4X2NA 4F6SA 4UN0C 5HU9A 4FKUA 3LKMA 1BMKA 2X9EA 1GOLA 4KIKB 4CRLA 3PG3A 4YLJA 4APCA 3ET7A 2OIBA 5DRDA 2BFXA 2X7OA 2QLUA 3RHXA 4BKJA 3QTSA 2HXQA 3L8XA 4F6UA 3PJ8A 2V0DA 1U4DA 3FZPA 2G01A 4W4XA 4AA4A 2PVRA 3VQHA 2GTMA 1BX6A 4RC3A 4Q5HA 1OVEA 3E93A 2GQSA 4O1PA 5J95A 3R9DA 5LOHA 2F7XE 2XK7A 1P4FA 4I23A 4IDVA 4OUCA 4Y85A 4ANOA 5CASA 2PMOX 2PHKA 2XNBA 3MY5A 4O0VA 4D2VA 2REIA 3R30A 1KOAA 3DNEA 4W9XA 3P86A 4QMVA 2JDTA 4S31A 4UXLA 4XG3A 4GVJA 3WYXA 4KUJA 2CJMA 2VO6A 4PMTA 5CEQA 2CCIA 4DH8A 5D11A 3W2PA 4O2ZA 1CTPE 3FPQA 5IA5A 4IB5A 4IQ6A 2FSLX 3V01A 3GVUA 1ZMUA 2GHLA 5CANA 4PTGA 1E1XA 4M69A 2BRBA 5TE0A 3SDJA 3QRJA 4WG3A 5DT0A 4ZLYA 4W4VA 2XB7A 1APME 1VR2A 5EYDA 3Q52A 3AC8A 1B39A 1FMKA 3CC6A 3DAEA 3EQRA 3IDBA 1YWRA 3KEXA 2A19B 1L3RE 2HENA 3NUXA 2XK4A 3QQGA 4IB1A 4TWNA 4TYGA 4YGAA 5HE3A 3CSVA 4J97A 1Y57A 3KL8A 4W8EA 3TG1A 4RQVA 1W82A 4RQKA 4DA5A 3H9FA 4I41A 1YWNA 3P4KA 4E7WA 5HORA 1JKSA 4G6OA 3WF5A 1QPCA 5IDNA 4DFLA 3HMNA 3FMLA 3PLAE 3AMAA 4YPSA 4FK3A 3D15A 5FRIA 3ITZA 5I0BA 3QTRA 4D2TA 1YRPA 2VO7A 3GC9A 3P1AA 2R3PA 3KMMA 2PMIA 2CKQA 4AN9A 4IJPA 4WT6A 3SVVA 3PYYA 4OTRA 4C58A 2ZB0A 1PKDA 2YLFA 4UWYA 1XBBA 4QOXA 1R1WA 2OZAA 3W33A 1GIIA 5I9UA 3VBTA 5L8KA 3B2TA 5BVWA 4JRNA 1A9UA 4FA2A 5DFPA 4EKLA 1UNLA 1ZZLA 3MN3A 5EH0A 4RJ6A 5DT4A 5BVEA 2G9XA 4PDSA 4U80A 1XO2B 3PPZA 5FG8A 3H3CA 3PE2A 3L9NA 5HGIA 3LQ3A 3HDNA 2IZTA 3JVSA
chains in the Genus database with same CATH superfamily
3JY0A 2B7AA 4IXPA 2H6DA 2C5VA 3B8QA 4MBJA 1R3CA 4UALA 3TJCA 2EU9A 3U87A 2YA9A 4BDAA 3CKXA 1YDSE 3KCFA 5CNOA 3OG7A 1ZARA 5JQ5A 1X8BA 1BKXA 1K2PA 4R3CA 2VTRA 5IISA 4YPDA 4BDFA 1UKHA 3EHAA 4QTCA 1QL6A 2H8HA 2ITVA 2YN8A 4KKEA 4OTDA 3QQKA 3LFCA 3A7HA 5I9XA 5LXMA 3KQ7A 3LIJA 4GRBA 3U9NA 2WIPA 3UE4A 1DI8A 5IH6A 3LJ0A 4MAOA 4DFNA 3DAKA 3Q5IA 2PVFA 5E1EA 2ACXA 5L6WL 4DN5A 3SXSA 4NKSA 4FKGA 4WA9A 4EC9A 2VWZA 4KA3A 5DNRA 4ARKA 4YC3A 4O7LA 4DH5A 3LFBA 4MQ1A 4RPVA 4U3ZA 2HWOA 3NUAA 4O4BB 3PFQA 2R3HA 4U79A 3DLSA 2G1TA 2W1ZA 1YOMA 5A6OA 5HZNA 4AAYA 3BI6A 3UC4A 4QQTA 4RIYA 4BY9E 2YFXA 3DKFA 3Q9WA 2OW3A 2RFSA 2OO8X 2UZEA 2VTPA 4Y73A 4ZY5A 2YIXA 4OBOA 1H1RA 4DTAA 4PTCA 4F64A 4AT3A 1VYZA 3U6HA 2QNJA 3HKOA 1J1CA 2CCHA 2E9PA 1U5RA 3REPA 1OBGA 5LVMA 3WZDA 5EHYA 4F99A 4PUZA 4F9BA 3QYWA 2CN5A 3NDMA 1RJBA 4G6NA 5E7RA 4QTDA 3QCQA 3WF6A 3R02A 4DT9A 2P55A 4AT5A 4NFMA 5G6VA 2UVXA 1H4LA 4LG4A 4FZAB 2GS6A 3BEGA 4TWOA 4DGGA 3FI3A 2CKOA 2R5TA 2F9GA 4GSBA 4KB8A 3UPZA 3FI8A 3TDVA 4I6QA 4O7WA 5EM5A 1XKKA 4EONA 3WIGA 4PRJA 3LZBA 4DFXE 3VUMA 1O6YA 4IX3A 3OCSA 2J50A 3RK5A 4EOMA 1W2CA 3HX4A 2IZUA 4XG7A 4RVKA 3F5GA 3UVQA 4QP6A 4DTKA 1OL5A 4QNYA 4RG0A 3OOMA 3BX5A 4AE6A 3I79A 2OIDA 3DXQA 4QYFA 3M42A 3QD0A 3RKBA 3O8TA 5BUJA 4DGLC 4EOQA 4I6LA 3NFFB 3FLZA 3NYOA 3VW6A 3MS9A 1PMEA 3E8CA 2W96B 3A7GA 4XP3A 2ZM4A 2XYUA 1Z57A 2YM6A 4IDTA 4O6EA 2HZ0A 4EL9A 3LM5A 4GK3A 3QRIA 1SVHA 3VS4A 5CS6A 5IUHA 4E93A 4IB3A 4N4SA 3FPMA 3ORNA 2WMTA 3BLRA 3EKKA 4X3FB 4BTMA 1H0WA 2BZKB 3DKOA 4FSWA 4ALWA 2WPAA 4DBNA 4NTSA 5L4QA 2B9JA 4XP2A 3QCYA 3QYZA 4FEWA 5DHJA 1T46A 4A7CA 1WMKA 4JDKA 3QCSA 2OICA 3O2MA 4QP9A 3RI1A 4AA0A 2JD5A 5AUYA 3ULZA 4R3PA 4FK6A 5CAVA 3M11A 2QHMA 3PDTA 4O83A 4FT3A 4TWCA 4L67A 5H8EA 4EHVA 4PF4A 5LWNA 1XBAA 5JGBA 1KOBA 3C51A 2WO6A 3NUSA 4PP9A 4PQNA 3NMUF 4BDIA 2VO3A 4C8BA 5CYIA 4LFIA 5BVDA 4WUAA 5CU4A 5BUEA 1PXLA 4O86A 3KRXA 2W4OA 4CFXA 3OW3A 3A7IA 4MXXA 2ONLC 3FV8A 1ZYJA 3TV6A 5CEMA 4I4EA 3TXOA 3EKNA 3RPOA 1TVOA 2FB8A 4BDGA 3P0MA 3VN9A 4YTFA 3WF9A 4HGSA 4AACA 4G6LA 4NM5A 4BCFA 3T9TA 3UIBA 5JMSA 4XLIA 1RW8A 2WNTA 3PVUA 4FTAA 5GNKA 4GH2A 2Z2WA 3ZSGA 3UIXA 2OBJA 1LR4A 2PVMA 4I5PA 4YJNA 1OPLA 5EDRA 2B0QA 2W05A 1KE5A 3GNIB 3JUHA 4BCHA 5A4LA 1OPKA 3QA8A 3GCQA 3KN5A 4GV1A 3FLNC 4H05A 4BHZA 3RZBA 2Q83A 3OWKA 1KWPA 2VGOA 3PE1A 4A9RA 3QLFA 2JDOA 1FMOE 2GQGA 4YZDA 1IAHA 2XS0A 4BR3A 2IJMA 4FT9A 4WBBB 3ZOSA 4BBEA 4FNYA 4FTKA 2V55A 3DKCA 4UZHA 4O84A 4FKSA 4U0IA 3RP9A 3SQQA 2E9VA 3DTCA 5H9BA 1UU9A 2X1NA 2J5FA 2YCQA 4AZFA 3H9OA 1TKIA 4Q9SA 1ZRZA 1ZYSA 3U4WA 4YZMA 1OGUA 2BZJA 4IW0A 4QMNA 1FVVA 2I40A 4JOAA 3OWPA 3R9HA 4YR8A 3HMMA 2JIUA 2X39A 4D2WA 1FPUA 3MVHA 3N9XA 5CWZA 4KD1A 4Z9LA 3ZDUA 1PRYA 1Z5MA 4JX3A 2W99B 5LVNA 3IW5A 4FT5A 4A9TA 2F7ZE 4CG9A 2Y0AA 2WXVA 4HPUE 2YAKA 4JX7A 3FQEA 2ZV8A 5KMMA 3L8VA 4IE9A 3UNZA 4JG7A 3W0OA 2IVSA 2IG7A 3DJ5A 2C4GA 5LARA 3ORZA 5BMSA 3CTHA 4QMOA 3ZFYA 3CGFA 4GFMA 2I1MA 2R0IA 4XV3A 4K8AA 4IAAA 3OHTA 4KWPA 1I09A 2OJ9A 3I4BA 5D12A 3MA3A 2QCSA 3PVWA 3GT8A 4O91A 4FL3A 3OF0A 5JT2A 5ANEA 2UW4A 4BDJA 5IKWA 4NEUA 3NUUA 3ATTA 2IW6A 3I7CA 3FMHA 3AD4A 4AG8A 4FTJA 3FKLA 2JLDA 3MPTA 4ZJJA 4BZDA 2YWPA 4JDIA 5I3OA 4BCIA 1KE7A 3PWYA 3LXPA 4ZS0A 4P5ZA 3MSSA 3W0PA 4HZSA 3L9MA 5JFWA 3LXNA 5ITAA 5B2LA 1XH7A 2NO3A 2OWBA 4V01A 4KSQA 4TYIA 2R3JA 3SAYA 1SNXA 4GEOA 1TQPA 3TV4A 2O3PA 1H1QA 2W06A 3GCUA 3BL9A 3A7JA 5J9ZA 1XQZA 4XCUA 5H2UA 4QD6A 4TZRA 3ZRKA 4IC7A 5HCZA 4L68A 4AQKA 3MFSA 2VNWA 3ZLSA 2C5YA 2QHNA 4K18A 2JAVA 4L01A 3TNIA 2OFUA 2CLQA 5ACKA 4RJ7A 2QR7A 4AW5A 2R2PA 2DYLA 1OL6A 2R0UA 4O7ZA 3O7LB 4O82A 3GI3A 3EYHA 4RWIA 4HCVA 4IX6A 3DB6A 4TNBA 5DI1A 4CRSA 2HAKA 5ANGA 4GK2A 1RDQE 3DZOA 4ZZOA 2J6MA 3AT4A 5GHVA 5G1XA 4FEUA 2W1CA 5GJDA 3LFQA 4FR4A 4YC8A 3CP9A 4NM0A 3BWFA 3IK3A 4IJ9A 5IA2A 5IQHA 3A4OX 2JC6A 5DA3A 4AU8A 3TL8A 5AP5A 5A6NA 5EQYA 5LVOA 2EB2A 1GIJA 2R3LA 1Q8UA 5I9YA 3QKKA 3Q5ZA 4ITIA 4EH6A 3FZOA 3GCPA 1GNGA 2RFEA 3FI4A 4BYIA 4FV0A 4BIDA 4E6CA 4FV3A 1NVRA 4G34A 4BCMA 4Q5EA 1P2AA 2BAKA 4NYEA 2CDZA 4KIPA 4ZTLA 4C4GA 4EHZA 4RJ5A 3LAUA 2ETMA 3ELJA 2CGVA 2XNMA 3SW7A 2XUUA 2XRWA 4LV5A 3ZS5A 3GP0A 3UDZA 3V5LA 4YJPA 4M14A 3D5XA 3UG1A 3FEGA 2XBAA 3L9LA 2Z02A 5EQEA 3MGYA 3PTGA 3ZC6A 4I1ZA 2Y9QA 4LMNA 5IA4A 4HZRA 5LJJA 4LI5A 3C13A 4XJ0A 5E8ZA 3C0GA 3IONA 2OU7A 2WQOA 3DT1A 3LQ8A 4RVMA 2XKEA 4ANBA 2ERZE 2X2MA 3IW7A 3MJ2A 3NS9A 5A46A 2JBOA 4YLLA 4FTNA 3NNXA 3GFWA 4HYIA 2VRXA 4I0TA 5FWKK 4TT7A 4AS0A 4PNIA 1REKA 3QL8A 3EFKA 2XEZA 2O0UA 4RRVA 3I60A 4CKJA 1J7IA 5HQ0A 3VQUA 3BYVA 3E92A 2UZTA 4CFNA 4CQGA 2NP8A 3KXNA 3K3JA 3RJCA 4YU2A 3QQHA 1ZMWA 2I0VA 2JKOA 2YDIA 3F3VA 3MWUA 3UJGA 3VJNA 4G3DA 5GIOE 2BRGA 3FAAA 3MVLA 5HO8A 5IDPA 3F7ZA 3UTOA 3C1XA 4GT5A 3OW4A 4FMQA 2R9SA 2V62A 4ERWA 1YXTA 3UOKA 3QQJA 3V51A 2QOOA 4IAYA 3MVJA 4EOOA 1URCA 3Q9ZA 4ONAA 5I5ZA 3TYKA 3MY1A 4JI9A 4EZ5A 1PJKA 5F9EA 3QU0A 1XH8A 4FSMA 4PV0A 3OXZA 4W9WA 5HESA 4ASZA 3RK9A 4KINA 3E8EA 4X3FC 1Q97A 4FX3A 2RG6A 4XS2A 1OI9A 3C4EA 2BILB 4YJOA 4E5BA 1H8FA 4EOIA 5DR9A 2WIHA 3NAXA 3T3UA 2ZOQA 4IC8A 3TIYA 1NXKA 4KS8A 5K0XA 3R7VA 2UZBA 3CJFA 2QKWB 5I9VA 4LYNA 3W2OA 3PIXA 4D2PA 5DYJA 2OFVA 2GFCA 4O4CA 2VU3A 4A4XA 4FYOA 1H00A 3V6RA 3EIDA 4S2ZA 3HRCA 4HVIA 5K4JA 1ZOHA 3PY3A 4FL1A 2PZRA 2VWIA 4QPMA 4BJJA 3BHUA 1ZOEA 2VV9A 2WELA 3SOCA 4CMTA 2BAQA 3RM6A 3QQUA 4PPAA 3FZTA 3UYTA 5AMNA 4R1VA 3EFWA 3G90X 4S34A 2UV2A 1OGYA 4Z55A 3QTIA 4FSUA 4ACMA 4KSPA 4U9AA 4QP1A 4WNPA 3E8DA 2NNWB 2CNVA 4R7HA 2C6EA 5HVJA 3KY2A 2QC6A 3BHHA 3BYUA 1ST4A 4JR7A 4C2WA 4OTQA 1PXPA 5F95A 4F1OA 1SVGA 4OTWA 3V5PA 5C8KA 2XIZA 1GAGA 1F5QA 4QYEA 4C61A 4RIOA 1IRKA 2LGCA 3C4ZA 3E8NA 5HG5A 5HLWA 3IW4A 2YEXA 3DU8A 3W16A 4C4IA 4RIWB 2CKEA 3ZLYA 3FC2A 3FLSA 3HP5A 5KMOA 2WMSA 2CGUA 3BQRA 4G31A 4QMUA 4QMLA 3VUIA 3NCGA 3ZZWA 2PSQA 5HICA 3FZSA 1JKLA 4EH5A 5IEYA 3FE3A 3E3PA 3GC7A 3TACA 3UBDA 1W8CA 3OUKA 4GYGA 4IVBA 4CZUA 3R21A 4DHJA 4FTCA 1KV2A 4JL9A 3CPBA 3QLGA 1WBOA 4M66A 1IA8A 4YJRA 1UA2A 2BVAA 2JAMA 2J2IB 4HPTE 4O7YA 4IAFA 3RAHA 2SRCA 4AZEA 2WD1A 2VTLA 3COHA 3DLZA 4L3PA 5DWRA 2ZDTA 3DKGA 4MBIA 4TXCA 2J0MB 4MXYA 4F70A 4O0YA 2C0TA 5CT7A 5CZHA 3DY7A 3OBGA 4EOSA 3VONA 5EDPA 3LQ5A 1YDRE 2UZWE 5CEOA 1MQBA 4M12A 3E5AA 3G5DA 4BRXA 3W0QA 1H28A 4DLJA 1WAKA 3LJ1A 4IAIA 4XBRA 2WEVA 3R01A 1JVPP 2VX1A 1Q41A 2B52A 3FKOA 3PXKA 3NZ0A 5JRQA 2ZV7A 1VYWA 1W7HA 2PL0A 3PPJA 2YM3A 2YIYA 5D9HA 2YAAA 1MRUA 4W4YA 3IS5A 4G3GA 4YBKA 3R7EA 5HX6A 3ZRLA 5JN2A 3LFEA 3VHEA 5GJFA 3G6HA 3UP2A 1BYGA 3MBLA 5E8SA 2VNYA 3C50A 2QOIA 4QT1A 4C3RA 4BICA 4JMQA 2QOHA 2WMRA 3TJDA 3GU4A 4RIXA 2QU5A 3IQ7A 4GT4A 3U55A 4F9YA 5AIRA 3DNDA 3RNIA 3W55A 3UQCA 3FMNA 3R83A 5JFXA 3R7YA 4H3BA 2X2KA 2WKMA 3Q04A 1XH9A 3S95A 3TTJA 4DFYA 4L45A 3MESA 1G5SA 2F57A 4LOQA 4GT3A 4DCAA 2XBJA 2EWAA 3G15A 3T9IA 4ACCA 4HVHA 4ZJIA 2XCHA 4JDHA 3ORIA 4ZTHA 4ASDA 1XJDA 2C5XA 4UMPA 2JBPA 4AXAA 3WIKA 4LV7A 5HTCA 3D0EA 3MH2A 3QD4A 5D1JA 4M3QA 4FKQA 3UO4A 2IZSA 5M07A 3PJ2A 3ZC5A 5HO7A 3ID6C 4NIFA 2VTHA 2JKQA 2DQ7X 4OBQA 5C27A 3UOLA 1WBWA 4ZSAA 3CQWA 1IASA 1YDTE 2IPXA 3A2CA 2CLXA 4DITA 3ZMMA 2BALA 4EK6A 5AV1A 2ITPA 4QMYA 2NYAA 4Z16A 5C03A 1J1BA 3OT8A 4CFVA 4MKCA 1YXUA 4L53A 4X7QA 3I0OA 2A98A 2XEYA 4NKAA 4GS6A 3VW8A 4F1MA 4BCPA 3D7TA 2G2FA 3QZFA 3UG2A 4BDKA 3NYNA 3LMHA 2WB8A 5AUVA 5EM8A 3ZUUA 1M2PA 2RGPA 2UW3A 3GCVA 3UOHA 3WZJA 4EK4A 3OCGA 3ZCLA 2EVAA 4KKGA 4N0SA 1H07A 1UV5A 3MPMA 5KNJA 2WMAA 3MVMA 2W5AA 4RFMA 3FWQA 3UIUA 4ACHA 3PUFC 4GL9A 3QUPA 3N51A 2YZLA 4K11A 2WTDA 3VAPA 1NVQA 4QMMA 4UYNA 2WTKC 3SV0A 4X21A 3KREA 1IA9A 2R3GA 3PP1A 4FVQA 4O7RA 3OC1A 3NUPA 1WBSA 5HE1A 2F2CB 5EOLA 4EUUA 1HOWA 4C36A 4N6ZA 4RJ4A 4CXAA 1OIRA 4G9CA 4DHIB 5GIPE 4BCGA 5AR5A 3L9PA 5D41A 3R8ZA 4TL0A 2BHHA 4BTKA 4MNEA 4IIRA 5CT0A 1F0QA 4YC6A 5KMNA 5ETFA 3K54A 4PDOA 4ZTNA 3O50A 3RPVA 3DDQA 3RPSA 3R63A 4F4PA 3BPRA 3UO5A 2GTNA 2ZV9A 3CXWA 5L6OA 1V0PA 1GIHA 2QI8A 5CQUA 2ETRA 3LJ2A 3KF7A 4C35A 3LPBA 4EQMA 2XK8A 4FZFB 4EYJA 4BDBA 5IQDA 2WTIA 1V1KA 3R2BA 4ZIMA 5HG7A 3R7IA 4DEIA 4TRLA 5KBRA 2QKRA 2O5KA 4EOKA 4ZLZA 4ZXTA 3KCKA 1BI7A 4FI1A 4IANA 4QYHA 4B0GA 4CGAA 1ZYLA 3HA6A 2A1AB 5J8IA 3FYJX 4LUEA 2C3KA 4XNEA 4XRLA 4UEUA 3H10A 4CKIA 3TCPA 2JDSA 1Q24A 3R00A 4D28A 2VWXA 2P4IA 3R73A 3EH9A 3PJ3A 2Z8CA 5L2SA 2X2LA 4L43A 5CENA 4I94A 5GJGA 4BIEA 4D4VA 4EBVA 5C4LA 1JOWB 1XBCA 2W17A 3PXYA 4P7EA 3KRLA 4BN1A 4FE2A 3C4FA 3ENMA 4JAJA 3COKA 4FV1A 1Q8YA 2Y4IC 4EWQA 2XKCA 1PXNA 3A61A 3F2AA 2IWIA 5IH4A 1G8JA 2O8YA 3EQFA 4GKHA 5AUXA 1URWA 3R2YA 2PPQA 4XUFA 1YXSA 4QPSA 5K4IA 2RSVA 3QXOA 4EH9A 4QRCA 3FY2A 5CF6A 4DF3A 5A4QA 4RZWA 4KBCA 4YSJA 3TUCA 4YJSA 1J7UA 3SD0A 3UNJA 4EH2A 2V22A 4CTCA 5CSHA 3SRVB 2OK1A 2DUVA 3QC9A 3U4UA 3PIZA 2Y8OA 4YURA 4B8MA 3QRUA 2JDRA 3EQGA 4B9DA 3U8WA 2UVZA 4H58A 2BTRA 4JG6A 3O96A 4U43A 5TKDA 3R8MA 3OMVA 4UWCA 1OPJA 3W32A 4C59A 2R3OA 2ZM3A 4ASXA 3BYSA 5F94A 3EN9A 2BZHB 3G0EA 4FTMA 3DK3A 5CVHA 5AIKA 3KULA 4ZLOA 4O7VA 3LCTA 1FBNA 5KCVA 3DB8A 5CI6A 5TF9A 4A4LA 3VC4A 3VRYA 5CU0A 3EJ1A 5J79A 2HZ4A 1W0XC 4F0FA 4J8MA 5AP3A 3EL8A 5EG3A 3HV6A 4C2VA 2H9VA 3DFCB 3ALOA 4O2PA 3RMFA 3ZFMA 3VS2A 3KVXA 2ITWA 4O0SA 1G3NA 3P08A 4FTOA 3JYAA 5AUZA 2HELA 3G51A 2ITQA 4MNFA 3FUPA 2B54A 3LMIA 5C8MA 4EJ7A 4E4LA 5AP0A 3OXIA 5EHOA 4BIBA 3Q32A 5LMKC 4HCUA 3EOCA 2XAOA 1Q8ZA 4FNXA 2QG7A 4EOJA 5IMXA 4U7ZA 4XRJA 4PTEA 1OIYA 3F88A 3Q60A 2J51A 4G16A 1LPUA 4FZ7A 3POZA 2ZMDA 4J95A 3O71A 4XV1A 5HG8A 3V04A 4C34A 3WOWA 3WZUA 5CZIA 5DLSA 2UW0A 4B4LA 4E6QA 1XH4A 2AQXA 4PMMA 4U97A 4LOPA 4GUEA 2OXXA 4RMZA 2ZMCA 3MIYA 3LMGA 3RGFA 2J4ZA 1MP8A 2WTVA 3VNTA 4H1MA 3W0SA 4FRFA 1CM8A 3CTJA 3RNYA 4FGRA 4BYJA 1G8KA 4QYGA 3R9RA 3NX8A 4I3ZA 3QHWA 3WE4A 1PMNA 2FVDA 2XCKA 5AAFA 3O23A 5EI8A 4LMUA 1XH6A 2BUJA 2FH9A 3BU6A 1OKWA 4CYIA 5HTBA 2R3NA 5L2TA 2YCRA 4M67A 4EUTA 1H27A 3LOKA 5HNGA 4FV7A 2DWBA 3FDNA 3LXLA 1H1PA 1NY3A 2QR8A 2KULA 3TNQB 3FHRA 5E8VA 3MFRA 2WQEA 1H25A 2V7OA 3CY3A 2VTTA 3OXTA 4RJ3A 4XMOA 3U54A 2W1IA 4X6RA 5AV4A 1TFFA 4DE4A 4L6QA 2J0KA 5K0KA 3HMPA 1U54A 1Q8TA 2GPHA 4FV6A 4J8NA 4GG7A 4F78A 3R7OA 3GC0A 4CZYB 1ZWSA 5EM7A 1O6KA 3ZU7A 3F5UA 1LUFA 5H3QA 3KKVA 3OUNB 4EI4A 4FKRA 1G8AA 4F0GA 3BV3A 3HAVA 5AX9A 3GU6A 3ACKA 4K2RA 1W2FA 4C4FA 4AOIA 2ZVAA 4FTIA 1QPEA 2FA2A 3ATSA 2QOQA 1OL7A 3E7OA 3ZRMA 5HKMA 4UXQA 4CNHA 1TQMA 2P0CA 4C4EA 2IZRA 2B4SB 2E9UA 2HCKA 1SMHA 3QAME 2ZDUA 5FM3A 4DC2A 5BYYA 1UU8A 3SG8A 2XRUA 2YHVA 4XG9A 1FINA 2X0PA 2JKMA 3I6WA 5T6KA 3FL5A 3HVCA 3IDCA 4IX5A 3RWQA 3HA8A 4DFUA 3VBXA 4IX4A 4UMRA 5DR2A 1M7QA 2XVDA 4NFNA 4Y8DA 2GNIA 4LL0A 1L8TA 2CKPA 4AXDA 4AZWA 3UDSA 4R5SA 5ANJA 4YHTA 3TMOA 2X4ZA 3B2WA 3EWHA 4ZOGA 4ZSLA 2P3GX 1JPAA 1Y6AA 3R7UA 4CLJA 4EK8A 1ZOGA 4NM7A 3LFDA 3WZEA 3CTQA 2HK5A 2X7FA 2IVTA 4IB0A 4F9AA 2WTJA 1O6LA 2EXCX 2ITOA 2GNJA 3P7AA 4YZ9A 4D1XA 4UBAA 3D9VA 1VJYA 4MD7E 3I5ZA 4BZNA 3ZO4A 4ANNA 4F9WA 2YM8A 3BCEA 4QP4A 4ANSA 5GZAA 5J1WA 2OH0E 4FSYA 3MIAA 2AEGA 4JIKA 4BCNA 3EZVA 3HGKA 4UB7A 3R71A 4YHFA 3TT0A 1JSUA 5L2IA 3UMXA 5DEYA 3ACJA 2UW8A 1GY3A 2WQMA 1DAYA 4DAWA 5JH6A 3R8PA 5M4UA 3H30A 4DGOA 1ATPE 4G2FA 3CJGA 4F7SA 5IEXA 2HW7A 4A9SA 4RVLA 1I44A 2PUUA 5A3XA 4KIQA 4DG2E 5FUTA 1YW2A 4DHFA 1M2QA 3FXZA 5M06A 4G3CA 2X4FA 4BBMA 2YM4A 5CF4A 2O64A 4E6DA 1SZMA 4D4YA 3TKIA 4BVUA 4H1JA 3DBQA 1KUTA 3W0NA 2YERA 3HECA 4H3PA 3OFMA 2J0LA 4DDGA 5TOZA 4IVDA 4V0GB 4ZTQA 5C1QB 4ALVA 2X6DA 2LAVA 4BB4A 5FBOA 4MYGA 2XNEA 1NT2A 2XF0A 4OTFA 5F4NA 3T3VA 3K5VA 3VVHA 2NRUA 4R5YA 4D55A 3EQCA 2GMXA 3ZLXA 4BWPA 4MF0A 4IHPA 5FXRA 5JFSA 3GU5A 2VZ6A 2XA4A 2UZUE 4AW0A 4CEGA 4USEA 4BWKA 4HW7A 4J96A 3V5QA 4AGDA 3C4WA 4JR3A 4BKYA 5J7HA 3WYYA 4FG9A 3QTUA 5LVPA 4O7TA 4FUXA 3A4PA 2ONLA 3E3BX 3GENA 1LEWA 4JDJA 3S4QA 1CKPA 2WOTA 3TZMA 3V8TA 3WZKA 4B6LA 3BQCA 2J0IA 5AUUA 3V8SA 3BE2A 3ZUTA 4RC4A 1ZY4A 4M97A 5BMMA 1AGWA 2VTJA 4KIKA 3RALA 3DPKA 3H0ZA 4FG7A 5AAGA 3ORTA 5L2WA 4GG5A 5CEPA 2CMWA 2AC5A 2WTWA 3TV7A 4ACGA 1UVRA 2OF4A 5BUIA 1AD5A 2VWYA 3OD6X 4Q2AA 4DEHA 1DAWA 3QD3A 3C4XA 3DTWA 4II5A 4ZSJA 3W10A 2J90A 3MH1A 3QWJA 3KXHA 3ORMA 5DVRA 3OWLA 3NFGB 2UVYA 2P2IA 2UW9A 1ERKA 4D2SA 4O0WA 5BYLA 3ORXA 4TNDA 4XLVA 4F65A 3LVPA 1ZXEA 3FLWA 1STCE 2F49A 4ITHA 4C38A 4MBLA 3BU3A 3VS0A 5HU3A 1JNKA 3BLHA 4DEBA 4NUSA 4FBXA 3SGCA 1PXKA 4GFOA 5ANIA 2XARA 4BTJA 2PZYA 4RBLA 4DLIA 3A60A 2B9FA 3F5PA 4NCTA 2IW8A 2C0OA 3KK9A 4PL3A 3UZPA 4AP7A 5J9YA 1IR3A 4RX7A 2HYYA 4NW5A 4AQCA 3F2NA 2YCSA 3FZ1A 4X0MA 5C9CA 5HD4A 4K33A 4YTCA 4G5PA 3FJQE 3MFUA 5CXHA 1UWJA 2C3JA 3GU8A 4X2GA 5BV3A 4PX6A 3S2PA 5JSMA 2Y4PA 2OH4A 4WO5A 4MX9A 5IQGA 2XNOA 5LCKA 3BLQA 4TYHB 4P4CA 4HOKA 4EH7A 4NU1A 5JKGA 4NL0A 2C3IB 4UZDA 5EI6A 3S3IA 4XV9A 4EORA 3E64A 5KMIA 3L8SA 4N6YA 2Z7LA 4U41A 3QUDA 3CKWA 5FLFA 3G2FA 4XG6A 3ZUVA 3NUYA 2VUWA 4LOOA 4KAOA 4R7IA 4PMSA 3ZEPA 4BL1A 3CS9A 2P2HA 4IADA 3ZONA 4JBPA 1IAJA 4WUNA 3BYOA 1CKIA 3SOAA 5I4NA 4J7BA 2R3FA 4ZTMA 4ERKA 2JFMA 4OW8A 2AC3A 3P7BA 3OCTA 5CAPA 3PFYA 5IUGA 3CPCA 4FEXA 2QQ7A 3BHVA 3A62A 4GFGA 3RPRA 3EQHA 4EOLA 4FZDB 4FSRA 4G3EA 3VBYA 5HLNA 2WOUA 3P7CA 3QRKA 3UVPA 2C5OA 2VX3A 3NIEA 2I0YA 3VJOA 5DR6A 3AKJA 1LP4A 3DJ7A 4YLKA 1E1VA 5M53A 2PVNA 4JQ7A 3D7ZA 5EK7A 3KN6A 4M69B 4L52A 4AW2A 3HRFA 1OIQA 2BFYA 4QP2A 2EUFB 4IACA 4X2KA 5FM2A 4C3PA 3HYHA 4F08A 2WTKB 4UYAA 4H39A 2YISA 4FL2A 3TDWA 2QU6A 3L8PA 1W84A 4JJRA 4TYJA 4L8MA 4CLIA 2QOCA 4F7JA 3SG9A 3UZRA 2A0CX 4Y95A 1Q3DA 2PMLX 3RBWA 3T8OA 2RFNA 3FL4A 2JITA 3NR9A 1OUYA 3FSKA 3CY2A 3P5JC 1Q62A 1QPDA 2XM8A 1WFCA 3TUDA 4C4HA 3DFAA 3F6XA 3ODZX 4RJ8A 3EN6A 2VWBA 3RZFA 5BNJA 3UDTA 3HV3A 5KUPA 3C4CA 4CZTA 3PXQA 2OXDA 4QMWA 3TEIA 3SC1A 3FQSA 4PWNA 5BVFA 3IPHA 3FQHA 3QCXA 4IWDA 4BDEA 4C7TA 3IOPA 3OCBA 4YJQA 1JKKA 4DCEA 3PA4A 4GU9A 2I0EA 4QP3A 5HE0A 5IU2A 2X8EA 2JFLA 3QX2A 3NVKI 3HNGA 2OZAB 3BHYA 2Q0BA 3K2LA 3QA0A 4MWIA