3HP5A

Crystal structure of human p38alpha complexed with a pyrimidopyridazinone compound
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
347
structure length
330
Chain Sequence
PTFYRQELNKTIWEVPERYQNLSPVGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Discovery of N-substituted pyridinones as potent and selective inhibitors of p38 kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 106
structure length 330
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hp5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hp5A01
3FMKA 2JKQA 3ORNA 4H36A 5LOHA 3F9NA 5CYIA 2XBAA 4M66A 5TOZA 3TZ8A 2ZDTA 5EI8A 2WTDA 4RLKA 3RK9A 3UYSA 4TWCA 5I9VA 5IQCA 4O0YA 3UODA 3SGCA 2CGVA 2R3HA 3NVKI 4O2ZA 4Y83A 3MN3A 4JIAA 5EFQA 4AZEA 3DQWA 4EOKA 4FT7A 4HNIA 3I4BA 3QZGA 4RX7A 4YU2A 3R7VA 3CBLA 3CCNA 3NUNA 2PVLA 3KRLA 2ITQA 3RAHA 4G3DA 4EOIA 2VU3A 2VTQA 2UZLA 2X1NA 4GYIA 4NJDA 3FQSA 2YDKA 4AOJA 2EWAA 3R83A 3ZM4A 4BCHA 5IH6A 5DE2A 5EW3A 4R1YA 5IISA 1BL7A 4LGHA 3V3VA 3G15A 4FL1A 4WUNA 4DGNA 3IS5A 4C62A 3G2FA 4E6CA 2IWIA 2VX3A 3F3TA 3IW6A 4A4XA 3KB7A 4FT3A 5L6PA 5AV1A 4AU8A 4KS8A 3FMEA 4I92A 3TI1A 4LV8A 4BIEA 4DH1A 5HE1A 4FTKA 4S33A 4O0RA 3CS9A 5GNKA 2OFUA 3VBQA 2CN8A 4OR5A 3IW8A 1H00A 4QMMA 4F65A 3LFSA 5DH3A 4I41A 1PMVA 3LJ2A 3VUHA 1RE8A 3AGLA 4EOLA 4ZMEA 3T3VA 1PKDA 4DCEA 4DYMA 2X8DA 2W1ZA 4AT3A 4MWHA 1MQ4A 3PY1A 5ETCA 2OI4X 5BPYA 4C33A 3E3BX 4BCNA 1PYEA 5FGKA 5H8GA 3FL4A 5FWKK 4ALWA 4XBUA 1M2QA 5F95A 4P2KA 1IA8A 5IEYA 5E1EA 3DK3A 4L67A 3EFLA 4RJ4A 3TXOA 4RRVA 3AMBA 4FV2A 4NJ3A 3Q5ZA 4YTFA 1SM2A 3RVGA 2OJIA 5AUZA 4D55A 1S9IA 3KRJA 3HV7A 3BU6A 3VJOA 3ZM9A 1P2AA 2PVNA 4WBBB 2ITYA 2PMIA 5BVWA 3UTOA 5CZHA 1UU9A 3SKCA 5HVJA 1CMKE 3I81A 1X8BA 3TNQB 5FQDC 4P90A 2P3GX 5ICPA 4N57A 4QMVA 2JDSA 4FIIA 1Z5MA 3LJ1A 2Z60A 4XRLA 5E4HA 2BZKB 2WTKC 5IA4A 2XF0A 4FTNA 3TZ9A 1VEBA 4ZSAA 2J0LA 4FMQA 4QTDA 2W5HA 4EH9A 4AGUA 4EUTA 5A54A 4BFMA 5IQAA 4BBEA 5C8KA 1HCKA 2GMXA 4HVIA 2UW9A 3H10A 5CSHA 4L01A 3AXWA 3R7IA 4FKQA 1H0VA 1KOBA 3E62A 1WZYA 2BIKB 1GNGA 3LCOA 1H27A 3BV2A 3FQHA 4R7BA 2XIXA 4EH3A 2WEVA 4QP4A 3QX4A 4KIPA 4AA4A 5IQDA 1R3CA 5AR3A 4EWHA 1YI4A 3MVLA 4TRLA 4R78A 2Y9QA 3O71A 3QZFA 1XHAA 4Q5EA 1URWA 2W06A 3ETAA 2W0JA 3HNGA 4AS0A 1JPAA 2QKRA 3OT3A 4C38A 5E9EA 2J6MA 1XBCA 5ETFA 2E9OA 4QYHA 3C4ZA 4X2KA 3QQFA 4YURA 5CAQA 5I9XA 1Q41A 4FV4A 3M1SA 4CFVA 1J7IA 3PRFA 3V8TA 4E4MA 4YSJA 5I0BA 3LFQA 4N4SA 1O6YA 4CV9A 1G8SA 3JXWA 4FKVA 4EOSA 5EQYA 4TYEA 2G01A 2V7AA 1J7LA 2X7GA 1O6KA 2G2FA 2SRCA 1OM1A 4GT3A 3TUDA 3LFNA 4C4FA 4S31A 3QRJA 4MK0A 2C5OA 1E1XA 1ZMUA 2CCHA 2DWBA 2C6OA 4OBPA 2ZAZA 4ZOGA 5IUIA 1UA2A 3OVVA 4W9XA 4G5PA 2BROA 5TT7A 4FODA 2NRUA 5JSMA 5IQIA 5EHYA 1BUHA 3KK9A 2WTIA 4KAOA 4KSQA 4AXAA 4NCTA 5EK7A 3OOMA 2PZIA 4JDKA 4RJ8A 5JQ5A 3CQWA 3MH0A 4HPUE 3DJ7A 2PVJA 4DT8A 1GIHA 2BILB 1FVRA 3KXMA 5AAGA 3NUSA 2FO0A 5M4FA 3PVWA 4JQ7A 1OBGA 3UVQA 5J7BA 3GI3A 5L4QA 1TQMA 3DZOA 3F3UA 3SAYA 4A06A 5HO6A 3TJDA 4F1TA 4ERKA 5C4LA 3L8XA 3QC4A 2YEXA 4NSTA 1OKYA 3ATTA 3R8VA 2XIYA 3LCDA 3QTRA 2CHLA 2BDJA 4UN0C 1UWHA 1FINA 1OL6A 2WTCA 1GJOA 3LIJA 3EQHA 4L53A 3HV6A 4TWNA 1J1BA 3F61A 3O8TA 2WAJA 3D7TB 3R04A 4EBVA 4C0TA 4BHZA 4PTGA 4R1VA 3GC7A 4CCUA 5FM2A 4OLIA 3WIKA 3ZSHA 4E73A 4WO5A 5BYLA 4QMLA 4LM5A 1ZY5A 2BAKA 2CLQA 2E9UA 2DUVA 3LFCA 4I20A 4ACMA 2O65A 3WYXA 2OJJA 3B2TA 3C5IA 3QD3A 3FAAA 3PJ1A 4OTRA 3IW7A 5E8UA 3EYGA 2VTNA 5K3YA 4QQCA 3SW4A 3C0HA 3MA6A 1ATPE 2IJMA 2ZB1A 3FE3A 3DLZA 5EM7A 5LMKC 1QPCA 3D9VA 5F94A 2YERA 3ROYA 3Q2JA 3ORLA 3NGAA 3LFAA 3OWKA 3F2NA 5M08A 4L9IA 2WD1A 2YACA 1CTPE 1H1WA 2VNWA 2VGOA 4AFEA 4FV7A 3HV4A 3TL8A 3U6HA 4LUEA 1HCLA 5FD2A 3Q4CA 2IZTA 4MNFA 1SMHA 4J53A 3D7TA 4RIOA 4ZY5A 3BI6A 2BDFA 4CG8A 2FA2A 4OTPA 5CQUA 4A9TA 5DT4A 4EK8A 2W96B 3R22A 4AE6A 2YWVA 4IZ7A 2XIRA 3IOPA 5DT0A 4O84A 3CPBA 4ENYA 3QCYA 4RPVA 5BVOA 3LM5A 5DEWA 2W5AA 5DN3A 2R64A 4IACA 3V5JA 4UX9A 2WFYA 5CEMA 3R9NA 4B8MA 2QOBA 1FVVA 3KVXA 4UWCA 3WF9A 2CNVA 3KKVA 5AP7A 1QMZA 2B4SB 2GCDA 2QI8A 3BWFA 4DF3A 2JDRA 5IF1A 5CF4A 4B0GA 5BQ0A 1ZY4A 2UZEA 3ZO1A 1Q8YA 2CMWA 1TVOA 4J99A 4PPAA 4TYHA 4CMTA 2O5KA 2PZRA 4O81A 4MH7A 3CIKA 2V5QA 1OVEA 2PVMA 3LM0A 4BCQA 4A4LA 3LHJA 3TIYA 5LJJA 4Z3VA 4LRKA 2R4BA 3MVJA 1AD5A 4G16A 5J5TA 2OG8A 4ACCA 5B2KA 4ANNA 3OMVA 4FT5A 4AE9A 4KBCA 4DTBA 5M57A 3QA0A 3D83A 4FL3A 3SG8A 2X8EA 3VJNA 4I5CA 2W1CA 4MXAA 5BYYA 1WBWA 4PDPA 5CSWA 4BI0A 1YXXA 3UPXA 2BKKA 4QTBA 4RFZA 4AN2A 3BZ3A 3P0MA 5T3QA 4J96A 3VS0A 4WBOA 4RFYA 3KRRA 4NK9A 5DIAA 1XH7A 4BI1A 4C3FA 4AG8A 4MF0A 2CKPA 3R1NA 4R5SA 4PRJA 4ALUA 1GIJA 2DYLA 4GUBA 4OTFA 4FSMA 5DR2A 1UU3A 1SNXA 5CAUA 3QHRA 3G33A 4E93A 4EH6A 5KZ0A 4E5AX 4CGAA 4JQEA 5I9UA 5AR5A 3ZO2A 2X39A 3PVBA 4PPCA 5E8WA 2GNJA 2XEZA 5TF9A 1B6CB 4NTTA 3ZS5A 4ANMA 4HPTE 4C4HA 2NO3A 1H28A 3PZHA 3VIDA 4PTEA 4EQCA 2V0DA 4EYMA 4QOXA 3HAMA 4D0WA 5HI2A 2YA9A 4HVHA 3D2KA 2QKWB 4RZWA 4EHEA 4NTSA 3L8VA 2WTKB 5M4IA 5JFWA 4V01A 3TV4A 4FV9A 4DEAA 4D1XA 2EB3A 2ITVA 2CGWA 5CU2A 1CSNA 5HLPA 3A4OX 3SRVA 5J1WA 3E8CA 4IC8A 1YI3A 3AC5A 4XG2A 5HBEA 2PHKA 2IW9A 3S3IA 4CRLA 2VNYA 1PXKA 1EH4A 4D4VA 5KZIA 3PWYA 4IB0A 4QNAA 4BB4A 3I7BA 4FKWA 4O91A 4AW5A 2REIA 3BHTA 4IADA 5CU4A 3N51A 4DH7A 2XKEA 3C4WA 4NFMA 5F4NA 3W16A 3A2CA 3VUIA 4GJ2A 4H3BA 3NSZA 4L42A 3VW8A 5ITAA 5LCJA 4AZTA 3OFMA 4K0YA 2QHNA 2WMVA 4DEHA 1YW2A 4CQGA 4AGWA 4ERWA 4U45A 2W9ZB 4DA5A 1Q97A 4IB3A 2HXQA 4X2GA 3FZOA 4F08A 3MESA 3DK6A 5L6WL 1KOAA 4DGLC 2RG6A 3O8PA 1JBPE 4BCOA 4NW5A 3SOCA 3EQCA 4QP6A 3MFSA 3THBA 2W4KA 1TQPA 3QKLA 5F1ZA 1GZKA 1OITA 5EDRA 3LFFA 5JH6A 3VHEA 3U51A 1ZMVA 3PXKA 4KD1A 3UJGA 4R8QA 3UIBA 4BDEA 4E6DA 5H2UA 3HA8A 5AIRA 3VAPA 5HBJA 2ZDUA 5IMXA 1LP4A 3A60A 4WD5A 4C4IA 5CI6A 2OW3A 5CEQA 3BX5A 4OTIA 2UVYA 4FNYA 2QD9A 3MYGA 2CDZA 3MB6A 3FLQA 3M42A 4GK2A 1Z9XA 3OCBA 4DAWA 3LQ3A 3VBTA 4I0RA 3Q2MA 4O83A 4IX3A 2GPHA 3TKHA 5AUWA 3EZVA 3V5LA 3B8QA 2C5XA 2WOUA 4FSQA 3RPOA 5IDPA 2RFNA 4FTMA 3BHUA 3UC3A 3UZRA 2PZPA 2RGPA 2VWUA 1HOWA 5LMAA 3JY9A 3ET7A 4WIHA 2IVUA 5DNRA 4WKQA 1YOMA 3RHXA 4ID7A 4I4EA 4K9YA 4TTHB 4RQKA 5J8IA 4OTWA 4PL5A 3PG1A 5KMIA 4M12A 4EH8A 4V0GB 4XG8A 2HK5A 3S1HA 3QYZA 5HNIX 5HBHA 4KABA 4II5A 4ORKA 3W1FA 4BRXA 3E8EA 2C5YA 3M2WA 2B53A 4RIWB 4S34A 4TKSA 1XBBA 4EKLA 3LMHA 4TL0A 3CKXA 2P0CA 3NIEA 4YHTA 2PUUA 4C59A 3ZLSA 3H9RA 3BQCA 3P7AA 4RIYB 5EHOA 5CXZA 4K11A 3C4CA 2V55A 4M15A 3FPQA 1OPKA 3NUPA 4RC4A 2AYPA 5DBXA 3R7UA 1WBSA 3FC1X 5CVFA 3GFEA 5IA5A 4FTTA 1Q99A 3CJGA 4MNEA 4UXLA 2WQMA 3N9XA 3ZRKA 2C1AA 2YIQA 4LI5A 3MFUA 4L00A 4M69B 2ZVAA 4AT5A 2CNUA 4QQ5A 2VWVA 3I79A 4Y8DA 1SVEA 4U80A 3LLAA 1ZLTA 1JKSA 3VBYA 4PV0A 3LMIA 3W8QA 4V0GA 2GS2A 4Z16A 5EYCA 1KE9A 4YO6A 3RTPA 3COHA 1U59A 3MY0A 2I0YA 5DVRA 3CE3A 1DI9A 4C8BA 5F9EA 4I0TA 4NL0A 3QLGA 3EWHA 3FV8A 4RIWA 4FSZA 3RPYA 2OK1A 4MD7E 4O6EA 3EFWA 4A9UA 1RW8A 3MI9A 3R71A 4Y73A 4OTGA 2YCFA 3EL7A 4QD6A 3VS4A 4KIOA 5A6OA 5H3QA 4HYSA 4CEGA 2PTKA 2BHEA 3DXPA 3QQHA 2QOFA 5LARA 2Y6MA 5FXRA 2XK7A 3ZU7A 3UVPA 4P4CA 5IKWA 4FIEA 5EQPA 3BV3A 2WPAA 3E63A 3VRYA 3PJ8A 3W2RA 1OECA 2XK6A 4FKUA 4TYIA 5DR9A 5E8TA 3IOKA 3TCPA 5E8VA 4KBAA 4OBOA 4DBXA 4LRJA 4QMZA 3Q52A 4G6LA 4AA0A 1ZMWA 4NKSA 3BHYA 3ORZA 3UOJA 2BTRA 3LCKA 3PYYA 3HUBA 3V04A 3A7IA 4U5JA 4R6VA 5LMKA 4UYAA 4U7ZA 1UNLA 2VWYA 5FLFA 4XP2A 4AZVA 5CU3A 1OIQA 5HGIA 3EH9A 3QC9A 2Y4IC 2CNQA 3OY3A 3CQUA 1W0XC 2VO7A 2ZMDA 5J9YA 4YZ9A 4HYIA 4KIKB 4HYHA 4BGHA 3QXOA 3GU6A 1ZAOA 2XA4A 4JBPA 4FZ7A 5E8ZA 3PP1A 5ETAA 4U44A 1QL6A 4DG3E 2XKDA 3D5UA 1GZNA 4F0FA 3ZC6A 2AC5A 2P2HA 2BRGA 2WXVA 3H3CA 4IAAA 5FTGA 3W8LA 4BCJA 3F6XA 5T68A 2ESMA 4R3CA 5LWNA 2EXMA 2PE0A 1W83A 2J5EA 4FEWA 2WMXA 4MEDA 4F70A 4EI4A 4PP9A 5DFPA 5HIBA 3DT1A 2C5NA 4F9BA 3TNHA 4HGTA 2QO9A 3MTLA 3IQ7A 2R3QA 4I6FA 4RLLA 5EYKA 4BDAA 2WGJA 4C2VA 4H58A 3TNWA 1STCE 5D41A 5ACBC 3L8SA 5J9LA 1OIUA 1QPDA 2PMLX 4F1OA 2Y7JA 2IN6A 1WCCA 3R8LA 2F7EE 5C9CA 3TEIA 3TN8A 4KWPA 5L6OA 1RJBA 4IVCA 4KIKA 5I5ZA 4GUEA 4BL1A 2WTWA 4FKTA 4AA5A 4HVGA 4YJQA 5IA0A 1CKJA 3GBZA 3QQJA 5T6KA 3QGWA 3G9LX 4HNFA 3FZ1A 3FKNA 5KE0A 5K5NA 4QYGA 3KXNA 5ANKA 3S0OA 4IBMA 4BR3A 1PXMA 4YJSA 1U54B 2OZAB 3UOLA 2OGVA 2BRHA 5TE0A 1YKRA 3UBDA 4PWNA 4J97A 4IZAA 5KMOA 2QURA 2O8YA 4L8MA 5HU9A 2VN9A 4RVKA 4U6RA 3AMYA 3KRXA 3RINA 3UQCA 3R30A 3G0EA 3NDMA 5HIDA 4O27B 1GOLA 2IZUA 4ZEGA 2X9EA 3BEGA 1TKIA 1XH4A 5J9ZA 3CSVA 5IH4A 3RALA 2ONLA 4HGEA 3KF7A 1NT2A 2E9PA 3AD4A 4F7NA 1R0EA 3C5UA 4LV5A 2X2KA 2YIYA 5FM3A 3IECA 3ITZA 3A4PA 3ZBFA 1ZXEA 5CI7A 4EK6A 1YXUA 2OSCA 4J95A 4FTJA 1GZ8A 3GQIA 2R3NA 4DFNA 4DE4A 4CMUA 4IDTA 4NM7A 4B4LA 3HMNA 3MS9A 4D5HA 1Q5KA 3RCDA 4KRCA 4G3EA 2H8HA 4KINA 4U9AA 5AR7A 4EEVA 5A4EA 4IWQA 5ANOA 2HW7A 4JR7A 1E9HA 5IH5A 2X7FA 3WF7A 4CSVA 1E1VA 2YM3A 5DRBA 5IA3A 1ZYJA 2OZAA 1WFCA 2WMBA 4A7CA 2XIKA 5CAPA 2YM5A 3QWKA 2XJ0A 2J9MA 2GHMA 3WZJA 4AOIA 4ZLYA 2ITWA 3QHWA 4GVAA 3DPKA 3F5UA 1H1QA 5AM6A 4FT9A 3IDCA 4EQUA 3O8UA 2W1GA 3HV5A 3QZHA 2X9FA 1JKTA 2GSFA 4CFMA 4E5WA 4F1MA 1JVPP 2RL5A 4G17A 1A06A 5HD4A 1I44A 2UZVA 4FZDB 1XH6A 4Y95A 2W7XA 4YR8A 2XNBA 3EQIA 2NNWB 3R1YA 3NWWA 2YABA 4YLJA 5HKMA 4RX9A 2W9FB 3R7OA 4YPSA 3UMXA 3OWPA 4GL9A 2KTYA 3DS6A 2W1DA 4L7FA 1YI6A 2WQBA 4R7IA 1XH5A 1IA9A 3PIXA 3BYOA 3HVCA 2PVKA 4M84A 4D2PA 3DAJA 4DTKA 2RG5A 5GINE 4XNEA 4O1PA 3KGAA 3L9PA 5K5XA 4CTBA 2GTMA 2V7OA 3IGOA 5IEVA 4LYNA 4RX8A 4X6RA 3UNJA 1LEWA 1ERKA 5ANEA 3F3WA 4RVLA 5HNBA 1RDQE 4E5BA 5CEPA 5DLSA 3DB6A 3LJ0A 3GU5A 5BYZA 5IZFA 4W8DA 2WTVA 2I0EA 1OIRA 1MUOA 2GS7A 3DTWA 4NWMA 4W4YA 3VBWA 4DFUA 4ZTMA 5DMZA 2HCKA 3QF9A 4OTDA 2PSQA 3KCKA 4QMTA 3RZFA 4U43A 4AQCA 2I6LA 3V6RA 4F64A 2WMTA 3PJ3A 3R8UA 1Y6BA 3TZMA 3HRBA 2GHGA 1IR3A 3AMAA 3MV5A 3QUDA 3NUYA 3Q4TA 1DI8A 3IONA 4D0XA 4J7BA 3A7GA 1L8TA 3UQFA 2PL0A 3RK7A 4Z55A 4F63A 5HZNA 4FTUA 4HW7A 3UP2A 4BVUA 1CDKA 4IAYA 5EH0A 1OUYA 2BZJA 4TWOA 4IQ6A 4FSYA 4FSTA 3CC6A 4AZWA 4FNXA 4FZAB 4M0YA 3ZRLA 2ITPA 5D10A 2W5BA 5D7AA 3S00A 5E7RA 5AUTA 2JIIA 1Q8UA 1REJA 5CEIA 1P4OA 1ZZ2A 2JDTA 4YHJA 5I3OA 4EK4A 5DYJA 1PJKA 2OF2A 5FDPA 3LKMA 2XBJA 4NKAA 5EM6A 4XV2A 4Q9ZA 4BKZA 2VTOA 3R7GA 5A6NA 2JBOA 3PTGA 3QTWA 3R1SA 4K8AA 3HL7A 3FI2A 4M0ZA 2WU6A 4CKIA 5HTCA 1Q62A 2YIXA 1FBNA 3LMGA 2XUUA 2XNNA 3MBLA 1U5QA 4LGDA 2XJ2A 2XRUA 2YWPA 3OCSA 4FV8A 4RJ7A 4QMSA 3RAIA 5AIKA 3F5PA 4YBKA 4BWKA 1H4LA 3CP9A 5LVMA 4GS6A 4GSBA 2W1EA 3E88A 1M17A 3K5VA 1SZMA 4ZZMA 2GNGA 3F88A 2R0UA 3MWUA 3KXXA 4RIXA 3TG1A 3QU0A 5K4IA 2BFYA 2GU8A 2I1MA 4AGCA 3KMWA 3ZLWA 5A4CA 5HO7A 3Q9XA 2BAJA 2X4ZA 4O1OA 4DEDA 3OCTA 5BVDA 3IK3A 3E7OA 4XV9A 2CPKE 1Y57A 1YVJA 5B0XA 3RCJA 3PXFA 5CNNA 2UUEA 1VZOA 5CSVA 3D4QA 5A46A 4YZDA 4ZIMA 3V5WA 2F49A 4W9WA 3LXLA 5EG3A 2HZ4A 5FEDA 5IU2A 4U81A 4PNKA 4JAJA 3QCQA 2F7ZE 2IVVA 3RJCA 5AAEA 4FEXA 2WU7A 3MA3A 3TKUA 3UZTA 5ANJA 1WAKA 3DFCB 4FV1A 4G6NA 2R3PA 4YC3A 2Y4IB 1J3HA 4ANSA 4FEUA 4QO9A 3UPZA 2Y4PA 1WVWA 2X6EA 3FI3A 3NIZA 3GUBA 3R28A 4YJVA 3GC0A 4L44A 5CS6A 5FP5A 5KMKA 4UMPA 1K9AA 4XG4A 4AW1A 2YLEA 3DJ6A 3ACJA 2AC3A 2ZV7A 4MD8E 4MD9E 4O0XA 3DKGA 5DOSA 3SD0A 3RM7A 3JS2A 4RZVA 4FTIA 1YXSA 3FLNC 2BZIB 3ZRMA 2X6DA 3FHRA 4NM0A 4ZY6A 4JDHA 1PXPA 3PXYA 4JXFA 2BALA 2JDVA 4ZZNA 3COMA 3D94A 3AT4A 3HEGA 3OG7A 4U40A 4OAUC 2VWBA 1Q8TA 4IAFA 4PNIA 5HO8A 2O63A 2UVZA 2YIRA 3KMUA 4EORA 1A48A 2BFXA 5EQEA 4EH2A 5L8LA 5IDNA 4YMJA 3WYYA 5CALA 4FV5A 4YTIA 3FZTA 5IQBA 2R3MA 4BZNA 3ORIA 3WZUA 2G9XA 2QOQA 3A61A 4FVQA 2ETKA 4O82A 1G5SA 2ACXA 2YJSA 2EU9A 5ACKA 3GEQA 4L3JA 1V1KA 1NVRA 2RFEA 2YM8A 1KWPA 3HUCA 3K2LA 3LW0A 4DN5A 5CF8A 3G6HA 3PLSA 1KV2A 4AAAA 2OU7A 5CAVA 3OP5A 1PXOA 5AP3A 3FBVA 1XBAA 2O0UA 2JFMA 4CYJA 2VRXA 2GNFA 4DEEA 3QQGA 5E1SA 3VS1A 4YO4A 4Y46A 5HOAA 2C3JA 4D2SA 1JKLA 3I0OA 3VQUA 2C4GA 5AV3A 1BX6A 5CASA 4F0IA 2CCIA 2PU8A 5GJDA 3VRZA 2EUFB 4OGRA 2R2PA 3GC8A 5HD7A 4I6QA 2B55A 3FZSA 1IAJA 2WIPA 3ULIA 3U4WA 3L9MA 3UNZA 2ITOA 4P5QA 2BUJA 1IASA 3EMGA 4ANQA 3LQ5A 4BF2A 3QKMA 4FEQA 3EQFA 3EIDA 3OS3A 3DU8A 4BDGA 4B6LA 2BCJA 3R1QA 4RSSA 2WEIA 1DM2A 1Z57A 4UEUA 2YITA 4CKJA 2RKUA 4IM3A 4FOCA 4QYEA 1ZWSA 3C9WA 3NYVA 4C7TA 4JBOA 3C50A 4WNKA 4UZDA 5AADA 3OW3A 3QGYA 4HCUA 4I0SA 5M4UA 3NAXA 2JC6A 2Z2WA 4M13A 3F5XA 4IE9A 2C6EA 2QOLA 4FKOA 5CSPA 4FOBA 4HCVA 3UG1A 2JIVA 4APCA 4ACDA 2J90A 3CD8A 3NW6A 5C03A 3KVWA 5G1XA 3OD6X 4JNWA 1V0PA 4RGJA 4TYHB 4B8LA 5B7VA 3GB2A 2JAVA 4FNWA 2UW3A 4AW0A 4H1JA 4IMYA 3VS5A 4S32A 4Y72A 3V5QA 2VO6A 3C7QA 5FBOA 1H08A 2XH5A 2J4ZA 2HYYA 4DFYA 2YDIA 4IWOA 4CLJA 4XOYA 2J7TA 5L8KA 2RF9A 4G5JA 3VS6A 4EHVA 3PP0A 1PKGA 4XJ0A 4DFBA 1JLUE 1SVHA 1MRVA 2OF4A 5KBQA 4ANBA 1OIYA 2WOTA 3D7ZA 3MJ1A 1Y91A 4C58A 3TT0A 5IEXA 4QMNA 3MIYA 2G1TA 1PMNA 3ALOA 4XX9A 3UOKA 5ANDA 4BGGA 4EBWA 3DJ5A 3O2MA 3UOHA 4JT3A 2ETRA 3MH2A 5A4TA 4L3PA 4DGGA 3SQQA 1IEPA 3UP7A 3KEXA 4XYFA 5DR6A 4BDDA 4FZFB 3QQUA 4YJPA 5CF6A 3ANRA 5EI2A 5FP6A 5KMMA 3WBLA 5EM5A 1OMWA 5I9YA 3NPCA 4CZTA 2XNMA 3NYNA 5CANA 3ATSA 2YCRA 4LMNA 5CSXA 4V05A 3TKIA 2JAMA 1MQBA 4FV6A 3VS3A 4M7IA 3FKLA 4XG3A 3MSSA 3R7YA 3EQRA 2HENA 1H1SA 3I6WA 2Z8CA 4YPDA 2G15A 4H3PA 1O9UA 1Q3DA 2P55A 2Z7SA 3ZDUA 3C4FA 4K2RA 2QOOA 3PXRA 4EONA 4L3LA 4O21A 3UO4A 3ZFXA 3DAEA 4FVPA 4E6QA 4CQEA 3BPRA 4M3QA 3SRVB 3VVHA 3GXLA 2FSLX 2OJFE 2QLUA 4FTQA 4WSQA 4BDIA 5HVKA 5K9IA 2R9SA 2VTIA 4U0IA 5BMMA 3RP9A 4UALA 5GZAA 3MB7A 3KA0A 4IM2A 5AUYA 3W33A 2ONLC 1JKKA 4PMSA 4ACGA 1PW2A 3GCUA 1OZ1A 5J79A 1J7UA 5CEOA 1W98A 3GU4A 3QTXA 4CV8A 3K54A 4I5HA 2XK8A 4GK4A 4ZTSA 5AUXA 2WMSA 3T9TA 1P4FA 3WARA 3ENMA 4AW2A 4GFMA 4DH5A 3T9IA 3HAVA 3EN4A 4GKHA 3E3PA 4GH2A 4CMOA 3ALNA 2QHMA 4ASZA 2XVDA 2F57A 3GCPA 3SA0A 1V0BA 4AOTA 5AJQA 5EM8A 1BI7A 3WIGA 3DZQA 3H9FA 2X2LA 2UZOA 3O0GA 2VTPA 2XCHA 4L43A 2QC6A 5JT2A 5KX8A 5AA9A 2PUNA 2Z02A 3ROCA 4AP7A 2XCKA 2YHVA 2C0OA 3TWJA 3FUPA 1M7QA 2HZIA 3ZO4A 4GU6A 2VTHA 3O51A 2OXXA 5A14A 2VV9A 2XKFA 2UW4A 1KE6A 3M11A 3O96A 3EL8A 2UZUE 4IAKA 3FLYA 3HMPA 5LCKA 4AUAA 1UNHA 3ORXA 1IRKA 4KRDA 3PE2A 4JLCA 1ZYDA 3HP2A 3P9JA 1XJDA 2FSTX 4FTOA 4XEYA 4BKYA 5CWZA 3FSKA 3R2BA 4FIJA 4BBFA 3MH3A 2FSOX 3QRUA 4ZZOA 2XZSA 5HTIA 4FKRA 1FGIA 5I3RA 5E90A 5HESA 3FHIA 3G51A 4QNYA 5C1QB 2BAQA 3UVRA 3IO7A 3ZBXA 4LGGA 5CAOA 3PPKA 4HZSA 2YIWA 4NIFB 3MY5A 3BE9A 5BUIA 2Y0AA 4OUCA 2JKKA 5AM7A 2BR1A 5TKDA 2XEYA 5LVLA 3ID6C 1OL5A 1M7NA 5EKOA 2E9NA 5D12A 3SVVA 3QYWA 4UBAA 2IZSA 3ORMA 3AGMA 4MXCA 5CT7A 4RBLA 3L9NA 3REPA 3WF6A 3QBNA 4I1ZA 1OKZA 2PE2A 3MVHA 4C02A 1OI9A 4C34A 3D0EA 3TM0A 2WKMA 3BWJA 4HOKA 2FVDA 1NVSA 4RWJA 4FTCA 4ANLA 3OXTA 3PPJA 3SXSA 3OUKA 3NUUA 4U3YA 4EOMA 2UW7A 3Q53A 3B8RA 5KKRC 1Q61A 4XCUA 3Q5IA 3QUPA 4NEUA 4CD0A 4DBNA 4F99A 3NYXA 2W4JA 2OXDA 4LUDA 5A4QA 4U42A 4DGMA 3ZEPA 2J2IB 4WT6A 4BYJA 4MBJA 5AUUA 4GMYA 2XYNA 4UWBA 4BIBA 4KKGA 1REKA 4WUAA 3FMNA 2ERKA 3PSDA 4NIFA 2QVSE 4DEIA 3PVUA 4JRVA 3V8SA 4FIFA 4IANA 4K6ZA 3IPHA 4N6YA 3OCGA 5JFVA 1XH8A 5CT0A 4BCFA 4BY9E 4MNEB 3HP5A 3E93A 4X3FC 2W05A 1SYKA 4E4LA 2I0HA 4BDKA 1NA7A 2PMOX 3P78A 4MCVA 5HE0A 4D2VA 4KB8A 4O0TA 1VJYA 3F66A 3AD5A 3LE6A 2XIZA 2P4IA 4XOZA 5DPVA 4D2WA 1FMKA 1PY5A 3DBEA 4C3RA 1SNUA 5I4NA 4QMPA 3OHTA 2YCQA 3U6JA 2JEDA 2IVTA 4QP8A 5HICA 1LR4A 2XNGA 3BU3A 1WVXA 1JOWB 1QPJA 3E8DA 3P4KA 4O7NA 4N70A 2A2AA 5JKGA 3SLSA 3MFTA 4A4OA 4BCMA 2C1BA 4JG7A 2XM9A 3UE4A 4BTFA 4RT7A 4A9YA 4BDFA 4IEBA 5GZ8A 2Z7LA 2X4FA 3G5DA 2JFLA 4L46A 4TN6A 3GNIB 5HNGA 4I6HA 4LOOA 3OC1A 4IC7A 5ANIA 1Y8GA 2QR8A 4WG4A 4DFZE 4FSWA 3D15A 5B2MA 3HA6A 5JQ8A 5AAFA 4FKLA 4NU1A 4TYJA 3E5AA 4YC8A 4A9SA 2Q0BA 2X0GA 2A0CX 4J71A 2GS6A 4ITHA 4CFXA 5EOBA 4EC8A 1K2PA 3WOWA 2PZYA 3LXKA 2V62A 4FZ6A 2VX1A 4QP3A 3RAKA 4CTCA 4ZMFA 4X6QC 3ZC5A 5L2IA 3DXNA 1WBOA 3BLQA 5EYDA 3QALE 3SDJA 4CFNA 2QOKA 4I94A 4E4XA 3UIXA 3QLFA 4ZTRA 5A3XA 2NRYA 1M14A 4DHFA 2J0MB 5M07A 3PLAE 2OIQA 2GNHA 2QLQA 3BYVA 5GIPE 4ZSJA 2QODA 2UW8A 3FXZA 4L68A 5JEBA 5KHWA 4GFGA 4MAOA 3C4EA 4PL4A 4PY1A 4FV0A 3ODYX 5EHLA 4YZMA 1CM8A 4J52A 3HMIA 4ZTQA 4ZJIA 1BI8A 4AFJA 1W7HA 3NW7A 2PK9A 4XV1A 4K33A 4D4RA 4DH8A 2CGXA 3QFVA 3GOKA 3OOGA 3QRKA 2R0IA 2W1FA 4D9TA 2RFDA 4DFXE 3UMWA 1W8CA 2R3RA 3LCTA 4GT5A 4GRBA 4G31A 3GCQA 4BCKA 3CJFA 4QPSA 1KUTA 2QO2A 3KREA 4ITJA 3A99A 5CLPA 4IHPA 4I22A 4O0UA 5LVPA 4AX8A 3NX8A 2ZB0A 4FVRA 4C35A 3R01A 3U55A 3P7CA 1ZOGA 3F3VA 1PXLA 3TV6A 4EHZA 5AA8A 1Y8YA 3KXHA 3JYAA 3H9OA 2YISA 3BKBA 3POZA 1DAYA 5AP6A 3UYTA 1YWVA 3NNWA 4ZTHA 3W2OA 2B9FA 2VGPA 4IFGA 3PZEA 1WBVA 2C47A 3R2YA 4IB5A 2X8IA 3FJQE 4O0VA 4YC6A 3S2PA 1H01A 4ZAUA 5KMJA 2ITNA 3QAME 5D9HA 3FSFA 3PSBA 3DNEA 4WNMA 5H9BA 2UW6A 3D5VA 3PWDA 2H6DA 4YNEA 4YTHA 4C4JA 3DQXA 2QU5A 1PXIA 2QONA 3A62A 4TT7A 4OTQA 3CPCA 5F20A 1UVRA 1LPUA 2XNOA 5CQWA 2YM6A 2ZJWA 2PE1A 2IO6A 1YHVA 4APPA 4D58A 4O86A 3DCVA 2B9IA 5IMEA 3CXWA 2PUIA 4G34A 4FE2A 5JGAA 5L2WA 3GP0A 3ELJA 4NM3A 3LAUA 4FBXA 5CXHA 1MRUA 3L1SA 5IA1A 2A27A 4FYOA 3I7CA 2JDOA 3L9LA 3DOGA 3EQBA 3W2SA 2C0IA 4ENXA 4FG9A 2E9VA 5AMNA 2I0VA 3BQRA 4A9RA 2C69A 2XKCA 3PIYA 3L8PA 2ZV8A 4Y85A 4YJUA 2CSNA 5IA2A 4BBMA 2W99B 4USFA 4PL3A 4B99A 4ANOA 4LG4A 2BZHB 2EXEA 2R3FA 3ORTA 3E92A 1MRYA 2WQNA 3FWQA 2KULA 3LQ8A 4F9WA 1FMOE 3V5TA 3B2WA 4QTEA 3QTUA 4G6OA 2ZYBA 3A7HA 2QOHA 4IM0A 2UZNA 5DI1A 3DY7A 4I93A 4QTCA 4JVGA 3EN5A 1YWRA 4NFNA 3FMDA 3VWAA 1YHSA 4PMTA 5HX8A 3AC1A 4GG5A 4BDHA 3PY3A 4Z7GA 3BCEA 4FG8A 3ZEWA 4XV3A 4EWQA 5AR2A 4JAIA 5FXQA 2NPQA 1RQQA 3HX4A 4P7EA 3Q04A 4EC9A 4FEVA 3HMOA 4LOQA 2XK4A 4ZJJA 3FYJX 4G2FA 4D1ZA 3IDBA 3CTJA 2C0TA 3P79A 1XR1A 4JDJA 4X0MA 4F6WA 5DWRA 3JVRA 3BELA 4I5MA 4BZOA 3AT3A 2Y8OA 3LZBA 3MTFA 2F9GA 5HEZA 4GEOA 3BBTB 3VO3A 3QWJA 1BYGA 4WNOA 3ZLYA 5HG5A 5JZJA 2PVHA 2VZ6A 3EQDA 4CKRA 3UDBA 3EN6A 2YZLA 1J1CA 4UV0A 4X2NA 5HQ0A 1ZOEA 5LXMA 2C6TA 2XJ1A 4D1SA 1J91A 3MPMA 5BVKA 4C36A 4XG9A 3FL5A 4FICA 4YHFA 2C6KA 2R3OA 4NUSA 3WILA 5CNOA 4BDJA 1NXKA 3FMLA 3LXNA 4JL9A 3R6XA 2EXCX 4RA5A 5K0XA 2A19B 4IJ9A 3T3UA 4Y5QA 2ERZE 4OT6A 3FXWA 3EQGA 2C6IA 4LMUA 3R00A 3TTJA 5I9WA 2PWLA 5FTQA 5D11A 2HY0A 2IVSA 4I5PA 3ZOSA 2GNIA 4EOOA 4E26A 2ZMCA 3VUMA 3CTQA 5CVHA 2VWXA 3K3IA 1A9UA 1URCA 5HCXA 1JSTA 5KKRB 4FX3A 4BCPA 4EH7A 4QMYA 3BYSA 3DNDA 2C5VA 3RHKA 3I6UA 2GTNA 5M44A 2UW0A 3MFRA 3MVMA 3RM6A 5IQGA 3R7EA 3DAKA 3AQVA 3CKWA 4FK3A 4RVTA 4YZNA 4XLVA 3QRIA 5KMLA 3QTZA 2GHLA 4IIRA 2UV2A 4RVMA 5C27A 2IW8A 4EYJA 3KMMA 2CKEA 3NNVA 2FGIA 5BVNA 3FZPA 3FLWA 3CEKA 3MY1A 3FY0A 4XBRA 2B9HA 4XG6A 4X3FB 2PUPA 5LWMA 5CEKA 1YXVA 2OWBA 4O96A 2ZM1A 5JK3A 4U8ZA 3ZONA 3D5WA 1MP8A 2G2HA 3KU2A 4MYGA 3BGZA 1FPUA 1B39A 4ZY4A 4YTCA 3HECA 1O6LA 4WG3A 1G8AA 3RK5A 1UWJA 2VD5A 4JX7A 3MGYA 5AEPA 5M56A 2OIDA 3CLYA 2YCSA 3NNUA 2XK3A 4JOAA 4J1RA 3TIZA 4F09A 1OBDA 2QCSA 4FL2A 1WVYA 5IPJA 5AP2A 3F7WA 3BGPA 1GZOA 4BDBA 3NS9A 1KE8A 4CVAA 4C2WA 4WG5A 4R5YA 2J0KA 4W4XA 4FTRA 3RKBA 4L6QA 5BVEA 5IQEA 2Z7QA 2P33A 3FDNA 4C61A 5KO1A 5H8BA 2ITTA 2VUWA 3OROA 4HZRA 5C8MA 5C26A 3NR9A 3Q60A 4H1MA 4EL9A 4O7TA 5DHJA 4RIXB 2X81A 3GGFA 3KFAA 4JIKA 3R9HA 5C8NA 2W17A 4CFWA 1WBPA 3AC3A 3NEWA 3PUPA 4TNBA 3ZCLA 4J98A 4X3FA 2IZRA 2RSVA 5HHWA 1U46A 4W4WA 3DBDA 4H05A 4PMPA 4ONAA 2VWWA 4PF4A 1YXTA 2V22A 4HCTA 3EHAA 4EK3A 4BZDA 4X2FA 3DGKA 4OT5A 4UZHA 3A7JA 4GYGA 4D28A 4DG0E 5KNJA 2CLXA 4IB1A 4L52A 3C4XA 4MX9A 2DQ7X 5KCVA 4IX4A 4F9YA 2ITXA 3C0GA 2E2BA 3QXPA 3FI8A 3Q3BA 4MBIA 1VYWA 2OIBA 5DA3A 1GY3A 1XO2B 3FI4A 1B38A 4XUFA 4QMQA 4G9RA 2JBPA 3F82A 4U79A 4TY1A 5L2TA 2WMAA 1OL7A 3D5XA 4GJ3A 2NP8A 5BNJA 3DKCA 3E8NA 3F5GA 3KN5A 3NCZA 3E64A 3FKOA 2BTSA 4M14A 1F0QA 3OZ6A 3S95A 3QD4A 4IXPA 3DDQA 4FT0A 4DG2E 3IDPA 1JSUA 5DG5A 1YQJA 4RC2A 2B7AA 4EJNA 5K4JA 4O7WA 2WHBA 5FUTA 2VTMA 4YJNA 4G1WA 2VTSA 1W84A 4MVFA 5LVNA 1YWNA 2W1HA 4HYUA 4PUZA 5HE3A 3TNIA 3EN9A 4B7TA 2JITA 4R7HA 5J7HA 3A7FA 2H96A 2XYUA 2WNTA 4IDVA 3TDVA 2VWIA 4F4PA 3TUBA 3GU8A 4ZJVA 4FYNA 4MQ2A 1R78A 4DINA 3C1XA 4RJ3A 5C01A 4ZK5A 4O7ZA 3NMUF 3VHKA 3F2RA 3U6IA 4F0GA 4FUYA 1BL6A 5AV0A 4QP9A 3VUGA 4LFIA 4O7LA 3MPAA 4CG9A 3HYHA 3VS7A 1R39A 1PYXA 3OTVA 4BWXA 4U97A 4WHZA 4MXXA 4NH1A 4USEA 4H39A 3R73A 4MKCA 4R3RA 5HLNA 3G90X 4UY9A 3V6SA 3DDPA 2VO0A 3R8PA 1ZZLA 1ZYLA 3JR1A 4C57A 4GIIA 4UMQA 3VBXA 1FVTA 2WO6A 2JGZA 2A4LA 1OL1A 2O2UA 2VTLA 4IX6A 4USDA 5EYMA 3RNYA 2F4JA 4CT1A 3PIZA 3EKNA 4GV1A 3W2CA 3H0ZA 3Q6UA 2Q0NA 3W10A 5LQFA 1Q4LA 3SHEA 4RJ6A 3MH1A 2B52A 4GK3A 4YNOA 3DFAA 3FPMA 5B2LA 3NAYA 5FG8A 3R9DA 3GCSA 2B1PA 3ZTXA 3BHHA 3FYKX 1YRPA 2OICA 1KSWA 4EHGA 4D4SA 3EQPA 4FKGA 2WB8A 4Y5HA 4F7SA 4M67A 3PVGA 4IWDA 4D9UA 2GQGA 3PXQA 5AFVA 3OBGA 4I24A 4UMUA 3KCFA 1NW1A 4OTHA 1ND4A 4KIQA 1JQHA 2O3PA 2OLCA 3ULZA 3N4UA 2RIOA 2GFCA 2J51A 3TZ7A 3FMMA 5AV4A 3ORPA 3Q4UA 4FIGA 2BIYA 2HOGA 4FV3A 3ZH8A 2JIUA 3HKOA 2VWZA 3LFBA 3DBQA 3QD2B 5EDQA 2UZTA 3OEFX 4FIHA 4BGQA 4FK6A 2YLFA 3UQGA 4YSMA 4K18A 1S9JA 2XMYA 5IQFA 3WF5A 5JFXA 4I3ZA 4E4NA 5FBNC 1CKIA 2ZOQA 3DK7A 3EB0A 1UKHA 2OH0E 2LAVA 2QO7A 4TPTA 3F69A 2QG7A 4C3PA 1JNKA 5KHXA 2JD5A 3KULB 4PDYA 4EOJA 1XH9A 3PA5A 5KMNA 3UNKA 3GU7A 3VQHA 4AT4A 1PMEA 4NM5A 3RZBA 3H0YA 1Y6AA 4RG0A 3VULA 1H1RA 4F6SA 3TDWA 3CQEA 2P2IA 2BDWA 3ZZEA 4LL0A 5I9ZA 4YJRA 4FG7A 5CZIA 4ASXA 2QOCA 2VTAA 3NVMB 5IUGA 1ZYSA 2HW6A 4BWPA 4D4YA 3TTIA 4IVDA 5JMSA 4MTAA 5M4CA 1OGUA 4X2JA 2X7OA 4AGDA 3ANQA 3HGKA 3OBJA 5HORA 1PHKA 4TZRA 4RFMA 3ZFMA 4GCJA 3WZKA 3QL8A 1JWHA 3KC3A 2UZDA 5HLWA 2R3LA 3Q9ZA 4FKIA 1PXJA 2G2IA 3UGCA 4PP7A 5JN2A 1QPEA 3CR0A 3BHVA 4QRCA 5J87A 4X7QA 2Q83A 4R3PA 3OUNB 2R3IA 4GU9A 3MPTA 5TR6A 4YZBA 2XM8A 3IW4A 4E1ZA 2CKQA 3RI1A 3TNPC 3EYHA 5HVYA 3KULA 4K1BA 3W2QA 5HE2A 3ZZWA 2EB2A 3VUKA 1OKWA 3HRCA 5AX9A 3VW6A 1SVGA 4PDOA 4CNHA 2FH9A 3KY2A 4WNPA 2H9VA 3WZEA 4O6LA 4G3CA 4IWPA 4ZSGA 2QR7A 5AV2A 4R77A 5JRSA 3FQEA 4DLIA 5HU3A 4F9AA 5FEQA 5AWMA 2OH4A 4I6BA 2FUMA 4FF8A 4YLLA 3GT8A 5K0KA 1GAGA 4RWIA 4IVBA 4RC3A 5JRQA 5CU6A 1KE7A 2HY81 3DTCA 5HCZA 3COIA 4PTCA 4QPAA 3ZUTA 5BUJA 3S4QA 2PY3A 2XNPA 4XG7A 4XRJA 1DAWA 1PMUA 3SXFA 5D1JA 5GZ9A 2HZNA 3BLHA 3H30A 4GFOA 3DB8A 4O7RA 4D2RA 4QMOA 5IUHA 3U54A 2OFVA 3HDMA 5L8JA 2OKRA 3O17A 2PVYA 1UKIA 1M52A 2HWOA 4M8TA 2EVAA 1BKXA 3KK8A 1VYZA 3DV3A 1UV5A 2CGUA 3JVSA 4MF1A 3SW7A 3Q9WA 4X21A 3U9CA 4DH3A 2QNJA 3LFDA 4TYGA 1U4DA 5HG9A 3RWPA 4QP2A 5EDPA 3RAWA 4N6ZA 4EOQA 2H34A 3MDYA 3O50A 4O0SA 5E8SA 4D5KA 1Q8WA 3BRBA 5HIEA 1PF8A 2R3KA 4FA2A 5BX0A 2ZV2A 3C13A 4QP1A 5CX9A 5GJFA 3IGGA 4QMXA 1KE5A 2WTJA 1UU7A 4JS8A 4EUUA 4AN9A 3NZ0A 4IFCA 4ALVA 4F9CA 3CGFA 3DBFA 1XWSA 2C3LA 3NNXA 3ERKA 1IAHA 4I4FA 4FNZA 4QYFA 4IW0A 3HMMA 2GQRA 1K3AA 3FEGA 4O22A 4KNBA 4QMUA 3FC2A 1KV1A 4FKPA 5L2QA 1APME 5ETIA 3MJ2A 5E8XA 4BICA 4HGLA 4WRSA 3HLLA 3E87A 3IW5A 4PMMA 3OW4A 4YLKA 4BC6A 4HJOA 2C3IB 3GENA 4PPBA 3K5UA 2WZJA 3V51A 5GIOE 4ZTLA 2R3JA 3GVUA 4UXQA 3FLSA 2C68A 3NW5A 3ZYAA 4JI9A 1OPJA 3VNTA 3K3JA 3R63A 4BYIA 3U9NA 4FR4A 3W2PA 4DT9A 3PA4A 4AN3A 4DTAA 5E91A 4M68A 1H26A 4KSPA 4WA9A 2GNLA 5HCYA 2CN5A 2VTJA 3PY0A 3UZPA 4KS7A 4MWIA 3QX2A 1WBNA 4IX5A 1PXNA 4LRMA 4ASDA 4E8AA 2HIWA 2F2UA 3KQ7A 4CRSA 4CCBA 2C30A 2XS0A 5DT3A 2O64A 4BCGA 3P1AA 4FC0A 4ZXTA 3RMFA 4U41A 1JAMA 4AF3A 3V5PA 3CY2A 2PYWA 2XP2A 3FMHA 4QPMA 4O7YA 3COKA 3P23A 4G9CA 3LPBA 2BMCA 2UZBA 3Q9YA 5D7VA 2ITZA 3NUXA 3UO6A 2B54A 3PDTA 4F7JA 4MHAA 5GJGA 4FUXA 3QCXA 2CJMA 3RNIA 2J50A 5AR8A 3TUCA 5M09A 4PDSA 2W4OA 4QQJA 2F2CB 3V01A 5JZNA 4ZLZA 2QOIA 5EW8A 4O0WA 3FY2A 5EOLA 3PJCA 2R3GA 2R5TA 4Q2AA 5EW9A 2JKOA 5AX3A 2QQ7A 2UW5A 3ODZX 3VUDA 1YDRE 4DFLA 2OO8X 1T45A 1W82A 3FLZA 4TWPA 4QYYA 4EZ7A 2R7BA 3SG9A 2BRMA 4YZCA 3E7VA 1R0PA 3MIAA 3PSCA 4F7LA 4LQMA 2BRNA 2UVXA 3Q32A 5HG8A 3R8ZA 4JG8A 3TJCA 3WZDA 5GHVA 4GVJA 3NYOA 2GFSA 1BLXA 1H0WA 4DEGA 3ENHA 1F3MC 5DEYA 3AD6A 1GIIA 2PMNX 1OUKA 2BHHA 4MBLA 4S30A 5AP0A 3BIZA 1ZYCA 3QCSA 4MXOA 2YN8A 3DXQA 2GDOA 3II5A 4FKSA 3VUTA 4WSYA 3WI6A 3ZXZA 3R9RA 3I0QA 4J8NA 4EJ7A 4PQNA 4O38A 2ETMA 5LVOA 4BI2A 3TACA 3U4UA 4N0SA 3VS2A 1ZOHA 4XH6A 2RFSA 2X2MA 3UIMA 4DITA 3AC8A 3G9NA 4RJ5A 4CXAA 2WIHA 2R7IA 1XKKA 2BRBA 4FGRA 4D2TA 1TQIA 1XQZA 3FXXA 4YP8A 3SXRA 5BVFA 5M53A 1ZARA 4I23A 2PULA 5M06A 3NRMA 1YHWA 1YDTE 4NZWB 1QCFA 3OXIA 1Q24A 3KN6A 3SX9A 3OXZA 4EK5A 2F7XE 3BYUA 3Q96A 3QA8A 4UB7A 3ZSIA 4X3JA 5CY3A 1YOLA 1OB3A 2HZ0A 5E8YA 2A1AB 4JBVA 3R0TA 4EOPA 4B9DA 4O7SA 5FDXA 2FYSA 3F2AA 3RPVA 5ANGA 2OJ9A 4NW6A 1VR2A 3QTIA 2XRWA 3RWQA 1FGKA 1NY3A 2VAGA 1V0OA 4ZTNA 1AGWA 5M51A 3VF9A 1F5QA 4C37A 2PZ5A 1LUFA 2PVFA 2WMWA 2ZM4A 3IKAA 3OEZA 5AUVA 4JJRA 4KKHA 4ZS4A 2YM4A 3TV7A 4E6AA 4ZLOA 3AC2A 5KBRA 4P5ZA 2YJRA 5EKNA 3HV3A 2IPXA 2VO3A 4ITIA 3A8WA 4JBQA 3AC4A 2WMQA 2Z7RA 1WBTA 4ZSEA 2YAKA 5L2SA 2HAKA 4M97A 1L3RE 5CF5A 3O7LD 1H24A 3EFJA 3FZRA 5CTPA 3R02A 2B9JA 4UYNA 4UWYA 1UU8A 3Q6WA 3UIUA 2PPQA 4JQ8A 2XK9A 3SC1A 2YFXA 1AQ1A 4CLIA 4FSRA 4ZSLA 3ZUUA 3LFEA 5DRDA 5FTOA 3F3ZA 4RMZA 3P08A 1YOJA 2WQOA 3HRFA 2QU6A 3AT2A 3UC4A 4FKJA 4GG7A 5G6VA 4RA4A 3BU5A 4AZFA 2XB7A 4HGSA 1M2RA 1Q8ZA 3ACKA 3ZUVA 3AG9A 3R21A 3GQLA 4AACA 2VX0A 2I40A 3ZFYA 3DKOA 3Q4ZA 3U8WA 3UO5A 3PA3A 4EZ3A 3QD0A 4C4GA 1P5EA 2AUHA 4G3FA 4KBKA 4W4VA 5M55A 4CFUA 5KUPA 3DBCA 3JPVA 3KF4A 4CT2A 1H25A 4BN1A 4UMTA 2YM7A 5AR4A 4EZ5A 4NT4A 1FOTA 2JKMA 5EI6A 3OWJA 5IG1A 2UZWE 4TXCA 4ARKA 3CGOA 3KXZA 4RWKA 3PRIA 5IQHA 4RIYA 4K77A 4E20A 4M69A 3ZHPC 3DLSA 2J0JA 3SV0A 5JGBA 1WMKA 3V8WA 3LCSA 3NCGA 3N4TA 3PE1A 5FXSA 5CVGA 4MXYA 3KXGA 4XS2A 4RX5A 4QT1A 4V04A 3OT8A 4GT4A 5AP5A 3O7LB 2WMUA 3OY1A 2IW6A 2C6DA 3A8XA 3G6GA 4ZS0A 3RPSA 3QKKA 4Z7HA 4DCAA 3RPRA 3U87A 4BDCA 3QRTA 2ZM3A 4G3GA 2JLDA 4I21A 3GFWA 4FTLA 4GIHA 4YJTA 2ITUA 5C4KA 4IJPA 4CYIA 4WRGA 4YBJA 3CTHA 3I5ZA 4OW8A 4Q5HA 4ASEA 2WMRA 3GOPA 3BGQA 4MQ1A 4RQVA 1I09A 4AZSA 3BYMA 4TW9A 2DS1A 3LOKA 3EZRA 4NCTC 4U3ZA 5FEEA 2PVRA 4GW8A 3ZDIA 3PXZA 4L45A 5TO8A 3P86A 3EN7A 4XP3A 4BCIA 3MW1A 5CU0A 3W55A 2LGCA 3VF8A 2XNEA 2FB8A 3DA6A 3O23A 2C3KA 3QZIA 4H3QA 4JG6A 4XHKB 4HVDA 3C0IA 4CZUA 4LL5A 4EKKA 5L3AA 1T46A 5J95A 1H1PA 3ZXTA 4TNDA 4W8EA 2ZV9A 4A07A 2HELA 4QTAA 5A4LA 2BVAA 3P5KA 3GCVA 4F6UA 1UNGA 2HWPA 5DGZA 1CKPA 2W1IA 3D14A 3POOA 3BLRA 1DS5A 3QQKA 3QQLA 2OBJA 2YDJA 4PX6A 3D2IA 4AWIA 4OAVB 1OL2A 1P14A 1R1WA 2I7QA 3ORKA 3LVPA 5JGDA 4E7WA 4E3CA 2BPMA 2J5FA 3H4JA 3PFQA 4LOPA 3LXPA 3WF8A 4DC2A 3QTQA 3R8MA 1FQ1B 3SOAA 2WELA 3HDNA 4FSNA 5AP1A 5LMBA 3PJ2A 3IG7A 4IAZA 4EH4A 2GQSA 2YAAA 3GC9A 3OTUA 1U5RA 4BHNA 4BTKA 4BIDA 3F7ZA 3WE8A 4KA3A 4BKJA 4QP7A 4C4EA 1ZRZA 2OJGA 3ZO3A 3CD3A 1OKVA 2WQEA 4CZYB 4L7SA 1OPLA 4JX3A 3I60A 2C6MA 4ZP5A 5H8EA 2HXLA 3ZMMA 4RWLA 4YUQA 4QMWA 3W18A 3I5NA 3DKFA 4HVSA 4FI1A 4IZYA 4FSUA 4GKIA 3P7BA 3OWLA 3ZLXA 4JR3A 4BTJA 3KL8A 4EH5A 1H07A 1YDSE 1NVQA 1Q3WA 4QQTA 5BMSA 1IG1A 4JRNA 1PRYA 3CY3A 3PG3A 5CENA 3EOCA 3R9OA 3WE4A 3BBWA 3VBVA 4EQMA 3ZSGA 2QG5A 4OBQA 4IH8A 4JDIA 4DGOA 3W32A 5JFSA 3NLBA 3G0FA 5BUEA 4XLIA 2OZOA 3JY0A 3N4VA 3OF0A 2VTTA 4KKEA 3UG2A 4IVAA 4KUJA 2VTRA 2IG7A 2Y6OA 4IAIA 1H8FA 4O2PA 2J0IA 5J5SA 3RBWA 4CFFA 3T8OA 3C51A 1G3NA 4XMOA 4WOVA 3VC4A 2B0QA 3AOXA 3EJ1A 3QTSA 4J8MA 3VN9A 4DEBA 4ACHA 5A9UA 5J1VA 3BEAA 1M2PA 4BTMA 5HG7A 3HZTA 4FGBA 1U54A 4UMRA 4MXZA 3JUHA 4DLJA 4NYEA 3QUEA 3BE2A 3EKKA 3LLTA 4Z9LA 5HTBA 2YZAA 4IZ5A 4Q9SA 4YJOA 2BKZA 3I1AA 2OXYA 3RGFA 4S2ZA 3PPZA 1JSVA 5AP4A 3NUAA 4FTAA 3EFKA 2FSMX 2C6LA 1BMKA 4YGAA 4XP0A 5FRIA 5HX6A 1LEZA 3KRWA 5E92A 2CKOA 3FMJA 4O7VA
chains in the Genus database with same CATH superfamily
3FMKA 2JKQA 3ORNA 4H36A 5LOHA 3F9NA 5CYIA 2XBAA 4M66A 5TOZA 3TZ8A 2ZDTA 5EI8A 2WTDA 4RLKA 3RK9A 3UYSA 4TWCA 5I9VA 5IQCA 4O0YA 3UODA 3SGCA 2CGVA 2R3HA 3NVKI 4O2ZA 4Y83A 3MN3A 4JIAA 5EFQA 4AZEA 3DQWA 4EOKA 4FT7A 4HNIA 3I4BA 3QZGA 4O4FA 4RX7A 4YU2A 3R7VA 3CBLA 3CCNA 3NUNA 2PVLA 3KRLA 2ITQA 3RAHA 4G3DA 4EOIA 2VU3A 2VTQA 2UZLA 2X1NA 4GYIA 4NJDA 3FQSA 2YDKA 4AOJA 2EWAA 3R83A 3ZM4A 4BCHA 5IH6A 5DE2A 5EW3A 4R1YA 5IISA 1BL7A 4LGHA 3V3VA 3G15A 4FL1A 4WUNA 4DGNA 3IS5A 4C62A 3G2FA 4E6CA 2IWIA 2VX3A 3F3TA 3IW6A 4A4XA 3KB7A 4FT3A 5L6PA 5AV1A 4AU8A 4KS8A 3FMEA 4I92A 3TI1A 4LV8A 4BIEA 4DH1A 4QDEA 5HE1A 4FTKA 4S33A 4O0RA 3CS9A 5GNKA 2OFUA 3VBQA 2CN8A 4OR5A 3IW8A 1H00A 4QMMA 4F65A 3LFSA 5DH3A 4I41A 1PMVA 3LJ2A 3VUHA 1RE8A 3AGLA 4EOLA 4ZMEA 3T3VA 1PKDA 4DCEA 4DYMA 2X8DA 2W1ZA 4AT3A 4MWHA 1MQ4A 3PY1A 5ETCA 2OI4X 5BPYA 4C33A 3E3BX 4BCNA 1PYEA 5FGKA 5H8GA 3FL4A 5FWKK 4ALWA 4XBUA 1M2QA 5F95A 4P2KA 1IA8A 5IEYA 5E1EA 3DK3A 4L67A 3EFLA 4RJ4A 3TXOA 4RRVA 3AMBA 4FV2A 4NJ3A 3Q5ZA 4YTFA 1SM2A 3RVGA 2OJIA 5AUZA 4D55A 1S9IA 3KRJA 3HV7A 3BU6A 3VJOA 3ZM9A 1P2AA 2PVNA 4WBBB 2ITYA 2PMIA 5BVWA 3UTOA 5CZHA 1UU9A 3SKCA 5HVJA 1CMKE 3I81A 1X8BA 3TNQB 5FQDC 4P90A 2P3GX 5ICPA 4N57A 4QMVA 2JDSA 4FIIA 1Z5MA 3LJ1A 2Z60A 4XRLA 5E4HA 2BZKB 2WTKC 5IA4A 2XF0A 4FTNA 3TZ9A 1VEBA 4ZSAA 2J0LA 4FMQA 4QTDA 2W5HA 4EH9A 4AGUA 4EUTA 5A54A 4BFMA 5IQAA 4BBEA 5C8KA 1HCKA 2GMXA 4HVIA 2UW9A 3H10A 5CSHA 4L01A 3AXWA 3R7IA 4FKQA 1H0VA 1KOBA 3E62A 1WZYA 2BIKB 1GNGA 3LCOA 1H27A 3BV2A 3FQHA 4R7BA 2XIXA 4EH3A 2WEVA 4QP4A 3QX4A 3UDZA 4KIPA 4AA4A 5IQDA 1R3CA 5AR3A 4EWHA 1YI4A 3MVLA 4TRLA 4R78A 2Y9QA 3O71A 3QZFA 1XHAA 4Q5EA 1URWA 2W06A 3ETAA 2W0JA 3HNGA 4AS0A 1JPAA 2QKRA 3OT3A 4C38A 1TFFA 5E9EA 2J6MA 1XBCA 5ETFA 2E9OA 4QYHA 3C4ZA 4X2KA 3QQFA 4YURA 5CAQA 5I9XA 1Q41A 4FV4A 3M1SA 4CFVA 1J7IA 3PRFA 3V8TA 4E4MA 4YSJA 5I0BA 3LFQA 4N4SA 1O6YA 4CV9A 1G8SA 3JXWA 4FKVA 4EOSA 5EQYA 4TYEA 2G01A 2V7AA 1J7LA 2X7GA 1O6KA 2G2FA 2SRCA 1OM1A 4GT3A 3TUDA 3LFNA 4C4FA 4S31A 3QRJA 4MK0A 2C5OA 1E1XA 1ZMUA 2AQXA 2CCHA 2DWBA 2C6OA 4OBPA 2IF8A 2ZAZA 4ZOGA 5IUIA 1UA2A 3OVVA 4W9XA 4G5PA 2BROA 5TT7A 4FODA 2NRUA 5JSMA 5IQIA 5EHYA 1BUHA 3KK9A 2WTIA 4KAOA 4KSQA 4AXAA 4NCTA 5EK7A 3OOMA 2PZIA 4JDKA 4RJ8A 5JQ5A 3CQWA 3MH0A 4HPUE 3DJ7A 2PVJA 4DT8A 1GIHA 2BILB 1FVRA 3KXMA 5AAGA 1XMMA 3NUSA 2FO0A 5M4FA 3PVWA 4JQ7A 1OBGA 3UVQA 5J7BA 3GI3A 5L4QA 4DDIA 1TQMA 3DZOA 3F3UA 3SAYA 4A06A 5HO6A 3TJDA 4F1TA 4ERKA 5C4LA 3L8XA 3QC4A 2YEXA 4NSTA 1OKYA 3ATTA 3R8VA 2XIYA 3LCDA 3QTRA 2CHLA 2BDJA 4UN0C 1UWHA 1FINA 1OL6A 2WTCA 1GJOA 3LIJA 3EQHA 4L53A 3HV6A 4TWNA 1J1BA 3F61A 3O8TA 2WAJA 3D7TB 3R04A 4EBVA 4C0TA 4BHZA 4PTGA 4R1VA 3GC7A 4CCUA 5FM2A 4OLIA 3WIKA 3ZSHA 4E73A 4WO5A 5BYLA 4QMLA 4LM5A 1ZY5A 2BAKA 2CLQA 2E9UA 2DUVA 3LFCA 4I20A 4ACMA 2O65A 3WYXA 2OJJA 3B2TA 3C5IA 3QD3A 3FAAA 3PJ1A 4OTRA 3IW7A 5E8UA 3EYGA 2VTNA 5K3YA 4QQCA 3SW4A 3C0HA 3MA6A 1ATPE 2IJMA 2ZB1A 3FE3A 3DLZA 5EM7A 5LMKC 1QPCA 3D9VA 5F94A 2YERA 3ROYA 3Q2JA 3ORLA 3NGAA 3LFAA 3OWKA 3F2NA 5M08A 4L9IA 2WD1A 2YACA 1CTPE 1H1WA 2VNWA 2VGOA 4AFEA 4FV7A 3HV4A 3TL8A 3U6HA 4LUEA 1HCLA 5FD2A 3Q4CA 2IZTA 4MNFA 1SMHA 4J53A 3D7TA 4RIOA 4ZY5A 3BI6A 2BDFA 4CG8A 2FA2A 4OTPA 5CQUA 4A9TA 5DT4A 4EK8A 2W96B 3R22A 4AE6A 2YWVA 4IZ7A 2XIRA 3IOPA 5DT0A 4O84A 3CPBA 4ENYA 3QCYA 4RPVA 5BVOA 3LM5A 5DEWA 2W5AA 5DN3A 2R64A 4IACA 3V5JA 4UX9A 2WFYA 5CEMA 3R9NA 4B8MA 2QOBA 1FVVA 3KVXA 4UWCA 3WF9A 2CNVA 3KKVA 5AP7A 1QMZA 2B4SB 2GCDA 2QI8A 3BWFA 4DF3A 2JDRA 5IF1A 5CF4A 4B0GA 5BQ0A 1ZY4A 2UZEA 3ZO1A 1Q8YA 2CMWA 1TVOA 4J99A 4PPAA 4TYHA 4CMTA 2O5KA 2PZRA 4O81A 4MH7A 3CIKA 2V5QA 1OVEA 2PVMA 1G8KA 3LM0A 4BCQA 4A4LA 3LHJA 3TIYA 5LJJA 4Z3VA 4LRKA 2R4BA 3MVJA 1AD5A 4G16A 5J5TA 2OG8A 4ACCA 5B2KA 4ANNA 3OMVA 4FT5A 4AE9A 4KBCA 4DTBA 5M57A 3QA0A 3D83A 4FL3A 3SG8A 2X8EA 3VJNA 4I5CA 2W1CA 4MXAA 5BYYA 1WBWA 4PDPA 5CSWA 4BI0A 1YXXA 3UPXA 1W2FA 4QTBA 4RFZA 4AN2A 2BKKA 3BZ3A 3P0MA 5T3QA 4J96A 3VS0A 4WBOA 4RFYA 3KRRA 4NK9A 5DIAA 1XH7A 4BI1A 4C3FA 4AG8A 4MF0A 2CKPA 3R1NA 4R5SA 4PRJA 4ALUA 1GIJA 2DYLA 4GUBA 4OTFA 4FSMA 5DR2A 1UU3A 1SNXA 5CAUA 3QHRA 3G33A 4E93A 4EH6A 5KZ0A 4E5AX 4CGAA 4JQEA 5I9UA 5AR5A 3ZO2A 2X39A 3PVBA 4PPCA 5E8WA 2GNJA 2XEZA 5TF9A 1B6CB 4NTTA 3ZS5A 4ANMA 4LV7A 4HPTE 4C4HA 2NO3A 1H28A 3PZHA 3VIDA 4PTEA 4EQCA 2V0DA 4EYMA 4QOXA 3HAMA 4D0WA 5HI2A 2YA9A 4HVHA 3D2KA 2QKWB 4RZWA 4EHEA 4NTSA 3L8VA 2WTKB 5M4IA 5JFWA 4V01A 3TV4A 4FV9A 4DEAA 4D1XA 2EB3A 2ITVA 2CGWA 5CU2A 1CSNA 5HLPA 3A4OX 3SRVA 5J1WA 3E8CA 4IC8A 1YI3A 3AC5A 4XG2A 5HBEA 2PHKA 2IW9A 3S3IA 4CRLA 2VNYA 1PXKA 1EH4A 2IEWA 4D4VA 5KZIA 3PWYA 4IB0A 4QNAA 4BB4A 3I7BA 4FKWA 4O91A 4AW5A 2REIA 3BHTA 4IADA 5CU4A 3N51A 4DH7A 2XKEA 3C4WA 4NFMA 5F4NA 3W16A 3A2CA 3VUIA 4GJ2A 4H3BA 3NSZA 4L42A 3VW8A 2ZFYA 5ITAA 1OGYA 5LCJA 4AZTA 3OFMA 4K0YA 2QHNA 2WMVA 4DEHA 1YW2A 4CQGA 4AGWA 4ERWA 4U45A 2W9ZB 4DA5A 1Q97A 4IB3A 2HXQA 4X2GA 3FZOA 4F08A 3MESA 3DK6A 5L6WL 1KOAA 4DGLC 2RG6A 3O8PA 1JBPE 4BCOA 4NW5A 3SOCA 3EQCA 4QP6A 3MFSA 3THBA 2W4KA 1TQPA 3QKLA 5F1ZA 1GZKA 1OITA 5EDRA 3LFFA 5JH6A 3VHEA 3U51A 1ZMVA 3PXKA 4KD1A 3UJGA 4R8QA 3UIBA 4BDEA 4E6DA 5H2UA 3HA8A 5AIRA 3VAPA 5HBJA 2ZDUA 5IMXA 1LP4A 3A60A 4WD5A 4C4IA 5CI6A 2OW3A 5CEQA 3BX5A 4OTIA 2UVYA 4FNYA 2QD9A 3MYGA 2CDZA 3MB6A 3FLQA 3M42A 4GK2A 1Z9XA 3OCBA 4DAWA 3LQ3A 3VBTA 4I0RA 3Q2MA 4O83A 4IX3A 2GPHA 3TKHA 5AUWA 3EZVA 3V5LA 3B8QA 2C5XA 2WOUA 4FSQA 3RPOA 5IDPA 2RFNA 4FTMA 3BHUA 3UC3A 3UZRA 2PZPA 2RGPA 2VWUA 1HOWA 5LMAA 3JY9A 3ET7A 4WIHA 2IVUA 5DNRA 4WKQA 1YOMA 3RHXA 4ID7A 4I4EA 4K9YA 4TTHB 4RQKA 5J8IA 4OTWA 4PL5A 3PG1A 5KMIA 4M12A 4EH8A 4V0GB 4XG8A 2HK5A 3S1HA 3QYZA 5HNIX 5HBHA 4KABA 4II5A 4ORKA 3W1FA 4BRXA 3E8EA 2C5YA 3M2WA 2B53A 4RIWB 4S34A 4TKSA 1XBBA 4EKLA 3LMHA 4TL0A 3CKXA 2P0CA 3NIEA 4YHTA 2PUUA 4C59A 3ZLSA 3H9RA 3BQCA 3P7AA 4RIYB 5EHOA 5CXZA 4K11A 3C4CA 2V55A 4M15A 3FPQA 1OPKA 1ST0A 3NUPA 4RC4A 2AYPA 5DBXA 3R7UA 1WBSA 3FC1X 5CVFA 3GFEA 5IA5A 4FTTA 1Q99A 3CJGA 4MNEA 4UXLA 2WQMA 3N9XA 3ZRKA 2C1AA 2YIQA 4LI5A 3MFUA 4L00A 4M69B 2ZVAA 4AT5A 2CNUA 4QQ5A 2VWVA 3I79A 4Y8DA 1SVEA 4U80A 3LLAA 1ZLTA 1JKSA 3VBYA 4PV0A 3LMIA 3W8QA 2X0OA 2GS2A 4V0GA 5EYCA 4Z16A 1KE9A 4YO6A 3RTPA 3COHA 1U59A 3MY0A 2I0YA 5DVRA 3CE3A 1DI9A 4C8BA 5F9EA 4I0TA 4NL0A 3QLGA 3EWHA 3FV8A 4RIWA 4FSZA 3RPYA 2OK1A 4MD7E 4O6EA 3EFWA 4A9UA 1RW8A 3MI9A 3R71A 4Y73A 4OTGA 2YCFA 3EL7A 4QD6A 3VS4A 4KIOA 5A6OA 5H3QA 4HYSA 4CEGA 2PTKA 2BHEA 3DXPA 3QQHA 2QOFA 5LARA 2Y6MA 5FXRA 2XK7A 3ZU7A 3UVPA 4P4CA 5IKWA 4FIEA 5EQPA 3BV3A 2WPAA 3E63A 3VRYA 3PJ8A 3W2RA 1OECA 2XK6A 4FKUA 4TYIA 5DR9A 5E8TA 3IOKA 3TCPA 5E8VA 4KBAA 4OBOA 4DBXA 4LRJA 4QMZA 3Q52A 4G6LA 4AA0A 1ST4A 1ZMWA 4NKSA 3BHYA 3ORZA 3UOJA 2BTRA 3LCKA 3PYYA 3HUBA 3V04A 3A7IA 4U5JA 4R6VA 5LMKA 4UYAA 4U7ZA 1UNLA 2VWYA 5FLFA 4XP2A 4AZVA 5CU3A 1OIQA 5HGIA 3EH9A 3QC9A 2Y4IC 2CNQA 3OY3A 3CQUA 1W0XC 2VO7A 2ZMDA 5J9YA 4YZ9A 4HYIA 4KIKB 4HYHA 4BGHA 3QXOA 3GU6A 1ZAOA 2XA4A 4JBPA 4FZ7A 5E8ZA 3PP1A 5ETAA 4U44A 1QL6A 4DG3E 2XKDA 3D5UA 1GZNA 4F0FA 3ZC6A 2AC5A 2P2HA 2BRGA 2WXVA 3H3CA 4IAAA 5FTGA 3W8LA 4BCJA 3F6XA 5T68A 2ESMA 4R3CA 5LWNA 2EXMA 2PE0A 1W83A 2J5EA 4FEWA 2WMXA 4MEDA 4F70A 4EI4A 4PP9A 5DFPA 5HIBA 3DT1A 2C5NA 4F9BA 3TNHA 4HGTA 2QO9A 3MTLA 3IQ7A 2R3QA 4I6FA 4RLLA 5EYKA 4BDAA 2WGJA 4C2VA 4H58A 3TNWA 3TYKA 1STCE 5D41A 5ACBC 3L8SA 5J9LA 1OIUA 1QPDA 2PMLX 4F1OA 2Y7JA 2IN6A 1WCCA 3R8LA 2F7EE 5C9CA 3TEIA 3TN8A 4KWPA 5L6OA 1RJBA 4IVCA 4KIKA 5I5ZA 4GUEA 4BL1A 2WTWA 4FKTA 4O4CA 4AA5A 4HVGA 4YJQA 5IA0A 3AKKA 1CKJA 3GBZA 3QQJA 3O5AA 5T6KA 3QGWA 3G9LX 4HNFA 3FZ1A 3FKNA 5KE0A 5K5NA 4QYGA 3KXNA 5ANKA 3S0OA 4IBMA 4BR3A 1PXMA 4YJSA 1U54B 2OZAB 3UOLA 2OGVA 2BRHA 5TE0A 1YKRA 3UBDA 4PWNA 4J97A 4IZAA 5KMOA 2QURA 2O8YA 4L8MA 5HU9A 2VN9A 4RVKA 4U6RA 3AMYA 3KRXA 3RINA 3UQCA 3R30A 3G0EA 3NDMA 5HIDA 4O27B 1GOLA 2IZUA 4ZEGA 2X9EA 3BEGA 1TKIA 1XH4A 5J9ZA 3CSVA 5IH4A 3RALA 2ONLA 4HGEA 3KF7A 1NT2A 2E9PA 3AD4A 4F7NA 1R0EA 3C5UA 4LV5A 2X2KA 2YIYA 5FM3A 3IECA 3ITZA 3A4PA 3ZBFA 1ZXEA 5CI7A 4EK6A 1YXUA 2OSCA 4J95A 4FTJA 1GZ8A 3GQIA 2R3NA 4DFNA 4DE4A 4CMUA 4IDTA 4NM7A 4B4LA 3HMNA 3MS9A 4D5HA 1Q5KA 3RCDA 4KRCA 4G3EA 2H8HA 4KINA 4U9AA 5AR7A 4EEVA 5A4EA 4IWQA 5ANOA 2HW7A 4JR7A 1E9HA 5IH5A 2X7FA 3WF7A 4CSVA 1E1VA 2YM3A 5DRBA 5IA3A 1ZYJA 2OZAA 1WFCA 2WMBA 4A7CA 2XIKA 5CAPA 2YM5A 3QWKA 2XJ0A 2J9MA 2GHMA 3WZJA 4AOIA 4ZLYA 2ITWA 3QHWA 4GVAA 3DPKA 3F5UA 1H1QA 5AM6A 4FT9A 4F78A 3IDCA 3ML1A 4EQUA 3O8UA 2W1GA 3HV5A 3QZHA 2X9FA 1JKTA 2GSFA 4CFMA 4E5WA 4F1MA 1JVPP 2RL5A 4G17A 1A06A 5HD4A 1I44A 2UZVA 4FZDB 1XH6A 4Y95A 2W7XA 4YR8A 2XNBA 3EQIA 2NNWB 3R1YA 3NWWA 2YABA 4YLJA 5HKMA 4RX9A 2W9FB 3R7OA 4YPSA 3UMXA 3OWPA 4GL9A 2KTYA 3DS6A 2W1DA 4L7FA 1YI6A 2WQBA 4R7IA 1XH5A 1IA9A 3PIXA 3BYOA 3HVCA 2PVKA 4M84A 4D2PA 3DAJA 4DTKA 2RG5A 5GINE 4XNEA 4O1PA 3KGAA 3L9PA 5K5XA 4CTBA 2GTMA 2V7OA 3IGOA 5IEVA 4LYNA 4RX8A 4X6RA 3UNJA 1LEWA 5BV3A 1ERKA 5ANEA 3F3WA 4DDGA 4RVLA 5HNBA 1RDQE 4E5BA 5CEPA 5DLSA 3DB6A 3LJ0A 3GU5A 5BYZA 5IZFA 4W8DA 2WTVA 2I0EA 1OIRA 1MUOA 2GS7A 3DTWA 4NWMA 4W4YA 3VBWA 4DFUA 4ZTMA 5DMZA 2HCKA 3QF9A 4OTDA 2PSQA 3KCKA 4QMTA 3RZFA 4U43A 4AQCA 2I6LA 3V6RA 4F64A 2WMTA 3PJ3A 3R8UA 1Y6BA 3TZMA 3HRBA 2GHGA 1IR3A 3AMAA 3MV5A 3QUDA 3NUYA 3Q4TA 1DI8A 3IONA 4D0XA 4J7BA 3A7GA 1L8TA 3UQFA 2PL0A 3RK7A 2XANA 4Z55A 4F63A 5HZNA 4FTUA 4HW7A 3UP2A 4BVUA 1CDKA 4IAYA 5EH0A 1OUYA 2BZJA 4TWOA 4IQ6A 4FSYA 4FSTA 3CC6A 4AZWA 4FNXA 4FZAB 4M0YA 3ZRLA 2ITPA 5D10A 2W5BA 5D7AA 3S00A 5E7RA 5AUTA 2JIIA 1Q8UA 1REJA 5CEIA 1P4OA 1ZZ2A 2JDTA 4YHJA 5I3OA 4EK4A 5DYJA 1PJKA 2OF2A 5FDPA 3LKMA 2XBJA 4NKAA 5EM6A 4XV2A 4Q9ZA 4BKZA 2VTOA 3R7GA 5A6NA 2JBOA 3PTGA 3QTWA 3R1SA 4K8AA 3HL7A 3FI2A 4M0ZA 2WU6A 4CKIA 5HTCA 1Q62A 2YIXA 1FBNA 3LMGA 4QDVA 2XUUA 2XNNA 3MBLA 1U5QA 4LGDA 2XJ2A 2XRUA 2YWPA 3OCSA 4FV8A 4RJ7A 4QMSA 3RAIA 5AIKA 3F5PA 4YBKA 4BWKA 1H4LA 3CP9A 5LVMA 3VONA 4GS6A 4GSBA 2W1EA 3E88A 1M17A 3K5VA 1SZMA 4ZZMA 2GNGA 3F88A 2R0UA 3MWUA 3KXXA 4RIXA 3TG1A 3QU0A 5K4IA 2BFYA 2GU8A 2I1MA 4AGCA 3KMWA 3ZLWA 5A4CA 5HO7A 3Q9XA 2BAJA 2X4ZA 4O1OA 4DEDA 3OCTA 5BVDA 3IK3A 3E7OA 4XV9A 2CPKE 1Y57A 1YVJA 5B0XA 3RCJA 3PXFA 3BL9A 5CNNA 2UUEA 1VZOA 5CSVA 3D4QA 5A46A 4YZDA 4ZIMA 3V5WA 2F49A 4W9WA 3LXLA 5EG3A 2HZ4A 5FEDA 5IU2A 4U81A 4PNKA 4JAJA 3QCQA 2F7ZE 2IVVA 3RJCA 5AAEA 1VLRA 4FEXA 2WU7A 3MA3A 3TKUA 3UZTA 5ANJA 1WAKA 3DFCB 4FV1A 4G6NA 2R3PA 4YC3A 2Y4IB 1J3HA 4ANSA 4FEUA 4QO9A 3UPZA 3W0QA 2Y4PA 1WVWA 2X6EA 3FI3A 3NIZA 3GUBA 3R28A 4YJVA 3P5JC 3GC0A 4L44A 5CS6A 5FP5A 5KMKA 4UMPA 1K9AA 4XG4A 4AW1A 2YLEA 3DJ6A 3ACJA 2AC3A 2ZV7A 4MD8E 4MD9E 4O0XA 3DKGA 5DOSA 3SD0A 3RM7A 3JS2A 4RZVA 4FTIA 1YXSA 3FLNC 2BZIB 3ZRMA 2X6DA 3FHRA 4NM0A 4ZY6A 4JDHA 1PXPA 3PXYA 4JXFA 2BALA 2JDVA 4ZZNA 3COMA 3D94A 3AT4A 3HEGA 3OG7A 4O4BB 4U40A 4OAUC 2VWBA 1Q8TA 4IAFA 4PNIA 5HO8A 2O63A 2UVZA 2YIRA 3KMUA 4EORA 1A48A 2BFXA 5EQEA 4EH2A 5L8LA 5IDNA 4YMJA 3WYYA 5CALA 4FV5A 4YTIA 3FZTA 5IQBA 2R3MA 4BZNA 3ORIA 3WZUA 2G9XA 2QOQA 3A61A 4FVQA 2ETKA 4O82A 1G5SA 2ACXA 2YJSA 2EU9A 5ACKA 3GEQA 4L3JA 1V1KA 1NVRA 2RFEA 2YM8A 1KWPA 3HUCA 3K2LA 3LW0A 4DN5A 5CF8A 3G6HA 3PLSA 1KV2A 4AAAA 2OU7A 5CAVA 3OP5A 1PXOA 5AP3A 2X0QA 1XBAA 2O0UA 3FBVA 4AAYA 2JFMA 4CYJA 2VRXA 2GNFA 4DEEA 3QQGA 5E1SA 3VS1A 4YO4A 4Y46A 5HOAA 2C3JA 4D2SA 1JKLA 3I0OA 3VQUA 2C4GA 5AV3A 1BX6A 5CASA 4F0IA 2CCIA 2PU8A 5GJDA 3VRZA 2EUFB 4OGRA 2R2PA 3GC8A 5HD7A 4I6QA 2B55A 3FZSA 1IAJA 2WIPA 3ULIA 3U4WA 3L9MA 3UNZA 2ITOA 4P5QA 2BUJA 1IASA 3EMGA 4ANQA 3LQ5A 4BF2A 3QKMA 4FEQA 3EQFA 3EIDA 3OS3A 3DU8A 4BDGA 4B6LA 2BCJA 3R1QA 4RSSA 2WEIA 1DM2A 1Z57A 4UEUA 2YITA 4CKJA 2RKUA 3TMOA 4IM3A 4FOCA 4QYEA 1ZWSA 3C9WA 3NYVA 4C7TA 4JBOA 3C50A 4WNKA 4UZDA 5AADA 3OW3A 3QGYA 4HCUA 4I0SA 5M4UA 3NAXA 2JC6A 2Z2WA 4M13A 3F5XA 4IE9A 2C6EA 2QOLA 4FKOA 5CSPA 4FOBA 4HCVA 3UG1A 2JIVA 4APCA 4ACDA 2J90A 3CD8A 3NW6A 5C03A 3KVWA 5G1XA 3OD6X 4JNWA 3NFFB 1V0PA 4RGJA 4TYHB 4B8LA 5B7VA 3GB2A 2JAVA 4FNWA 2UW3A 4AW0A 4H1JA 4IMYA 3VS5A 4S32A 4Y72A 3V5QA 2VO6A 3C7QA 5FBOA 1H08A 2XH5A 2J4ZA 2HYYA 4DFYA 2YDIA 4IWOA 4CLJA 4XOYA 2J7TA 5L8KA 2RF9A 4G5JA 3VS6A 4EHVA 3PP0A 1PKGA 4XJ0A 4DFBA 1JLUE 1SVHA 1MRVA 2OF4A 5KBQA 4ANBA 1OIYA 2WOTA 3D7ZA 3MJ1A 1Y91A 4C58A 3TT0A 5IEXA 4QMNA 3MIYA 2G1TA 1PMNA 3ALOA 4XX9A 3UOKA 5ANDA 4BGGA 4EBWA 3DJ5A 3O2MA 3UOHA 4JT3A 2ETRA 3MH2A 5A4TA 4L3PA 4DGGA 3SQQA 1IEPA 3UP7A 3KEXA 4XYFA 5DR6A 4BDDA 4FZFB 3QQUA 4YJPA 5CF6A 3ANRA 5EI2A 5FP6A 5KMMA 3WBLA 5EM5A 1OMWA 5I9YA 3NPCA 4CZTA 2XNMA 3NYNA 5CANA 3ATSA 2YCRA 4LMNA 5CSXA 4V05A 3TKIA 4O4DA 2JAMA 1MQBA 4FV6A 3VS3A 4M7IA 3FKLA 4XG3A 3MSSA 3R7YA 3EQRA 2HENA 1H1SA 3I6WA 2Z8CA 4YPDA 2G15A 4H3PA 1O9UA 1Q3DA 2P55A 2Z7SA 3ZDUA 3C4FA 4K2RA 2QOOA 3PXRA 4EONA 4L3LA 4O21A 3UO4A 3ZFXA 3DAEA 4FVPA 4E6QA 4CQEA 3BPRA 4M3QA 3SRVB 3VVHA 3GXLA 2FSLX 2OJFE 2QLUA 4FTQA 4WSQA 4BDIA 5HVKA 5K9IA 2R9SA 2VTIA 4U0IA 5BMMA 3RP9A 4UALA 5GZAA 3MB7A 3KA0A 4IM2A 5AUYA 3W33A 2ONLC 1JKKA 4PMSA 4ACGA 1PW2A 3GCUA 1OZ1A 5J79A 1J7UA 5CEOA 1W98A 3GU4A 3QTXA 4CV8A 3K54A 4I5HA 2XK8A 4GK4A 4ZTSA 5AUXA 2WMSA 3T9TA 1P4FA 3WARA 3ENMA 4AW2A 4GFMA 4DH5A 3T9IA 3HAVA 3EN4A 4GKHA 3E3PA 4GH2A 4CMOA 3ALNA 2QHMA 4ASZA 2XVDA 2F57A 3GCPA 3SA0A 1V0BA 4AOTA 5AJQA 5EM8A 3KIOC 1BI7A 3WIGA 3DZQA 3H9FA 2X2LA 2UZOA 3O0GA 2VTPA 2XCHA 4L43A 2QC6A 5JT2A 5KX8A 5AA9A 2PUNA 2Z02A 3ROCA 4AP7A 2XCKA 2YHVA 2C0OA 3TWJA 3FUPA 1M7QA 2HZIA 3ZO4A 4GU6A 2VTHA 3O51A 2OXXA 5A14A 2VV9A 2XKFA 2UW4A 1KE6A 3M11A 3O96A 3EL8A 2UZUE 4IAKA 3FLYA 3HMPA 5LCKA 4AUAA 1UNHA 3ORXA 1IRKA 4KRDA 3PE2A 4JLCA 1ZYDA 3HP2A 3P9JA 1XJDA 2FSTX 4FTOA 4XEYA 4BKYA 5CWZA 3FSKA 3R2BA 4FIJA 4BBFA 3MH3A 2FSOX 3QRUA 4ZZOA 2XZSA 5HTIA 4FKRA 1FGIA 5I3RA 5E90A 5HESA 3FHIA 3G51A 4QNYA 5C1QB 2BAQA 3UVRA 3IO7A 3ZBXA