2PY3A

Crystal structure of fgf receptor 2 (fgfr2) kinase domain harboring the pathogenic e565g mutation responsible for pfeiffer syndrome
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
299
structure length
282
Chain Sequence
LPEDPKWEFPRDKLTLGKPLFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVGYASKGNLREYLRARRPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A molecular brake in the kinase hinge region regulates the activity of receptor tyrosine kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Fibroblast growth factor receptor 2
total genus 93
structure length 282
sequence length 299
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2py3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2py3A01
3TZ8A 5E8WA 3QTQA 4EKKA 3MESA 3A99A 4S31A 2WQBA 4RSSA 4IX5A 4BYJA 3HV5A 1CDKA 4IAFA 3OY1A 3FI4A 4CD0A 1LR4A 3OF0A 3PE2A 4L00A 2X9EA 4AACA 4YURA 5IQDA 4YMJA 2ITXA 1H4LA 4YO6A 4IXPA 1H08A 4GEOA 5FBNC 5M56A 1Q62A 2ITNA 2WMWA 2HY0A 1DM2A 4E6QA 2JKKA 2QI8A 4FR4A 2C4GA 2OXYA 3ZMMA 3FMJA 3P7AA 4ACCA 4XS2A 3W2RA 3FI2A 4S34A 4C36A 3ZFXA 4CKJA 3R71A 4CMOA 3UOJA 5EQEA 3GQIA 4AGCA 4Q5EA 5CAUA 5CVGA 5CSXA 1WVXA 2OW3A 2WNTA 3R00A 3SW7A 4QNYA 3WE4A 4ASZA 1H26A 3FLWA 3HMMA 4M15A 5F4NA 3TG1A 3Q4UA 4CZUA 5A4LA 2ZDUA 2BAQA 4AZSA 2OZAB 3GVUA 2R3IA 1U54B 2YDKA 3IK3A 1YQJA 4I21A 3RNIA 2Y6OA 4HZSA 2X81A 2YISA 5C4LA 1H1QA 3RJCA 1GZNA 2JC6A 4RIXB 4FV5A 2PVKA 3NRMA 4F7NA 3B8RA 4EQCA 4BKJA 4BRXA 4C7TA 3BHYA 1M2PA 3KMMA 4X3FA 3ZZWA 4C59A 4GT5A 2NO3A 3E3BX 4GMYA 2Z7LA 4RJ4A 4RLLA 3RMFA 4EOLA 1FGKA 5I4NA 3IG7A 5E8YA 3ROCA 5CF8A 2R3JA 3NCZA 1UU8A 4G6LA 1Y6AA 2ZV9A 4OTRA 3TZ9A 4BDKA 4CQEA 3Q96A 4QMUA 5AEPA 3A8XA 2W5BA 2ETMA 3ATSA 3KRWA 4PPAA 3BU5A 3ZRKA 2FYSA 4CFNA 4Q9ZA 5AV1A 1H1RA 1UKHA 2OI4X 2E9PA 2VU3A 3GC9A 2HZNA 5EI8A 4FKPA 4LOPA 3REPA 3TV4A 3KL8A 4BCFA 4O7VA 5EQYA 4IJ9A 3MH2A 2VTQA 2WIHA 3PA3A 4O0VA 4GS6A 3EL8A 4UWBA 5E8TA 4U97A 1ZZLA 3R1SA 2ZAZA 5DFPA 3ZM9A 2YM4A 3P79A 3SD0A 3EN4A 2XK9A 5M51A 4LMUA 1H0VA 4APPA 2JGZA 5CAPA 2WZJA 4LL5A 3O2MA 4ZTSA 2CJMA 4DHFA 5ANDA 4X0MA 5HKMA 4CQGA 3TM0A 5L3AA 3E93A 3TEIA 5KO1A 3DAJA 3DFCB 3SW4A 5LVPA 3QZHA 3U6IA 3UPZA 4MD8E 5HNBA 3ZO4A 2QODA 3ELJA 5CAOA 4TTHB 4HCVA 2QCSA 1BI8A 1P14A 4M8TA 2YM8A 3GENA 5AV3A 3EQHA 4PTEA 2XIXA 2YACA 2PULA 3WILA 4KWPA 2O64A 4M67A 3VUHA 1SNUA 3ZU7A 2C6DA 3U6HA 3QALE 4QTDA 4CCBA 5KX8A 4FG7A 4BGGA 4FSMA 4KIKB 5BVNA 4NT4A 3HP2A 3MY0A 4LUEA 1OPJA 5K4IA 3PRFA 2W1DA 2XRWA 5HBHA 3DXQA 4IX3A 4NZWB 1IRKA 4BDAA 4FODA 2WELA 4ZY6A 3N4TA 3RINA 1XBBA 1UKIA 5HVYA 4KRCA 4QMWA 4DFYA 1ZMVA 3CS9A 5DE2A 5JGBA 2ERZE 1S9IA 5CI7A 4BWPA 2YLFA 1Y8YA 4IVBA 3VS4A 5LCKA 5DYJA 4BDCA 1L8TA 4I23A 5EI2A 4C35A 4DH1A 4JX3A 2H9VA 3FY2A 4JLCA 2Z2WA 3P4KA 4ZY5A 3PLSA 1XO2B 1P2AA 2VTLA 5DI1A 1KE9A 3NS9A 3QYZA 4IADA 4J98A 4I0SA 5FEDA 4D2RA 3CLYA 2XCHA 4FZ7A 5EDRA 2XRUA 3DA6A 2QOLA 3OEFX 2VWXA 3P23A 2QURA 2CGXA 3H4JA 4H39A 3TZMA 2CNQA 2A2AA 3GU7A 3UTOA 1YOJA 4D2SA 2BILB 2IG7A 4MNFA 4QTCA 5M4CA 3LHJA 2CLXA 2VTPA 5HG9A 4BB4A 5KMLA 5ITAA 3WF8A 4IVCA 3PJ2A 3CCNA 4F7SA 4NEUA 1QPDA 1URWA 2QHMA 3EYGA 5AR5A 4QQ5A 4UMUA 3M11A 3QRTA 2QVSE 3QA0A 2VTOA 3GUBA 5A54A 4CFFA 5J8IA 2YWPA 4FV0A 1CKJA 3IOKA 3O8PA 3V6RA 2PZRA 3OWLA 2XIYA 4E4MA 1Y57A 3CSVA 4ZS4A 2UW8A 3QLFA 3MVLA 2UVXA 3D14A 4TYHA 2EUFB 4BTFA 3LMIA 1W7HA 3GP0A 4TPTA 4GKIA 3OTVA 4FSWA 4MCVA 4YP8A 3C4FA 3WIGA 5JQ8A 5DGZA 2XS0A 3ORMA 4DEHA 4F0GA 3QD0A 3BU3A 2R0IA 3FMMA 3QD2B 3R9DA 4AZFA 3F88A 3NCGA 2GCDA 4TNBA 2JBOA 3UVQA 2G1TA 3ZBFA 4AZTA 5KNJA 1Z57A 4AX8A 3HAVA 4ZJJA 3TKHA 1K3AA 3PXFA 2F4JA 3DNDA 4FNXA 4FKRA 4FKOA 3IW5A 2J0IA 2W1CA 3KRJA 4RJ6A 4U7ZA 4HYIA 4FKGA 5HCZA 5GZ8A 3CP9A 1IR3A 4FV6A 3VJOA 1CMKE 4ZLOA 4I4FA 2VV9A 4C3PA 3K3JA 4O7ZA 1OZ1A 3DB8A 2BZHB 3F3WA 1I44A 2W1HA 1RJBA 4WG4A 3RZFA 4RZWA 4YHTA 3WOWA 3FXXA 4FSZA 4W9WA 2OFUA 3SRVB 4I3ZA 2WMRA 4D28A 3NVMB 2X9FA 4GU9A 3BGQA 3QQHA 1OKWA 4QP1A 4QYFA 1OUKA 4QMQA 2B52A 4RIOA 1F0QA 4HZRA 5AP0A 3PFQA 2GHLA 1PXNA 1JOWB 4FVPA 3VNTA 2XZSA 4AWIA 4FKSA 5HNIX 4RRVA 3QZGA 5AP7A 3RZBA 3HX4A 5J5TA 4F70A 1WBTA 4FIFA 4NM0A 4WG3A 4JI9A 4RVTA 1WBWA 3EMGA 5CX9A 1GIIA 3VRZA 3KRRA 1KOAA 1TQMA 2GTNA 4CT1A 4L7SA 4XUFA 3Q5ZA 1STCE 1WBVA 5GJFA 3UMXA 4OBOA 4CVAA 5HX6A 3LLTA 3MJ1A 4Y5QA 5JT2A 4DFBA 1KOBA 3VF8A 4CT2A 1M7QA 5TOZA 5HLPA 3PY0A 1RW8A 2XEZA 3ZXTA 5JGDA 5CXZA 2XYUA 3DTCA 2WMXA 5C4KA 4XOZA 3ZOSA 3QTXA 3RPVA 4UXQA 5M4FA 3DQXA 2WMQA 5FXSA 3SDJA 3F5GA 3U6JA 3K3IA 1OI9A 4XP2A 4GKHA 3CXWA 1XH8A 2ITYA 4X6QC 3AC5A 2Z02A 5L8LA 1XR1A 2OJ9A 3I81A 5IUHA 3E8DA 3O51A 4C02A 3TUCA 4GT4A 4K33A 4PL5A 2VTSA 3QWKA 4WNPA 3EQCA 3HL7A 4AU8A 3R8UA 5FTGA 1H01A 2XJ1A 4Q9SA 2GFSA 3OZ6A 4FTUA 3L8PA 5I9ZA 4MQ1A 3VS2A 2CKOA 3JR1A 1ZYSA 4O84A 5LXMA 3GCUA 5CEPA 5I9WA 4F6SA 1KWPA 2VO0A 2JKOA 3COMA 3TNIA 4ZOGA 4EUTA 4RMZA 3VUKA 3KC3A 4G34A 4X7QA 1REJA 4YJOA 4FSQA 1P4OA 3AC2A 1H28A 3HUCA 4FIGA 3IECA 4KA3A 4S2ZA 4AW2A 4JBQA 4QP9A 5ETAA 4O7SA 4I5HA 2PY3A 3LFSA 4GFMA 4FX3A 2ETKA 4IB1A 1AGWA 4GRBA 3HP5A 3EN6A 3N9XA 5ANEA 4V0GB 3AC1A 3VS3A 4EK3A 1T46A 2F2CB 3OWJA 2BZJA 4FTNA 1ZY5A 4AG8A 3KQ7A 3OY3A 3FJQE 4CTBA 4HW7A 5EM6A 3SX9A 5HLNA 3IGOA 1CKPA 4CNHA 3FLSA 3PP0A 3LXKA 4H1MA 3OEZA 4MH7A 4IZYA 4AXAA 5BNJA 2PZPA 3W2PA 2QNJA 4BCKA 2ZMCA 4ANBA 5L6OA 5T6KA 3ORKA 4L01A 4AAAA 3FI3A 4ACHA 3NIEA 4FL1A 2WEVA 3CQUA 5IH5A 4FKQA 4D2WA 5AMNA 5JH6A 1E1VA 4XG4A 4Y5HA 3TL8A 5AADA 1Q3DA 3SQQA 3MPTA 5BVEA 3F3UA 5IQBA 3LAUA 3CY3A 2YCRA 3BLRA 3T3UA 1IA9A 3CQEA 4D5KA 3S4QA 5DMZA 4M69B 4YZDA 4BGQA 5JK3A 1YI3A 2ESMA 3LVPA 4NL0A 2B9JA 2W9FB 5KMJA 4CFUA 5J1WA 3BEAA 5AWMA 3KRXA 4BBMA 4FG8A 4BDGA 3ULIA 2JITA 3NUSA 5EDPA 4WNOA 3VUIA 1Q4LA 4W8DA 1MP8A 4K1BA 1URCA 4MWIA 5EH0A 2XBJA 2CCIA 3OROA 5BMMA 4FZFB 2O5KA 4XJ0A 3TIYA 4IM0A 4NIFB 3MSSA 4UWCA 5L2WA 3L9LA 1ZXEA 3MJ2A 3NSZA 2KTYA 4DFXE 3Q4CA 4IAAA 2GU8A 3Q9YA 1PXOA 4LGDA 1GNGA 3FKOA 5AA8A 2VTRA 3UODA 2CKQA 2O8YA 4D1ZA 1R1WA 3UZPA 2I6LA 1CKIA 3G90X 5A14A 1XWSA 3ZS5A 4BCQA 4E1ZA 3IW4A 3HV7A 4QMXA 4PMMA 3Q60A 5BVWA 3SC1A 4MQ2A 3F5PA 2IPXA 2J0KA 4GW8A 4P4CA 3MA6A 3R02A 2RKUA 3MYGA 4S33A 4USDA 2WMSA 2V22A 4YBKA 1XH9A 3PSCA 4YNOA 5AUTA 4GIHA 2F7ZE 4QYGA 4XOYA 5ANGA 1FVRA 2QO7A 3GI3A 3L8VA 4F0IA 4K2RA 4BI0A 1KE7A 3T9TA 4LGHA 2C30A 3QLGA 4G5JA 3UYTA 3UQGA 1YVJA 4ZSLA 4L3JA 2W06A 2Y4PA 3E3PA 2PVLA 5IUGA 3E7OA 4C4JA 3RWQA 3V01A 4EORA 4GYIA 3FPQA 3WI6A 4D58A 3DKOA 4JAIA 2Y0AA 4EWQA 3BYUA 1YW2A 3KN6A 3ZZEA 4HVGA 2XNEA 3FXWA 2HENA 4JIAA 3POZA 2RFNA 3QYWA 5EHOA 4FOBA 5C8NA 4JG7A 5BYLA 2CCHA 2ZV8A 5B0XA 4ANQA 1JWHA 2G2IA 3PY1A 5L8JA 4ALVA 4KUJA 2Y4IC 4LRMA 2QQ7A 4YTIA 4D2PA 1YHVA 2V5QA 4OR5A 2XEYA 5ANJA 5IQAA 2BRGA 4BBFA 5IQHA 3DFAA 2PE1A 3UC4A 5E90A 4TKSA 2R64A 2CGWA 3GXLA 5KKRC 5H2UA 4AOIA 2IVTA 2J90A 2VD5A 3CGFA 4BBEA 3O8TA 3EQBA 3F66A 4J8NA 4M66A 4PUZA 4B9DA 4E4XA 5D7VA 2CDZA 5HVKA 5KUPA 4ORKA 3D4QA 4JXFA 4OTPA 4YU2A 4D0XA 3TNWA 3VC4A 4EH4A 4FV3A 5KZ0A 5FP5A 1F3MC 2O2UA 4K8AA 4WKQA 1JKLA 4RWKA 4WA9A 2W9ZB 3PSBA 4FTOA 4F08A 3ZDIA 3KK8A 2OXXA 2IWIA 3IW8A 3PXQA 4UALA 5LMKC 4XG8A 2ZVAA 4TWNA 4X3JA 4YTFA 3PVGA 3U9CA 3F7WA 4QQJA 5IA1A 5AR2A 3VWAA 3CE3A 4EH7A 2J6MA 3HEGA 3P78A 5EYMA 3GC8A 3NUAA 3QTIA 1OPLA 4ID7A 3R8VA 4B4LA 1OIQA 4QMSA 1B39A 4XRJA 4E4NA 4ZSEA 2UZTA 2H8HA 2HIWA 4I6HA 3GFEA 4WD5A 3FE3A 5EHYA 3Q6WA 3T8OA 5HX8A 4P7EA 4APCA 4N0SA 4PMTA 4PV0A 5M4IA 1GIHA 2HZ4A 1YHWA 3MWUA 3LLAA 3DCVA 3NUYA 2JBPA 4QTEA 2WMBA 3MTLA 4DGLC 3ENMA 4ZTRA 3AT2A 3SOCA 2BUJA 2JIIA 3PLAE 3BV3A 5DBXA 3ID6C 4C8BA 4U81A 3C7QA 2QOFA 4ZXTA 1ZZ2A 4EH9A 2CN5A 5CASA 4QP2A 5IH4A 1XHAA 2GTMA 2W1ZA 2ZMDA 3CD8A 3PIXA 1KE8A 1OBDA 4EOKA 4OTGA 4OT6A 5FEQA 3RWPA 5HE1A 4EL9A 1IAJA 3KA0A 2GHMA 4M84A 2YIRA 2A4LA 2X8DA 3I7BA 4IB0A 4CRSA 2FGIA 3OT3A 2W7XA 4CGAA 4JDIA 5M06A 4DG0E 4GK3A 2UW6A 1YHSA 2XH5A 4FV2A 4RX9A 4FF8A 3PJ3A 3DS6A 2XK6A 1QPCA 2X7FA 2ITOA 3C4WA 1BX6A 1M52A 2C5OA 3PA4A 3RGFA 4LRJA 3HDMA 4ZSAA 1VEBA 4YLKA 2PVNA 4FG9A 5FGKA 3Q04A 2B9FA 4ALUA 4FEUA 2C69A 3GT8A 3KFAA 3WIKA 3Q5IA 4CV8A 3OOGA 3MFTA 2P55A 1FMKA 3E64A 3LOKA 4JG8A 3PVWA 2QHNA 3KMWA 4PRJA 5GZ9A 3UYSA 4BN1A 1AD5A 2ITQA 3Q4TA 3FMHA 4NTSA 2DS1A 5IQEA 3AMAA 3VUGA 4W4YA 3QQFA 3W2SA 1YXSA 2PVYA 3LJ2A 4QYEA 4X2FA 4AN9A 3II5A 3SA0A 2YCQA 4EBVA 3OP5A 4O2ZA 3UG2A 4XBUA 4AZWA 3HDNA 4FA2A 4DFUA 2XK8A 2PZ5A 4AFEA 1WBPA 5LWMA 5E4HA 2ZM3A 4RFYA 4G6NA 4QPMA 4CV9A 4TT7A 2IVUA 1HCKA 4FK3A 1LUFA 1UU9A 3BE2A 2UUEA 3C4ZA 3PJ1A 2WFYA 5IA3A 4PDPA 3HMNA 4X6RA 4EK8A 1OMWA 5E8XA 3RPRA 5C8KA 4CFWA 4D2TA 4QPAA 4DBNA 5C01A 2VWZA 3HRCA 4EONA 4ERWA 5BUIA 2IN6A 2BFYA 2W5HA 3L9MA 4G1WA 4QO9A 3HUBA 3CEKA 2BIKB 4IE9A 5CT0A 1OL2A 5ANIA 5G1XA 3AXWA 3NNWA 3MB7A 3SRVA 4EH6A 5FTQA 3NX8A 3ROYA 4D5HA 1PRYA 3OUKA 4KAOA 3ERKA 5LVOA 4AN2A 5DR2A 5CEOA 3KXHA 3HV6A 3D0EA 3K5UA 4H3PA 4B8MA 2W05A 4I5CA 3VBYA 3VUTA 5AFVA 4L3LA 2A0CX 3DB6A 3JXWA 1SM2A 2OIDA 4PQNA 5HNGA 1NY3A 5EI6A 4DF3A 2XUUA 2REIA 3BQRA 3VIDA 3ZLSA 4AW5A 4BCJA 1FBNA 2WTVA 4BTKA 2QG5A 4CFXA 1ZYDA 2W0JA 4FKVA 4DH8A 4FI1A 3E8CA 2GNIA 2YEXA 2YJRA 3FZOA 4H36A 1Y91A 3H9RA 3UDBA 4CYIA 1W98A 4BDBA 3HAMA 4I6FA 3PWDA 4N6YA 3IONA 5AP6A 3UQFA 3M42A 3PVBA 3RAHA 4FZDB 5AAEA 3H9FA 4DGGA 4DT8A 3OOMA 1BL6A 1NA7A 3EFJA 5AV0A 4FL3A 4C4EA 4YR8A 1YXUA 2BHEA 3W8LA 3ATTA 3D83A 3QU0A 1E9HA 1MRYA 2QONA 5AX3A 4CXAA 3E8NA 3NUNA 3SG9A 2BRBA 5EHLA 2PSQA 3LE6A 3NGAA 4IAZA 4TYEA 3S95A 4YTHA 4F1TA 4AW0A 4ZZNA 2OH4A 1REKA 5DT4A 2C6TA 3QTWA 3G15A 4QTBA 3TNPC 4GJ3A 4R6VA 4ZZMA 4BCOA 2ZB1A 3MGYA 3ZEPA 1O6YA 3F5XA 5D12A 3QXPA 3BQCA 4FSYA 3LFQA 4K9YA 4XV9A 2X0GA 4O0XA 4TWOA 4FGBA 5ETIA 2FUMA 2PVJA 4M69A 4KIQA 3ITZA 4QP3A 3Q2JA 4RA5A 4DEAA 3QRKA 2JD5A 3WZEA 4TYHB 1AQ1A 1H24A 3DKFA 2WHBA 3EIDA 3KU2A 5EKOA 1W83A 4FK6A 3DBEA 5E9EA 2OU7A 3TJCA 1YI6A 3BE9A 3KY2A 3LKMA 4M14A 2GPHA 4XG6A 4DTAA 3UVRA 4EH8A 2QOOA 2OIBA 4G6OA 5HE2A 4DG3E 4WO5A 4IAYA 2W17A 2WQEA 4BIBA 1G8AA 4RJ3A 1Z5MA 1WVYA 3ALNA 2P2HA 4MD9E 1KE5A 4DBXA 4G31A 4X2JA 3VULA 2ZDTA 3BYMA 4V0GA 1IA8A 3PE1A 2R3GA 4G9CA 4L44A 4U0IA 5CU2A 4ZTNA 2OICA 3O50A 4Y46A 4AE6A 4JBPA 3CQWA 4RPVA 3QCSA 3BYOA 4I41A 4EBWA 5KMKA 1QPEA 5I5ZA 1QL6A 3PY3A 2W1IA 3K54A 2ZM4A 3HYHA 5K5NA 3ULZA 5KCVA 4FL2A 2PPQA 3ORIA 3LFDA 4WBOA 3L8XA 5LJJA 2PE0A 3D5WA 3B2WA 3A7FA 4JQ8A 1V1KA 3KGAA 2BROA 3ZYAA 3HRFA 4MBJA 1WZYA 1ZMWA 3U55A 4BR3A 4A9UA 2XM9A 2Z8CA 3L8SA 4DG2E 3WZUA 3LM5A 3LIJA 1SNXA 3DGKA 5AP2A 3H9OA 3UC3A 4A9SA 4DTBA 2YM6A 4DITA 2FH9A 3E88A 1UNGA 3V04A 4QT1A 1B6CB 2XMYA 3TCPA 1Q24A 2HCKA 4CG8A 2YLEA 2F7XE 2W4JA 3BIZA 3CY2A 3NUUA 4FIEA 4LYNA 4N70A 1Q3WA 4FV9A 4O22A 1HCLA 2H34A 1Y6BA 2LAVA 5IF1A 4FEVA 3LPBA 3MB6A 5DWRA 3FLNC 3NYNA 4Y8DA 3NW5A 4XG9A 4L9IA 2RGPA 4MXYA 1BUHA 5C9CA 4EHEA 5HG8A 2GMXA 4FKTA 1ZYCA 3O96A 4C3FA 4MBLA 3EFKA 2R3LA 2R3FA 3UIBA 5HO7A 3LQ3A 3D5XA 4RFZA 4FEQA 3OCGA 4Q5HA 4D4SA 2XF0A 4TN6A 4EH5A 5L4QA 3JUHA 4FKIA 5K4JA 2QU5A 4JVGA 4J1RA 4ACGA 1LEZA 3EN9A 2E9VA 3FLZA 5BMSA 3FUPA 3RHKA 2YZAA 5FEEA 3EFWA 3EQIA 4R1VA 3KRLA 4RZVA 5CU0A 4Y95A 4K6ZA 1PF8A 5M4UA 3PP1A 5EOLA 3EWHA 2AC3A 4U3YA 5CF5A 4BHNA 4MXXA 5DR9A 3R7IA 4CZTA 4E5WA 3UNZA 1WAKA 2PMIA 3QC4A 3LCOA 4ARKA 4AUAA 4EUUA 3RAKA 4E6CA 4U44A 2XCKA 5KE0A 2NP8A 2JLDA 4WUNA 3AC4A 4IWOA 5CAQA 5FXRA 5ACBC 4FKUA 3VS1A 5JKGA 3GOKA 2QC6A 4JX7A 5DIAA 1J91A 4R5SA 2WTWA 3KXZA 4L6QA 2P3GX 3BGPA 4UYNA 5E91A 1FOTA 3P86A 2RF9A 4FC0A 4LV5A 5HVJA 2UZWE 2HZ0A 4H1JA 4EZ7A 3MIAA 3OCSA 1M17A 2YERA 2HYYA 4NYEA 4HYHA 5AR4A 5GHVA 3CD3A 5B7VA 3HA8A 3RM7A 3W2OA 5AUWA 5TR6A 3DAKA 3FBVA 3OCBA 3R21A 1CTPE 2YM3A 4FOCA 3UIUA 5F95A 2ZYBA 4FTAA 4MEDA 3HNGA 3C4EA 3NYXA 3C0HA 3S3IA 1Q8ZA 4KKGA 3TUDA 3UOKA 3AGLA 5HBJA 3AT3A 3QKKA 4G3EA 3DOGA 4ZSGA 3DQWA 1IAHA 2I0YA 4FEWA 4L68A 4MK0A 3NPCA 3VVHA 2QKRA 3NYVA 4PMSA 2BFXA 1M2RA 4I4EA 3JYAA 5KMNA 4ZTHA 2YIWA 4OUCA 3E92A 2CLQA 2G01A 3DK6A 1NVSA 4YJPA 5C1QB 3QD3A 3ZCLA 3V51A 2XK3A 5CAVA 4OTWA 1PMVA 5BVFA 2YN8A 5JEBA 2VTAA 3LFBA 3U8WA 1GOLA 3W8QA 5DT3A 3EKNA 5IZFA 2C0TA 2HK5A 3TKIA 4IAKA 4YJVA 4F0FA 3R1NA 4RVMA 4EJ7A 3PXZA 5IA5A 5JQ5A 4FNZA 4F99A 2BTRA 2P33A 1H1PA 1Q8TA 2WMTA 3R9OA 3W55A 4BKZA 3FL5A 3ALOA 1VYWA 3AOXA 4BZDA 4C34A 3FMNA 3FL4A 4EOIA 4QP8A 3LMHA 3PG1A 4O0SA 3EN7A 2GNFA 4DLIA 3DNEA 4IB5A 1Q5KA 3HMPA 2XNGA 1Q8WA 4PY1A 4BDDA 4F65A 3R04A 4FV4A 4H3BA 3R7YA 4ZS0A 5BUJA 1R0PA 3RNYA 1ATPE 2IVSA 3NNVA 4EK5A 5D10A 2VX1A 3PZHA 2E9NA 4RIWB 3KVWA 3I5ZA 3LCSA 4GJ2A 4NM3A 2BHHA 5E1EA 4A4XA 3QHWA 5FP6A 3KULA 4ERKA 5HORA 3FMLA 4V04A 4Z7GA 4L43A 2B0QA 3Q53A 5CLPA 4PMPA 5IDPA 5GIPE 4O91A 4GUEA 4ZJVA 4FTIA 2VZ6A 3EJ1A 2FA2A 3UO6A 4U45A 1VYZA 2OXDA 2EU9A 4ZAUA 3S00A 4ANNA 3G6GA 1PXIA 2BALA 2A1AB 2EXEA 2J51A 1TQPA 5I9YA 3QCQA 2WB8A 3GOPA 5KHXA 4PP9A 1SZMA 2B7AA 2RFSA 2C5NA 2X2LA 4A4OA 4D4RA 4KIKA 5T3QA 2PMNX 4NCTC 3UPXA 4I6BA 1GJOA 4IEBA 4HVHA 4BCNA 4KIPA 2J4ZA 5CANA 4X21A 1GAGA 4CZYB 4IVAA 3DDQA 5CVFA 4OTHA 1WMKA 2Z7RA 3JY0A 3RP9A 3SKCA 2YCFA 2R3NA 3LJ0A 3DY7A 2Q0NA 1V0OA 2UW4A 4FKLA 3NR9A 1BI7A 4PWNA 4GFGA 3D5VA 4JL9A 2OSCA 4GSBA 4R7HA 4DEIA 2X4ZA 3PXYA 4R3RA 2EXCX 2C3LA 2X2KA 1DS5A 3JY9A 4EOMA 3N4VA 5LVMA 1K2PA 3RAWA 4LV8A 4YGAA 4CRLA 3LFCA 4PPCA 3PXKA 4U3ZA 5DN3A 1IASA 4J99A 3D94A 3F2AA 2J5EA 4JR3A 2UZDA 1E1XA 2VX0A 3CKXA 5CXHA 4D55A 2J9MA 4TW9A 4FTJA 2EB3A 2VWBA 3C1XA 2BAJA 1YDRE 1BMKA 2RSVA 5I9UA 3JVRA 3JS2A 4J97A 3DT1A 3BLHA 5LARA 3TXOA 3R9NA 3WE8A 4J71A 3ZUVA 4BDIA 4UBAA 4W8EA 5K0KA 2PHKA 4EQMA 2VO3A 4DEDA 1A48A 2I0VA 4H3QA 1UU3A 4O21A 4XMOA 5T68A 1J3HA 4RT7A 1DAYA 2VWYA 3KVXA 1NXKA 4TYJA 4DH5A 5J9YA 5L2IA 1U4DA 2FSOX 3PTGA 5EM8A 1PMNA 3QTSA 4BF2A 3SVVA 5LOHA 4MX9A 4ITJA 1KE6A 1O9UA 1ZAOA 4CCUA 4EZ3A 5H3QA 3KKVA 4DEBA 4G3DA 4FNYA 3ACKA 4R3CA 2GQGA 4CSVA 1ZMUA 5EK7A 3OBGA 4C58A 3VAPA 4IM2A 5L2TA 5DG5A 4DTKA 2VTHA 3QBNA 5ACKA 5CEKA 4I6QA 5DHJA 4USEA 5GZAA 2GDOA 5CU6A 2JKQA 2W96B 3EQRA 4TY1A 2QG7A 3TTJA 3UJGA 3SXFA 3IDBA 4D9UA 3EFLA 3W32A 4KD1A 4PDSA 4UZDA 2W1EA 4LM5A 3MY1A 2B53A 5EW8A 2PWLA 5CSWA 4NSTA 3CPBA 4QTAA 1XH4A 3TIZA 1U5QA 2WXVA 3C51A 3IDPA 3RI1A 4E5AX 3JVSA 3TJDA 2UZNA 2OKRA 4C3RA 3PDTA 4IC7A 2H96A 4YC8A 4HPUE 4NJDA 3QRJA 5FDXA 3OS3A 1ZOEA 4M7IA 2NNWB 5J7HA 3FAAA 1JAMA 2PMLX 4BCHA 4E7WA 4TZRA 3FPMA 4E73A 4WHZA 3EQFA 5EYKA 2QR7A 3UIXA 1JKTA 1OKZA 3DLZA 4MKCA 3V6SA 4J7BA 5IKWA 5AM7A 3OW3A 3R7OA 4AF3A 2BPMA 3R0TA 3GCVA 4FGRA 3A8WA 3F7ZA 2GSFA 3D15A 4C38A 3NUPA 4UMTA 2HXLA 2C6MA 3BHUA 1R39A 4IMYA 5M57A 2W1GA 2CGUA 4RFMA 5CNOA 3DLSA 4DEEA 1GIJA 3OFMA 3PWYA 5A4QA 4NFMA 3F9NA 3O0GA 3Q32A 3G5DA 2QD9A 2R3MA 3CBLA 3R2BA 1FVTA 1OL5A 3KXMA 1XBAA 4JQEA 5D7AA 3QQJA 5HZNA 3KCKA 2C3IB 5A4CA 1F5QA 1ZOGA 5A4TA 1OL1A 4L3PA 2B55A 3L1SA 2XNOA 4RWIA 1FPUA 4RX8A 3LCTA 4I5MA 4OTDA 4P90A 2FSTX 1R3CA 4BICA 3IKAA 1OIYA 4K11A 2VTMA 2VUWA 5AR8A 2WU6A 3C9WA 2YZLA 4ITIA 5JZNA 4E8AA 2HW6A 4FZAB 3OMVA 3LFNA 1PXPA 3TTIA 4OGRA 4XG2A 3Q2MA 4EOJA 3ZC6A 4DCAA 3F6XA 5M07A 5TT7A 4YBJA 3H10A 3RM6A 2WTJA 2C0OA 3SHEA 4AE9A 4IANA 5DA3A 5CZIA 5FLFA 4QYYA 4DH7A 4NJ3A 4XYFA 4PP7A 3ZXZA 2JDVA 2AYPA 1XBCA 2B1PA 3B2TA 4H05A 5JSMA 2WQOA 4DT9A 3VN9A 2GHGA 2OJIA 3HV4A 5J87A 4MD7E 2IZTA 4BHZA 1VR2A 2XNPA 4RJ7A 2XKFA 1UA2A 5EOBA 3DJ5A 3HKOA 3FV8A 3QQKA 4BGHA 4R78A 4TWPA 5JRQA 3BRBA 4CG9A 2YM7A 2VO7A 2WMAA 3KK9A 3POOA 4KBCA 4F7LA 1TQIA 3WZKA 5IA2A 3I0OA 1OUYA 3FZTA 1PY5A 5FWKK 3OWPA 1M14A 2WOTA 3HECA 3KN5A 4K77A 4BWXA 2ZOQA 3NW6A 2VN9A 3EQDA 3RALA 4B8LA 3LM0A 5LCJA 3FY0A 2HAKA 5K5XA 4OTFA 3ZFMA 3ZO2A 2G9XA 2X8EA 2PK9A 4ONAA 4OLIA 4U80A 4J96A 2RIOA 4QQTA 5EYCA 1OPKA 3ZTXA 5DT0A 4W4VA 5AX9A 3TV7A 3A7HA 4DFLA 2Z7SA 4L46A 4MXZA 5LVLA 3R8LA 2X6EA 3TT0A 2SRCA 2Q0BA 3MTFA 3R6XA 4AA5A 4P2KA 5HE0A 2NPQA 2R3KA 5B2LA 3CR0A 4YC6A 2BDWA 3EB0A 4J52A 3V3VA 4HVSA 3G6HA 2HWPA 5L6WL 2J0JA 4GIIA 3E63A 4FIJA 2J5FA 4P5QA 3CKWA 4EK4A 5CWZA 3E7VA 4NW5A 4Z16A 3LQ5A 3PJ8A 3UZRA 3R1YA 2F49A 3V5WA 1ERKA 2AUHA 4C37A 3MI9A 3FZRA 3AD6A 5E8SA 2WTDA 3CTJA 3GEQA 4FTCA 2BRMA 5BVDA 4DH3A 4WNMA 1YXVA 2ACXA 2Z60A 2ZM1A 4JDKA 1ND4A 3BHTA 1RQQA 3BLQA 4FZ6A 3UGCA 1BKXA 2PZYA 4F1MA 4BCGA 5IEXA 4IACA 4O7YA 3SLSA 4O7WA 2C5XA 1FVVA 2JKMA 5EM5A 4G17A 5KBRA 1A9UA 5CSHA 1XH5A 2YM5A 3VS6A 4DFZE 3NDMA 2UZUE 1YDTE 1L3RE 3U9NA 4AT3A 4CTCA 3KF7A 1H00A 3QZIA 4A7CA 2WD1A 2C5YA 4G16A 4OBPA 4QYHA 3DBCA 4MNEA 3V5JA 4AFJA 3R28A 4MXCA 3RBWA 1JSVA 2IVVA 2J7TA 2YWVA 3P9JA 3OVVA 3OXZA 4U79A 4O86A 2R5TA 4MWHA 1PXLA 1JKSA 3QGWA 5CALA 3LXNA 4K18A 3RPYA 2ITVA 4FTLA 3MVHA 4ZLYA 5K0XA 3ACJA 5L2QA 4U43A 3EOCA 4R3PA 3R7EA 4DA5A 4FTRA 4IZ7A 2BDFA 5CNNA 5DVRA 4EK6A 3RAIA 4YO4A 4YTCA 4C4HA 2HELA 4O27B 1Z9XA 4JIKA 2WO6A 4YPDA 4QP6A 2PVHA 3DBDA 4L52A 5FQDC 4DGNA 1SVGA 3R7VA 3ZSGA 1JSTA 2OWBA 2X7OA 1RE8A 4ZJIA 5BPYA 5DEWA 3SG8A 4BZNA 3V5PA 1UWHA 3FYKX 4IC8A 4EC8A 3F5UA 3UVPA 2XBAA 3IGGA 4FE2A 2YJSA 2PE2A 3H0YA 3UNJA 2YITA 2Y9QA 3QX4A 3ZM4A 4BYIA 4FV8A 5HIEA 5J9ZA 2IZUA 3FZPA 4E20A 4P5ZA 4W9XA 1SYKA 2UZVA 4ITHA 5HO6A 3R01A 4TXCA 3I1AA 4AGUA 2BRNA 2BKKA 2JDSA 4YSMA 4G3FA 3ET7A 4IFGA 1BLXA 3MA3A 2PVRA 4FV7A 3WYXA 3KXXA 4BDJA 5F1ZA 3D9VA 4FYNA 4F7JA 2X7GA 2YAAA 1LEWA 4FSRA 4IW0A 4EWHA 2UW5A 3BELA 4D9TA 4UWYA 3UMWA 3KXNA 1O6KA 2XK4A 2WQNA 4RX7A 2NRUA 4XBRA 5L6PA 3DPKA 5HCXA 4O7RA 3COIA 5J5SA 4GUBA 4O6LA 1J1BA 3P7BA 3RKBA 4MVFA 4YJSA 2ZJWA 4CYJA 1G8SA 4LMNA 1PXMA 3AQVA 5HG5A 2WQMA 4CEGA 2J2IB 3GC0A 1Q41A 5JFSA 2F9GA 4AQCA 2XVDA 3VBXA 4GK4A 4NWMA 5CVHA 4XX9A 3DK7A 3R63A 4DGOA 2OG8A 3U4UA 2DWBA 3DBQA 4KBKA 1NT2A 3HA6A 4XRLA 2PL0A 1PMUA 4YLJA 3C0GA 4DLJA 2OH0E 5EM7A 2QU6A 4GU6A 5CEQA 5KMMA 4C4FA 3DXNA 5CI6A 5CF6A 5CY3A 2C3JA 2B9IA 3FQEA 5HQ0A 4RC2A 3D5UA 1BL7A 5FRIA 3SOAA 3W2QA 3ZFYA 1NVRA 3R7UA 5M08A 2RL5A 1TKIA 5LQFA 3PXRA 4M12A 5FBOA 2PUPA 5GIOE 3AC3A 2CSNA 5H8EA 1OL6A 2VO6A 4AS0A 5KKRB 2C3KA 4HCUA 4G3GA 4EHVA 3Q6UA 3FC1X 1PMEA 2JIUA 4XV3A 4EOQA 1LPUA 1ZOHA 3GC7A 4LQMA 4RC4A 4XP3A 4OW8A 1W8CA 1W82A 1I09A 2UW7A 2HWOA 2PUIA 4MNEB 3P7CA 4JAJA 4JRNA 4QD6A 3UOHA 3VO3A 1J7UA 3SGCA 3MN3A 3Q9WA 3R2YA 4K0YA 4EHGA 2V0DA 2Z7QA 4F1OA 3EYHA 3W2CA 4GVAA 5KHWA 4PDYA 4EEVA 4NK9A 3DK3A 3A7IA 4ZMEA 3KCFA 2BR1A 5LWNA 4HVIA 4BCMA 1H1SA 4U40A 3DZQA 3P1AA 4E6AA 3EN5A 1JBPE 4NM7A 5IUIA 4NIFA 4YUQA 5JMSA 4W4XA 3I7CA 3PZEA 4Y83A 2B54A 3G33A 5TKDA 2X39A 3QRIA 2GS2A 5E7RA 3UO4A 4E3CA 5JN2A 5LMAA 2VNWA 2OK1A 3UBDA 3BV2A 4XEYA 2I7QA 5CTPA 5ANOA 2E9OA 4HGSA 2UZLA 4FTMA 1TVOA 1H27A 3BWJA 2CN8A 4PPBA 4MXOA 5EFQA 5AR3A 5AAFA 4QNAA 4D4VA 5M44A 1ZLTA 4MXAA 4YZCA 3NMUF 3CGOA 3NAXA 2UVYA 3FSFA 3VS5A 3NVKI 2C1AA 4WG5A 4IHPA 3DAEA 3AG9A 3MV5A 4GG5A 4MTAA 3VRYA 3WF6A 5AM6A 3ORXA 5CQWA 1XH6A 2XNBA 5HCYA 2B9HA 2ZV7A 4BIDA 3LJ1A 3RCJA 1JKKA 5I3RA 2FSMX 4Y72A 2V7AA 4F6WA 3PVUA 4GV1A 1P4FA 2ZB0A 4X3FB 5CT7A 4XH6A 1YOLA 3QXOA 3E5AA 2OLCA 1VJYA 5E92A 2OZAA 2BVAA 4UZHA 1YWRA 4L45A 3FLQA 4IZAA 2ZV2A 2JFLA 4QRCA 4DYMA 4ANLA 2C68A 1K9AA 1J1CA 3LFAA 3OG7A 4TWCA 2X8IA 2R3RA 4R8QA 2BMCA 3KB7A 2UVZA 3GU4A 5IA0A 3GB2A 1GY3A 3NW7A 4HYSA 3BEGA 3HZTA 3BCEA 2I0HA 4ACDA 1B38A 3ZLYA 1YRPA 2JAMA 3F82A 3MFUA 4S32A 2ITZA 4U5JA 2GS6A 2RFEA 4BDHA 2YIXA 1A06A 5D1JA 5HTCA 3GU8A 3A2CA 2I40A 4RIXA 4L53A 3MDYA 2Y8OA 5J79A 3DDPA 4UY9A 4KBAA 3QAME 1J7IA 3PUPA 5FM3A 5TO8A 3T3VA 3V5TA 4BL1A 2XKCA 2F57A 3FQSA 3ORZA 2XK7A 4UB7A 3W10A 5A9UA 2GNLA 3QF9A 2GNGA 3CJGA 3OD6X 4UEUA 4YZ9A 4YC3A 3ZBXA 4ANOA 4ENYA 3QTUA 4AGDA 3QUEA 2PTKA 2HY81 3FXZA 2EXMA 3C5IA 1ZYLA 3CJFA 4IH8A 3FEGA 3L9NA 3QTRA 4GFOA 4ZTMA 5IISA 3AC8A 4X2GA 5JFXA 1QCFA 4HOKA 3UP2A 4BWKA 4I22A 5IPJA 1W84A 5ICPA 3ORNA 4YZBA 2WKMA 2QOQA 4KRDA 3AMYA 4ZP5A 4CMTA 1UVRA 2IW9A 1GZ8A 2OF4A 2YFXA 4GH2A 4QMPA 3G51A 5AP5A 3A7GA 1R78A 4FUXA 5L2SA 4QMMA 3U51A 2V62A 3D7ZA 5G6VA 5KMIA 3KEXA 4YJTA 3OWKA 1G3NA 2EWAA 2X2MA 5CYIA 3E8EA 3KULB 3A4PA 5J95A 4IJPA 3NLBA 5CEIA 3R1QA 3FMKA 1NVQA 3GFWA 1WCCA 4IQ6A 2CHLA 2OFVA 2XP2A 3QRUA 1JNKA 2XKDA 3OTUA 3TWJA 2A19B 5LVNA 3I5NA 3KXGA 4HGTA 4B99A 2QOCA 1OL7A 3HMIA 4IWDA 3R9HA 2B4SB 1IEPA 2X1NA 4FSTA 2VWVA 4JDJA 4RQKA 5F9EA 2CGVA 2O63A 1DI8A 4FICA 1XQZA 3AD4A 4J8MA 2XYNA 4R77A 4ZTLA 5BYZA 2PVMA 3K5VA 4C61A 3V8WA 4QMZA 3CTQA 1PJKA 4RJ8A 5ETCA 4EOOA 1JLUE 2UV2A 4RC3A 4U41A 3VQUA 2BZIB 3VHKA 1ZYJA 4XCUA 3R7GA 2FO0A 2EB2A 3MW1A 4ASXA 5IU2A 3C13A 4ZK5A 5ANKA 4RBLA 1MQ4A 3R9RA 4HGLA 5IMEA 3GGFA 5EKNA 3ZC5A 3S1HA 4L7FA 3ZEWA 4F9BA 5DRBA 2OBJA 4FV1A 3OXTA 2ITPA 4FIHA 4I20A 1YI4A 3QA8A 3R73A 5A6OA 4JR7A 4NH1A 5AV4A 1ZY4A 4BCIA 2XIRA 4N6ZA 3N4UA 1YWNA 1OIRA 3WF9A 2VTJA 4C0TA 4DE4A 3MPAA 2CMWA 3GU6A 2QLUA 3BX5A 4EH3A 5FM2A 1X8BA 2QOIA 5B2KA 3QHRA 4YZNA 4IWQA 4IVDA 5IG1A 1OITA 2OJFE 4I24A 5EYDA 4HVDA 3NZ0A 4O0WA 4NU1A 5FD2A 4GYGA 4JBVA 4O0RA 3D2KA 2GNJA 5KBQA 3S2PA 4G9RA 4BDEA 3FHRA 2R3HA 4RG0A 1CM8A 4YLLA 5ETFA 3I0QA 3UQCA 3UNKA 4WRGA 3NWWA 2OGVA 1W0XC 4YPSA 2QLQA 3TUBA 3D7TA 1S9JA 5DLSA 2VAGA 4F63A 1PKDA 2BRHA 3VBQA 3DKCA 4MBIA 2ITTA 2GFCA 4WUAA 2BDJA 1WFCA 3D7TB 4UYAA 5IQIA 4EH2A 2YIYA 4O81A 1OKYA 4FMQA 1FMOE 4I1ZA 2O3PA 2WU7A 4KSQA 4KKHA 4I92A 2C1BA 2W1FA 5AUYA 4DINA 3C0IA 4CLJA 3LMGA 1EH4A 4KS8A 5AUVA 3VBTA 2XKEA 5GJDA 4X2NA 2JAVA 4C62A 3V5QA 3M2WA 3F3TA 5J9LA 4JT3A 4C2WA 2WTKB 3MPMA 5JRSA 2I1MA 3WYYA 2IZRA 4DAWA 4QMTA 4YJQA 5BUEA 1LP4A 3GU5A 2C47A 2IO6A 4Q2AA 3PIYA 3QKLA 2PUUA 3BU6A 3O7LB 4B6LA 4DEGA 4HCTA 2QKWB 3WZDA 5DPVA 3TACA 2UW3A 3EQGA 2R3OA 3BBWA 4M3QA 4OT5A 4M0YA 2I0EA 3ODYX 5M09A 2IW8A 4FSNA 5D9HA 3UZTA 4O83A 1FQ1B 3DZOA 4U6RA 1H25A 3TDVA 4EHZA 2X6DA 3F3VA 2WGJA 4XNEA 3SAYA 3ZH8A 5TE0A 3RVGA 3VJNA 4D4YA 3OHTA 3BBTB 5H9BA 2O65A 5K9IA 4F4PA 2GS7A 2Q83A 4HYUA 4A9TA 4IB3A 4GL9A 4C4IA 5I0BA 4BTMA 3R8PA 5A6NA 4RVKA 1Y8GA 4KS7A 3TNHA 3O7LD 4MAOA 4BZOA 4C33A 4USFA 5CSPA 4JRVA 2J50A 4M0ZA 2CNVA 5AP3A 2R0UA 4FBXA 4EYJA 1V0PA 3AGMA 4DC2A 5AAGA 3ZUTA 3LXPA 2QOKA 4X3FC 4AW1A 3UIMA 2HOGA 4GVJA 2YDJA 2O0UA 4JQ7A 3V8TA 5AA9A 3IS5A 2EVAA 2W4KA 3O17A 4FT3A 5CU4A 4OAVB 4TYGA 3DTWA 4FT9A 2G15A 3ORTA 4IIRA 4UV0A 2BTSA 3VUMA 5E8ZA 4QMNA 2YHVA 4FTTA 1V0BA 3WF5A 3ZDUA 5C8MA 3BZ3A 4FSUA 2VGOA 5C27A 2UZBA 2VTIA 4BY9E 4A4LA 2C6IA 4FNWA 4FEXA 4O0TA 4Z3VA 2CNUA 5C03A 3Q3BA 4AA4A 3D2IA 4CKIA 2G2FA 2OZOA 5JGAA 1RDQE 3OC1A 1HOWA 4NKSA 5H8GA 3PPKA 1M2QA 3DKGA 4GG7A 1XH7A 3WZJA 3BYVA 3PPZA 4B7TA 4G3CA 3BWFA 2E2BA 2J0MB 2R2PA 1KUTA 1U46A 2XM8A 3MH1A 4PF4A 5HEZA 4PNKA 4PNIA 4G5PA 1P5EA 3F2RA 1ZWSA 3KREA 1JSUA 3QCYA 5HD7A 3FMDA 1YXXA 4NCTA 2PMOX 4ZEGA 4LG4A 5L8KA 4ZLZA 1Q8UA 3GCSA 5FTOA 4QP4A 4OAUC 1BYGA 4QOXA 1YXTA 2W4OA 3QX2A 4BFMA 4JDHA 4IWPA 5HICA 4WBBB 1G5SA 4QMOA 4U9AA 2VGPA 1UWJA 4LL0A 5IA4A 4YSJA 2PU8A 3FHIA 4BC6A 4FT5A 2PYWA 3Q9ZA 3VW8A 3WF7A 3HV3A 5HO8A 4AT4A 4AZEA 4GK2A 3AD5A 1UV5A 2XNNA 4LFIA 2FVDA 2NRYA 1OECA 4AOTA 4BCPA 4M13A 2FB8A 2XB7A 3FLYA 5F94A 5KZIA 1KSWA 3Q52A 3FKLA 2XJ0A 2C5VA 2C0IA 3SV0A 1CSNA 3QCXA 4OBQA 2JDRA 2Y4IB 2P0CA 4J53A 2XNMA 5HU9A 3A62A 4PDOA 3QUDA 5M55A 5JFVA 3ZUUA 1PHKA 3COHA 2KULA 3BHVA 3OUNB 4WNKA 4Z9LA 5HE3A 3WARA 5IQCA 5EQPA 1H8FA 2BIYA 4I94A 5E1SA 4A07A 4AN3A 2ETRA 1SVHA 4CKRA 3V8SA 3L9PA 3MBLA 2CKEA 4LOOA 3F2NA 4KABA 2IJMA 4AOJA 2ITUA 4RLKA 5HESA 1JQHA 2R3PA 3DJ6A 4UN0C 5AUUA 1IG1A 2ONLC 2JDOA 3W18A 2HW7A 4TNDA 4PL4A 4RVLA 4O0YA 3HMOA 3LCKA 3QD4A 4NFNA 4IZ5A 3NEWA 3HVCA 3BGZA 4FIIA 4J95A 4M68A 4O7LA 3FC2A 2BZKB 2LGCA 5HG7A 3SXRA 4RQVA 1OKVA 1MRUA 3DBFA 4NUSA 1YOMA 4QQCA 3PIZA 4WIHA 2G2HA 4UMRA 4ANMA 2VX3A 3LFFA 4ZY4A 4JG6A 5KMOA 2X4FA 2CKPA 3WBLA 3LQ8A 4B0GA 4JOAA 4RJ5A 4ZIMA 5J1VA 5D41A 1SMHA 3H30A 1PW2A 4YHJA 2YCSA 5DRDA 1H1WA 4FUYA 4EOSA 5I9XA 4RIYA 3EKKA 3LCDA 3U87A 3NYOA 5H8BA 2WTCA 4BIEA 3VS0A 4MF0A 1KV1A 1OIUA 3I60A 2OO8X 3M1SA 4QPSA 3F3ZA 3VQHA 4ANSA 4DFNA 3MY5A 4WRSA 3VS7A 5CEMA 4S30A 4C57A 5HLWA 5AP1A 3T9IA 5E8VA 2WMVA 4O6EA 5M53A 3RK9A 1XJDA 2DQ7X 3COKA 3FDNA 2F7EE 1QMZA 4EYMA 3SXSA 2IZSA 3NAYA 3UP7A 4LUDA 4XHKB 3LFEA 2C6EA 3ORLA 4O0UA 3R8MA 4I5PA 2VNYA 4FVRA 4XV2A 5TF9A 2OJGA 5IMXA 2WAJA 3PRIA 4FYOA 3ZRLA 3FMEA 1R0EA 3IW7A 4RWLA 3EHAA 4A9YA 4XV1A 4C2VA 4UX9A 5HD4A 2DUVA 3FWQA 4RIYB 3QWJA 5CQUA 3CC6A 2R9SA 4DGMA 3R83A 4QMVA 4HGEA 4UMPA 3UOLA 4LGGA 5AUXA 1WVWA 3EL7A 4F6UA 3ZHPC 2P4IA 5IEVA 3MH0A 3UG1A 5IH6A 3LZBA 4NKAA 4RWJA 3QL8A 3RK7A 3VHEA 5IQGA 2E9UA 3OCTA 5GJGA 1OBGA 4IX6A 2OF2A 3DJ7A 4II5A 3FSKA 4LI5A 4QMLA 2W5AA 3BI6A 4KIOA 4TYIA 3RPOA 3A7JA 4AZVA 3B8QA 2XJ2A 5CU3A 5AP4A 3G0EA 4O82A 3I79A 5DH3A 3BYSA 4O1OA 1YKRA 4GCJA 4V05A 1YDSE 4IM3A 4OTQA 1DAWA 3PG3A 1Q97A 5AIRA 3W1FA 4IAIA 4ZSJA 3PPJA 1PXKA 4E6DA 4YHFA 2PUNA 3IOPA 5BX0A 1U54A 3TKUA 3BKBA 3A61A 3O23A 2C6KA 2Y7JA 4UMQA 2JFMA 3R8ZA 5LMBA 2CPKE 2UW0A 3TZ7A 4IX4A 2F2UA 2C6LA 2YAKA 5CENA 2YIQA 3ANRA 3UE4A 1J7LA 4BI2A 4ACMA 3EQPA 5EW9A 3Q9XA 2QO2A 3MIYA 4JJRA 3P5KA 3OW4A 5A46A 3N51A 3C5UA 5GNKA 2WEIA 3RCDA 3W33A 3VUDA 5IQFA 3G2FA 5AV2A 5DEYA 3TV6A 4AGWA 3QC9A 4UXLA 2V55A 2HZIA 4KINA 4BDFA 4O96A 2YABA 4YJUA 4CFVA 4TRLA 5HBEA 4KB8A 3W16A 2WMUA 3JPVA 2VTTA 3HRBA 3QUPA 1PYXA 4FVQA 5AIKA 3RK5A 4E4LA 3O71A 1QPJA 4WOVA 3QQLA 2UZOA 2VWWA 3PYYA 5HHWA 3ZLWA 1UNHA 3HLLA 3QQGA 4PTCA 3TN8A 4ALWA 4ENXA 5GINE 1PYEA 3BHHA 5HIBA 4PX6A 4KNBA 3ZSIA 4A9RA 3VBWA 1U59A 2JIVA 1WBOA 4JNWA 4AP7A 4Z7HA 5LMKA 4IDTA 2R3QA 3MH3A 4M97A 5DR6A 4IDVA 2OJJA 4DCEA 3FI8A 4HPTE 5C26A 3AMBA 4C4GA 2GQSA 3U54A 2WPAA 2HXQA 2QO9A 3PA5A 1JVPP 4LRKA 5CF4A 3MS9A 5BVOA 2W99B 3THBA 4ASDA 2IW6A 2R7IA 2WOUA 3GQLA 5I9VA 2WIPA 3C4CA 4N57A 3UO5A 4XG3A 5HGIA 4EI4A 3GBZA 2VTNA 1OVEA 4FTQA 4F09A 4L8MA 3P0MA 2QOBA 4E93A 4R1YA 3IPHA 3GCQA 2WTKC 3CPCA 4L67A 5HU3A 5DNRA 1FGIA 3IO7A 4AA0A 3IW6A 3G9LX 4H58A 4WT6A 2YA9A 1H07A 3HGKA 4R7BA 3DU8A 5FXQA 3EZVA 5FUTA 3IDCA 4O7NA 4Z55A 2RG5A 2C6OA 3TNQB 3O8UA 3ENHA 3U4WA 3NIZA 2VWUA 4XP0A 3ODZX 2ERKA 3ZO1A 4ZTQA 3E62A 4R7IA 4YJRA 4F9AA 2Y6MA 4RGJA 5HI2A 4F64A 1SVEA 1WBSA 2ONLA 4F9CA 4NW6A 4O2PA 4OTIA 3FZ1A 5AUZA 4Y85A 2J0LA 2WTIA 5HTIA 2XIKA 3P08A 4EJNA 5CSVA 3ORPA 3QFVA 4GT3A 1Q99A 4XLIA 1WBNA 2PVFA 3GNIB 4MYGA 3LW0A 3MFRA 4ZZOA 3BPRA 5HOAA 4CLIA 5AJQA 4EC9A 2QOHA 3VW6A 2UW9A 3R30A 3CTHA 3I6UA 3QQUA 4HNIA 4XG7A 3V5LA 3F69A 3VBVA 4CFMA 5EG3A 4HNFA 5BVKA 4NTTA 3K2LA 2RG6A 4F9WA 3QZFA 4IBMA 5F20A 4WSQA 4RX5A 3LXLA 4YJNA 3OBJA 4FT0A 3EZRA 4HJOA 2OIQA 1OM1A 4KSPA 3PSDA 3MVJA 4L42A 3ANQA 4AT5A 5A3XA 4U42A 4O7TA 1UU7A 3E87A 4I0TA 3G9NA 4TL0A 5BQ0A 3ZRMA 4ASEA 2JEDA 2P2IA 3QKMA 1XKKA 4BTJA 3F61A 2VRXA 2XIZA 2PZIA 5EDQA 5AR7A 1M7NA 1MUOA 3GCPA 3A60A 4FTKA 4FKJA 2ITWA 4DN5A 3QTZA 4PTGA 4BKYA 4CMUA 4O1PA 4N4SA 3PJCA 1UNLA 4FT7A 1NW1A 4G2FA 3AT4A 4JBOA 3ZONA 4ZMFA 4YZMA 2DYLA 5EW3A 4QMYA 4D0WA 3Q4ZA 4V01A 4RA4A 1ZARA 1Q61A 3G0FA 5J7BA 2YDIA 1YWVA 2R7BA 1VZOA 4I0RA 4W4WA 2RFDA 5DOSA 1MRVA 3FYJX 4X2KA 5FG8A 3H3CA 3RHXA 4QP7A 5E8UA 5FDPA 3C50A 4FKWA 3EH9A 3ZLXA 3RPSA 3DV3A 2GNHA 3ZO3A 3R22A 5JFWA 3ETAA 5BYYA 1APME 4LOQA 3OXIA 4U8ZA 4KKEA 1OGUA 3IQ7A 5JZJA 3A4OX 4IFCA 1ZRZA 5K3YA 2H6DA 4I93A 5CZHA 3S0OA 5HIDA 2GQRA 3CIKA 3FKNA 3I6WA 3QGYA 4Y73A 1PXJA 2JDTA 4EQUA 4D1SA 1GZOA 3FZSA 4D1XA 1GZKA 4E26A 4RIWA 4MHAA 3NUXA 3MFSA 5IEYA 5D11A 4BVUA 5I3OA 4BI1A 2R4BA 2BAKA 3ZSHA 1DI9A 2BCJA 2AC5A 3RTPA 3KMUA 4F9YA 3TDWA 1PKGA 4XLVA 3NNUA 3H0ZA 3I4BA 3OT8A 4NM5A 4EZ5A 4R5YA 2QR8A 1U5RA 1JPAA 5IDNA 1O6LA 3KF4A 2UZEA 3MVMA 5B2MA 1Q8YA 5A4EA 2V7OA 5CS6A 3FQHA 3C4XA 4WSYA 4D2VA 5HTBA 1OB3A 3TI1A 4JS8A 1KV2A 3VF9A 3NNXA 4E5BA 4EKLA 2BKZA 4PL3A 4O38A 2XA4A 1T45A 1MQBA 4A06A 2VWIA 4YNEA 2A27A 4EOPA 2FSLX 1H0WA 4MF1A 1FINA 3DXPA
chains in the Genus database with same CATH superfamily
3TZ8A 5E8WA 3QTQA 4EKKA 3MESA 3A99A 4S31A 2WQBA 4RSSA 4IX5A 4BYJA 3HV5A 1CDKA 4IAFA 3OY1A 3FI4A 4CD0A 1LR4A 3OF0A 3PE2A 4L00A 2X9EA 4AACA 4YURA 5IQDA 4YMJA 2ITXA 1H4LA 4YO6A 4IXPA 1H08A 4GEOA 5FBNC 5M56A 1Q62A 2ITNA 2WMWA 2HY0A 1DM2A 4E6QA 2JKKA 2QI8A 4FR4A 2C4GA 2OXYA 3ZMMA 3FMJA 3P7AA 4ACCA 4XS2A 3W2RA 3FI2A 4S34A 4C36A 3ZFXA 4CKJA 3R71A 4CMOA 3UOJA 4QDVA 3GQIA 5EQEA 4AGCA 4Q5EA 5CAUA 5CVGA 5CSXA 1WVXA 2OW3A 2WNTA 3R00A 3SW7A 4QNYA 3WE4A 4ASZA 1H26A 3FLWA 3HMMA 4M15A 5F4NA 3TG1A 3Q4UA 4CZUA 5A4LA 2ZDUA 2BAQA 4AZSA 2OZAB 3GVUA 2R3IA 1U54B 2YDKA 3IK3A 1YQJA 4I21A 3RNIA 2Y6OA 4HZSA 2X81A 2YISA 5C4LA 1H1QA 3RJCA 1GZNA 2JC6A 4RIXB 4FV5A 2PVKA 3NRMA 4F7NA 3B8RA 4EQCA 4BKJA 4BRXA 4C7TA 3BHYA 1M2PA 3KMMA 4X3FA 3ZZWA 4C59A 4GT5A 2NO3A 3E3BX 4GMYA 2Z7LA 4RJ4A 4RLLA 3RMFA 4EOLA 1FGKA 5I4NA 3IG7A 5E8YA 3ROCA 5CF8A 2R3JA 3NCZA 1UU8A 4G6LA 1Y6AA 2ZV9A 4OTRA 3TZ9A 4BDKA 4CQEA 3Q96A 4QMUA 5AEPA 3A8XA 2W5BA 2ETMA 3ATSA 3KRWA 4PPAA 3BU5A 3ZRKA 2FYSA 4CFNA 4Q9ZA 5AV1A 1H1RA 1UKHA 2OI4X 2E9PA 2VU3A 3GC9A 2HZNA 5EI8A 4FKPA 4LOPA 3REPA 3TV4A 3KL8A 4BCFA 4O7VA 5EQYA 4IJ9A 3MH2A 2VTQA 2WIHA 3PA3A 4O0VA 4GS6A 3EL8A 4UWBA 5E8TA 4U97A 1ZZLA 3R1SA 2ZAZA 5DFPA 3ZM9A 2YM4A 3P79A 3SD0A 3EN4A 2XK9A 5M51A 4LMUA 1H0VA 4APPA 2JGZA 5CAPA 2WZJA 4LL5A 3O2MA 4ZTSA 2CJMA 4DHFA 5ANDA 4X0MA 5HKMA 4CQGA 3TM0A 5L3AA 3E93A 3TEIA 5KO1A 3DAJA 3DFCB 3SW4A 5LVPA 3QZHA 3U6IA 3UPZA 4MD8E 5HNBA 3ZO4A 2QODA 3ELJA 5CAOA 4TTHB 4HCVA 2QCSA 1BI8A 1P14A 4M8TA 2YM8A 3GENA 5AV3A 3EQHA 4PTEA 2XIXA 2YACA 2PULA 3WILA 4KWPA 2O64A 4M67A 3VUHA 1SNUA 3ZU7A 2C6DA 3U6HA 3QALE 4QTDA 4CCBA 5KX8A 4FG7A 4BGGA 4FSMA 4KIKB 5BVNA 4NT4A 3HP2A 3MY0A 4LUEA 1OPJA 5K4IA 3PRFA 2W1DA 2XRWA 5HBHA 3DXQA 4IX3A 4NZWB 1IRKA 4BDAA 4FODA 2WELA 4ZY6A 3N4TA 3RINA 1XBBA 1UKIA 5HVYA 4KRCA 4QMWA 4DFYA 1ZMVA 3CS9A 5DE2A 5JGBA 2ERZE 1S9IA 5CI7A 4BWPA 2YLFA 1Y8YA 4IVBA 3VS4A 5LCKA 5DYJA 4BDCA 1L8TA 4I23A 5EI2A 4C35A 4DH1A 4JX3A 2H9VA 3FY2A 4JLCA 2Z2WA 3P4KA 4ZY5A 3PLSA 1XO2B 1P2AA 2VTLA 5DI1A 1KE9A 3NS9A 3QYZA 4IADA 4J98A 4I0SA 5FEDA 4D2RA 3CLYA 2XCHA 4FZ7A 5EDRA 2XRUA 3DA6A 2QOLA 3OEFX 3PFYA 2VWXA 3P23A 2QURA 2CGXA 3H4JA 4H39A 3TZMA 2CNQA 2A2AA 3GU7A 3UTOA 1YOJA 4D2SA 2BILB 2IG7A 4MNFA 4QTCA 5M4CA 3LHJA 2CLXA 2VTPA 5HG9A 4BB4A 5KMLA 5ITAA 3WF8A 4IVCA 3PJ2A 3CCNA 4F7SA 4NEUA 1QPDA 1URWA 2QHMA 3EYGA 5AR5A 4QQ5A 4UMUA 3M11A 3QRTA 2QVSE 3QA0A 2VTOA 3GUBA 5A54A 4CFFA 5J8IA 2YWPA 4FV0A 1CKJA 3IOKA 3O8PA 3V6RA 2PZRA 3OWLA 1TFFA 2XIYA 4E4MA 1Y57A 3CSVA 4ZS4A 2UW8A 3QLFA 3MVLA 2UVXA 3D14A 4TYHA 2EUFB 4BTFA 3LMIA 1W7HA 3GP0A 4TPTA 4GKIA 3OTVA 4FSWA 4MCVA 4YP8A 3C4FA 3WIGA 5JQ8A 5DGZA 2XS0A 3ORMA 4DEHA 4F0GA 3QD0A 3BU3A 2R0IA 3FMMA 3QD2B 3R9DA 4AZFA 3F88A 3NCGA 2GCDA 4TNBA 2JBOA 3UVQA 2G1TA 3ZBFA 4AZTA 5KNJA 1Z57A 4AX8A 3HAVA 4ZJJA 3TKHA 1K3AA 3PXFA 2F4JA 3DNDA 4FNXA 4FKRA 4FKOA 3IW5A 2J0IA 2W1CA 3KRJA 4RJ6A 4U7ZA 4HYIA 4FKGA 5HCZA 5GZ8A 3CP9A 1IR3A 4FV6A 3VJOA 1CMKE 4ZLOA 4AAYA 4I4FA 2VV9A 4C3PA 3K3JA 4O7ZA 1OZ1A 3DB8A 2BZHB 3F3WA 1I44A 2W1HA 1RJBA 4WG4A 3RZFA 4BJJA 4RZWA 4YHTA 3WOWA 3FXXA 4FSZA 4W9WA 2OFUA 3SRVB 4I3ZA 2WMRA 4D28A 3NVMB 2X9FA 4GU9A 3BGQA 3QQHA 1OKWA 4QP1A 4QYFA 1OUKA 4QMQA 2B52A 4RIOA 1F0QA 4HZRA 5AP0A 3PFQA 2GHLA 1PXNA 1JOWB 4FVPA 3VNTA 2XZSA 4AWIA 4FKSA 5HNIX 4RRVA 3NFFB 3QZGA 5AP7A 3RZBA 3UDZA 3HX4A 5J5TA 4F70A 1WBTA 4FIFA 4NM0A 4WG3A 4JI9A 4RVTA 1WBWA 3EMGA 5CX9A 1GIIA 3VRZA 3KRRA 1KOAA 1TQMA 2GTNA 4FRFA 4CT1A 4L7SA 4XUFA 3Q5ZA 1STCE 1WBVA 5GJFA 3UMXA 4OBOA 4CVAA 5HX6A 3LLTA 3MJ1A 4Y5QA 5JT2A 4DFBA 1KOBA 3VF8A 4CT2A 1M7QA 5TOZA 5HLPA 3PY0A 1RW8A 2XEZA 3ZXTA 5JGDA 5CXZA 2XYUA 3DTCA 2WMXA 5C4KA 4XOZA 3ZOSA 3QTXA 3RPVA 4UXQA 5M4FA 3DQXA 2WMQA 5FXSA 3SDJA 3F5GA 3U6JA 3K3IA 1OI9A 4XP2A 4GKHA 3CXWA 1XH8A 2ITYA 4X6QC 3AC5A 2Z02A 5L8LA 1XR1A 2OJ9A 3I81A 5IUHA 3E8DA 3O51A 4C02A 3TUCA 4GT4A 4K33A 4PL5A 2VTSA 3QWKA 4WNPA 3EQCA 3HL7A 4AU8A 3R8UA 5FTGA 1H01A 2XJ1A 4Q9SA 2GFSA 3OZ6A 4FTUA 3L8PA 5I9ZA 4MQ1A 3VS2A 2CKOA 3JR1A 1ZYSA 4O84A 5LXMA 3GCUA 5CEPA 5I9WA 4F6SA 1KWPA 2VO0A 2JKOA 3COMA 3TNIA 4ZOGA 4EUTA 4RMZA 3VUKA 4O4FA 4FJVA 3KC3A 4G34A 4X7QA 1REJA 4YJOA 4FSQA 1P4OA 3AC2A 1H28A 3HUCA 4FIGA 3IECA 4KA3A 4S2ZA 4AW2A 4JBQA 4QP9A 5ETAA 4O7SA 4I5HA 2PY3A 3LFSA 4GFMA 4FX3A 2ETKA 4IB1A 1AGWA 4GRBA 3HP5A 3EN6A 3N9XA 5ANEA 4V0GB 3AC1A 3VS3A 4EK3A 1T46A 2F2CB 3OWJA 2BZJA 4FTNA 1ZY5A 4AG8A 3KQ7A 3OY3A 3FJQE 4CTBA 4HW7A 5EM6A 3SX9A 5HLNA 3IGOA 1CKPA 4CNHA 3FLSA 3PP0A 3LXKA 4H1MA 3OEZA 4MH7A 4IZYA 4AXAA 5BNJA 2PZPA 3W2PA 2QNJA 4BCKA 2ZMCA 4ANBA 5L6OA 5T6KA 3ORKA 4L01A 4AAAA 3FI3A 4ACHA 3NIEA 4FL1A 2WEVA 3CQUA 5IH5A 4FKQA 4D2WA 5AMNA 5JH6A 1E1VA 4XG4A 4Y5HA 3TL8A 5AADA 1Q3DA 3SQQA 3MPTA 5BVEA 3F3UA 5IQBA 3LAUA 3CY3A 2YCRA 3BLRA 3T3UA 1IA9A 3CQEA 4D5KA 3S4QA 5DMZA 4M69B 4YZDA 4BGQA 5JK3A 1YI3A 2ESMA 3LVPA 4NL0A 2B9JA 2W9FB 5KMJA 4CFUA 5J1WA 3BEAA 5AWMA 3KRXA 4BBMA 4FG8A 4BDGA 3ULIA 2JITA 3NUSA 5EDPA 4WNOA 3VUIA 1Q4LA 4W8DA 1MP8A 4K1BA 1URCA 4MWIA 5EH0A 2XBJA 2CCIA 3OROA 5BMMA 4FZFB 2O5KA 4XJ0A 3TIYA 4IM0A 4NIFB 3MSSA 4UWCA 5L2WA 3L9LA 1ZXEA 3MJ2A 3NSZA 2KTYA 4DFXE 3Q4CA 4IAAA 2GU8A 4AXDA 3Q9YA 1PXOA 4LGDA 1GNGA 3FKOA 5AA8A 2VTRA 3UODA 2CKQA 2O8YA 4D1ZA 1R1WA 3UZPA 2I6LA 1W2FA 1CKIA 3G90X 5A14A 1XWSA 3ZS5A 4BCQA 4E1ZA 3IW4A 3HV7A 4QMXA 4PMMA 3Q60A 5BVWA 3SC1A 4MQ2A 3F5PA 2IPXA 2J0KA 4GW8A 4P4CA 3MA6A 3R02A 2RKUA 3MYGA 4S33A 4USDA 2WMSA 2V22A 4YBKA 1XH9A 3PSCA 4YNOA 5AUTA 4GIHA 2F7ZE 4QYGA 4XOYA 5ANGA 1FVRA 2QO7A 3GI3A 3L8VA 4F0IA 4K2RA 4BI0A 2X0QA 1KE7A 3T9TA 3BL9A 4LGHA 2C30A 3QLGA 4G5JA 3UYTA 3UQGA 1YVJA 4ZSLA 4L3JA 2W06A 2Y4PA 3E3PA 2PVLA 5IUGA 3E7OA 4C4JA 3RWQA 3V01A 4EORA 4GYIA 3FPQA 3WI6A 4D58A 3DKOA 4JAIA 2Y0AA 4EWQA 3BYUA 1YW2A 3KN6A 3ZZEA 4HVGA 2XNEA 3FXWA 2HENA 4JIAA 3POZA 2RFNA 3QYWA 5EHOA 4FOBA 5C8NA 4JG7A 5BYLA 2CCHA 2ZV8A 5B0XA 4ANQA 1JWHA 2G2IA 3PY1A 5L8JA 4ALVA 4KUJA 2Y4IC 4LRMA 2QQ7A 4YTIA 4D2PA 1YHVA 2V5QA 4OR5A 2XEYA 5ANJA 5IQAA 2BRGA 4BBFA 5IQHA 3DFAA 2PE1A 3UC4A 5E90A 4TKSA 2R64A 2CGWA 3GXLA 5KKRC 5H2UA 3UDSA 4AOIA 2IVTA 2J90A 2VD5A 3CGFA 4BBEA 3O8TA 3EQBA 3F66A 4J8NA 4M66A 4PUZA 4B9DA 4E4XA 5D7VA 2CDZA 5HVKA 5KUPA 4ORKA 3D4QA 4JXFA 4OTPA 4YU2A 4D0XA 3TNWA 3VC4A 4EH4A 4FV3A 5KZ0A 5FP5A 1F3MC 2O2UA 4K8AA 4WKQA 1JKLA 4RWKA 4WA9A 2W9ZB 3PSBA 4FTOA 4F08A 3ZDIA 3KK8A 2OXXA 2IWIA 3IW8A 3PXQA 4UALA 5LMKC 4XG8A 4O4DA 2ZVAA 4TWNA 4X3JA 4YTFA 3PVGA 3U9CA 3F7WA 4QQJA 5IA1A 5AR2A 3VWAA 3CE3A 4EH7A 2J6MA 3HEGA 3P78A 5EYMA 3GC8A 3NUAA 3QTIA 1OPLA 4ID7A 3R8VA 4B4LA 1OIQA 4QMSA 1B39A 4XRJA 4QDEA 4E4NA 4ZSEA 2UZTA 2H8HA 2HIWA 4I6HA 3GFEA 4WD5A 3FE3A 5EHYA 3Q6WA 3T8OA 5HX8A 4P7EA 4APCA 4N0SA 4PMTA 4PV0A 5M4IA 1GIHA 2HZ4A 1YHWA 3MWUA 1ST4A 3DCVA 3LLAA 3NUYA 2JBPA 4QTEA 2WMBA 3MTLA 4DGLC 4F78A 3ENMA 4ZTRA 3AT2A 3SOCA 2BUJA 2JIIA 3PLAE 3BV3A 5DBXA 3ID6C 4C8BA 4U81A 3C7QA 2QOFA 4ZXTA 1ZZ2A 4EH9A 2CN5A 5CASA 4QP2A 5IH4A 1XHAA 2GTMA 2W1ZA 2ZMDA 3CD8A 3PIXA 1KE8A 1OBDA 4EOKA 4OTGA 4OT6A 5FEQA 3RWPA 5HE1A 4EL9A 1IAJA 3KA0A 2GHMA 4M84A 2YIRA 2A4LA 2X8DA 3I7BA 4IB0A 4CRSA 2FGIA 3OT3A 2W7XA 4CGAA 4JDIA 5M06A 4DG0E 4GK3A 2UW6A 1YHSA 2XH5A 4FV2A 4RX9A 4FF8A 3PJ3A 3DS6A 2XK6A 1QPCA 2X7FA 2ITOA 1XMMA 3C4WA 1BX6A 1M52A 2C5OA 3PA4A 3RGFA 4LRJA 3HDMA 4ZSAA 1VEBA 4YLKA 2PVNA 4FG9A 5FGKA 3Q04A 2B9FA 4ALUA 4FEUA 2C69A 3GT8A 3KFAA 3WIKA 3Q5IA 4CV8A 3OOGA 3MFTA 2P55A 1FMKA 3E64A 3LOKA 4JG8A 3PVWA 2QHNA 3KMWA 4PRJA 5GZ9A 3UYSA 4BN1A 1AD5A 2ITQA 3Q4TA 3FMHA 4NTSA 2DS1A 5IQEA 3AMAA 3VUGA 4W4YA 3QQFA 3W2SA 1YXSA 2PVYA 3LJ2A 4QYEA 4X2FA 4AN9A 3II5A 3SA0A 2YCQA 4EBVA 3OP5A 4O2ZA 3UG2A 4XBUA 4AZWA 3HDNA 4FA2A 4DFUA 2XK8A 2PZ5A 4AFEA 1WBPA 5LWMA 5E4HA 2ZM3A 4RFYA 4G6NA 4QPMA 4CV9A 4TT7A 2IVUA 1HCKA 4FK3A 1LUFA 1UU9A 3BE2A 2UUEA 3C4ZA 3PJ1A 2WFYA 5IA3A 4PDPA 3HMNA 4X6RA 4EK8A 1OMWA 5E8XA 3RPRA 5C8KA 2AEGA 4CFWA 4D2TA 2NYAA 4QPAA 4DBNA 5C01A 2VWZA 3HRCA 4EONA 4ERWA 5BUIA 2IN6A 2BFYA 2W5HA 3L9MA 4G1WA 4QO9A 1XMLA 3HUBA 3CEKA 2BIKB 4IE9A 5CT0A 1OL2A 5ANIA 5G1XA 3AXWA 3NNWA 3MB7A 3SRVA 4EH6A 5FTQA 3NX8A 3ROYA 4D5HA 1PRYA 3OUKA 4KAOA 3ERKA 5LVOA 4AN2A 5DR2A 5CEOA 3KXHA 1VLRA 3HV6A 3D0EA 3K5UA 4H3PA 4B8MA 2W05A 4I5CA 3VBYA 3VUTA 5AFVA 4L3LA 2A0CX 3DB6A 3JXWA 1SM2A 2OIDA 4O4EA 4PQNA 5HNGA 1NY3A 5EI6A 4DF3A 2XUUA 2REIA 3BQRA 3VIDA 3ZLSA 4AW5A 4BCJA 1FBNA 2WTVA 4BTKA 2QG5A 4CFXA 1ZYDA 2W0JA 4FKVA 4DH8A 4FI1A 3E8CA 2GNIA 2YEXA 2YJRA 3FZOA 4H36A 1Y91A 3H9RA 3UDBA 4CYIA 1W98A 4BDBA 3HAMA 4I6FA 3PWDA 4N6YA 3IONA 5AP6A 3UQFA 3M42A 3PVBA 3RAHA 4FZDB 5AAEA 3H9FA 4DGGA 4DT8A 3OOMA 1BL6A 1NA7A 3EFJA 5AV0A 4FL3A 4C4EA 4YR8A 1YXUA 2BHEA 3W8LA 3ATTA 3D83A 3AKKA 3QU0A 1E9HA 1MRYA 2QONA 5AX3A 4CXAA 3E8NA 3NUNA 3SG9A 2BRBA 3TMOA 5EHLA 2PSQA 3LE6A 3NGAA 4IAZA 4TYEA 3S95A 4YTHA 4F1TA 4AW0A 4ZZNA 2OH4A 1REKA 5DT4A 2C6TA 3QTWA 3G15A 4QTBA 3TNPC 4GJ3A 4R6VA 4ZZMA 4BCOA 2ZB1A 3MGYA 3ZEPA 3W0MA 1O6YA 3F5XA 5D12A 3QXPA 3BQCA 4FSYA 3LFQA 4K9YA 4XV9A 2X0GA 4O0XA 4TWOA 4FGBA 5ETIA 2FUMA 2PVJA 4M69A 4KIQA 3ITZA 4QP3A 3Q2JA 4RA5A 4DEAA 3QRKA 2JD5A 3WZEA 4TYHB 1AQ1A 1H24A 3DKFA 2WHBA 3EIDA 3KU2A 5EKOA 1W83A 4FK6A 3DBEA 5E9EA 2OU7A 3TJCA 1YI6A 3BE9A 3KY2A 3LKMA 4M14A 2GPHA 4XG6A 4DTAA 3UVRA 4EH8A 2QOOA 2OIBA 4G6OA 5HE2A 4DG3E 4WO5A 4IAYA 2W17A 2WQEA 4BIBA 1G8AA 4RJ3A 1Z5MA 1WVYA 3ALNA 2P2HA 4MD9E 1KE5A 4DBXA 4G31A 4X2JA 3VULA 2ZDTA 3BYMA 4V0GA 1IA8A 3PE1A 2R3GA 4G9CA 4L44A 4U0IA 5CU2A 4ZTNA 2OICA 3O50A 4Y46A 4AE6A 4JBPA 3CQWA 4RPVA 3QCSA 3BYOA 4I41A 4EBWA 5KMKA 1QPEA 5I5ZA 1QL6A 3PY3A 2W1IA 3K54A 2ZM4A 3HYHA 5K5NA 3ULZA 5KCVA 4FL2A 2PPQA 3ORIA 3LFDA 4WBOA 3L8XA 5LJJA 2PE0A 3D5WA 3B2WA 3A7FA 4JQ8A 1V1KA 3KGAA 2BROA 3ZYAA 3HRFA 4MBJA 1WZYA 1ZMWA 3U55A 4BR3A 4A9UA 2XM9A 2Z8CA 3L8SA 4DG2E 3WZUA 3LM5A 3LIJA 1SNXA 3DGKA 5AP2A 3H9OA 3UC3A 4A9SA 4DTBA 2YM6A 4DITA 2FH9A 3E88A 1UNGA 3V04A 4QT1A 1B6CB 2XMYA 3TCPA 1Q24A 2HCKA 4CG8A 2YLEA 2F7XE 2W4JA 3BIZA 3CY2A 3NUUA 4FIEA 4LYNA 4N70A 1Q3WA 4FV9A 4O22A 1HCLA 2H34A 1Y6BA 2LAVA 5IF1A 4FEVA 3LPBA 3MB6A 5DWRA 3FLNC 3NYNA 4Y8DA 3NW5A 4XG9A 4L9IA 2RGPA 4MXYA 1BUHA 5C9CA 4EHEA 5HG8A 2GMXA 4FKTA 1ZYCA 3O96A 4C3FA 4MBLA 3EFKA 2R3LA 2R3FA 3UIBA 5HO7A 3LQ3A 3D5XA 4RFZA 2A98A 2IF8A 4FEQA 3OCGA 4Q5HA 4D4SA 2XF0A 4TN6A 4EH5A 5L4QA 3JUHA 4FKIA 5K4JA 2QU5A 4JVGA 4J1RA 4ACGA 1LEZA 3EN9A 2E9VA 3FLZA 5BMSA 3FUPA 3RHKA 2YZAA 5FEEA 3EFWA 3EQIA 4R1VA 3KRLA 4RZVA 5CU0A 4Y95A 4K6ZA 1PF8A 5M4UA 3PP1A 5EOLA 3EWHA 2AC3A 4U3YA 5CF5A 4BHNA 4MXXA 5DR9A 3R7IA 4CZTA 4E5WA 3UNZA 1WAKA 2PMIA 3QC4A 3LCOA 4ARKA 4AUAA 4EUUA 3RAKA 4E6CA 4U44A 2XCKA 5KE0A 2NP8A 2JLDA 4WUNA 3AC4A 3O5AA 4IWOA 5CAQA 5FXRA 5ACBC 4FKUA 3VS1A 5JKGA 3GOKA 2QC6A 4JX7A 4LDTA 5DIAA 1J91A 4R5SA 2WTWA 3KXZA 4L6QA 2P3GX 3BGPA 4UYNA 5E91A 1FOTA 3P86A 2RF9A 4FC0A 4LV5A 5HVJA 2UZWE 2HZ0A 4H1JA 4EZ7A 3MIAA 3OCSA 1M17A 2YERA 2HYYA 4NYEA 4HYHA 5AR4A 5GHVA 3CD3A 5B7VA 3HA8A 3RM7A 3W2OA 5AUWA 5TR6A 3BL7A 3DAKA 3FBVA 3OCBA 3R21A 1CTPE 2YM3A 4FOCA 3UIUA 5F95A 2ZYBA 4FTAA 4MEDA 3HNGA 3C4EA 3NYXA 3C0HA 3S3IA 1Q8ZA 4KKGA 3TUDA 3UOKA 3AKLA 3AGLA 5HBJA 3AT3A 3QKKA 4G3EA 3DOGA 4ZSGA 3DQWA 1IAHA 2I0YA 4FEWA 4L68A 4MK0A 3NPCA 3VVHA 2QKRA 3NYVA 4PMSA 2BFXA 1M2RA 4I4EA 3JYAA 5KMNA 4ZTHA 2YIWA 4OUCA 3E92A 2CLQA 2G01A 3DK6A 1NVSA 4YJPA 5C1QB 3QD3A 3ZCLA 3V51A 2XK3A 5CAVA 4OTWA 1PMVA 5BVFA 2YN8A 5JEBA 2VTAA 3LFBA 3U8WA 1GOLA 3W8QA 5DT3A 3EKNA 5IZFA 2C0TA 2HK5A 3TKIA 4IAKA 4YJVA 4F0FA 3R1NA 4RVMA 4EJ7A 3PXZA 5IA5A 5JQ5A 4FNZA 4F99A 2BTRA 2P33A 1H1PA 1Q8TA 2WMTA 3R9OA 3W55A 4BKZA 3FL5A 3ALOA 1VYWA 3AOXA 4BZDA 4C34A 3FMNA 3FL4A 4EOIA 4QP8A 3LMHA 3PG1A 4O0SA 3EN7A 2GNFA 4DLIA 3DNEA 4IB5A 1Q5KA 3HMPA 2XNGA 1Q8WA 4PY1A 4BDDA 4F65A 3R04A 4FV4A 4H3BA 3R7YA 4ZS0A 5BUJA 1R0PA 3RNYA 1ATPE 2IVSA 3NNVA 4EK5A 5D10A 2VX1A 3PZHA 2E9NA 4RIWB 3KVWA 1W2CA 3I5ZA 3LCSA 4GJ2A 4NM3A 2BHHA 5E1EA 4A4XA 3QHWA 5FP6A 3KULA 4ERKA 5HORA 3FMLA 4V04A 4Z7GA 4L43A 2B0QA 3Q53A 5CLPA 4PMPA 5IDPA 5GIPE 4O91A 4GUEA 4ZJVA 4FTIA 2VZ6A 3EJ1A 2FA2A 3UO6A 4U45A 1VYZA 2OXDA 2EU9A 4ZAUA 3S00A 4ANNA 3G6GA 1PXIA 2BALA 2A1AB 2EXEA 2J51A 1TQPA 5I9YA 3QCQA 2WB8A 3GOPA 5KHXA 4PP9A 1SZMA 2B7AA 2RFSA 2C5NA 2X2LA 4A4OA 4D4RA 4KIKA 5T3QA 2PMNX 4NCTC 3UPXA 4I6BA 1GJOA 4IEBA 4HVHA 4BCNA 4KIPA 2J4ZA 5CANA 4X21A 1GAGA 4CZYB 4IVAA 3DDQA 5CVFA 4OTHA 1WMKA 2Z7RA 3JY0A 3RP9A 3SKCA 2YCFA 2R3NA 3LJ0A 3DY7A 2Q0NA 1V0OA 2UW4A 4FKLA 3NR9A 1BI7A 4PWNA 4MUQA 4GFGA 3D5VA 4JL9A 2OSCA 4GSBA 4R7HA 4DEIA 2X4ZA 3PXYA 4R3RA 2EXCX 2C3LA 2X2KA 1DS5A 3JY9A 4EOMA 3N4VA 5LVMA 1K2PA 3RAWA 4LV8A 4YGAA 4CRLA 3LFCA 4PPCA 3PXKA 4U3ZA 5DN3A 1IASA 4J99A 3D94A 3F2AA 2J5EA 4JR3A 2UZDA 1E1XA 2VX0A 3CKXA 5CXHA 4D55A 2J9MA 4TW9A 4FTJA 2EB3A 2VWBA 3C1XA 2BAJA 1YDRE 1BMKA 2RSVA 5I9UA 3JVRA 3JS2A 4J97A 3DT1A 3BLHA 5LARA 3TXOA 3R9NA 3WE8A 4J71A 3ZUVA 4BDIA 4UBAA 4W8EA 5K0KA 2PHKA 4EQMA 2VO3A 4DEDA 1A48A 3W0SA 2I0VA 4H3QA 1UU3A 4O21A 4XMOA 5T68A 1J3HA 4RT7A 1DAYA 2VWYA 3KVXA 1NXKA 4TYJA 4DH5A 5J9YA 5L2IA 1U4DA 2FSOX 3PTGA 5EM8A 1PMNA 3QTSA 4BF2A 3SVVA 5LOHA 4MX9A 4ITJA 1KE6A 1O9UA 1ZAOA 4CCUA 4EZ3A 5H3QA 3KKVA 4DEBA 3AKJA 4G3DA 4FNYA 3ACKA 4R3CA 2GQGA 4CSVA 1ZMUA 5EK7A 3OBGA 4C58A 3VAPA 4IM2A 5L2TA 5DG5A 4DTKA 2VTHA 3QBNA 5ACKA 5CEKA 4I6QA 5DHJA 4USEA 5GZAA 2GDOA 5CU6A 1TZDA 2JKQA 2W96B 3EQRA 4TY1A 2QG7A 3TTJA 3UJGA 3SXFA 3IDBA 4D9UA 3EFLA 3W32A 4KD1A 4PDSA 4UZDA 2W1EA 4LM5A 3MY1A 3NFGB 2B53A 5EW8A 2PWLA 5CSWA 4NSTA 3CPBA 4QTAA 1XH4A 3TIZA 1U5QA 2WXVA 3C51A 3IDPA 3RI1A 4E5AX 3JVSA 3TJDA 2UZNA 2OKRA 4C3RA 3PDTA 4IC7A 3W0PA 2H96A 4YC8A 4HPUE 4NJDA 3QRJA 5FDXA 3OS3A 1ZOEA 4M7IA 2NNWB 5J7HA 3FAAA 1ST0A 1JAMA 2PMLX 4BCHA 4E7WA 4TZRA 3FPMA 4E73A 4WHZA 3EQFA 5EYKA 2QR7A 3UIXA 1JKTA 1OKZA 3DLZA 4MKCA 3V6SA 4J7BA 5IKWA 5AM7A 3OW3A 3R7OA 4AF3A 2BPMA 3R0TA 3GCVA 2IEWA 4FGRA 3A8WA 3F7ZA 2GSFA 3D15A 4C38A