2PY3A

Crystal structure of fgf receptor 2 (fgfr2) kinase domain harboring the pathogenic e565g mutation responsible for pfeiffer syndrome
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
299
structure length
282
Chain Sequence
LPEDPKWEFPRDKLTLGKPLFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVGYASKGNLREYLRARRPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Fibroblast growth factor receptor 2
publication title A molecular brake in the kinase hinge region regulates the activity of receptor tyrosine kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 282
sequence length 299
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2py3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2py3A01
2XK3A 1Y8YA 2ZMCA 3F69A 2HXLA 3OWLA 1Q61A 3G90X 4W8EA 5CLPA 4EK3A 3AC3A 2UW4A 3ZLYA 1ZLTA 5IDPA 4H1MA 4FKVA 2GPHA 3V5JA 2ERKA 4WNPA 2YIXA 4C33A 3NR9A 2DYLA 3MVLA 4L53A 5DT4A 3ROCA 4FX3A 3OW4A 3FXXA 4IADA 3DTWA 4U7ZA 1WBTA 4HVIA 3QCSA 4ORKA 4FC0A 5CS6A 5CEMA 2GS7A 2ZM4A 2HZ0A 4H36A 4P5QA 5HE0A 4BGQA 3U54A 3MS9A 1KSWA 3PJCA 4X6RA 3GB2A 3WF7A 4ANNA 4C4GA 4EOSA 4AF3A 5J9YA 4IMYA 5I3RA 2B0QA 1GY3A 1Q24A 4AW1A 2B4SB 3NRMA 4EJ7A 1OUYA 1MRYA 3R01A 2YABA 4BCMA 4MWIA 4ZS4A 2XZSA 3NW7A 5TOZA 3H10A 5HQ0A 4FYOA 4EC8A 3QQHA 3CPCA 1JOWB 5EQPA 2OG8A 3FMHA 4O1PA 5A4EA 1M7NA 4IVCA 4R5SA 3ZRKA 1VEBA 4EK6A 4QMQA 1CSNA 5CX9A 1GIHA 1OKZA 1ZYSA 4R3RA 5TKDA 4ENXA 4RIXA 2OU7A 3KXHA 2DWBA 3W2QA 5EOBA 3ORNA 5AP3A 2JDVA 3QCYA 4Q9SA 4QO9A 5FM3A 3F3UA 5KZIA 5FQDC 3PXRA 4ZY6A 3E7VA 1IA8A 2X9FA 1H07A 2B9IA 3QQFA 2FA2A 4FIIA 3PVGA 4FTQA 3NAYA 4K6ZA 3Q2MA 2CKPA 4RFMA 5KHXA 1URCA 4FG7A 3RM7A 4FKWA 4FEVA 1YWNA 2VWYA 2YM5A 4FZ6A 3N4VA 1OZ1A 2BZJA 4N0SA 5HTCA 4GK2A 1OECA 3FI3A 3OXZA 5HO6A 3HV4A 3O8TA 3K2LA 3FZPA 3KA0A 3OXIA 3QUPA 4EHEA 4ZSAA 1VJYA 1KOAA 4TYIA 4ZP5A 1GZ8A 4ANQA 2XUUA 2XS0A 4GUBA 4CTBA 4HZRA 2C68A 3R9OA 5LVOA 4HGTA 4A9RA 4C0TA 3MW1A 2FGIA 4ASDA 5CENA 4W9XA 1ZOEA 3FMNA 3Q4TA 3EL8A 4CFNA 4D2PA 5F95A 4EBVA 5HD7A 3BZ3A 4L3JA 4KINA 3R22A 1H25A 4MD9E 3RAIA 2YZLA 2BPMA 3DNEA 1FGIA 2QC6A 2VTQA 4PTEA 5TT7A 4A4XA 1K2PA 1TQPA 3EN4A 5L2SA 3A7GA 3BHVA 4LL5A 4PF4A 3M11A 4FIJA 5HLWA 5K0XA 1JQHA 4FZDB 4CT2A 1U54A 3G51A 4G3GA 2YWPA 5EKNA 3PSCA 5E8VA 5F94A 3L8VA 3QZIA 4A4OA 3HDNA 1XHAA 3O2MA 4DEIA 3A4OX 4M0YA 4F7NA 4KA3A 1QPCA 4ZTQA 4JBVA 4ZTNA 4BCNA 4BTFA 1PY5A 4KWPA 4XV9A 3CE3A 4X2GA 2EVAA 1CKIA 4QMWA 3QGWA 3PE2A 2IWIA 2PE1A 3WARA 4MK0A 3KKVA 3FUPA 5CF8A 5J7HA 4FSNA 5JEBA 3SAYA 4QQJA 1YWRA 2O5KA 4ENYA 2ETMA 3A2CA 4FK6A 4AOIA 4FTJA 4XEYA 2CLXA 4GU6A 3QD4A 4F0GA 4LOPA 5BYYA 1H08A 3TIZA 1U59A 4U43A 4DEDA 3EFKA 4QTAA 3OUKA 3AT2A 4O0RA 4P5ZA 3VUTA 4AE6A 4CNHA 2PSQA 2XIRA 3NWWA 3CTQA 3UOJA 3VS3A 4O6LA 1UWHA 4ACDA 2UVZA 1YXTA 4F4PA 3IPHA 1RW8A 2UW6A 4WBOA 3ZSHA 1UWJA 5BVWA 4EHVA 4KUJA 3D0EA 3DJ5A 3D5WA 2PK9A 3W16A 3NEWA 1SM2A 4Z55A 4EOPA 3KL8A 3BPRA 4HNIA 4D58A 2VTAA 1OGUA 2YM4A 5FBNC 3BRBA 2KTYA 3SHEA 4RIWB 2J5FA 4G9RA 4QYHA 2HY0A 5BMMA 3KULB 1GNGA 3OG7A 1HCLA 3VNTA 4EQCA 3FSKA 4EL9A 2QKRA 2ZM1A 3EQGA 5AIRA 3ATTA 3G9LX 2CN8A 4D5KA 5M56A 3HAMA 3ORMA 5HBEA 4YURA 3IGGA 4IAYA 5C26A 5HIEA 5EYCA 3PP1A 3MSSA 5J95A 3ZOSA 1W98A 5I9XA 4D2TA 5DPVA 2QOOA 3HUCA 3QGYA 4R3PA 5DLSA 2UZWE 1KE8A 1OPLA 3QQKA 4YJUA 5IEXA 5J1VA 5BVEA 3EHAA 2P2IA 2BHEA 4BIBA 3OBGA 3BEGA 4O7ZA 2F7ZE 3MY1A 4A9UA 4A9SA 3UQGA 3VQUA 1YHVA 1ZYLA 2JDSA 4FR4A 4MXCA 2UW7A 5JFXA 1M52A 2ONLA 4FTAA 3G2FA 4UX9A 3VS6A 3TUBA 5DT0A 2YWVA 4G3DA 3GFEA 3PA5A 4CMOA 2PYWA 5HVYA 5CSHA 3ZDUA 5CVFA 5HTIA 2YIQA 1H28A 3NX8A 2FSTX 4K9YA 3PPKA 3VS0A 3G6HA 5AR2A 4ZTRA 1IR3A 2GSFA 5CEIA 4DEHA 4PPCA 2BMCA 4M14A 5CY3A 3I1AA 2HXQA 4YHJA 5IQGA 4JQ7A 1K9AA 2WMAA 4M8TA 4K11A 4YLJA 4YJVA 4P4CA 3CCNA 4KIKB 4JDIA 3C5IA 1H1RA 2UW0A 3HYHA 5C4KA 5HESA 2VTMA 2PMIA 1RJBA 3TG1A 4BTKA 5CAUA 1LUFA 3IO7A 1MRUA 2G9XA 3PWDA 3CIKA 4FV0A 3FY0A 4HPUE 3N4UA 3I7BA 1Y57A 4R3CA 3AD6A 4DEAA 4O7YA 1J7IA 4F7LA 3GNIB 4EEVA 4L9IA 1WCCA 4WOVA 3AG9A 4YJOA 5L2TA 4BHZA 3WIKA 1TVOA 3OCSA 3UP2A 2C6LA 3D5XA 2W1CA 4L67A 4QYFA 1JWHA 4FT7A 5BPYA 2BR1A 4UXQA 2Z60A 3WF8A 2XP2A 2HZ4A 3R7YA 5B2MA 2NPQA 3QC4A 3R04A 2HW7A 1TKIA 3DBFA 4JT3A 4BGGA 3QRUA 2BILB 1FOTA 4PDPA 4EH9A 2IG7A 4BY9E 4QP4A 4MKCA 3QTZA 2YLEA 3U9NA 4BZOA 3BYMA 2ZV7A 5KMIA 3TZMA 1WMKA 3QUEA 1J7LA 5A4LA 1YHSA 4NM0A 3BKBA 1CKJA 2QD9A 3OWPA 4EH6A 4HGLA 5KKRB 4TY1A 5FXSA 1AGWA 4I24A 3IW7A 5J8IA 4IWOA 1YXVA 1YOLA 2XK9A 3AMYA 4I6FA 2IW8A 4FSRA 4UMPA 5I4NA 4CT1A 5EYDA 5JFVA 3O0GA 5K5XA 2X2LA 2QHNA 3ZO3A 5F4NA 4YNOA 4BDKA 1SNXA 2OSCA 3MJ2A 1ZOGA 4GKHA 4HVHA 4ZY5A 1SMHA 4BDCA 1DAWA 2YCQA 4LYNA 2Y4IB 3OCBA 3S00A 3TUDA 4FV4A 4WBBB 4BB4A 3A8XA 2BHHA 1V0OA 5AADA 2P4IA 2W5BA 4DLIA 1GJOA 2PZ5A 5IEVA 2F49A 3ANQA 3QQUA 4BCHA 3FC2A 3GOPA 3EFLA 3P9JA 3QTRA 4GVAA 3LQ3A 3CD3A 3K3IA 4M0ZA 3HV5A 3MYGA 1XH6A 2XYNA 5FTQA 4EK5A 4X2JA 2WTWA 4DTAA 1UU3A 3Q4UA 4YJTA 2YERA 3CTJA 5E91A 4E5WA 4FV3A 4X21A 3TKUA 1FMKA 3MV5A 3SD0A 4RBLA 2O2UA 5I5ZA 1U4DA 2YISA 4MF0A 1OBGA 3VQHA 5AP2A 4W4WA 3TN8A 4D4RA 4EH3A 3R1QA 2IO6A 4XG8A 4XJ0A 4CFMA 2JIIA 1ERKA 4YZDA 4J98A 2XJ2A 2FSMX 2AC5A 4U79A 2R4BA 2V55A 3FAAA 4H3BA 3ELJA 5DRDA 3ZBFA 5AAEA 3F82A 1PMVA 4YC3A 3LXLA 2P55A 3ACJA 3M2WA 4IX4A 4R7HA 3UOHA 2J0MB 5DEYA 2OJGA 4GU9A 5DG5A 4AZSA 4D2WA 3PVWA 2EB3A 1QL6A 5M07A 1YDRE 3F61A 4WA9A 2PE2A 3OT8A 3DBCA 1H4LA 1OB3A 3EQPA 4YPSA 2OJJA 5IQBA 5ANKA 3FMLA 4I6HA 2RFSA 3MY0A 4BI0A 2C6IA 5KKRC 2R0UA 4NJ3A 5EDPA 3VUMA 2XBJA 2W1DA 2QNJA 5L6OA 2PWLA 3HP5A 3R7IA 5HORA 2REIA 4KKGA 5G1XA 4RWKA 3UVPA 4FTUA 4OW8A 4TYHB 2SRCA 4FG9A 4F99A 3DS6A 3U6IA 2WEIA 4OTFA 2WTKC 4G16A 4IB3A 3FBVA 3PSDA 3DDQA 4BDHA 3KXXA 4YC6A 2BUJA 3ZTXA 1UNGA 4C3FA 3U6JA 1WBNA 5CT7A 2OO8X 3EQIA 3V8WA 2OIQA 3GC8A 4II5A 4RPVA 1F5QA 2Y4IC 3R00A 5A4TA 4ONAA 5KMJA 5M06A 1W0XC 2C1AA 1XH9A 4EH2A 1R39A 3FLYA 3R9RA 4EUTA 3RZBA 1I44A 4DN5A 3W55A 4HNFA 3PYYA 1Q8TA 1PRYA 3RPSA 4JOAA 4DG0E 3FXWA 4PWNA 4JI9A 5IEYA 3ORXA 2XK4A 1W84A 1PMEA 3QTIA 4IAIA 5FEEA 4AA5A 2W06A 3OP5A 4C38A 4N70A 2WQEA 4FKOA 3MA6A 4DBNA 2J2IB 4NL0A 2YJRA 3QZFA 3LKMA 2UVYA 4OTHA 4USDA 1YI4A 3VUIA 1NVQA 1TQIA 3KXGA 4FEXA 1JNKA 2ITNA 4IAZA 3I0QA 1UA2A 3BHHA 1U54B 4C57A 4UB7A 2OKRA 4FEQA 4BBEA 1DI8A 3E92A 4RX8A 5AUXA 3CKWA 4AOJA 1V0BA 2VV9A 5EI2A 2PU8A 4GIIA 3W2OA 3NPCA 4PY1A 3ZO2A 4W4VA 4RIOA 5E90A 5IQHA 4CZYB 4ALWA 3LM0A 4KIQA 4MQ1A 3W2PA 5T6KA 5M44A 3RINA 3G33A 4F6WA 5EYKA 3GU6A 4I23A 3BU5A 2YAKA 5CXHA 3R8MA 4AT4A 5AR7A 4Y46A 4O2ZA 3UYSA 3PVUA 2XNNA 4X0MA 4EH4A 3F3ZA 3EWHA 4ZZNA 4XLIA 3GU7A 4CYIA 4LV5A 4AN2A 2F7XE 3TTIA 5CANA 2GQSA 4FKJA 3OHTA 4O38A 4YBKA 3VS7A 4A9TA 2FVDA 4TKSA 3SXRA 4CQEA 5JZJA 5CU2A 1AD5A 3VF8A 3WE4A 5H8EA 3A99A 4MTAA 4K33A 4CXAA 4ZZOA 1NT2A 5AFVA 4WO5A 4O7WA 1HCKA 5C9CA 5HU9A 5JRQA 2C6KA 4CMTA 5CTPA 3I0OA 3BGPA 3O71A 4F6SA 3C5UA 4L43A 1JBPE 3SOCA 3EIDA 4B9DA 2QG5A 4FGRA 3VBWA 3HV7A 2CCHA 3UZRA 2KULA 3RHKA 4JG7A 4DEBA 3E93A 5CF6A 2OH0E 4CKJA 2W99B 4EHGA 3T9IA 4AU8A 3EQDA 2VWZA 3R21A 3VN9A 4XV2A 4ANMA 2WTVA 4V04A 4HJOA 3ZFYA 1WBPA 3PUPA 4FTIA 4IW0A 3UZPA 3TTJA 4S30A 5ACKA 4BC6A 3FQEA 1P4OA 2GNLA 3QTSA 3R2YA 4DFZE 3F88A 3LJ0A 4L52A 1DM2A 4CFVA 2GTMA 3D4QA 3PJ3A 3RPVA 4JJRA 3I60A 3FMMA 3ETAA 1P2AA 4EKKA 5GJDA 2QOLA 3L1SA 3QHWA 4L44A 4LUDA 4BBMA 3C4WA 4TNBA 2QOFA 4AGUA 4RVTA 3WI6A 1ATPE 2VAGA 2JEDA 1LR4A 4CZTA 4IDVA 1Z9XA 5ACBC 4AOTA 4QP3A 3JPVA 3OFMA 3VAPA 3WZUA 1XJDA 3WE8A 2PUIA 3RK5A 4GJ3A 4XOZA 2UZEA 2PZPA 3U55A 5J87A 5BVOA 3PPZA 3KFAA 4E5AX 4JDHA 1YXUA 4TN6A 4M13A 2Z7SA 3TM0A 3CD8A 3EFWA 5K4IA 4AACA 1PMNA 3ATSA 3D94A 3II5A 1LEWA 3QX4A 2C5YA 3K5UA 4G6NA 4O22A 4QTCA 4F0FA 3DAKA 3I79A 4YU2A 3FMEA 4RIWA 1H01A 1JSUA 3LLTA 4I20A 5AV0A 3EKNA 4MWHA 3TNIA 2BIKB 2YAAA 1YXXA 4TT7A 4CFXA 4FKPA 5CZIA 3WIGA 5M4IA 4BCGA 3HV6A 4GRBA 3QRKA 4OUCA 1B39A 4QMSA 4WSYA 2HK5A 1OL5A 2JIVA 5CALA 1JVPP 5CQUA 3R8VA 3P4KA 3NLBA 3WZEA 3DK3A 5CAOA 3COHA 4U42A 4DH8A 3ZSGA 3SGCA 3E7OA 4R6VA 1OL2A 4NM3A 4OBOA 4XG7A 5HOAA 5J9ZA 4M7IA 5H3QA 1A9UA 3COKA 3QTWA 4KIPA 3GBZA 4BCQA 3BYSA 3VF9A 5B2LA 3GCVA 3H0YA 4BIEA 4D28A 4YZCA 1P4FA 4CTCA 2HYYA 5L8JA 3UMXA 4BKYA 1KOBA 3FZ1A 4D2RA 4DFUA 4BDFA 4M66A 2RFEA 3P5KA 4ZEGA 5KE0A 3KREA 5BYLA 3ZM9A 3GVUA 2I0HA 4L68A 4DH7A 3OY1A 3DPKA 4FYNA 4TPTA 4I5CA 1ZMUA 4R1VA 3KMUA 4AZFA 4RFZA 1BL6A 3R1YA 2C5OA 4O7RA 3C4EA 3C51A 4I5MA 2YM6A 3HAVA 4H39A 5IQDA 2O64A 1Y6AA 4G3CA 4PDYA 3EZRA 4MYGA 5CSVA 3R8ZA 1XBBA 2XIXA 5FEQA 2PVNA 4XLVA 5D10A 4KIKA 4L7SA 3OW3A 3DKOA 2YDIA 2ZB0A 4GT5A 4PL5A 3BYOA 4AGWA 1YRPA 3MVHA 3M1SA 4FKUA 2V7OA 2NNWB 4E4MA 3SVVA 4P7EA 2CPKE 4WHZA 3TNQB 2HOGA 2R64A 3KVXA 1L8TA 3NW5A 3QF9A 1GIJA 3N51A 4EH5A 4OAVB 5LQFA 3LXPA 4FT9A 3VBQA 5IA2A 1FVVA 4LGDA 2BFYA 2VD5A 4QPAA 2RKUA 3O17A 3TCPA 5K9IA 3ID6C 3LMIA 3TDVA 4EWHA 4ID7A 4MHAA 4NW6A 4YHTA 4BTJA 2I40A 4MAOA 2VNYA 4RGJA 2R2PA 4YO6A 4IZ7A 3BGZA 2IW6A 5EDQA 4WKQA 4C4FA 3F2NA 1ZAOA 2V5QA 3QXOA 4HPTE 4QMTA 5KO1A 4TTHB 3G5DA 2VX0A 4IC8A 1FPUA 4UALA 3RPYA 3AD5A 3Q3BA 4RVMA 2RL5A 5HO8A 3W2RA 4ACGA 5JGAA 1FBNA 3FLNC 2OXDA 4I0RA 2GQGA 2I1MA 4FTRA 4XUFA 4J97A 4YP8A 2XNGA 3RWPA 1FVTA 3F5UA 4WNKA 4I94A 1J1CA 3FLSA 4NIFA 2QOBA 3H9RA 4BDBA 3QKKA 2QG7A 4WG4A 5I3OA 3BE9A 5A6NA 3CY2A 4E4NA 3K3JA 5AUUA 4D1XA 2C0TA 3QAME 5DRBA 4HYUA 2ZYBA 4QMYA 3IONA 4WIHA 5AA8A 2VTRA 3B2WA 4DFXE 2YFXA 3JR1A 4ZLYA 5CAVA 5IKWA 3KMWA 4GMYA 2QOKA 5HG8A 5GZ8A 5IA4A 5H2UA 2WU7A 3QUDA 4F9WA 3BBWA 4FV5A 4FKGA 5HTBA 3DXQA 2ZVAA 3S1HA 2R3MA 2VO0A 2WGJA 1ZYJA 3E8NA 3NNVA 5EW3A 2PVJA 1V1KA 4Y73A 4I92A 3UMWA 3FL5A 4ACHA 4NTTA 4RRVA 2WB8A 4D0XA 4AWIA 2A1AB 2OXXA 2YLFA 2XMYA 2UZUE 4B4LA 4AZVA 3UG1A 4WG5A 4OTRA 3R7UA 1Q8YA 5KMKA 3R83A 2ETRA 4IFGA 3V5LA 1A06A 5BNJA 5CSWA 3SXSA 4QMPA 5FXRA 4FZ7A 2XJ0A 3CKXA 1Q8ZA 5A46A 2FSOX 5FEDA 4FVPA 4QT1A 3V5TA 2ZJWA 1ND4A 3WF5A 4F1OA 3A61A 3O8UA 2GNIA 2XBAA 3D83A 4JRNA 5EW8A 2W05A 3EN6A 3PZHA 5E8UA 4S34A 3MH3A 1KUTA 3MFUA 4ZZMA 2I0EA 3WZDA 2X7GA 3IW8A 3ZO1A 4AXAA 4CV8A 2C6EA 4FTTA 3NUPA 3SOAA 4IWDA 4QMMA 4B8LA 2WU6A 2XNPA 3REPA 4EH8A 4LL0A 3PJ1A 3E64A 2XIYA 3CQEA 3BELA 2X4FA 3ENMA 5LVNA 2J0JA 2PVMA 2OI4X 3ZLXA 2YJSA 3BV3A 1QMZA 3D5VA 5C27A 5M4UA 3Q53A 3DA6A 3IGOA 5E4HA 4RJ3A 3PIYA 4QNAA 3Q4CA 1XH8A 4ANBA 4FTLA 3HMIA 4TYHA 2ZM3A 4LM5A 2P2HA 3VIDA 1DS5A 2XK7A 2ITPA 3QKMA 4G31A 4KNBA 4E5BA 5IA3A 2C47A 4BTMA 3L8SA 2WEVA 5L4QA 3I7CA 4GS6A 3LM5A 4BN1A 3C4CA 3S4QA 3GQIA 3OT3A 2GNFA 4FV2A 4UYNA 5AUZA 3U6HA 2W1HA 4U81A 4FIGA 1F3MC 2GNHA 3DK7A 5I9WA 3FPQA 5KHWA 3FPMA 3GEQA 4QYEA 2EWAA 4JDKA 2BRHA 2Y9QA 3NNUA 4FKRA 4HOKA 4K2RA 4MBJA 2X7FA 2J0KA 3SA0A 2XK8A 4EOOA 4IJ9A 3QYZA 4EYJA 3GENA 1PMUA 4C4JA 3UTOA 4O7VA 2DUVA 4M69B 4M15A 4EI4A 2QU5A 5T3QA 5EI8A 2G2FA 3BLRA 5CU0A 2A2AA 4ANSA 4F7SA 1NW1A 3R7VA 5BUJA 4MQ2A 2QOQA 4CCUA 3OWJA 5AV3A 3U8WA 3VBTA 3PZEA 3PFQA 2R3JA 3PLSA 4R1YA 5AAFA 4BIDA 3L8PA 5KMMA 1NVRA 2VTSA 3FSFA 4ZK5A 5C01A 4PP7A 4ZAUA 3PP0A 4FZAB 4NEUA 3QRIA 4GJ2A 3MWUA 1BUHA 4FV1A 4MVFA 4UBAA 3A7IA 4BZDA 4BWKA 1RQQA 4GYGA 3G9NA 5IUIA 4DFBA 3KY2A 2EXCX 2WZJA 4XCUA 4Q2AA 2C6MA 4DC2A 2ZV9A 1P14A 5JQ8A 2E9OA 4OBPA 5JH6A 1GAGA 3QU0A 2CGWA 4MX9A 5KBQA 4TZRA 4UY9A 3DBDA 3NW6A 4DT9A 3LIJA 1REJA 3A62A 4QP2A 4YLKA 3E5AA 4W4XA 3CJFA 3JY9A 2YDKA 3IDPA 4KS8A 4UWYA 3R9DA 5A3XA 3UIBA 5CT0A 1Z57A 3HLLA 5HE2A 3F6XA 4M84A 4WUAA 5JQ5A 2W96B 2V0DA 3UIMA 4H3QA 4OTWA 3RKBA 1JPAA 2VN9A 2QU6A 4G3FA 4YTCA 1FMOE 3CJGA 3FMKA 5EM8A 5HX8A 4S31A 3AD4A 3NUAA 5L2QA 4O81A 1BMKA 2QR7A 3FYJX 4YUQA 5M53A 2CKEA 1Y8GA 2W5HA 3I5NA 4HCVA 3BGQA 3FHIA 3UE4A 5IH4A 3MH2A 2HCKA 3CGFA 2XCHA 4TYJA 5J1WA 3DB6A 3RNYA 3MH0A 3E3PA 3MI9A 2WIHA 2WMQA 3H0ZA 3LCTA 4L00A 4AA0A 4EOJA 3HMNA 5EHYA 2XEZA 4QP6A 3RM6A 3TXOA 2J6MA 3MN3A 4BZNA 4DFNA 3NCZA 3Q60A 5LVMA 4XG2A 1RDQE 3DAJA 2EU9A 4F64A 4ANOA 5BUEA 3VS2A 2OJFE 4OBQA 4K1BA 1XO2B 2X8DA 4E6CA 3BQCA 4R7BA 3OEZA 4I4FA 4ACCA 2AC3A 3VBYA 2PMNX 4AW5A 4BCJA 3RAHA 4E73A 3R7OA 2C6TA 3HEGA 1PHKA 4MD8E 3P7AA 4APPA 4JDJA 2CGUA 3PG3A 3DV3A 1XR1A 3DJ7A 3JYAA 3R28A 3I6WA 4ITHA 1ZOHA 2W1IA 5DBXA 5I0BA 3GC9A 3W1FA 3C0IA 3COIA 3RPRA 1ZRZA 4CG8A 2Y4PA 1KE7A 3C4ZA 3NYXA 3GI3A 3LJ1A 2ITXA 4HYHA 3Q5ZA 5LCKA 3ZC6A 2GHGA 4EOKA 4X2NA 3NDMA 3FMJA 3UOLA 2B52A 4YNEA 3UODA 5L2WA 3HGKA 4FSWA 3OWKA 4GFOA 3NSZA 4YTFA 4EOMA 3O8PA 3MVJA 2JBPA 4R8QA 3DXPA 4IXPA 4FV7A 1WVWA 2A4LA 2VTIA 2VU3A 4JX3A 4FV8A 2XM9A 3D7TB 2V22A 4C3PA 4BCIA 5IF1A 4AE9A 4OT6A 3Q9YA 2X8EA 3Q04A 3PLAE 2DQ7X 2BDJA 4DITA 3AOXA 3CR0A 5I9UA 4EWQA 4X3FB 3VO3A 3ZXTA 4UV0A 2C5VA 5J7BA 4NK9A 3UBDA 1Q41A 3KK9A 4BRXA 4DTBA 3GGFA 3PXFA 1W8CA 2BRGA 3EB0A 1FVRA 2R3FA 3FL4A 3HUBA 4O21A 4U8ZA 2F2CB 2QR8A 1WBSA 3JVSA 3JY0A 2XKDA 2CKOA 4WT6A 2VWVA 4JR3A 3DAEA 2QCSA 2CN5A 3AMBA 4BVUA 3EQBA 5FXQA 4J99A 4BCOA 4RC3A 1M2PA 3BLHA 4RQKA 4OTPA 4A4LA 4BDIA 2VO7A 3RHXA 3KXZA 3SG8A 4XG9A 4D55A 3WBLA 4U44A 3LFDA 5LMKC 3RCJA 2GFSA 5AR5A 2UW9A 4DGLC 5M55A 4OLIA 4UZDA 5D7VA 4ZSLA 3QA0A 3A7JA 2VTJA 4GIHA 1GOLA 5HEZA 2HIWA 1UKHA 1H26A 2ITUA 4FNZA 3BV2A 1W83A 4NIFB 4NFMA 4GYIA 4C37A 4HVDA 2VTOA 2JKOA 4JG6A 3R0TA 4MXOA 4EQMA 5HCYA 2HZNA 3EFJA 3Q9XA 3TNPC 3E8DA 1H0WA 2C6OA 4IB1A 4GL9A 2WTKB 5I9VA 4AW0A 4E8AA 3KVWA 4PTGA 4G5JA 3UOKA 4DTKA 3KRXA 1IAHA 4IVBA 4ZSGA 2UZLA 3PTGA 3UNZA 2C0OA 4AS0A 2QOIA 4O7NA 4J1RA 3V3VA 4FKSA 4GG7A 4DH3A 4DE4A 2OJIA 3U9CA 4AN9A 3ZONA 2PTKA 2YITA 4KSPA 4YMJA 4DGMA 1O6LA 3DJ6A 4O1OA 4DCEA 4FGBA 4Q5HA 5GZAA 2YN8A 3CTHA 4FOBA 5EHOA 1NA7A 5C03A 2PZIA 4HGSA 3W2CA 3FI4A 4AA4A 4IBMA 3C0HA 5JN2A 4Z3VA 4DBXA 5CVHA 3F66A 4APCA 2OIBA 4FNYA 4MNFA 5E7RA 5EQYA 4IZ5A 4QMXA 3NYOA 3DTCA 3E8CA 3HRFA 4CFUA 1FGKA 3QYWA 3VVHA 3SG9A 3OOGA 2IZSA 4YJRA 4V0GA 4KS7A 4N57A 3R9HA 1F0QA 3C50A 3LXKA 3AC1A 2OW3A 4X3FC 2JDOA 1ZMWA 2BZKB 4ALUA 2WMRA 4RC4A 4Y8DA 3DOGA 5M4FA 4ZTSA 3TUCA 2YCRA 2P0CA 3QCQA 4XNEA 4UMRA 2EB2A 1OBDA 2IVSA 3TEIA 1XQZA 2QQ7A 3VHEA 5GHVA 1L3RE 4JAJA 4TWNA 5BVKA 3W8QA 5M4CA 4CFFA 3FKOA 1YQJA 2FSLX 3P79A 1YDSE 3AC4A 4C02A 4ASXA 2H6DA 2VTHA 3QZHA 4DEEA 4FUYA 2QO2A 4LG4A 5EK7A 5BMSA 3SLSA 4L6QA 1OM1A 4QNYA 4Y5QA 5FD2A 2W0JA 3HDMA 4LGGA 4E4XA 4HVGA 5JGBA 3HV3A 1SZMA 3R8UA 4J52A 1G3NA 1UU9A 4DGGA 3DBEA 1YKRA 3UPXA 4MXXA 2CNVA 2R3KA 2B9HA 3I5ZA 3DT1A 3OEFX 2CGXA 2R7IA 5I9ZA 1MP8A 3U51A 4U9AA 2C1BA 2J51A 3LFQA 3SC1A 3KEXA 4LOQA 4DFLA 4IDTA 5EI6A 3G6GA 4Q9ZA 4U80A 3EL7A 2B9FA 3R6XA 5AP0A 2PVKA 2WD1A 2X9EA 3BE2A 4OT5A 5LJJA 4JLCA 5LVPA 3IOPA 4XS2A 2C3LA 5TE0A 5AR3A 4DEGA 1Q8UA 2HWPA 2UZTA 4KKHA 3RAKA 5IUGA 3ALOA 2BKKA 4M3QA 5BUIA 3PJ8A 3OOMA 2ZOQA 2J90A 3NVKI 5AV4A 1FINA 2G2HA 5IZFA 1M17A 2ZV8A 4H3PA 2CLQA 2RFDA 4UEUA 4ZLZA 2WQOA 3IS5A 2VTPA 3GU5A 3NYNA 4PMPA 2X2MA 3KCFA 3WZJA 4BCPA 4PV0A 3UYTA 5HO7A 4ZOGA 2Z8CA 3GCSA 3COMA 4HYIA 5HICA 2YZAA 3R63A 1YW2A 1GZNA 1T45A 2RGPA 2P3GX 1M2QA 4NCTC 3ZFXA 2H8HA 3OF0A 5M51A 4BCFA 5HKMA 1SVEA 3F3TA 4GKIA 4U41A 2J50A 5DN3A 2X0GA 4IWPA 3HA6A 3HVCA 4JIKA 1G8AA 2GNGA 3Q4ZA 5JSMA 2YM7A 5L6WL 2AUHA 5HNGA 1XWSA 3R7GA 2QLQA 2ACXA 3BYUA 1TQMA 4M12A 4LMNA 1UNHA 3O96A 4YGAA 5DNRA 2GCDA 3UC3A 3HNGA 4C58A 4HZSA 5LOHA 5DH3A 1JKSA 3SQQA 4A9YA 4YZBA 4ZJIA 2PHKA 2WKMA 2YM8A 3MFSA 3QD3A 5DR6A 3R9NA 5CQWA 4KRCA 1XBAA 3SXFA 3KXMA 5F9EA 3WF6A 1KV2A 5J79A 2ITYA 4BI1A 2QOCA 4MD7E 3QZGA 3O7LB 3VUHA 4MXZA 3BX5A 5EYMA 4M69A 3ROYA 2PVRA 3L9MA 4EYMA 4HVSA 5ANIA 5FWKK 4DF3A 3F3VA 2IVTA 5HU3A 4QP7A 2XB7A 1BL7A 1IEPA 4YZ9A 4D9TA 3UQCA 2ZB1A 5H8BA 3VUDA 5FP5A 4KSQA 3AQVA 4WRGA 5LARA 4ASZA 3I4BA 4U97A 3JXWA 3DZQA 3P78A 4C3RA 4XOYA 5HI2A 3AGMA 4CZUA 4O6EA 3CS9A 3L9NA 4IAFA 2XH5A 4FIEA 2WMVA 3Q96A 4RSSA 1Q3DA 3FXZA 3OROA 4FVQA 3D7ZA 4OGRA 4C62A 3RK9A 3VW6A 4E1ZA 5J5TA 2R3NA 3DDPA 1GIIA 4BDAA 4AX8A 4YTHA 4G17A 3LCSA 2XNOA 3GCQA 2R0IA 5AWMA 3H9OA 4YLLA 3IDBA 2C69A 5JT2A 3D2KA 4HCUA 4FSTA 1OIRA 2UZDA 1IASA 2R3QA 4IB0A 2XEYA 3MH1A 4BYIA 2R7BA 3UG2A 1H1QA 2VUWA 2WTIA 4GFMA 2BTSA 3KXNA 1UKIA 2CHLA 3ENHA 1UV5A 4UMQA 2WTJA 2UUEA 3FLZA 4YHFA 1OIQA 3SW7A 5FTGA 3AC8A 4EKLA 4EHZA 4I41A 4DCAA 3TIYA 4ZLOA 3HP2A 4FT3A 3B8RA 4O86A 5LXMA 4BDGA 3KC3A 3MTLA 4X2FA 2WIPA 4O0TA 4QQTA 1Y91A 3LCKA 4YO4A 1JLUE 2UZOA 3QKLA 3FY2A 3QD0A 3EOCA 4XH6A 3MJ1A 5CF5A 2JITA 1J1BA 2X39A 2R3PA 2PUUA 3DFCB 3UO5A 2V7AA 1PXOA 1MQBA 1LEZA 4ZSEA 3TKHA 5AEPA 1X8BA 1B38A 4QQCA 3FLQA 2W5AA 1EH4A 5E8WA 4AQCA 5IQCA 3I6UA 4EK4A 4FMQA 3NUSA 2O63A 2ZDTA 4J95A 3Q2JA 1B6CB 2WFYA 3WYXA 2XA4A 3ZDIA 5TF9A 5D7AA 3EQHA 4DHFA 4QMOA 3CQUA 4FKLA 4XMOA 5CEQA 3TWJA 4N6ZA 2E9VA 3KRRA 5ETAA 1PXKA 5AUVA 4TYEA 3LQ5A 3VBXA 5B2KA 5LVLA 2GS2A 3FYKX 4RG0A 5LMKA 2RF9A 1XH4A 4PUZA 2O3PA 2H34A 3FZTA 4M97A 4CV9A 5CEPA 3V6SA 3V5WA 2Z2WA 5AX3A 2VX1A 5M57A 3NIZA 5D41A 3E8EA 3L9LA 2FUMA 3FE3A 2W17A 2WQBA 1PXPA 2YACA 3D5UA 4G9CA 2X4ZA 3QHRA 1STCE 2F4JA 3C0GA 2LAVA 3OVVA 4RLLA 4S33A 2BAQA 3VS4A 4E3CA 2BIYA 4EZ7A 5A54A 3FDNA 1ZXEA 3S2PA 4XRJA 4NM7A 3GCPA 4OAUC 3ZU7A 4MCVA 2BDFA 3MPAA 4KRDA 3V5QA 3N4TA 5HHWA 4NYEA 5GZ9A 5AMNA 4E7WA 3QLGA 1OIYA 3RP9A 4L01A 4AAAA 2C5XA 2ITQA 5IQIA 4KAOA 4WNMA 5EW9A 5HNIX 2XRUA 3OCTA 2UW8A 1WBVA 4K8AA 4EQUA 4FTOA 2LGCA 4BYJA 5AP1A 2R3LA 4ZXTA 3F2AA 4I5PA 2VGOA 4O91A 2ITOA 4XG3A 2WO6A 5FDXA 3C4XA 4C36A 4LRKA 3D9VA 3F3WA 2RFNA 3QWKA 4ASEA 4QRCA 4CD0A 3CP9A 3KRLA 3NUNA 4XV3A 2OLCA 1JSTA 5CU4A 5GNKA 3D7TA 1UU8A 3PWYA 5AUYA 3DGKA 2PULA 3MPMA 4O0UA 4O7LA 1SYKA 4GW8A 4BL1A 4O0VA 3QTXA 4X3FA 4EOLA 4GSBA 3FKNA 5IQEA 3U87A 1OITA 5HG5A 5DI1A 4O83A 3VJOA 3H9FA 4FSZA 4KB8A 4PMMA 3W18A 4YBJA 4F09A 3C13A 4E20A 5IPJA 1BLXA 3OXTA 2B53A 2YIYA 2WQNA 3UO6A 4QTEA 5C8NA 5KUPA 2NO3A 3HKOA 3NUYA 2QKWB 2OWBA 2UVXA 3GC7A 2FO0A 4IX6A 4BKJA 5DGZA 1O9UA 3NUXA 1Q4LA 5HLNA 4J96A 3Q32A 3KN5A 4IE9A 1IRKA 3PJ2A 3WILA 4V0GB 4DYMA 4O0WA 4Z9LA 2OXYA 2C30A 5GJFA 4E26A 3LE6A 5LMBA 3TKIA 3AT3A 5E9EA 3DLZA 4D4YA 4NKSA 2Q0BA 5AP4A 2QVSE 3ZRLA 2GTNA 4MF1A 4AW2A 4EONA 1JKKA 2C4GA 3VS5A 4UYAA 5E8TA 2XKEA 3EN7A 4NU1A 2Z7RA 4TYGA 1PKGA 2CJMA 5KX8A 1NVSA 4IWQA 4WRSA 2X7OA 3ZZWA 4DINA 5HCXA 1G5SA 4RVKA 2XKFA 3R73A 3SDJA 4OTGA 2QLUA 3DB8A 3GXLA 3T9TA 3ZYAA 4B0GA 1Y6BA 4B7TA 5BQ0A 4N6YA 4JBOA 2BROA 3I81A 4XP0A 5DA3A 5EM5A 4U3ZA 4PQNA 5G6VA 2BRMA 4QMZA 4CLIA 4OR5A 1H0VA 2CGVA 3LVPA 3T8OA 4X7QA 2WMSA 4WNOA 4FSQA 4TXCA 4KIOA 4RIYA 3EN9A 3B8QA 4W4YA 1Q99A 4FUXA 3IOKA 3TZ8A 3DKCA 2Y0AA 3DY7A 5DIAA 3TV6A 1IAJA 1K3AA 3FEGA 3CPBA 1U5RA 2EXMA 2VWXA 2Z7LA 4G6LA 1XH7A 3TZ7A 4RA5A 5EHLA 4DG2E 4O7TA 4UWCA 2W1FA 4ITJA 3ODYX 1W82A 2UW5A 1XH5A 5AP6A 5IH6A 1H27A 4E6AA 5E8XA 1E9HA 4WG3A 4F6UA 4PL4A 2R3IA 1WBOA 4NCTA 1QPDA 4KBKA 3RNIA 2C3IB 4BGHA 5IA1A 4LUEA 3PXYA 2QONA 4IIRA 5JMSA 2PY3A 2Y8OA 5D11A 2JAVA 3GP0A 4C59A 5CF4A 2BFXA 4J53A 1O6YA 3MTFA 4RJ6A 3SRVB 3ZM4A 3AT4A 3UJGA 5EQEA 1Q5KA 3V04A 3PIXA 2Z02A 5HIDA 4JR7A 1H00A 3RGFA 3O7LD 2QURA 4XG6A 3VRYA 2VNWA 4FL3A 5H9BA 1S9IA 4C61A 4MXYA 2WNTA 4AGCA 4C2WA 5GINE 3HA8A 4RT7A 3BLQA 3OZ6A 5CVGA 2JAMA 3NGAA 3F7WA 2YIRA 2WMBA 1U46A 3QBNA 4D1ZA 3QCXA 3PY1A 3D14A 3ORKA 5GIPE 4FTKA 4GT4A 5CU3A 2ETKA 3R8LA 4EOIA 1PXJA 3UC4A 1OL7A 2W1ZA 2XM8A 3LFSA 4BHNA 3DU8A 3EJ1A 3O23A 5EM7A 2P33A 2BVAA 5LMAA 3ITZA 3MIAA 3TNWA 2UZBA 3ZH8A 4O0YA 1JKLA 2YM3A 4J7BA 4A7CA 3ZC5A 3AC2A 3QC9A 3DXNA 3PA4A 5HCZA 3BBTB 4O96A 1PXIA 3THBA 1JSVA 5AIKA 3ZXZA 4CQGA 2VTNA 3GFWA 4I6QA 3UVQA 5K4JA 5HE1A 3DBQA 4D2VA 2B9JA 4DT8A 3HX4A 3PY0A 1ZY4A 5K0KA 2XIZA 3QALE 2GMXA 4BDEA 3HZTA 3OTUA 4NUSA 4CKIA 5IU2A 2VWWA 3ALNA 4ZY4A 4QMNA 3ET7A 2O0UA 3R71A 1E1VA 3P1AA 1H8FA 2JIUA 4BI2A 4E4LA 5JFSA 1ZWSA 2G01A 4AUAA 3F7ZA 3ZEPA 4FTCA 1OKWA 3POZA 4ZTLA 2IVUA 4JRVA 3MVMA 4OTIA 3FV8A 1OI9A 3OBJA 5EM6A 1DAYA 4AZEA 4I1ZA 3OC1A 2VRXA 3KN6A 2WMTA 2CCIA 2HW6A 4F9AA 4DAWA 1ZZ2A 4PP9A 5AP7A 1PXMA 2PPQA 4NZWB 3VUGA 1VYZA 4ZJJA 1CDKA 1YXSA 4FSYA 3GC0A 4PPBA 4ALVA 3ORTA 3U4UA 2OK1A 3OCGA 1VZOA 1YHWA 4I0TA 3GQLA 2R5TA 3Q9WA 2OJ9A 5K3YA 5GIOE 2J9MA 3NZ0A 3R1NA 4Y85A 1KV1A 4R7IA 3ZSIA 4Z7HA 3RPOA 2WMXA 5L8KA 4L46A 4B99A 5BVNA 3S95A 2E9UA 4HGEA 2GHLA 1SVHA 3UP7A 2VO6A 4EK8A 3VW8A 3F5XA 3LLAA 4QYGA 5DR9A 3ZEWA 5J9LA 4MNEA 3E62A 2GDOA 1WVXA 4BKZA 3K5VA 2GFCA 4UZHA 2PZYA 5CXZA 4EORA 2W9FB 3LW0A 4JXFA 4Y72A 4K0YA 3PY3A 3ZUTA 4F08A 4FEUA 4JVGA 2BCJA 4UMUA 2YDJA 3AC5A 4JNWA 4RJ8A 1S9JA 1ZARA 2GU8A 4B8MA 3S0OA 4GT3A 2W1EA 3VUKA 4EH7A 2O65A 4TL0A 2XRWA 3F9NA 1J3HA 4TW9A 3D15A 3E63A 4JX7A 5FGKA 1OKVA 4FKIA 4GK3A 2H9VA 3BHYA 4HW7A 2FH9A 1O6KA 3CY3A 3ORLA 3F2RA 1PYEA 4QOXA 4FE2A 4KABA 3UPZA 4C2VA 4D0WA 4YTIA 5E8SA 1WFCA 2O8YA 4AP7A 3FZSA 3AXWA 3QD2B 5HBJA 4BICA 4U5JA 4TNDA 3BWJA 3NIEA 3TJDA 2FB8A 4RZVA 3EQFA 4D4SA 2X1NA 4PTCA 3RTPA 4TRLA 3HMPA 3DKFA 5BVDA 4RZWA 4LV8A 5AX9A 2YIWA 3DQWA 4YJQA 3LMHA 2F57A 5E8YA 2VWUA 4PPAA 5DHJA 3NNXA 4FTNA 4AFJA 2YCFA 3KCKA 3DLSA 2CNQA 3RK7A 2F7EE 5LCJA 3PA3A 5ANJA 5BX0A 1Q97A 5IA0A 3MB7A 5DE2A 3FMDA 3LCOA 5CI7A 4O84A 4C4IA 3UVRA 5LWNA 3UNKA 4YZNA 5CSXA 1Z5MA 3EKKA 1OPJA 2X6DA 1H1PA 2BZIB 1UU7A 4U6RA 2JDTA 3E87A 3LQ8A 4PRJA 4UN0C 4C4EA 4NH1A 5ANDA 2J0LA 3UO4A 3SW4A 1NXKA 4DG3E 3BHTA 5M09A 1ZYDA 1CM8A 2B55A 2JKMA 2YCSA 4IZYA 3PPJA 3ZO4A 5GJGA 4AN3A 2BAJA 5IA5A 2PE0A 4AT3A 3ULZA 4X6QC 3BYVA 4UWBA 1YOMA 2JKKA 3VHKA 5IUHA 3K54A 3MIYA 2WOUA 4G34A 3LFFA 1YDTE 2ITZA 4IC7A 3IW4A 4QP9A 4RJ5A 3W33A 4JG8A 3NCGA 3LJ2A 3WZKA 2PL0A 4GFGA 4PDSA 3W8LA 1PXLA 2ZV2A 4FTMA 5IQAA 3ZRMA 5A6OA 2J7TA 2G15A 2PMOX 2G2IA 5DR2A 4DLJA 2PVFA 4FG8A 3VWAA 4RFYA 1YVJA 5AUTA 3IW6A 1KE5A 5JGDA 4IH8A 2VTTA 4H58A 3UIXA 4XV1A 1CTPE 4EBWA 2BAKA 4UMTA 2B1PA 2WMWA 5EG3A 1OKYA 2JLDA 2R3RA 3QA8A 4YZMA 1Q8WA 5AV1A 4V01A 5HG9A 3W10A 3MFTA 4D9UA 1Q3WA 3F5PA 2QOHA 3KRJA 1SNUA 2HZIA 2RIOA 3P08A 2C6DA 3F5GA 5C1QB 3FZRA 4IQ6A 3IQ7A 5AP5A 3TT0A 5FG8A 3VC4A 2IZRA 1H1SA 3DKGA 4FIFA 4RJ7A 4BWXA 4E93A 3AMAA 1YI6A 2CSNA 3DK6A 4EC9A 4DA5A 4M67A 2E9PA 2WELA 4GH2A 4JAIA 4L7FA 3FI2A 4YJNA 4F9YA 4O0XA 4LRMA 3RBWA 2QHMA 4NM5A 4AZWA 4D2SA 3PIZA 3ORZA 2C3JA 4IX3A 2VWIA 1JAMA 3ZMMA 3VS1A 1QPJA 4IX5A 2NRYA 4I6BA 3EYHA 4RC2A 2XNEA 5HG7A 4ZSJA 2ITTA 3VJNA 2BDWA 3N9XA 5JKGA 1W7HA 4GEOA 1AQ1A 2BKZA 2EXEA 2I0VA 4N4SA 4X2KA 2PVHA 4QMUA 2BZHB 3E88A 4I3ZA 4FT0A 3BI6A 5TO8A 4FV6A 4O7SA 4FBXA 2HWOA 1R3CA 5L3AA 2FYSA 2OZAB 4RA4A 2WPAA 3BCEA 4ZMEA 1OUKA 2XVDA 2CKQA 3R30A 4NFNA 4FKQA 5IDNA 2X2KA 5CAQA 2A27A 3L9PA 4E6QA 1BYGA 3B2TA 3HMMA 4MXAA 4F70A 3CXWA 3KB7A 4Z7GA 3GT8A 5AUWA 5DEWA 4G1WA 1KWPA 4IVAA 5FBOA 4JS8A 4QPMA 5D12A 2OIDA 4LI5A 2W9ZB 4FNWA 5DOSA 2R3OA 4RIYB 2HAKA 2UV2A 4P90A 2OH4A 5AM6A 4YJPA 2A0CX 4U40A 2J5EA 3H30A 5BVFA 4USFA 5HVJA 2XYUA 5ITAA 2WQMA 3IG7A 4RWJA 3WF9A 3R8PA 5CZHA 2J0IA 3ZLSA 3EYGA 3QX2A 4AZTA 3JS2A 4W9WA 4NKAA 5HIBA 2JFLA 4IVDA 2PUPA 2VX3A 2F9GA 5E92A 1OIUA 2OBJA 4UXLA 4RJ4A 4DGOA 2OF4A 4E6DA 5CAPA 1HOWA 4QYYA 4FICA 1QCFA 5DT3A 2C0IA 3GOKA 3VULA 5IH5A 2PVYA 1BKXA 4F7JA 2IJMA 4WD5A 5HGIA 4ZIMA 4Q5EA 5DYJA 1BX6A 4MEDA 3NNWA 3GCUA 1GZOA 2R9SA 2OGVA 5JK3A 5H8GA 3Q5IA 2E2BA 3DCVA 2YHVA 4F9CA 5HD4A 2CNUA 5AAGA 1MQ4A 4IM2A 4XP2A 3A7HA 3TI1A 4CKRA 4H05A 2I7QA 3TDWA 4IZAA 3EQCA 2ESMA 2W1GA 4JIAA 4QP8A 5ANGA 3ZHPC 5HVKA 5LWMA 3LFCA 4FSMA 2RG6A 4LQMA 2A19B 4DH1A 4FV9A 3KU2A 3TV7A 3EQRA 4V05A 2JGZA 2NRUA 3A60A 4M68A 4PMTA 2HENA 2Q0NA 4QMVA 2IPXA 1CMKE 4IFCA 2UW3A 5FDPA 4ITIA 4AG8A 1M2RA 4RQVA 4YSJA 3H3CA 2Y7JA 4CLJA 2XIKA 1R1WA 2IN6A 3LCDA 4KBCA 1T46A 5C8MA 4USEA 4TWPA 3ORPA 1J91A 5EKOA 5CSPA 3FKLA 3QQGA 4K77A 4BFMA 4FI1A 3SKCA 4L3LA 3TL8A 3BU6A 4MBIA 4AT5A 5B0XA 4IEBA 3A7FA 3KMMA 4RIXB 4XHKB 3C4FA 4FL2A 4CRSA 3QQLA 3SRVA 5L2IA 5IMEA 1WAKA 2J4ZA 4QPSA 5AM7A 5KCVA 5D9HA 3OS3A 5A4CA 1DI9A 4KKEA 3CSVA 2WHBA 4ACMA 5CNOA 2ITWA 4PL3A 5JZNA 4F63A 1CKPA 4ANLA 5IG1A 3QXPA 4I0SA 1XBCA 2QO7A 2XKCA 1WVYA 2XCKA 3WOWA 2PMLX 2XK6A 3FWQA 3OUNB 1OPKA 3Q6UA 3GUBA 3LHJA 4IHPA 4CMUA 4BR3A 4CG9A 3E3BX 5E8ZA 4JQ8A 5EH0A 5CWZA 4A06A 4GK4A 2JKQA 4BCKA 1PJKA 3PXKA 3S3IA 4QD6A 2Z7QA 5BYZA 4GCJA 3RMFA 4C4HA 2PVLA 5EDRA 1YWVA 1R0PA 4FA2A 3OTVA 3IDCA 5CASA 1REKA 1WZYA 4LOOA 1R0EA 4LFIA 3NS9A 4XBUA 3ERKA 3PSBA 3CC6A 3L8XA 3RAWA 2ITVA 3HECA 3TZ9A 2GS6A 2Y6MA 3G0FA 5E1EA 3RCDA 4QTDA 2IZUA 3V01A 5KMNA 5AR4A 3EN5A 3POOA 3P86A 1KE6A 2X81A 3OMVA 4NJDA 4C34A 2B7AA 4R5YA 4F0IA 1FQ1B 5ICPA 4FOCA 3ANRA 1UVRA 4FIHA 3O51A 2QO9A 3JVRA 2NP8A 5M08A 4RWIA 4NTSA 3LZBA 2V62A 4QMLA 3TNHA 4R77A 3O50A 3FZOA 4MNEB 2CMWA 1ZMVA 3LPBA 4FL1A 5CI6A 4ZTHA 4G6OA 1IA9A 4PDOA 4RWLA 3MY5A 5CNNA 1PYXA 1BI7A 1PF8A 4O2PA 5AJQA 5EOLA 3QL8A 4DGNA 4S32A 2WMUA 3GU8A 2R3GA 2W7XA 5FRIA 4AGDA 3MESA 1ZY5A 4O82A 3LFBA 4U0IA 3RALA 3V6RA 2Q83A 3DFAA 4KD1A 3RZFA 4DH5A 3LAUA 2R3HA 3WYYA 1APME 2GHMA 4Y5HA 5IMXA 3LOKA 3TACA 5F1ZA 4XP3A 1PW2A 3QFVA 5EFQA 5AR8A 5T68A 4D5HA 3FQHA 4OTQA 4WSQA 5IQFA 5ETCA 4BBFA 2OFVA 3CLYA 3T3UA 5L6PA 3GU4A 3R02A 5TR6A 4XYFA 5I9YA 5HBHA 2ZMDA 3RVGA 2RG5A 3T3VA 3FHRA 4ZTMA 4CGAA 3OY3A 4QQ5A 3BWFA 3TJCA 1M14A 2QI8A 4RX9A 4C8BA 4JQEA 1R78A 1VYWA 4YJSA 1MUOA 1LP4A 3DNDA 4L3PA 3P7BA 3PVBA 4O27B 2BTRA 4S2ZA 4Y83A 4IM0A 3UGCA 4F9BA 3A4PA 4EJNA 3ACKA 1NY3A 1OMWA 1YOJA 4BF2A 4W8DA 2DS1A 3AGLA 4QP1A 3PXZA 4EZ5A 3KK8A 3FQSA 5KMOA 5CEOA 5HZNA 4ZMFA 3KF4A 2H96A 5HLPA 1OVEA 2X8IA 2OZOA 3PDTA 3IW5A 4I21A 5KBRA 2VO3A 3LXNA 3FI8A 3C7QA 4XX9A 4ZJVA 2VTLA 2W4JA 1URWA 2AYPA 4TWOA 3MPTA 1H1WA 4G2FA 2IW9A 3KRWA 1BI8A 3FLWA 2UZNA 1UNLA 3C1XA 3NAXA 2XNBA 4I22A 3ZUUA 4PNKA 4CEGA 4L45A 4FSUA 5K5NA 4C35A 4IAKA 2XNMA 5C4LA 3LFAA 4O0SA 1J7UA 5HNBA 5FM2A 5KNJA 3U4WA 4WUNA 1OL1A 1U5QA 3DQXA 3HL7A 4OTDA 2RSVA 1M7QA 2OICA 2W4OA 2Y6OA 3QRJA 3R1SA 4Y95A 4IACA 3QWJA 2PZRA 3ZZEA 4NT4A 3ZLWA 5CEKA 1P5EA 2C5NA 3NUUA 2BALA 3MDYA 3Q52A 3QTUA 3V5PA 4I93A 5DMZA 4PNIA 4IM3A 4F1MA 3NMUF 2JDRA 2VWBA 2XJ1A 1E1XA 3FJQE 3P0MA 4CYJA 5ANOA 2UZVA 2G1TA 2I0YA 4P2KA 3ORIA 4RX7A 3EMGA 4ARKA 5FP6A 4IJPA 2OFUA 4F1TA 3W2SA 4J8NA 1G8SA 3CQWA 4RLKA 3BQRA 2JC6A 4HYSA 3MGYA 1IG1A 4D4VA 2F2UA 3ZFMA 4FODA 5KMLA 3DZOA 3KULA 3BEAA 2I6LA 3RI1A 4ZS0A 4MBLA 2W4KA 3LMGA 5KZ0A 3A8WA 4JBPA 2E9NA 1VR2A 5A9UA 5IISA 2X6EA 3KQ7A 5A4QA 2HELA 2JFMA 4LGHA 4K18A 3IKAA 4FKTA 4J8MA 4G3EA 4EUUA 1YI3A 2BRBA 5J5SA 5B7VA 3MFRA 3ZUVA 4BDDA 3EH9A 3Q9ZA 4XG4A 4GVJA 3CEKA 4YSMA 2JBOA 3CBLA 1WBWA 2JD5A 5AA9A 4NSTA 4IB5A 4G5PA 1ZZLA 4GUEA 4NW5A 4CCBA 2YEXA 2C3KA 5JRSA 2YA9A 2VZ6A 3BHUA 2WXVA 4JBQA 4U3YA 2PUNA 3VBVA 3PE1A 4BDJA 4TWCA 3PRIA 3ULIA 2WAJA 3OD6X 4IANA 4YPDA 4MH7A 3P7CA 3FC1X 3LFNA 1XKKA 4FVRA 5DWRA 5C8KA 1A48A 1OL6A 2IZTA 4FEWA 3RWQA 3QRTA 5F20A 4L8MA 4CFWA 3MA3A 4CVAA 4NWMA 1Q62A 5FUTA 4GG5A 3ZS5A 3V8SA 2ZDUA 1RE8A 3HRBA 3Q6WA 4R78A 2EUFB 3TV4A 3UIUA 3ZCLA 1MRVA 5ETIA 3H4JA 3NVMB 5CYIA 5FLFA 3QQJA 2ONLC 4KBAA 4B6LA 5E1SA 3BIZA 5ANEA 1PXNA 5DFPA 3HRCA 2GQRA 3MBLA 4HCTA 3CGOA 4FZFB 4L42A 2BRNA 4JL9A 3IECA 3KGAA 3MB6A 2CDZA 1I09A 3V8TA 1SVGA 1QPEA 4U45A 2GNJA 4RMZA 4FK3A 2WOTA 5L8LA 3UQFA 3PXQA 3NYVA 2ZAZA 3D2IA 3SX9A 4CSVA 4BWPA 4XRLA 3PG1A 4I5HA 4FT5A 5FTOA 4F65A 2XF0A 3R7EA 3M42A 1KE9A 2OZAA 3IK3A 3SV0A 4XBRA 1PKDA 4PMSA 4QTBA 1ZYCA 1JKTA 3HMOA 3EZVA 3P23A 2WTCA 4I4EA 3R2BA 4LRJA 4RVLA 4ERWA 5HX6A 2IVVA 3VRZA 3ZBXA 3PRFA 3G0EA 4YC8A 4PX6A 1H24A 4EOQA 2QODA 2ERZE 4Z16A 2OF2A 3ODZX 3C9WA 5AV2A 4C7TA 5JFWA 4IAAA 3JUHA 4EZ3A 5D1JA 3LFEA 3KF7A 3RJCA 2B54A 3QTQA 3UDBA 4ERKA 5HE3A 5DVRA 2WTDA 4D1SA 3UZTA 4X3JA 3G15A 2HY81 4A07A 3BU3A 3V51A 2VGPA 1LPUA 4YR8A 1V0PA 4AFEA 5A14A 4FF8A 3UNJA 3QLFA 4DFYA 1GZKA 4H1JA 4FNXA 5CU6A 4J71A 4RX5A 3W32A 4GV1A 5ETFA 4LMUA 4CRLA
chains in the Genus database with same CATH superfamily
2XK3A 1Y8YA 2ZMCA 3F69A 2HXLA 3OWLA 1Q61A 3G90X 4W8EA 5CLPA 4EK3A 3AC3A 2UW4A 3ZLYA 1ZLTA 4AAYA 5IDPA 4H1MA 4FKVA 2GPHA 3V5JA 2ERKA 4WNPA 2YIXA 4C33A 3NR9A 2DYLA 3MVLA 4L53A 5DT4A 3ROCA 4FX3A 3OW4A 3FXXA 4IADA 3DTWA 4U7ZA 1WBTA 4HVIA 3QCSA 4ORKA 4FC0A 5CS6A 5CEMA 2GS7A 2ZM4A 2HZ0A 4H36A 4P5QA 5HE0A 4BGQA 3U54A 3MS9A 1KSWA 3PJCA 4X6RA 4O4BB 3GB2A 3WF7A 4ANNA 4C4GA 4EOSA 4AF3A 5J9YA 4IMYA 5I3RA 2B0QA 1GY3A 1Q24A 4AW1A 2B4SB 3NRMA 4EJ7A 1OUYA 1MRYA 3R01A 2YABA 4BCMA 4MWIA 4ZS4A 2XZSA 3NW7A 5TOZA 3H10A 5HQ0A 4FYOA 4EC8A 3QQHA 1XMLA 3CPCA 1JOWB 5EQPA 2OG8A 3FMHA 4O1PA 5A4EA 1M7NA 4IVCA 4R5SA 3ZRKA 1VEBA 4EK6A 4QMQA 1CSNA 5CX9A 1GIHA 1OKZA 1ZYSA 4R3RA 5TKDA 4ENXA 4RIXA 1G8JA 2OU7A 3KXHA 2DWBA 2X0OA 3W2QA 5EOBA 3ORNA 5AP3A 2JDVA 3QCYA 4Q9SA 4QO9A 5FM3A 3F3UA 5KZIA 5FQDC 3PXRA 4ZY6A 3E7VA 1IA8A 2X9FA 3BL9A 1H07A 2B9IA 3QQFA 2FA2A 4FIIA 3PVGA 4FTQA 3NAYA 4K6ZA 3Q2MA 2CKPA 4RFMA 5KHXA 1URCA 4FG7A 3RM7A 4FKWA 4FEVA 1YWNA 2VWYA 2YM5A 4FZ6A 3N4VA 1OZ1A 2BZJA 4N0SA 5HTCA 4GK2A 1OECA 3FI3A 3OXZA 5HO6A 1TFFA 3HV4A 3O8TA 3K2LA 3FZPA 3KA0A 3OXIA 3QUPA 4EHEA 4ZSAA 1VJYA 1KOAA 4TYIA 4ZP5A 1GZ8A 4ANQA 2XUUA 2XS0A 4GUBA 4CTBA 4HZRA 2C68A 3R9OA 5LVOA 4HGTA 4A9RA 4C0TA 3MW1A 2FGIA 4ASDA 5CENA 4W9XA 1ZOEA 3FMNA 3Q4TA 3EL8A 4CFNA 4D2PA 5F95A 4EBVA 5HD7A 3BZ3A 4L3JA 4KINA 3R22A 1H25A 4MD9E 3RAIA 2YZLA 2BPMA 3DNEA 1FGIA 2QC6A 2VTQA 4PTEA 5TT7A 4A4XA 1K2PA 1TQPA 3EN4A 5L2SA 3A7GA 3BHVA 4LL5A 4PF4A 3M11A 4FIJA 5HLWA 5K0XA 1JQHA 4FZDB 4CT2A 1U54A 3G51A 4G3GA 2YWPA 5EKNA 3PSCA 5E8VA 5F94A 3L8VA 3QZIA 4A4OA 3HDNA 1XHAA 3O2MA 4DEIA 3A4OX 3NFFB 3O5AA 4M0YA 4F7NA 4KA3A 1QPCA 4ZTQA 4JBVA 4ZTNA 4BCNA 4BTFA 1PY5A 4KWPA 4XV9A 3CE3A 4X2GA 2EVAA 1CKIA 4QMWA 3QGWA 3PE2A 2IWIA 2PE1A 3WARA 4MK0A 3KKVA 3FUPA 5CF8A 5J7HA 1XMMA 4FSNA 3P5JC 5JEBA 3SAYA 4QQJA 1YWRA 2O5KA 4ENYA 2ETMA 3A2CA 4FK6A 4AOIA 4FTJA 4XEYA 2CLXA 4GU6A 3QD4A 4F0GA 4LOPA 5BYYA 1H08A 3TIZA 1U59A 4U43A 4DEDA 3EFKA 4QTAA 3OUKA 3AT2A 4O0RA 4P5ZA 3VUTA 4AE6A 4CNHA 2PSQA 2XIRA 3NWWA 3CTQA 3UOJA 3VS3A 4O6LA 1UWHA 4ACDA 2UVZA 1YXTA 4F4PA 3IPHA 1RW8A 2UW6A 4WBOA 3ZSHA 1UWJA 5BVWA 4EHVA 4KUJA 3D0EA 3DJ5A 3D5WA 2PK9A 3W16A 3NEWA 1SM2A 4Z55A 4EOPA 3KL8A 3BPRA 4HNIA 4D58A 2VTAA 1OGUA 2YM4A 5FBNC 3BRBA 2KTYA 3SHEA 4RIWB 2J5FA 4G9RA 4QYHA 2HY0A 5BMMA 3KULB 1GNGA 3OG7A 1HCLA 3VNTA 4EQCA 3FSKA 4EL9A 2QKRA 2ZM1A 3EQGA 5AIRA 3ATTA 4DHZA 3G9LX 2CN8A 4D5KA 5M56A 3HAMA 3ORMA 5HBEA 4YURA 3IGGA 4IAYA 5C26A 5HIEA 5EYCA 3PP1A 3MSSA 5J95A 3ZOSA 1W98A 5I9XA 4D2TA 5DPVA 2QOOA 3HUCA 3QGYA 4R3PA 5DLSA 2UZWE 1KE8A 1OPLA 3QQKA 4YJUA 5IEXA 5J1VA 5BVEA 3EHAA 2P2IA 2BHEA 4BIBA 3OBGA 3BEGA 4O7ZA 2F7ZE 3MY1A 4A9UA 4A9SA 3UQGA 3VQUA 1YHVA 1ZYLA 2JDSA 4FR4A 4MXCA 2UW7A 5JFXA 1M52A 2ONLA 4FTAA 3G2FA 4UX9A 3VS6A 3TUBA 5DT0A 2YWVA 4G3DA 3GFEA 3PA5A 4CMOA 2PYWA 5HVYA 5CSHA 3ZDUA 5CVFA 5HTIA 2YIQA 1H28A 3NX8A 2FSTX 4K9YA 3PPKA 3VS0A 3G6HA 5AR2A 4ZTRA 1IR3A 2GSFA 5CEIA 4DEHA 4PPCA 2BMCA 4M14A 5CY3A 3I1AA 2HXQA 4YHJA 5IQGA 4JQ7A 1K9AA 2WMAA 4M8TA 4K11A 4YLJA 4YJVA 4P4CA 3CCNA 4KIKB 4JDIA 3C5IA 1H1RA 2UW0A 3HYHA 5C4KA 5HESA 2VTMA 2PMIA 1RJBA 3TG1A 4BTKA 5CAUA 1LUFA 3IO7A 1MRUA 2G9XA 3PWDA 3CIKA 4FV0A 3FY0A 4HPUE 3N4UA 3I7BA 1Y57A 4R3CA 3AD6A 4DEAA 4O7YA 1J7IA 4F7LA 3GNIB 4EEVA 4L9IA 4O4CA 1WCCA 4WOVA 3AG9A 4YJOA 5L2TA 4BHZA 3WIKA 1TVOA 3OCSA 3UP2A 2C6LA 3D5XA 2W1CA 4L67A 4QYFA 1JWHA 4FT7A 5BPYA 2BR1A 4UXQA 2Z60A 3WF8A 2XP2A 2HZ4A 3R7YA 5B2MA 2NPQA 3QC4A 3R04A 2HW7A 1TKIA 3DBFA 4JT3A 4BGGA 3QRUA 2BILB 1FOTA 4PDPA 4EH9A 2IG7A 4BY9E 4QP4A 4MKCA 3QTZA 2YLEA 3U9NA 4BZOA 3BYMA 2ZV7A 5KMIA 3TZMA 1WMKA 3QUEA 1J7LA 5A4LA 1YHSA 4NM0A 3BKBA 1CKJA 2QD9A 3OWPA 4EH6A 4HGLA 5KKRB 4TY1A 5FXSA 1AGWA 4I24A 3IW7A 5J8IA 4IWOA 1YXVA 1YOLA 2XK9A 3AMYA 4I6FA 2IW8A 4FSRA 4UMPA 5I4NA 3UDTA 3W0MA 4CT1A 5EYDA 5JFVA 3O0GA 5K5XA 2X2LA 2QHNA 3ZO3A 5F4NA 4YNOA 4BDKA 1SNXA 2OSCA 3MJ2A 1ZOGA 4GKHA 4HVHA 4ZY5A 1SMHA 4BDCA 1DAWA 3PUFC 2YCQA 4LYNA 2Y4IB 3OCBA 3S00A 3TUDA 4FV4A 4WBBB 4BB4A 3A8XA 2BHHA 1V0OA 5AADA 2P4IA 2XANA 2W5BA 4DLIA 1GJOA 2PZ5A 5IEVA 2F49A 3ANQA 3QQUA 4BCHA 4AXDA 4BJJA 3FC2A 3GOPA 3EFLA 3P9JA 3QTRA 4GVAA 3LQ3A 3CD3A 3K3IA 4M0ZA 3HV5A 3MYGA 1XH6A 2XYNA 5FTQA 4EK5A 4X2JA 2WTWA 4DTAA 1UU3A 3Q4UA 4YJTA 2YERA 3CTJA 5E91A 4E5WA 4FV3A 4X21A 3W0NA 3TKUA 1FMKA 3MV5A 3SD0A 4RBLA 2O2UA 5I5ZA 1U4DA 2YISA 4MF0A 1OBGA 3VQHA 5AP2A 4W4WA 3TN8A 4D4RA 4EH3A 3R1QA 2IO6A 4XG8A 4XJ0A 4CFMA 2JIIA 1ERKA 4YZDA 4J98A 2XJ2A 2FSMX 2AC5A 4U79A 2R4BA 2V55A 3FAAA 4H3BA 3ELJA 5DRDA 3ZBFA 5AAEA 3F82A 1PMVA 4YC3A 3LXLA 2P55A 3ACJA 3M2WA 4IX4A 4R7HA 3UOHA 2J0MB 5DEYA 2OJGA 4GU9A 5DG5A 4AZSA 4D2WA 3PVWA 2EB3A 1QL6A 5M07A 1YDRE 3F61A 4WA9A 2PE2A 3OT8A 3DBCA 1H4LA 1OB3A 3EQPA 4YPSA 2OJJA 5IQBA 5ANKA 3FMLA 4I6HA 2RFSA 3MY0A 4BI0A 2C6IA 5KKRC 2R0UA 4NJ3A 5EDPA 2A98A 3VUMA 2XBJA 2W1DA 2QNJA 5L6OA 2PWLA 3HP5A 3R7IA 5HORA 2REIA 4KKGA 5G1XA 4RWKA 3UVPA 4FTUA 4OW8A 4TYHB 2SRCA 4FG9A 4F99A 3DS6A 3U6IA 2WEIA 4OTFA 2WTKC 4G16A 4IB3A 3FBVA 3PSDA 3DDQA 4BDHA 3KXXA 4YC6A 2BUJA 3ZTXA 1UNGA 4C3FA 3U6JA 1WBNA 5CT7A 2OO8X 3EQIA 3V8WA 2OIQA 3GC8A 4II5A 4RPVA 1F5QA 2Y4IC 3R00A 5A4TA 4ONAA 5KMJA 5M06A 1W0XC 2C1AA 1XH9A 4EH2A 1R39A 3FLYA 3R9RA 4EUTA 3RZBA 1I44A 4DN5A 3W55A 4HNFA 3PYYA 1Q8TA 1PRYA 3RPSA 4JOAA 4DG0E 3FXWA 4PWNA 4JI9A 5IEYA 3ORXA 2XK4A 1W84A 1PMEA 3QTIA 4IAIA 5FEEA 4AA5A 2W06A 3OP5A 4C38A 4N70A 2WQEA 4FKOA 3MA6A 4DBNA 2J2IB 4NL0A 2YJRA 3QZFA 3LKMA 2UVYA 4OTHA 4USDA 1YI4A 3VUIA 1NVQA 1TQIA 3KXGA 4FEXA 1JNKA 2ITNA 4IAZA 3I0QA 1UA2A 3BHHA 1U54B 4C57A 4UB7A 2OKRA 4FEQA 4BBEA 1DI8A 3E92A 4RX8A 5AUXA 3CKWA 4AOJA 1V0BA 2VV9A 5EI2A 2PU8A 4GIIA 3W2OA 3NPCA 4PY1A 3ZO2A 4W4VA 4RIOA 5E90A 5IQHA 4CZYB 4ALWA 3LM0A 4KIQA 4MQ1A 3W2PA 5T6KA 5M44A 3RINA 3G33A 4F6WA 5EYKA 3GU6A 4I23A 3BU5A 2YAKA 5CXHA 3R8MA 4AT4A 5AR7A 4Y46A 4O2ZA 3UYSA 3PVUA 2XNNA 4X0MA 4EH4A 3F3ZA 3EWHA 4ZZNA 4XLIA 3GU7A 4CYIA 4LV5A 4AN2A 2F7XE 3TTIA 5CANA 2GQSA 4FKJA 3OHTA 4O38A 4YBKA 3VS7A 4A9TA 2FVDA 4TKSA 3SXRA 4CQEA 5JZJA 5CU2A 1AD5A 3VF8A 3WE4A 5H8EA 3A99A 4MTAA 4K33A 4CXAA 4ZZOA 1NT2A 5AFVA 4WO5A 4O7WA 1HCKA 5C9CA 5HU9A 5JRQA 2C6KA 4CMTA 5CTPA 3I0OA 3BGPA 3O71A 4F6SA 3C5UA 4L43A 1JBPE 3SOCA 3EIDA 4B9DA 2QG5A 4FGRA 3VBWA 3HV7A 2CCHA 3UZRA 2KULA 3RHKA 4JG7A 4DEBA 3E93A 5CF6A 2OH0E 4CKJA 2W99B 4EHGA 3T9IA 4AU8A 3EQDA 2VWZA 3R21A 3VN9A 4XV2A 4ANMA 2WTVA 4V04A 4HJOA 3ZFYA 1WBPA 3PUPA 4FTIA 4IW0A 3UZPA 3TTJA 4S30A 5ACKA 4BC6A 3FQEA 1P4OA 2GNLA 3QTSA 3R2YA 4DFZE 3F88A 4QDVA 3LJ0A 4L52A 1DM2A 4CFVA 2GTMA 3D4QA 3PJ3A 3RPVA 4JJRA 3I60A 3FMMA 3ETAA 1P2AA 4EKKA 5GJDA 2QOLA 3L1SA 3QHWA 4L44A 4LUDA 4BBMA 3C4WA 4TNBA 2QOFA 4AGUA 4RVTA 3WI6A 1ATPE 2VAGA 2JEDA 1LR4A 4CZTA 4IDVA 1Z9XA 5ACBC 4AOTA 4QP3A 3JPVA 3OFMA 3VAPA 3WZUA 1XJDA 3WE8A 2PUIA 3RK5A 4GJ3A 4XOZA 2UZEA 2PZPA 3U55A 5J87A 5BVOA 3PPZA 3KFAA 4E5AX 4JDHA 1YXUA 4TN6A 4M13A 2Z7SA 3TM0A 3CD8A 3EFWA 5K4IA 4AACA 1PMNA 3ATSA 3D94A 3II5A 1LEWA 3QX4A 2C5YA 3K5UA 4G6NA 4O22A 4QTCA 4F0FA 3DAKA 3I79A 4YU2A 3FMEA 4RIWA 1H01A 1JSUA 3LLTA 4I20A 5AV0A 3EKNA 4MWHA 3TNIA 2BIKB 2YAAA 1YXXA 4TT7A 4CFXA 4FKPA 5CZIA 3WIGA 5M4IA 4BCGA 3HV6A 4GRBA 3QRKA 4OUCA 1B39A 4QMSA 4WSYA 2HK5A 1OL5A 2JIVA 5CALA 1JVPP 5CQUA 3R8VA 3P4KA 3NLBA 3WZEA 3DK3A 5CAOA 3COHA 4U42A 4DH8A 3ZSGA 3SGCA 3E7OA 4R6VA 1OL2A 4NM3A 4OBOA 4XG7A 5HOAA 5J9ZA 4M7IA 5H3QA 1A9UA 3COKA 3QTWA 4KIPA 3GBZA 4BCQA 3BYSA 3VF9A 5B2LA 3GCVA 3H0YA 4BIEA 4D28A 4YZCA 1P4FA 4CTCA 2HYYA 5L8JA 3UMXA 4BKYA 1KOBA 3FZ1A 4D2RA 4DFUA 4BDFA 4M66A 2RFEA 3P5KA 4ZEGA 5KE0A 3KREA 5BYLA 3ZM9A 3GVUA 2I0HA 4L68A 4DH7A 3OY1A 3DPKA 4FYNA 4TPTA 4I5CA 1ZMUA 4R1VA 3KMUA 4AZFA 4RFZA 1BL6A 3R1YA 2C5OA 4O7RA 3C4EA 3C51A 4I5MA 2YM6A 3HAVA 4H39A 4O4DA 2O64A 5IQDA 1Y6AA 4G3CA 4PDYA 3EZRA 4MYGA 5CSVA 3R8ZA 1XBBA 2XIXA 5FEQA 2PVNA 4XLVA 5D10A 4KIKA 4L7SA 3OW3A 3DKOA 2YDIA 2ZB0A 4GT5A 4PL5A 3BYOA 4AGWA 1YRPA 3MVHA 3M1SA 4FKUA 2V7OA 2NNWB 4E4MA 3SVVA 4P7EA 2CPKE 4WHZA 3TNQB 2HOGA 2R64A 3KVXA 1L8TA 3NW5A 3QF9A 1GIJA 3N51A 4EH5A 4OAVB 5LQFA 3LXPA 4FT9A 3VBQA 5IA2A 1FVVA 4LGDA 2BFYA 2VD5A 4QPAA 2RKUA 3O17A 3TCPA 5K9IA 3ID6C 3LMIA 3TDVA 4EWHA 4ID7A 4MHAA 4NW6A 4YHTA 4BTJA 2I40A 4MAOA 4BJJB 2VNYA 4RGJA 2R2PA 4YO6A 4IZ7A 3BGZA 2IW6A 5EDQA 4WKQA 4C4FA 3F2NA 1ZAOA 2V5QA 3QXOA 4HPTE 4QMTA 5KO1A 4TTHB 3G5DA 2VX0A 4IC8A 1FPUA 4UALA 3RPYA 3AD5A 3Q3BA 4RVMA 2RL5A 5HO8A 3W2RA 4ACGA 5JGAA 1FBNA 3FLNC 2OXDA 4I0RA 2GQGA 2I1MA 4FTRA 4XUFA 4J97A 4YP8A 2XNGA 3RWPA 1FVTA 3F5UA 4WNKA 4I94A 1J1CA 3FLSA 4NIFA 2QOBA 3H9RA 4BDBA 3QKKA 2QG7A 4WG4A 5I3OA 3BE9A 5A6NA 3CY2A 4E4NA 3K3JA 5AUUA 4D1XA 2C0TA 3QAME 5DRBA 4HYUA 2ZYBA 4QMYA 3IONA 4WIHA 5AA8A 2VTRA 3B2WA 4DFXE 2YFXA 3JR1A 4ZLYA 5CAVA 5IKWA 3KMWA 4GMYA 2QOKA 5HG8A 5GZ8A 1W2CA 5IA4A 5H2UA 2WU7A 3QUDA 4F9WA 3BBWA 4FV5A 4FKGA 5HTBA 3DXQA 2ZVAA 3S1HA 2R3MA 2VO0A 2WGJA 1ZYJA 3E8NA 3NNVA 5EW3A 2PVJA 1V1KA 4Y73A 4I92A 3UMWA 3FL5A 4ACHA 4NTTA 4RRVA 2WB8A 4D0XA 4AWIA 2A1AB 2OXXA 2YLFA 2XMYA 2UZUE 4B4LA 4AZVA 3UG1A 4WG5A 4OTRA 3R7UA 1Q8YA 5KMKA 3R83A 2ETRA 4IFGA 3V5LA 1A06A 5BNJA 5CSWA 3SXSA 4QMPA 5FXRA 4FZ7A 2XJ0A 3CKXA 1Q8ZA 5A46A 2FSOX 5FEDA 4FVPA 4QT1A 3V5TA 2ZJWA 4O4FA 1ND4A 3WF5A 4F1OA 3A61A 3O8UA 2GNIA 2XBAA 3D83A 4JRNA 5EW8A 2W05A 3EN6A 3PZHA 5E8UA 4S34A 3MH3A 1KUTA 3MFUA 4ZZMA 2I0EA 3WZDA 2X7GA 3IW8A 3ZO1A 4AXAA 4CV8A 2C6EA 4FTTA 3NUPA 3SOAA 4IWDA 4QMMA 4B8LA 2WU6A 2XNPA 3REPA 4EH8A 4LL0A 3PJ1A 3E64A 2XIYA 3BELA 3CQEA 2X4FA 3ENMA 5LVNA 2J0JA 2PVMA 2OI4X 3ZLXA 2ZFYA 2YJSA 4AXFA 3BV3A 1QMZA 3D5VA 5C27A 5M4UA 3Q53A 3DA6A 3IGOA 5E4HA 4RJ3A 3PIYA 4QNAA 3Q4CA 1XH8A 4ANBA 4FTLA 3HMIA 4TYHA 2ZM3A 4LM5A 2P2HA 3VIDA 1DS5A 2XK7A 2ITPA 3QKMA 4G31A 4KNBA 4E5BA 5IA3A 2C47A 4BTMA 3L8SA 2WEVA 5L4QA 3I7CA 4GS6A 3LM5A 4BN1A 3C4CA 3S4QA 3GQIA 3OT3A 2GNFA 4FV2A 4UYNA 5AUZA 3U6HA 2W1HA 4U81A 4FIGA 1F3MC 2GNHA 3DK7A 5I9WA 3FPQA 5KHWA 3FPMA 3GEQA 4QYEA 2EWAA 4JDKA 2BRHA 2Y9QA 3NNUA 4FKRA 4HOKA 4K2RA 4MBJA 2X7FA 2J0KA 3SA0A 2XK8A 4EOOA 4IJ9A 3QYZA 4EYJA 3GENA 1PMUA 4C4JA 3UTOA 4O7VA 2DUVA 4M69B 4M15A 4EI4A 2QU5A 5T3QA 4DDIA 5EI8A 2G2FA 3BLRA 5CU0A 2A2AA 4ANSA 4F7SA 1NW1A 3R7VA 5BUJA 4MQ2A 2QOQA 4CCUA 3OWJA 5AV3A 3U8WA 3VBTA 3PZEA 3PFQA 2R3JA 3PLSA 4R1YA 5AAFA 4BIDA 3L8PA 5KMMA 1NVRA 2VTSA 3FSFA 4ZK5A 5C01A 4PP7A 4ZAUA 3PP0A 4FZAB 4NEUA 3QRIA 4GJ2A 3MWUA 1BUHA 4FV1A 4MVFA 4UBAA 1ST4A 3A7IA 4BZDA 4BWKA 1RQQA 4GYGA 3G9NA 5IUIA 4DFBA 3KY2A 2EXCX 2WZJA 4XCUA 4Q2AA 2C6MA 4DC2A 2ZV9A 1P14A 5JQ8A 2E9OA 4OBPA 5JH6A 1GAGA 3QU0A 2CGWA 4MX9A 5KBQA 4TZRA 4UY9A 3DBDA 3NW6A 4DT9A 3LIJA 1REJA 3A62A 4QP2A 4YLKA 3E5AA 4W4XA 3CJFA 3JY9A 2YDKA 3IDPA 4KS8A 4UWYA 3R9DA 5A3XA 3UIBA 5CT0A 1Z57A 3HLLA 5HE2A 3F6XA 4M84A 4WUAA 5JQ5A 2W96B 2V0DA 3UIMA 4H3QA 4OTWA 3RKBA 1JPAA 2VN9A 2QU6A 4G3FA 4YTCA 1FMOE 3CJGA 3FMKA 5EM8A 5HX8A 4S31A 3AD4A 3NUAA 5L2QA 4O81A 1BMKA 2QR7A 3FYJX 4YUQA 5M53A 2CKEA 1Y8GA 2W5HA 3I5NA 4HCVA 3BGQA 3FHIA 3UE4A 5IH4A 3MH2A 2HCKA 3CGFA 2XCHA 4TYJA 5J1WA 3DB6A 3RNYA 3MH0A 3E3PA 3MI9A 2WIHA 2WMQA 3H0ZA 3LCTA 4L00A 4AA0A 4EOJA 3HMNA 5EHYA 2XEZA 4QP6A 3RM6A 3TXOA 2J6MA 3MN3A 4BZNA 4DFNA 3NCZA 3Q60A 5LVMA 4XG2A 1RDQE 3DAJA 2EU9A 4F64A 4ANOA 5BUEA 3VS2A 2OJFE 4OBQA 4K1BA 1XO2B 2X8DA 4E6CA 3BQCA 4R7BA 3OEZA 4I4FA 4ACCA 2AC3A 3VBYA 2PMNX 4AW5A 4BCJA 3RAHA 4E73A 3R7OA 2C6TA 3HEGA 1PHKA 4MD8E 3P7AA 4APPA 4JDJA 2CGUA 3PG3A 3DV3A 1XR1A 3DJ7A 3JYAA 3R28A 3I6WA 4ITHA 3KIOC 1ZOHA 2W1IA 5DBXA 5I0BA 3GC9A 3W1FA 3C0IA 3COIA 3RPRA 1ZRZA 4CG8A 2Y4PA 1KE7A 3C4ZA 3NYXA 3GI3A 3LJ1A 2ITXA 4HYHA 3Q5ZA 5LCKA 3ZC6A 2GHGA 4EOKA 4X2NA 3NDMA 3FMJA 3UOLA 2B52A 4YNEA 3UODA 5L2WA 3HGKA 4FSWA 3OWKA 4GFOA 3NSZA 4LDTA 4YTFA 4EOMA 3O8PA 3MVJA 2JBPA 4R8QA 3DXPA 4IXPA 4FV7A 1WVWA 2A4LA 2VTIA 2VU3A 4JX3A 4FV8A 2XM9A 3D7TB 2V22A 4C3PA 4BCIA 5IF1A 4AE9A 4OT6A 3Q9YA 2X8EA 3Q04A 3PLAE 2DQ7X 2BDJA 4DITA 3AOXA 3CR0A 5I9UA 4EWQA 4X3FB 3VO3A 3ZXTA 4UV0A 2C5VA 5J7BA 4NK9A 3UBDA 1Q41A 3KK9A 4BRXA 4DTBA 3GGFA 3PXFA 1W8CA 2BRGA 3EB0A 1FVRA 2R3FA 3FL4A 3HUBA 4O21A 4U8ZA 2F2CB 2QR8A 1WBSA 3JVSA 4FJVA 3JY0A 2XKDA 2CKOA 4WT6A 2VWVA 4JR3A 3DAEA 2QCSA 2CN5A 3AMBA 4BVUA 3EQBA 5FXQA 4J99A 4BCOA 4RC3A 1M2PA 3BLHA 4RQKA 4OTPA 4A4LA 4BDIA 2VO7A 3RHXA 3KXZA 3SG8A 4XG9A 4D55A 3WBLA 4U44A 3LFDA 5LMKC 3RCJA 2GFSA 5AR5A 2UW9A 4DGLC 5M55A 4OLIA 4UZDA 5D7VA 4ZSLA 3QA0A 3A7JA 2VTJA 4GIHA 1GOLA 5HEZA 2HIWA 1UKHA 1H26A 2ITUA 4FNZA 3BV2A 1W83A 4NIFB 4NFMA 4GYIA 4C37A 4HVDA 2VTOA 2JKOA 4JG6A 3R0TA 4MXOA 4EQMA 5HCYA 2HZNA 3EFJA 3Q9XA 3TNPC 3E8DA 1H0WA 2C6OA 4IB1A 4GL9A 2WTKB 5I9VA 4AW0A 4E8AA 3KVWA 4PTGA 4G5JA 3UOKA 4DTKA 3KRXA 1IAHA 4IVBA 4ZSGA 2UZLA 3PTGA 3UNZA 2C0OA 4AS0A 2QOIA 4O7NA 4J1RA 3V3VA 4FKSA 4GG7A 4DH3A 4DE4A 2OJIA 3U9CA 4AN9A 3ZONA 2PTKA 2YITA 4KSPA 4YMJA 4DGMA 1O6LA 3DJ6A 4O1OA 4DCEA 4FGBA 1VLRA 1G8KA 4Q5HA 5GZAA 2YN8A 3CTHA 4FOBA 5EHOA 1NA7A 5C03A 2PZIA 4HGSA 3W2CA 3FI4A 4AA4A 4IBMA 3C0HA 5JN2A 4Z3VA 4DBXA 5CVHA 3F66A 4APCA 2OIBA 4FNYA 4MNFA 5E7RA 5EQYA 4IZ5A 4QMXA 3NYOA 3DTCA 3E8CA 3HRFA 4CFUA 1FGKA 2X0QA 3QYWA 3VVHA 3OOGA 2IZSA 4YJRA 4V0GA 4KS7A 4N57A 3R9HA 1F0QA 3C50A 3LXKA 3AC1A 2OW3A 4X3FC 2JDOA 1ZMWA 2BZKB 4ALUA 2WMRA 4RC4A 4Y8DA 3DOGA 5M4FA 4ZTSA 3TUCA 2YCRA 2P0CA 3QCQA 4XNEA 4UMRA 2EB2A 1OBDA 2IVSA 3TEIA 1XQZA 2QQ7A 3VHEA 5GHVA 1L3RE 4JAJA 4TWNA 5BVKA 3W8QA 5M4CA 3ML1A 4CFFA 3FKOA 1YQJA 2FSLX 3P79A 1YDSE 3AC4A 4C02A 4ASXA 2H6DA 2VTHA 3QZHA 4DEEA 4FUYA 2QO2A 4LG4A 5EK7A 5BMSA 3SLSA 4L6QA 1OM1A 4QNYA 4Y5QA 5FD2A 2W0JA 3HDMA 4LGGA 4E4XA 4HVGA 5JGBA 3HV3A 1SZMA 3R8UA 4J52A 1G3NA 1UU9A 4DGGA 3DBEA 1YKRA 3UPXA 4MXXA 2CNVA 2R3KA 2B9HA 3I5ZA 3DT1A 3OEFX 2CGXA 2R7IA 5I9ZA 1MP8A 3U51A 4U9AA 2C1BA 2J51A 3LFQA 3SC1A 3KEXA 4LOQA 4DFLA 4IDTA 5EI6A 3G6GA 4Q9ZA 4U80A 3EL7A 2B9FA 3R6XA 5AP0A 2PVKA 2WD1A 2X9EA 3BE2A 4OT5A 5LJJA