3LZBA

Egfr kinase domain complexed with an imidazo[2,1-b]thiazole inhibitor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
281
structure length
265
Chain Sequence
LLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMRKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Imidazo[2,1-b]thiazoles: multitargeted inhibitors of both the insulin-like growth factor receptor and members of the epidermal growth factor family of receptor tyrosine kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
total genus 85
structure length 265
sequence length 281
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lzbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lzbA01
2J2IB 2G1TA 2WNTA 1MRVA 2YJSA 3GQIA 2OFUA 4Y95A 3TXOA 3F5GA 2H8HA 4J99A 5FEQA 4DN5A 2PPQA 3GT8A 4DH1A 1OUKA 1W82A 4HPTE 4XJ0A 1URCA 2CPKE 4FSQA 3RK7A 4NL0A 1XJDA 1P4FA 3WZKA 3VBXA 2BZKB 3ZM4A 2GS2A 2WTKC 4FIIA 3N4TA 3A8XA 5EI8A 5BVFA 5DWRA 1QMZA 1P2AA 5M44A 4XOYA 3VULA 4F0FA 4FV5A 1L8TA 3DNDA 2VTJA 4H3QA 2OJGA 2XUUA 4XV9A 2X8EA 2R3JA 2CKQA 2Y6MA 3UYSA 3BE9A 5L2IA 2R3QA 4ZY4A 2C6DA 2QOBA 3P9JA 4KBAA 1ZARA 2X6DA 4LV8A 4PMSA 1YRPA 4TW9A 4YBJA 4R77A 4EOMA 2XIKA 3MPMA 4GSBA 5HQ0A 5HU3A 5K4IA 3CJFA 3ORNA 4OTDA 5DA3A 3R73A 1S9IA 4BZDA 5F9EA 4GYGA 5HVKA 3C51A 4I6HA 3LCDA 1WCCA 4WOVA 4ZP5A 2WMSA 2YJRA 1KV2A 2W1ZA 3UIXA 1VJYA 4FTJA 5L8JA 3UGCA 4GVAA 3BPRA 3EN5A 5A54A 3A4PA 4IZ5A 3FMLA 3FMHA 5FXQA 4BI0A 4EBWA 3DKCA 2VWWA 5CTPA 2OH0E 3KXNA 5FTQA 2X8DA 4R7HA 5EQPA 4FBXA 3RKBA 4D58A 2WQBA 2Z7RA 3LIJA 4KKHA 2Y4IC 4IXPA 4MXOA 2HXLA 4CLIA 2ETRA 2J90A 5CAVA 2YISA 2XRUA 3QA8A 4QP6A 2R3OA 4U0IA 4IAKA 3MTLA 4JDIA 2B4SB 4U9AA 2O65A 2WAJA 4J1RA 1TVOA 5IA4A 2R2PA 3R21A 4P4CA 4GU9A 1R3CA 5EHYA 5I9UA 3QQFA 5CU3A 2YIXA 5AUXA 3NGAA 4CQGA 2KTYA 2R3LA 3UVQA 4J96A 3FUPA 3VRYA 2Y9QA 4BY9E 3ZRKA 4MWHA 1FVVA 3Q4TA 3MY0A 1PMEA 4YZBA 4CFVA 4E4LA 2W99B 3IGGA 3MVMA 4NJDA 4G3FA 5ANDA 4EK3A 1XBBA 4YZDA 4YLJA 3OUKA 1CSNA 4YR8A 5CALA 1Z5MA 3PUPA 5IQBA 3C4FA 4WO5A 3ANQA 4P7EA 1YXVA 4QTEA 3VUHA 3D0EA 1OL5A 4QP9A 3CXWA 2HW7A 5K3YA 2Q0NA 4PRJA 3HMOA 1I44A 2DUVA 5KNJA 5CF4A 3DJ7A 1APME 4U7ZA 1NA7A 4AGWA 4BCIA 3U4UA 5E92A 1REJA 3GVUA 1MRYA 3GQLA 4UMQA 4WSQA 5FEEA 3LQ5A 5IH4A 5CI7A 2ZYBA 2ZJWA 4BI2A 2WFYA 4FSTA 2EUFB 3EZVA 4M13A 3KMMA 1UU3A 2GPHA 3PPJA 3EN4A 3W1FA 2QNJA 3Q4CA 4CZYB 1A48A 2B0QA 3IECA 2J0JA 4O0VA 3BU3A 5GHVA 4L01A 3DBDA 1IR3A 1R39A 2OJJA 4DCEA 1H1WA 3W2OA 4JS8A 5EM7A 2P3GX 4OT5A 5A4TA 4XMOA 3SW4A 3HV7A 4AGCA 5IA0A 3MN3A 3MV5A 5DOSA 3QX4A 4E8AA 2X2KA 3FLYA 4AN3A 5CF5A 3PJ2A 3R7IA 2WQEA 5HI2A 2WIPA 4YSJA 1XQZA 3C4ZA 3I7CA 3KN6A 3P0MA 3E92A 2X6EA 2C1BA 3BU5A 2X2MA 4I92A 3DQXA 4EK4A 4HGEA 2VWZA 1RQQA 3DDQA 1H00A 3COIA 3R1QA 4QTBA 1JKKA 4W4XA 5E7RA 4L3LA 3TACA 1IRKA 4FL2A 3I4BA 4NM0A 3BYVA 3VJNA 3R30A 3TJDA 3P23A 2B52A 5CZIA 3R8PA 5AR4A 1ZWSA 1PMUA 5HO7A 5AFVA 3VS7A 4IZ7A 4FIEA 5B2KA 3PE1A 2CGUA 3KCFA 5LVLA 3PZHA 4PDPA 1TQPA 2BHEA 3KRWA 3ZSIA 4FK3A 5AX9A 3FYKX 4A7CA 4W4VA 4TWPA 4R3PA 3WF8A 4TYJA 5DGZA 4A9TA 4BYIA 3F3TA 4E4MA 4CFUA 3RPVA 5J9LA 4KSQA 1KUTA 3ODZX 1B38A 2X4ZA 3A7HA 4D1XA 4FI1A 3UQFA 1XH6A 3LE6A 3IK3A 3MFTA 3W8QA 2R0UA 4BZNA 3HDMA 1YXSA 5IEXA 5IUGA 2XM9A 1H24A 4AE6A 3MH2A 3NAYA 4NIFA 4Z9LA 3HEGA 4JG7A 4CV8A 3NUSA 4F9AA 2VRXA 4LUEA 4G3EA 4AFJA 3U9NA 4AN2A 2WMTA 4NEUA 5DIAA 4YJSA 5IQFA 3ATTA 5M09A 3MA3A 4X0MA 3KEXA 4I94A 5DR2A 3RP9A 4DG0E 4TRLA 2YCQA 4F99A 3DA6A 4IHPA 2WGJA 2OXDA 4D55A 5IU2A 4I6FA 2BDWA 2XKDA 4HYSA 5E91A 5EYMA 1Y91A 1AD5A 4WKQA 5CEIA 4BCMA 4LRMA 4U45A 3EB0A 5EDPA 3S3IA 4JRVA 4FNZA 4O0SA 5EM5A 3ZDUA 1U54B 2XMYA 4PV0A 2GCDA 5JFVA 3FMEA 3G0FA 2O2UA 4L42A 3R7EA 4MBIA 5TOZA 1ZYSA 2ZV7A 3UO5A 4BDFA 4IMYA 4OTHA 3OROA 5KBRA 3P08A 1VEBA 3AD4A 3GBZA 4L43A 1Q8TA 2GNLA 5FP5A 3TEIA 3C4XA 4FZ7A 4FKQA 5L2WA 2V7AA 5HBEA 5AP3A 1V0BA 4C02A 3KXHA 4TNDA 5ICPA 4IM2A 4RFMA 2F57A 4PTGA 3CS9A 3QRIA 5E8SA 4GG7A 2CSNA 4UYAA 4WIHA 3LJ2A 4BZOA 3GI3A 2XCKA 2RFEA 3SD0A 1OECA 1RDQE 3UOHA 4PQNA 1ZZLA 3PIZA 2YIWA 4M7IA 4M69A 5EOLA 5ETFA 4ZSJA 5JRSA 3ZXTA 4FV6A 4C36A 1GZKA 1Q99A 1RJBA 1NVRA 3EN9A 4IX6A 4E4XA 1MUOA 2GTMA 4O2ZA 4MQ2A 2XYNA 1OIYA 4FTKA 4QQCA 3QRJA 2WOUA 4XCUA 1PXJA 2IZUA 4JRNA 4LGHA 5TT7A 3TCPA 5B7VA 3C4CA 2YWVA 4X2GA 4HYIA 4O86A 5KMOA 2VUWA 3ZM9A 5DRBA 3SX9A 4D2PA 4K8AA 3P7CA 4HCTA 3E7VA 5CNNA 4FNWA 3EQGA 4ANSA 2R4BA 4KIKB 3D2KA 4ZSEA 4BDCA 1REKA 3DLZA 2C6OA 3LFAA 2A4LA 2VWVA 3TUCA 2HENA 2HZNA 4EJNA 5M57A 4IIRA 2X7OA 5E8UA 4IAYA 1OIQA 1SVEA 4JQEA 2W5BA 2HAKA 3E5AA 3B8QA 4IX5A 5EG3A 4B9DA 3FXZA 4D0WA 3H0ZA 3T8OA 4D9UA 3V5QA 2RFDA 2WIHA 3AOXA 4EHGA 2FYSA 4FKUA 1GJOA 2VX3A 2JC6A 2UZWE 2HZIA 3NEWA 4LGDA 4L7FA 5HVYA 2OKRA 3ZYAA 1ZYDA 2HZ0A 4NKSA 3KMWA 5IH5A 4HVSA 5FDPA 3FQSA 5IUHA 4GT4A 2XF0A 3UO6A 4D1SA 3DB8A 5E9EA 2J0LA 4FTMA 5K5XA 4OBPA 3HDNA 1Y6BA 4U3YA 4FSNA 5LQFA 1CKJA 1JNKA 4CVAA 4O6EA 3CQWA 4CKJA 3U87A 4AE9A 2CKOA 2PTKA 3VNTA 2JDVA 3ZRMA 5HKMA 3VBQA 4R7BA 3UP2A 1SNUA 4FTRA 2DS1A 4PP9A 3R02A 4EHVA 3ALOA 5HBHA 3SG8A 4FMQA 2IZSA 3SLSA 4WG4A 1H8FA 2ITNA 3ORPA 4ONAA 4XEYA 5EYDA 5DT0A 5HG8A 4A4XA 4XH6A 4BDEA 4YBKA 3PVUA 4C8BA 4OTWA 2Y8OA 1Q62A 3BX5A 3WZDA 1UVRA 5JKGA 3L9LA 4DBXA 2I40A 4DHFA 2JDOA 3OTVA 4ZLYA 3ATSA 3PVGA 3PPKA 3G51A 3GC7A 1G3NA 2Y4IB 4OT6A 4BIDA 2GSFA 4JL9A 5LMKC 2BIKB 4XLIA 4JAIA 3DBQA 4IAFA 3W2SA 1T46A 2W1IA 4Y83A 3OZ6A 4U42A 3PJ8A 5AR7A 3QU0A 3AC5A 5DE2A 1SMHA 4QMLA 2VTPA 1BL7A 5AA9A 1UWHA 5AP0A 3B2TA 3U6IA 2XJ0A 3E8CA 4QYHA 2C30A 2P2HA 4A4OA 4F1TA 4EH9A 5AR5A 3DXNA 4PDYA 3QFVA 5F95A 3NDMA 4EYJA 1YHWA 4MXYA 3SXFA 4LUDA 3U54A 1VYWA 2BRBA 5ACKA 3IW7A 4O7YA 3ENMA 4ZIMA 2F7XE 4TYHA 4WSYA 4MBJA 4GCJA 3A7FA 3Q6UA 4RJ4A 4IC8A 3DGKA 3VS3A 4H39A 3NYNA 3IW6A 4BWKA 4E5BA 3HYHA 5HTIA 5IQDA 4GFMA 3CGOA 3FY2A 2J0MB 3FE3A 3BBWA 1XBCA 4I6BA 1YHSA 2OO8X 3QWKA 3ORTA 5HG7A 3AC1A 3F2NA 4DFYA 4DGNA 4RSSA 3IOPA 5CLPA 2FH9A 5B2MA 2HK5A 1WBNA 2PVFA 4X3FC 3WZJA 4KS7A 1WVYA 2C3KA 4RPVA 4JBOA 5GINE 3MFUA 4BGQA 5J7HA 2R3KA 4X21A 3ZUVA 4YNOA 4B6LA 4YZMA 2PZPA 2W1CA 4KIQA 3R8ZA 3T3VA 1Q24A 2C3IB 4ZSLA 3VF8A 3DJ6A 5AP4A 2J9MA 1PXLA 3M2WA 2Z7SA 2UW0A 3EQIA 4Q9ZA 1QL6A 3HA8A 4YJVA 3R8UA 5IZFA 5T6KA 3R1NA 4ZTRA 1OKWA 3CSVA 4G2FA 5AM7A 2XKFA 3QKKA 4C3PA 1BX6A 4IAZA 3H0YA 1H1QA 4HVGA 4YSMA 4ZTQA 4WRSA 4XBRA 2Y4PA 3QCSA 4RG0A 4XP2A 3AC2A 3PRIA 4YGAA 2BRMA 2YCFA 3ZZWA 1JKLA 4BDKA 2ITQA 5H2UA 4QTAA 4TT7A 4EUTA 2JBPA 5LWNA 4O81A 3F9NA 3KRJA 3UZPA 3PRFA 3CPCA 3ORLA 4GS6A 1UNLA 4O27B 4DFNA 3RPSA 2REIA 5HCZA 3W2PA 2PZIA 4E4NA 4RJ8A 5AV4A 1IEPA 2UZTA 4IACA 4FSWA 4PMTA 3LQ8A 3UMWA 2CGVA 2X7GA 3WF7A 5HO6A 3CTJA 4LRKA 2WTIA 2XEYA 1FMKA 3O17A 3P79A 4GT5A 3I5NA 3OC1A 4M3QA 5AUVA 4ZZMA 3V6SA 4OR5A 4O7LA 4HZSA 1J7UA 2Z02A 4PNIA 2IW6A 4HCVA 4JG6A 3W8LA 1SZMA 4RIYA 2W9ZB 2E9VA 5D7AA 4ACCA 3FSFA 4IEBA 4FA2A 2ZM4A 3C9WA 4R5YA 3Q96A 2VWUA 4OTGA 4L68A 4KRDA 3TL8A 3CBLA 4BIEA 3O50A 5HE2A 5TE0A 4BCFA 3EQDA 3VHEA 1WBSA 5CAOA 3L8VA 3PPZA 3LCSA 3PXRA 4WNMA 4BYJA 4F7NA 3Q9ZA 1OMWA 4DA5A 3R8MA 2AC3A 1W84A 3VBVA 3ZUTA 4IE9A 3MFRA 3W32A 2Y0AA 4D4YA 1H26A 3ROCA 2ZVAA 4GK2A 4TYEA 5HIBA 4ERKA 3TZMA 3HV3A 4YTFA 5B2LA 3GU8A 4DTBA 2C3LA 3BYUA 5M53A 5IUIA 4HW7A 2X2LA 3IDBA 3QX2A 1M2PA 5A6OA 4RZWA 1CTPE 4I21A 4N6ZA 3P78A 5HOAA 3O8TA 4UB7A 2BFYA 2Z8CA 3RM7A 5HIEA 3K3IA 2OIQA 1U4DA 4V0GA 3VS5A 5IA1A 2PUUA 2W7XA 1O6LA 3HMIA 5AP5A 2CNVA 3FI4A 3BU6A 3SQQA 2NRYA 2F2CB 3VUTA 2R3NA 3DNEA 2R3FA 3EMGA 4RX5A 3OWKA 4CG9A 2XK9A 4ZTSA 3VQUA 3F2AA 4DH5A 3UIUA 1NT2A 4FTCA 5CVHA 5FM3A 2OJ9A 2WMAA 5CSVA 4I0TA 3Q5IA 3RAIA 3W55A 4AN9A 3AQVA 4IQ6A 1L3RE 2R64A 4IC7A 5BX0A 2YHVA 2WMVA 1F3MC 4DGOA 4LMNA 2ZDTA 2WMQA 3PJ3A 2PWLA 3IQ7A 4I4EA 5FG8A 1M17A 5A9UA 5JEBA 5AV0A 3G90X 5GJDA 3S00A 3QD0A 2OZOA 2QVSE 4KA3A 2F2UA 4AS0A 2UVYA 4Q2AA 4IWPA 4YMJA 3FKNA 3L1SA 4DC2A 5FTOA 2W1HA 2WQOA 3Q4ZA 5H3QA 5HG5A 5BQ0A 2VTIA 1DI9A 2YDKA 3RMFA 2P55A 2XNMA 3LM0A 3UQCA 5DEWA 3LMGA 5C9CA 2J7TA 4CFWA 5IQIA 5EI2A 2C68A 4APPA 5EYCA 3R9HA 2BZHB 4Y5QA 5HD4A 1GIIA 4DFUA 3MWUA 3TV6A 4TL0A 2CN5A 3PY1A 3ZFYA 3CR0A 4X3FB 2EWAA 3DK6A 3KK9A 1STCE 3R9OA 4DYMA 3QD4A 3OEZA 1BI7A 3WF5A 4DLJA 5KMIA 4ZY6A 4CKIA 4JG8A 1BI8A 3WBLA 4NKAA 1PXIA 2ITVA 1ZRZA 4O7RA 3WARA 5M56A 3PA5A 4OTQA 4WT6A 3N9XA 3MH1A 3GU6A 3LFSA 4O7WA 3FBVA 2ERZE 2VO3A 1LEWA 5CVGA 5BVWA 5LCKA 5EW8A 1MP8A 4ANQA 2QHMA 4DT8A 4LL0A 4LQMA 3KL8A 3NUUA 3QQKA 2PL0A 4ZJJA 2JAMA 5CAQA 5KHXA 5M4CA 5HD7A 4BCPA 2QKRA 1NVSA 3E8EA 5EYKA 4BC6A 4IB0A 5AV2A 1DAWA 2JDTA 1FVRA 3ORKA 3G2FA 3D5XA 3O23A 4FKWA 4JXFA 3D4QA 5F1ZA 3ULIA 1OL7A 3Q2JA 3II5A 3FV8A 2QO7A 4FTQA 4QNYA 2BAQA 3F82A 1PXOA 1J1CA 2VZ6A 4RT7A 5A46A 4O96A 4L53A 2PY3A 3WIGA 4RIXA 4E6CA 1X8BA 2IVTA 4AW0A 4Y72A 5TF9A 1GIHA 5FDXA 3OCGA 2UUEA 4F9BA 1UU9A 3G6GA 3LXNA 4IWDA 4IX4A 4EOSA 5CQWA 5DR9A 4BWPA 3OVVA 2PMOX 5FUTA 5EK7A 4Y5HA 3KXGA 5D9HA 5TR6A 4D5KA 4ERWA 5IG1A 2QO2A 4AZFA 3GC0A 5EQEA 2XIZA 3GENA 4EQCA 4AGDA 5JK3A 4MQ1A 4O84A 1R1WA 5J5TA 4BCQA 3RWPA 3FDNA 3NW7A 2ETMA 3OMVA 3KF4A 4IZYA 4AACA 5JT2A 4ZS4A 2VTHA 1WBWA 2ZB1A 4IAIA 2VX0A 4KIOA 2QR7A 4DFLA 2UVZA 3FMKA 3RK9A 4DG2E 5AR8A 5BMMA 3BWFA 3TZ8A 4C4FA 3FAAA 4S32A 3N4UA 4IB5A 1ZZ2A 5TO8A 4Z55A 3CKWA 4H05A 3V6RA 3RI1A 3BBTB 5IQGA 4YTCA 2QONA 4YJUA 4HVHA 4L3PA 2YERA 2XK3A 5KHWA 5AP1A 2KULA 1DS5A 1XH5A 2BZJA 2GHLA 2GNGA 3BCEA 3COKA 2VAGA 3FWQA 3HRFA 3KA0A 4BR3A 4MD8E 4TWNA 4NFNA 4BCGA 3ZH8A 2EXCX 4UN0C 2XM8A 4TKSA 2QODA 4GUBA 5IMEA 4K0YA 2I0EA 1IASA 4QMOA 3V5TA 3GCQA 2ZB0A 4H3PA 5AIKA 4GJ2A 5B0XA 3ZO3A 3Q60A 3DKGA 2OWBA 2UZEA 3A99A 3I1AA 3L9MA 3E3PA 5ETCA 5AV1A 5L6PA 4F9WA 2WTCA 3BYSA 3AGMA 3CD3A 3QHWA 4XOZA 3NSZA 4U6RA 4MD7E 3TNWA 4HVIA 4ALVA 4F4PA 3JYAA 4XHKB 1JWHA 4FVPA 1Q8ZA 2W96B 3QUEA 3UG1A 3PY0A 5BUIA 1U59A 3F69A 2PZYA 4XG4A 4FV0A 3OY3A 4FKPA 4TYHB 3OEFX 2C5XA 4BTFA 4BI1A 3MYGA 3UPXA 3V04A 3DAJA 5HNIX 2OK1A 2QLUA 2OICA 4U81A 5CU2A 5AUYA 3C4EA 4F1OA 3M1SA 4E5WA 1R78A 3WI6A 4FTTA 2R3GA 4AOTA 4ZSAA 3GB2A 4M69B 2B7AA 2V0DA 3UDBA 4R1YA 1TKIA 4C4HA 4NM3A 3QA0A 4J71A 4DTKA 1XBAA 4AA4A 4B8LA 3BHVA 4K18A 4ZEGA 3LMIA 3D7TB 4TN6A 4ZMFA 5C4LA 4FT3A 1GY3A 5KMNA 4O82A 4J8NA 3CIKA 3FLSA 4Y8DA 3UC4A 4BB4A 3POOA 1A9UA 1JSTA 3JVSA 5BPYA 2FSMX 3NYOA 4ITJA 2OW3A 3LFEA 4LL5A 3VRZA 2AYPA 3E62A 2RFNA 3V5WA 3VBTA 2ONLC 1H1PA 3CD8A 3GFWA 4FL1A 3L8SA 2F9GA 4IX3A 4MK0A 4OBQA 5ANJA 1TQIA 1H27A 5CI6A 5LXMA 5L6OA 4ACHA 2QOIA 4BDHA 4EH7A 4GVJA 2C5VA 4JQ8A 4XG6A 4P90A 4WUAA 4YO6A 1PW2A 4GKIA 1XH4A 3QQLA 1XO2B 3EWHA 4R3RA 5AUZA 3UPZA 4C3RA 2YAAA 4EK5A 1QPDA 2HZ4A 3LXKA 4E7WA 3MH0A 3NW5A 4RVMA 2ACXA 3R0TA 2J4ZA 3FZTA 4PUZA 3TTIA 4N4SA 2J5FA 4PL3A 4C4JA 4X6RA 3I81A 3WILA 4NCTA 2YZLA 3QQJA 5KZ0A 3DOGA 4X2FA 4XS2A 3HP5A 1FMOE 3GXLA 4P5QA 3LM5A 1YDTE 2YEXA 4M0YA 3LFQA 1GNGA 3BHHA 3LLAA 4R78A 4EKLA 5ETAA 4RWIA 4J95A 4FG7A 2WMXA 3R63A 2HY0A 3BZ3A 3GCSA 5AWMA 4O83A 3MBLA 4CGAA 3O51A 4DTAA 4H3BA 4XG8A 4EYMA 4L44A 4DF3A 4FT9A 3VUKA 2YITA 4NZWB 5L4QA 3TZ7A 3U9CA 3UO4A 1ZYJA 2E2BA 2JAVA 2Z2WA 4UWBA 5CVFA 3RWQA 3ZXZA 4C57A 3DQWA 3G5DA 4JX3A 3IS5A 4OTFA 4IADA 2CGWA 3V51A 3NZ0A 4FVQA 2W4OA 4KBCA 4WD5A 2ONLA 5HLNA 4PMPA 3FQEA 3KXZA 4EL9A 4RLLA 1XHAA 3KCKA 1U5QA 4PF4A 4N6YA 4UWYA 3KMUA 4W8EA 4AW5A 5KMKA 5A4CA 5HG9A 3UOKA 2VWYA 4UMRA 3DXQA 1ATPE 3HUBA 3CQUA 1HOWA 3BGQA 4UZHA 4MHAA 4V0GB 2VNWA 3BQCA 4RA4A 4NFMA 1PXMA 2OGVA 3NAXA 4JDKA 1KE9A 4R6VA 2O64A 5D11A 1PY5A 4F70A 1GAGA 3C5IA 3OWLA 3DCVA 3EFJA 2VWXA 4R7IA 3RM6A 5CEPA 5CXZA 3GU4A 3ERKA 3O96A 4CTBA 5AP7A 4UXQA 1WFCA 3HP2A 4NCTC 5FBNC 4GW8A 2QC6A 4KABA 4WG5A 4CXAA 4U40A 1PXKA 4ANMA 4JR7A 3W33A 1OL2A 3HV4A 4O1OA 3V8SA 4AOIA 4EHZA 2UW8A 4GU6A 3OG7A 4YTHA 5F20A 2IZRA 1NXKA 4IB1A 4PTCA 3ZO1A 5AAGA 4IB3A 5LVMA 3NUXA 3DBFA 3P1AA 3EYHA 4CLJA 4NYEA 3I0QA 2WELA 1PRYA 4X3FA 3KRXA 2V55A 1K2PA 1XR1A 5IKWA 2B54A 3ZSHA 4PY1A 2BPMA 4MXZA 3QC9A 3CEKA 4C2VA 4FIGA 4LM5A 5GZAA 4EOPA 1OUYA 3HMPA 2GTNA 1KOAA 2WQMA 2V62A 2R3MA 4BGGA 4L67A 5FWKK 3FL4A 3KVWA 3FI3A 1M2RA 2BHHA 4UWCA 4CRLA 4D5HA 4RGJA 1URWA 2I0YA 4FV7A 3QD3A 2UZDA 2VV9A 4G34A 3NX8A 3MH3A 3MSSA 4YP8A 2IW8A 5AAEA 3IW4A 2WEVA 4IW0A 3TTJA 5BYZA 2BRGA 4PNKA 5FD2A 4P5ZA 4PDOA 5BYYA 3HRBA 3QXOA 4ZTHA 3FKOA 4D0XA 4WUNA 3EQBA 3Q4UA 2JDSA 4ZSGA 3VS1A 3FMNA 1YHVA 3CP9A 4UMTA 5HU9A 5L8LA 3ZSGA 3QYZA 3QCQA 1LPUA 1P14A 2G2FA 4F63A 3H30A 5IISA 3QQHA 4C38A 5HGIA 2UZNA 2GQSA 3EN7A 3PXQA 4ZZNA 3F5PA 2LAVA 1Y8YA 4EORA 5EI6A 5BVDA 3QRUA 2NPQA 3SOCA 3NVMB 1XKKA 3ZUUA 5HLWA 5HX6A 2GS7A 3TG1A 2HYYA 3VUDA 3UQGA 4IDTA 4O6LA 3PLSA 1QPCA 3DK3A 3MTFA 3OS3A 2BTSA 3TN8A 2VX1A 3PFQA 4R5SA 4FZDB 1H0WA 1SVGA 3V5JA 4AQCA 4HVDA 5CY3A 2VTNA 4I24A 4BIBA 3UJGA 2PVRA 3DTWA 4XBUA 5FEDA 2Y7JA 2JIVA 4QP4A 2EXEA 3H3CA 5A4LA 3KREA 4XUFA 2PVKA 3DK7A 3CGFA 3HKOA 3KQ7A 1E9HA 4G1WA 4OUCA 3HX4A 4XNEA 5LCJA 2FUMA 3RVGA 3EFLA 4KKGA 4XV1A 2C6EA 2FA2A 3KXXA 4O0RA 5HE1A 2O0UA 3BKBA 3OCBA 3TNHA 3BLQA 4K9YA 2CGXA 4EONA 3O2MA 3O8PA 4FKOA 3RNIA 1J91A 3L9PA 1W8CA 1YXUA 2XK6A 2FGIA 4EH4A 4C58A 4JBVA 3VBWA 2ITYA 4E20A 1IAHA 3RAHA 4MBLA 1J7LA 2B9JA 3BV3A 2OXXA 3SHEA 3U51A 2OZAB 3Q6WA 5EM8A 1BL6A 2ITOA 3QTQA 4RIWA 4TNBA 3W18A 4EOKA 4F0IA 2FB8A 3L8PA 2JKQA 1O6KA 4FGRA 1BKXA 3QF9A 4Q5HA 5K9IA 1BLXA 3HAMA 4DEGA 5F94A 4HGTA 5K0KA 2C6KA 4I20A 4KRCA 1Q8YA 5EH0A 5FM2A 5CYIA 1H1SA 3C7QA 4JBPA 3MFSA 2OXYA 5CEKA 4FV1A 2VTLA 4Y85A 1JBPE 3PXKA 1ZMWA 5JRQA 1R0EA 2IVUA 1A06A 2UZLA 5JZNA 1Q5KA 3ZC6A 4I5MA 4RWKA 5C4KA 3D5VA 3F88A 3JXWA 5IA3A 4O0WA 3QLFA 2IZTA 2X9EA 1OPLA 3MA6A 4F9YA 3DS6A 2ZM1A 3CC6A 4FNYA 2X8IA 3FLNC 3R8LA 3TV4A 3QWJA 3ZU7A 4U41A 2ITUA 2ERKA 1Q41A 5DVRA 4EOLA 4C34A 1ND4A 3ET7A 4S34A 4I23A 4X2JA 2ZM3A 3SGCA 3FHRA 3VWAA 3NNWA 2GNJA 4A07A 2PUPA 3BGPA 3ZS5A 2QKWB 3DZOA 2BKZA 2JKMA 2W0JA 3KULB 4LI5A 5DEYA 4FV3A 2XNGA 4A9YA 4ORKA 3AXWA 4RIWB 3GCVA 5BVEA 4CCUA 2BRHA 2G15A 4I3ZA 2J51A 1K9AA 4KAOA 4UMUA 1B39A 3Q32A 4GRBA 4HGLA 3NIEA 2I0HA 1BMKA 4KINA 4O21A 3VUGA 1H1RA 4DEIA 5IQEA 2QU6A 4P2KA 5HBJA 5JFSA 4FTIA 2R7BA 1FBNA 3R1YA 3F2RA 2CJMA 3PWYA 3IGOA 3PYYA 1YQJA 3I79A 3PTGA 5HNGA 1H4LA 2PUNA 2YABA 3LCKA 3CQEA 3H4JA 2G9XA 3UVPA 4PWNA 4FIFA 4QP3A 4WBOA 4YZNA 4EEVA 5BMSA 4FTLA 1FGKA 5JGDA 3NPCA 5DMZA 4YC8A 1WVWA 3PJ1A 1OIRA 3EZRA 4LOQA 4E5AX 3AGLA 4QTCA 4FZFB 4M66A 4D2WA 5KCVA 3O7LD 3R28A 4MXXA 5AJQA 2DWBA 4WBBB 3V3VA 1LP4A 3FMDA 4BDIA 4DEAA 3LFNA 4NH1A 5AMNA 4BRXA 3U55A 1YI6A 4EC9A 1UKIA 4GIIA 3IOKA 4OW8A 3NWWA 3U6JA 4N0SA 3NUAA 5JQ5A 5H8EA 3TNIA 2VGPA 1W0XC 3SXSA 2JKOA 5CQUA 3QCXA 3SW7A 2WO6A 1G8SA 1KE8A 1E1VA 2XVDA 3SAYA 2C6TA 2YM3A 4XLVA 2VTOA 4FX3A 3C5UA 3V5LA 4B4LA 1IA8A 3E8NA 3L8XA 3NNVA 2YDIA 4BCNA 3C1XA 4IVCA 4IWQA 3BHUA 4QO9A 4RJ3A 5EHLA 3SC1A 2BDJA 3TUBA 4KNBA 2PMLX 4ITIA 4M0ZA 4QP7A 3I6WA 4DH8A 5EDQA 2VWBA 2I0VA 4AOJA 2W06A 4USEA 3ORIA 4AT3A 3VW6A 3FPMA 1Y6AA 2W4KA 3FZ1A 4RIXB 4I93A 4FT7A 4TY1A 4EOQA 5M51A 2C1AA 5AR2A 1OBGA 2JD5A 5FLFA 4BL1A 5BUEA 3BEAA 2X7FA 5IQAA 3ZFMA 2B55A 4JNWA 4FYNA 2BVAA 1OL1A 4XG2A 5J8IA 3VAPA 3UYTA 3ACKA 1R0PA 3G15A 4ZMEA 1OKZA 2C6LA 2OBJA 5F4NA 2HXQA 3H9RA 1YOLA 2CN8A 2PU8A 4ALWA 4O1PA 4FV4A 4H36A 5JFXA 3P7AA 3DFAA 2WTWA 2XNPA 3FMMA 3N51A 4AZVA 2UW4A 4ID7A 1KE5A 3H9FA 5E8ZA 1E1XA 4XV3A 4EZ5A 4JIAA 4QMTA 2P0CA 4ZXTA 2RG5A 3WIKA 1M2QA 4FKLA 4MEDA 5KMLA 4W4YA 3COHA 3S0OA 3U6HA 4RJ7A 4C3FA 2X81A 3AC3A 4TYGA 3DFCB 1YI4A 1S9JA 4CRSA 4AWIA 4IH8A 4EJ7A 4LFIA 2EU9A 5I9VA 2WZJA 2R3HA 3QTXA 2A1AB 3QLGA 2IN6A 4W9WA 1U5RA 3EFKA 1H08A 4S31A 2QOFA 3FPQA 2R5TA 5KUPA 3R7YA 3OUNB 3PP1A 2UZOA 5I9XA 5I9WA 3JVRA 2W4JA 3CJGA 2Z7QA 1WZYA 2G2HA 3VUMA 3LZBA 3RGFA 3SV0A 2X1NA 1H07A 1ZY5A 1Q4LA 3Q9XA 4FKSA 4MNFA 5D12A 4USFA 4MXCA 3D7ZA 4KIPA 3R7OA 5KKRB 2ZOQA 3GP0A 1SYKA 2P2IA 3W2RA 3IDPA 1JPAA 1VYZA 3PVWA 1M52A 3I60A 4G3GA 4FE2A 3DBCA 3QZFA 3WYXA 1YWRA 3R9DA 2JGZA 4QMWA 4R8QA 4I5CA 2AUHA 5CASA 2GHMA 5JH6A 5L8KA 3ZHPC 4BICA 5CEQA 4CCBA 5G1XA 3RPYA 3ORZA 4AZTA 1F0QA 5ANKA 3QZGA 5E8WA 3VJOA 4DEHA 3KVXA 5HEZA 2ZDUA 4LG4A 3EQFA 4BKYA 2AC5A 5IDPA 3W16A 5K4JA 1FQ1B 4RVTA 4UMPA 2PK9A 2R0IA 1O9UA 4EHEA 3WZEA 2WMBA 2XZSA 3MY1A 4IVBA 3C0IA 5D1JA 4BDDA 3AT4A 3FY0A 4RLKA 5AP2A 4QMNA 3QKLA 2IWIA 3DTCA 1GIJA 3ETAA 2CLQA 5FP6A 3ZOSA 4F65A 5HHWA 3DV3A 3Q52A 5I3OA 1U54A 5J87A 3TDVA 3QD2B 5I0BA 2VTAA 5FTGA 5AIRA 4MXAA 3ZRLA 2XBAA 4FEQA 5M4IA 4I22A 4USDA 4J53A 2CCHA 5A14A 5CSPA 5C8MA 3UZTA 2CKPA 1V0PA 3F5UA 3QALE 5HCXA 3NUNA 3UE4A 4YU2A 3C13A 3NYXA 3PSCA 2GU8A 3UVRA 5CSHA 4DEDA 3ZZEA 3VW8A 3HGKA 4V01A 4G31A 3SRVB 3SG9A 1ZLTA 2Z7LA 4NIFB 2WKMA 3OD6X 4M15A 2PE1A 5CSXA 4U97A 1P4OA 3I6UA 3UMXA 3PXYA 2F4JA 5CEMA 5KMJA 4E1ZA 3PA3A 4MX9A 3DKOA 4RIYB 1PMVA 3P5KA 1PJKA 4N57A 1TQMA 3EIDA 2GHGA 3NCZA 4FSZA 3V8TA 4GV1A 2XP2A 2YIYA 2JKKA 2ZAZA 5ACBC 4BDAA 4L3JA 4C4GA 1IAJA 5FXRA 3D9VA 3BWJA 3QZHA 2XH5A 4U3ZA 1PKDA 2XNBA 3FLWA 5I5ZA 4X6QC 4RVKA 2PSQA 2R9SA 3O7LB 4D2RA 5J7BA 4C4EA 2GNIA 2C0IA 1BYGA 2YACA 3QCYA 3WZUA 3B2WA 2UZVA 2H9VA 3HZTA 1JOWB 4TPTA 1YKRA 2IVVA 4UXLA 4FYOA 3AC4A 3FSKA 4G5JA 2FSTX 3WF9A 5CAUA 3WE8A 4I41A 1CMKE 1Q3WA 3GCUA 5ANOA 4I1ZA 3KXMA 4IFGA 2PVHA 4E73A 2ITZA 4E6QA 4E26A 2V7OA 4E6DA 3A62A 5ANEA 4XX9A 3WYYA 1KE6A 2YM6A 2JLDA 5HVJA 4RBLA 5D10A 4FEWA 3B8RA 3NIZA 4FG8A 4BWXA 4O22A 4AZWA 1WBVA 3BELA 2VO6A 4QTDA 5ETIA 2Q83A 4AW1A 1AQ1A 2Q0BA 3G9NA 3IW8A 3EH9A 3KF7A 3UP7A 2VGOA 2JIUA 2OLCA 4W8DA 3O0GA 3LXPA 3A7JA 3QUDA 3OT3A 2X39A 4YLLA 1OIUA 3AD6A 2BILB 3M42A 3QTRA 4QMYA 3WE4A 1SVHA 4L45A 4DH3A 2VTTA 3Q04A 3VQHA 3VS0A 2YM8A 2VTRA 3TM0A 2QOHA 3EQRA 4JX7A 4U43A 2X4FA 1KE7A 2QOQA 3QC4A 2B9HA 2C0OA 4D2SA 5JZJA 3D7TA 5EKNA 4HYHA 2QQ7A 5M4UA 3G0EA 5AX3A 3VVHA 4FKJA 3BLHA 5E8VA 4JDHA 3E64A 3LCTA 3V5PA 5J9ZA 5BVNA 4FIJA 5LJJA 4I5HA 3RAWA 4FNXA 3EQHA 3VN9A 4JBQA 2IJMA 4IM3A 2ZV8A 3D5UA 3NNUA 2X0GA 4NK9A 4RZVA 4AGUA 4BTKA 5CENA 2GQRA 3HMMA 3MESA 1J3HA 2GFCA 2QOLA 3R00A 1PF8A 2FSLX 3FC1X 5E8XA 5K5NA 3R7UA 3TUDA 4YJRA 1ZYCA 4ZAUA 4QPMA 1YXXA 5AADA 3EKNA 2QR8A 2W17A 4KKEA 2F7EE 3ORXA 4TZRA 5AR3A 3TNPC 3WOWA 1JVPP 5E8YA 4AAAA 2YM4A 4PL4A 4RFYA 4J7BA 4I4FA 3I5ZA 2C5YA 1VR2A 2VO7A 2W9FB 4YJOA 4B0GA 1T45A 2IO6A 4BDJA 3OOMA 2B9FA 3IPHA 2RSVA 4D4VA 5GIPE 3GEQA 4FODA 2NP8A 2WTJA 4F7JA 3ZO4A 4RJ6A 4CD0A 3LW0A 4I6QA 3R7VA 3VBYA 4QQJA 1KSWA 5J1VA 4YO4A 4F7SA 1LUFA 3MIAA 2BAKA 4QD6A 3L9NA 3W10A 2ESMA 4U8ZA 1RE8A 4ACMA 1JAMA 2CHLA 2XIRA 1WBPA 4W4WA 2XIXA 3R9NA 3FYJX 2J0IA 4ASEA 1JQHA 3OWJA 3TWJA 1Q8UA 5LVOA 2G01A 3FI8A 3G33A 3PJCA 5CS6A 4PPCA 3V8WA 3HAVA 4ANLA 2VNYA 4IJPA 4AZSA 3PWDA 4FGBA 2WMWA 2PVLA 3AC8A 3OY1A 3MJ1A 4RQVA 2JFMA 4FSRA 5E8TA 3PSDA 3KY2A 4QPAA 4YNEA 4C59A 3AT2A 3NRMA 1LEZA 1PYXA 1PHKA 5M07A 4GFGA 2CKEA 3LHJA 2V5QA 2OI4X 5KBQA 3OOGA 2DYLA 2RGPA 5CANA 3GU7A 3MPTA 3FLQA 4EI4A 4F6UA 3LPBA 2P4IA 3E8DA 4CT2A 3DKFA 4H1JA 3ZBXA 4XV2A 5L6WL 4EOJA 4ANOA 5CEOA 3EHAA 2WTKB 3ZONA 3CCNA 3BGZA 3UNJA 4DFBA 2ZMCA 4ASZA 4DG3E 5T68A 4JT3A 3Q9WA 3CY3A 5JMSA 3H10A 3QYWA 4YJTA 5AUUA 4QMUA 4K11A 4D2VA 2QURA 4BKZA 3I7BA 4BCHA 2JITA 4BBEA 3IO7A 4G9RA 2GNHA 4YC6A 4CQEA 1FOTA 1DAYA 1DM2A 3NVKI 3IONA 5EKOA 2PZRA 4K6ZA 3QQGA 4RWJA 4GK3A 4UV0A 5TKDA 4DFXE 4AFEA 4TWCA 3REPA 1GZOA 1NY3A 3LCOA 4QMMA 3SDJA 3MVJA 4FKGA 3ULZA 3UTOA 3RPOA 2H6DA 2PE0A 2NNWB 4O7ZA 4EQUA 2BDFA 3BHYA 4IDVA 3MVLA 3QTWA 2YCSA 1P5EA 1GZ8A 3T9IA 3NS9A 1NW1A 4NW6A 3GUBA 4FT0A 2B1PA 3GCPA 3PZEA 4O0XA 4XYFA 4YHFA 2ZV2A 4NM7A 3HECA 4OGRA 4DLIA 4RJ5A 4FC0A 3AD5A 2W1FA 3OCSA 3PXZA 3BV2A 4M8TA 1YWNA 2YA9A 1U46A 4IFCA 3AMBA 3DDPA 2IW9A 3N4VA 2HWPA 4WHZA 4Z7GA 3EKKA 4Y46A 5BUJA 2V22A 3UIBA 4KUJA 1WMKA 3CLYA 4EC8A 3K2LA 1IA9A 3LOKA 3H9OA 5FQDC 4GIHA 5DYJA 1XH9A 3E87A 3DXPA 2QG5A 4ZZOA 3R2BA 4FV9A 4NWMA 4X2KA 5EM6A 5JGBA 1CDKA 5M4FA 3F61A 4EBVA 3DBEA 2XNEA 4DT9A 4ZOGA 3ZCLA 5IF1A 1ZMVA 2XA4A 3FMJA 3TT0A 1V1KA 2PMIA 4XG7A 5HO8A 2X9FA 5HNBA 3SA0A 2H96A 2YM5A 3OWPA 5DLSA 4AA0A 2OJFE 3GNIB 5C03A 4MF1A 4FEXA 2O63A 3C0HA 3IW5A 3AMYA 3MI9A 2VTQA 4OTPA 3UZRA 3R2YA 4G9CA 3Q5ZA 2BFXA 1JKTA 5LVNA 3P4KA 3Q3BA 3R6XA 1HCLA 3NMUF 1OZ1A 2YIQA 4RA5A 5IQHA 3OF0A 2Z60A 2XJ1A 4J8MA 3JUHA 4V04A 5C01A 4RX8A 1QPEA 5A3XA 1Q3DA 3RALA 3OXTA 4CFFA 2FO0A 5BNJA 4FV8A 1UA2A 4KBKA 1ZAOA 3W2CA 2WOTA 3EYGA 2PVMA 4NW5A 3T3UA 4N70A 4O2PA 5LOHA 4G3CA 4PP7A 2J50A 2EB3A 3LFFA 2WEIA 4JAJA 1FVTA 1BUHA 3TZ9A 4HZRA 3UBDA 3THBA 5AM6A 3BQRA 4FSYA 5K0XA 5HIDA 1WVXA 4ACGA 3JR1A 4BHNA 2XCHA 5EHOA 4IVDA 1K3AA 4KB8A 2UW7A 2A0CX 2HCKA 4FZAB 3PE2A 4F7LA 1IG1A 5A6NA 4QMPA 5GZ8A 4LMUA 4LOPA 4MAOA 2XK7A 1VZOA 2GDOA 3KULA 2C47A 4LV5A 4O7TA 5HORA 2Y6OA 4ZS0A 4HPUE 3OXZA 4MCVA 4EWHA 3V01A 5A4EA 3PG1A 2YM7A 4ALUA 3DJ5A 4DAWA 4ZTNA 4YJNA 4YUQA 2HW6A 3PP0A 3VS2A 3QL8A 5J95A 4MNEA 4AT5A 4XG9A 4FK6A 3A2CA 4TWOA 4EZ3A 4L8MA 3IKAA 4QQTA 4EK6A 3RPRA 3ANRA 2SRCA 2XNOA 5DHJA 4QQ5A 1XH8A 2R3IA 5JN2A 4O91A 2EVAA 2E9UA 2PMNX 4YZCA 3TDWA 3KGAA 4L7SA 3U8WA 4ZTMA 4GYIA 5IPJA 3F7WA 5EOBA 1UNGA 3DPKA 3TIYA 4K2RA 4M12A 4XP0A 4CEGA 3UODA 1FPUA 2C5NA 3KU2A 4FUYA 2ITXA 3A60A 3P86A 5IEVA 4EWQA 3QGWA 1W83A 4C62A 3BI6A 2E9PA 3ZEWA 2YFXA 5J79A 4DCAA 3KFAA 3UOJA 2UW3A 3CTQA 3HA6A 3BYOA 2PHKA 3TKUA 2WHBA 4E6AA 4L52A 1XH7A 3E88A 2QG7A 5BYLA 5AA8A 5DI1A 2YDJA 5GIOE 4ZY5A 4RX7A 2JIIA 2R3RA 3MS9A 4F1MA 5FRIA 4DEBA 3IG7A 4KS8A 4AA5A 3FXXA 3R7GA 3S2PA 4ARKA 4C7TA 4RVLA 2OG8A 3FI2A 2PULA 4RC3A 4OAUC 4PX6A 3HVCA 3EQCA 5DNRA 3QRTA 2UZBA 3I0OA 3Q9YA 3RTPA 4BGHA 2OZAA 3D94A 3PG3A 2HOGA 2UZUE 1YDSE 1H01A 2YIRA 2ZV9A 3CPBA 3PY3A 5E90A 2XK8A 4AU8A 2W5HA 4HGSA 3F66A 4EZ7A 3VO3A 1PMNA 1OBDA 2WXVA 4RQKA 2WMRA 1RW8A 4FZ6A 3ZTXA 4D4SA 4ZLOA 2BTRA 3LXLA 3ZEPA 1G5SA 2BMCA 3TIZA 4C35A 4GMYA 5IA2A 3COMA 4G3DA 2VO0A 2BUJA 2GFSA 4ANNA 4GFOA 4CFXA 4CYJA 3OHTA 4FKTA 4UY9A 3VC4A 2XIYA 3RHKA 5FXSA 1KWPA 2YAKA 3GOPA 3TV7A 3UOLA 3LMHA 1UU7A 4A06A 3QQUA 5HTBA 1ZXEA 3QHRA 1OKVA 4ACDA 5DH3A 4ASXA 5LMKA 4EH5A 5EQYA 4QOXA 3RCDA 3R1SA 4IM0A 3ITZA 3LQ3A 4M97A 2OH4A 4NTSA 3IDCA 3DLSA 2OFVA 1V0OA 4QPSA 4RC4A 4FOBA 2EXMA 3OW4A 4A4LA 3C0GA 4FG9A 1W98A 1Z57A 4MH7A 4QNAA 3TKHA 5T3QA 3TI1A 5HTCA 2PYWA 3DAEA 3HV5A 4HNIA 2IG7A 3LFBA 3POZA 5HESA 2BKKA 1EH4A 1JSUA 2F7ZE 4K33A 1OL6A 5CX9A 3DY7A 4QYFA 4FVRA 4A9UA 3KC3A 2VTMA 1YVJA 4JOAA 3HL7A 4BDBA 3MY5A 2IVSA 4RRVA 4MWIA 3QXPA 3VIDA 1ZY4A 2A19B 3JY9A 2RF9A 5CU0A 1MQBA 4KD1A 4D1ZA 3LFCA 4IWOA 4JLCA 3F3VA 2ITWA 5DBXA 5GZ9A 4K1BA 2HWOA 1GOLA 2B9IA 2CNQA 3DB6A 4EKKA 4GT3A 5LWMA 2E9NA 4JVGA 3A61A 3PVBA 5CZHA 3MW1A 4LGGA 3MGYA 3SVVA 3ACJA 3NLBA 4DE4A 1M7NA 4S33A 4GH2A 4RFZA 4WG3A 4QMZA 4L46A 5DT3A 4GEOA 3EJ1A 2XNNA 4UALA 4BBFA 4HCUA 3HUCA 4KSPA 3VHKA 4FTOA 3RAKA 4QMQA 1UNHA 3BHTA 4JQ7A 4BCKA 3F3WA 4ZK5A 4MTAA 4L9IA 3GU5A 4YJQA 2WTDA 3ZLSA 2PVYA 3F6XA 2OJIA 2QOCA 2WMUA 3ZMMA 3MIYA 2JBOA 5AUWA 2FVDA 2GNFA 3E7OA 4MNEB 4QP2A 3LFDA 1H0VA 2OU7A 2W05A 2XKCA 4D28A 1G8AA 4S30A 3TJCA 5I3RA 4U80A 5E1EA 3R22A 1OPKA 1SM2A 4WA9A 5CU6A 5JFWA 1O6YA 2O3PA 3JPVA 3BIZA 3CE3A 2VN9A 1FGIA 4Q5EA 3ZFXA 1WAKA 1ZYLA 2QOOA 1Y8GA 3LAUA 3W2QA 4IVAA 2QU5A 4J97A 1Q97A 2BR1A 2XBJA 1Q8WA 4AG8A 3PXFA 5BVKA 5M08A 2E9OA 2F49A 1ZOHA 2GQGA 1H28A 2JDRA 5LMAA 3ROYA 4FSMA 3O8UA 4R1VA 2HY81 5AEPA 2XS0A 3U4WA 4BBMA 4PL5A 4NTTA 4O7VA 1JSVA 2EB2A 3T9TA 1JKSA 1I09A 1QPJA 4MF0A 4JI9A 5JGAA 1AGWA 4OBOA 3HRCA 5EW9A 3G6HA 3BLRA 3NR9A 3FQHA 2OF4A 4PPBA 4YPSA 5ANIA 1XWSA 1YOMA 4II5A 2ITPA 3QGYA 3D15A 1ZOGA 3TKIA 4DBNA 4OAVB 3OTUA 5FBOA 3D83A 2IPXA 5DN3A 4J98A 4EOOA 3UNKA 5C1QB 4FT5A 3A8WA 2C3JA 4GUEA 5HX8A 4H1MA 5E1SA 2WU7A 4QT1A 3RZBA 5LVPA 4XRLA 2BROA 2I7QA 4FV2A 1LR4A 4CKRA 3Q53A 4G17A 2XYUA 4EOIA 5KZIA 4G16A 2QOKA 4IJ9A 2C6MA 3FJQE 4OTIA 1GZNA 4U79A 2OSCA 2RIOA 4DGMA 4NSTA 5KO1A 3UIMA 3PDTA 3NCGA 5CXHA 4BTMA 2PVJA 3QTIA 4OTRA 3UNZA 4G6OA 2R7IA 4FKVA 4E3CA 4PDSA 4X7QA 1YI3A 3F7ZA 1ERKA 1OB3A 3O71A 3OW3A 4B8MA 4X3JA 1WBTA 3AMAA 4Y73A 4ANBA 2W1DA 3NUYA 3BYMA 3JS2A 1M14A 2ZMDA 2VTSA 3TNQB 3HLLA 4XG3A 4CFNA 4UX9A 4BHZA 3RHXA 2CNUA 4YC3A 5EW3A 4JDJA 4NM5A 4FEUA 2ITTA 1W7HA 4F64A 5EDRA 2QD9A 2W5AA 3GC9A 1YOJA 4LYNA 4TXCA 1PYEA 1MQ4A 1H25A 2QLQA 2RL5A 4MD9E 2UW6A 3EQPA 3QZIA 4X2NA 3MB6A 4C2WA 2O5KA 1OM1A 4IZAA 4CYIA 5DPVA 3A7GA 4FTUA 4Q9SA 4TYIA 3R8VA 3FZRA 4QMXA 1SNXA 3ZC5A 4A9RA 1ZMUA 3R04A 4J52A 4F0GA 2C5OA 3ZLXA 1FINA 3BEGA 3KRRA 4HJOA 4DITA 3VS6A 2WTVA 5C8KA 5JSMA 5L2TA 2PE2A 1B6CB 3QTSA 5CAPA 4PTEA 5L2SA 3ZLYA 1Y57A 4B7TA 2YN8A 3QUPA 1KV1A 3M11A 3FHIA 3FL5A 2OF2A 2C6IA 2ETKA 3QRKA 5CF6A 1HCKA 4GJ3A 3ZBFA 2QO9A 2HIWA 2PZ5A 2UV2A 5KE0A 3RZFA 4EH6A 3K5VA 4RIOA 5E4HA 3EFWA 2FSOX 4M67A 2YLEA 2WPAA 3GGFA 3CY2A 4RX9A 3VF9A 3F3ZA 4QMSA 2C69A 4H58A 3BRBA 4WRGA 4YHJA 2H34A 4AF3A 5H8BA 2VU3A 5FGKA 3WF6A 5IA5A 5AAFA 4GG5A 5HZNA 3ZLWA 1PXPA 3EN6A 2BCJA 4RWLA 4C61A 4F08A 1JLUE 3QTZA 2XKEA 4ZTLA 3HV6A 1CKPA 1WBOA 4V05A 4PPAA 4QYEA 3F5XA 3FZSA 3HNGA 2BALA 2RKUA 3VS4A 4KIKA 4CFMA 4L00A 4FOCA 3R71A 3OXIA 3UG2A 2R3PA 4YPDA 5AV3A 3OCTA 4EH3A 1OKYA 1NVQA 3KKVA 5AUTA 1CM8A 2YCRA 4RC2A 3AT3A 4EH2A 3ZDIA 5CNOA 3LJ0A 4LOOA 4FR4A 4FF8A 4HOKA 5KKRC 4YTIA 5IQCA 4I0RA 5LMBA 3FLZA 4NUSA 5HICA 2J6MA 4CZTA 4F9CA 3PIXA 5J5SA 2QHNA 4BKJA 3OBJA 2B53A 2CDZA 4W9XA 3ORMA 5H9BA 4ZLZA 2W1GA 2LGCA 4YJPA 5G6VA 5KX8A 5I4NA 4MYGA 3FC2A 4BCOA 4M68A 5GJFA 3OP5A 2NO3A 2I6LA 5DFPA 2XRWA 4BCJA 4C0TA 3ID6C 4L6QA 3QBNA 3D14A 2RFSA 3SXRA 1OI9A 1OVEA 2W1EA 4BVUA 3QTUA 4R3CA 3E93A 1KOBA 3KRLA 4WNOA 4CSVA 5I9ZA 4FEVA 3VUIA 3DAKA 5CU4A 3MPAA 2CMWA 3RCJA 4ZJIA 4FICA 4A9SA 4CZUA 4WNPA 4C37A 3MJ2A 4O0UA 4CT1A 4Z7HA 4C33A 3A4OX 3R9RA 2OIBA 2HELA 3F3UA 4G6LA 1UWJA 3BE2A 3RK5A 4EQMA 4F6WA 3NYVA 2JEDA 3K3JA 4DH7A 3NW6A 4JJRA 5C26A 5DR6A 1CKIA 4I5PA 4PMMA 4WNKA 3UC3A 3C4WA 5ITAA 3RNYA 5H8GA 3PSBA 3OBGA 4AW2A 4FSUA 5CT7A 2XB7A 5HE3A 4EH8A 2O8YA 4IBMA 1OPJA 2CCIA 3NUPA 1PKGA 4Z3VA 4FKIA 4F6SA 3FXWA 3ZO2A 2GS6A 3ALNA 3DU8A 3LLTA 3OFMA 4M84A 2A27A 4O0YA 4QP8A 4XRJA 3SRVA 5L2QA 2WD1A 5J1WA 2C4GA 2UW5A 3JY0A 3LJ1A 4RMZA 5HE0A 4JIKA 2YZAA 4GK4A 4G5PA 3CKXA 4BTJA 1OGUA 5GJGA 4CMUA 1YWVA 1UU8A 3FZOA 4C4IA 5D41A 4DGLC 4CNHA 4JR3A 5DT4A 4CMTA 5AP6A 2A2AA 2QI8A 5CT0A 5A4QA 4NT4A 5M55A 3MB7A 5DRDA 3PIYA 3EL8A 2P33A 4IANA 5EFQA 5LARA 4G6NA 2UVXA 2WU6A 3S1HA 4O0TA 4QP1A 2VD5A 1PXNA 4AX8A 3S95A 5CWZA 5L3AA 2NRUA 2XK4A 1UKHA 4DGGA 3DZQA 4FUXA 4YURA 4FTAA 2XJ2A 1YDRE 3ODYX 1YW2A 4BN1A 1F5QA 2BRNA 4UYNA 4QYGA 3MVHA 4APCA 2OIDA 3FEGA 2G2IA 4U44A 2BAJA 5I9YA 1QCFA 2BIYA 3D2IA 2UW9A 3QAME 2XEZA 4AP7A 5IDNA 2BZIB 3ENHA 3GFEA 3P7BA 3EOCA 3HMNA 4UBAA 1Q61A 4QMVA 2I1MA 2YLFA 4KWPA 4QYYA 5HLPA 3KN5A 1J7IA 4ITHA 5C8NA 1UV5A 3CTHA 4MKCA 3RINA 3A7IA 2GMXA 4NJ3A 1YXTA 4D9TA 4YHTA 4YLKA 4XP3A 4EUUA 5IH6A 3LKMA 4DINA 4O7SA 2PUIA 2J0KA 4ZJVA 1J1BA 4CTCA 5ANGA 3E63A 3K54A 5KMMA 4GKHA 3GC8A 1ZOEA 4D4RA 4DFZE 4CMOA 4CV9A 4DEEA 4OLIA 3PA4A 3RJCA 5IEYA 1M7QA 4AXAA 3D5WA 4D2TA 4UZDA 4FKRA 3KB7A 1MRUA 4HNFA 1DI8A 2DQ7X 3G9LX 1OITA 1Z9XA 3GOKA 4FIHA 4LRJA 5BVOA 3LVPA 4O7NA 3RBWA 5D7VA 3S4QA 4B99A 4GL9A 4BFMA 2PVNA 5CF8A 3ELJA 2J5EA 4UEUA 4K77A 3SKCA 4MVFA 3DT1A 3QKMA 3FZPA 4IAAA 4O38A 5IMXA 2C0TA 4AT4A 4ENXA 3NNXA 3OT8A 5GNKA 3MDYA 4HYUA 4NU1A 3Q2MA 4FTNA 5HCYA 2VWIA 2YWPA 4ASDA 4I0SA 4ENYA 3AG9A 3KK8A 4M14A 2JFLA 3C50A 4AZEA 5CSWA 4BF2A 4Z16A 5JQ8A 5M06A 5C27A 4YZ9A 2WQNA 4FL3A 4F09A 4CG8A 3R83A 4U5JA 4BDGA 4QRCA 3SOAA 2QCSA 2RG6A 3R01A 4AUAA 4EK8A 4E93A 3PLAE 4TTHB 3EL7A 3K5UA 2CLXA 5J9YA 3E3BX 4S2ZA 3FKLA 5DG5A 2WB8A
chains in the Genus database with same CATH superfamily
2J2IB 2G1TA 2WNTA 1MRVA 2YJSA 3GQIA 2OFUA 4Y95A 3TXOA 3F5GA 2H8HA 4J99A 5FEQA 4DN5A 2PPQA 3GT8A 4DH1A 1OUKA 1W82A 4HPTE 4XJ0A 1URCA 2CPKE 4FSQA 3RK7A 4NL0A 1XJDA 1P4FA 3WZKA 3VBXA 2BZKB 3ZM4A 2GS2A 2WTKC 4FIIA 3N4TA 3A8XA 5EI8A 5BVFA 5DWRA 1QMZA 1P2AA 5M44A 4XOYA 3VULA 4F0FA 4FV5A 1L8TA 4AAYA 3DNDA 2VTJA 4H3QA 2OJGA 2XUUA 4XV9A 2X8EA 2R3JA 2CKQA 2Y6MA 3UYSA 3BE9A 5L2IA 2R3QA 4ZY4A 2C6DA 2QOBA 3P9JA 4KBAA 1ZARA 2X6DA 4LV8A 4PMSA 1YRPA 4TW9A 4YBJA 4R77A 4EOMA 2XIKA 3MPMA 4GSBA 5HQ0A 5HU3A 5K4IA 3CJFA 3ORNA 4OTDA 5DA3A 3R73A 1S9IA 4BZDA 5F9EA 4GYGA 5HVKA 3C51A 4I6HA 3LCDA 1WCCA 4WOVA 4ZP5A 2WMSA 2YJRA 1KV2A 2W1ZA 3UIXA 1VJYA 4FTJA 5L8JA 2IF8A 3UGCA 4GVAA 3BPRA 3EN5A 5A54A 3A4PA 4IZ5A 3FMLA 3FMHA 5FXQA 4BI0A 4EBWA 3DKCA 2VWWA 5CTPA 2OH0E 3KXNA 5FTQA 2X8DA 4R7HA 5EQPA 4FBXA 3RKBA 4D58A 2WQBA 2Z7RA 3LIJA 4KKHA 2Y4IC 4IXPA 4MXOA 2HXLA 4CLIA 2ETRA 2J90A 5CAVA 2YISA 2XRUA 3QA8A 4QP6A 2R3OA 4U0IA 4IAKA 3MTLA 4JDIA 2B4SB 4U9AA 2O65A 2WAJA 4J1RA 1TVOA 5IA4A 2R2PA 3R21A 4P4CA 1W2DA 4GU9A 1R3CA 5EHYA 5I9UA 3QQFA 5CU3A 2YIXA 5AUXA 3NGAA 4CQGA 2KTYA 2R3LA 3UVQA 4J96A 3FUPA 3VRYA 2Y9QA 4BY9E 3ZRKA 4MWHA 1FVVA 3Q4TA 3MY0A 1PMEA 4YZBA 4CFVA 4E4LA 2W99B 3IGGA 3MVMA 4NJDA 4G3FA 5ANDA 4EK3A 1XBBA 4YZDA 4YLJA 3OUKA 1CSNA 4YR8A 5CALA 1Z5MA 3PUPA 5IQBA 3C4FA 4WO5A 3ANQA 4P7EA 1YXVA 4QTEA 3VUHA 3D0EA 1OL5A 4QP9A 3CXWA 2HW7A 5K3YA 1XMLA 3AKLA 2Q0NA 4PRJA 3HMOA 1I44A 2DUVA 5KNJA 5CF4A 3DJ7A 1APME 4U7ZA 1NA7A 4DHJA 4AGWA 4BCIA 3U4UA 5E92A 1REJA 3GVUA 1MRYA 3GQLA 4UMQA 4WSQA 5FEEA 3LQ5A 5IH4A 5CI7A 2ZYBA 2ZJWA 4BI2A 2WFYA 4FSTA 2EUFB 3EZVA 4M13A 3KMMA 1UU3A 2GPHA 3PPJA 3EN4A 3W1FA 2QNJA 3Q4CA 4CZYB 1A48A 2B0QA 3IECA 2J0JA 4O0VA 3BU3A 5GHVA 4L01A 3DBDA 1IR3A 1R39A 2OJJA 4DCEA 1H1WA 3W2OA 4JS8A 5EM7A 2P3GX 4OT5A 5A4TA 4XMOA 3SW4A 3HV7A 4AGCA 5IA0A 3MN3A 3MV5A 5DOSA 3QX4A 4E8AA 2X2KA 3FLYA 4AN3A 5CF5A 3PJ2A 3R7IA 2WQEA 5HI2A 3UDZA 2WIPA 4YSJA 1XQZA 3C4ZA 3I7CA 3KN6A 3P0MA 3E92A 2X6EA 1VLRA 2C1BA 4JMQA 3BU5A 2X2MA 4I92A 3DQXA 4EK4A 4HGEA 2VWZA 1RQQA 3DDQA 1H00A 3COIA 3R1QA 4QTBA 1JKKA 4W4XA 5E7RA 4L3LA 3TACA 1IRKA 4FL2A 3I4BA 4NM0A 3BYVA 3VJNA 3R30A 3TJDA 3P23A 2B52A 5CZIA 3R8PA 5AR4A 1ZWSA 1PMUA 5HO7A 5AFVA 3VS7A 4IZ7A 4FIEA 5B2KA 3PE1A 2CGUA 3KCFA 5LVLA 3PZHA 4PDPA 1TQPA 2BHEA 3KRWA 3ZSIA 4FK3A 5AX9A 3FYKX 4A7CA 4W4VA 4TWPA 4R3PA 3WF8A 4TYJA 5DGZA 4A9TA 4BYIA 3F3TA 4E4MA 4CFUA 3RPVA 5J9LA 4KSQA 1KUTA 3ODZX 1B38A 2X4ZA 3A7HA 4D1XA 4FI1A 3UQFA 1XH6A 3LE6A 3IK3A 3MFTA 3W8QA 2R0UA 4BZNA 3HDMA 1YXSA 5IEXA 5IUGA 2XM9A 1H24A 3UDSA 4AE6A 3MH2A 3NAYA 4NIFA 4Z9LA 3HEGA 4JG7A 4CV8A 3NUSA 4F9AA 2VRXA 4LUEA 4G3EA 4AFJA 3U9NA 4AN2A 2WMTA 4NEUA 5DIAA 4YJSA 5IQFA 3ATTA 5M09A 3MA3A 4X0MA 3KEXA 4I94A 5DR2A 3RP9A 4DG0E 4TRLA 2YCQA 4F99A 3DA6A 4IHPA 2WGJA 2OXDA 4D55A 5IU2A 4I6FA 2BDWA 2XKDA 4HYSA 5E91A 5EYMA 1Y91A 1AD5A 4WKQA 5CEIA 4BCMA 4LRMA 4U45A 3EB0A 5EDPA 3S3IA 4JRVA 4FNZA 4O0SA 5EM5A 3ZDUA 1U54B 2XMYA 4PV0A 2GCDA 5JFVA 3FMEA 3G0FA 2O2UA 4L42A 3R7EA 4MBIA 5TOZA 1ZYSA 2ZV7A 3UO5A 4BDFA 4IMYA 4OTHA 3OROA 5KBRA 3P08A 1VEBA 3AD4A 3GBZA 4L43A 1Q8TA 2GNLA 5FP5A 3TEIA 3C4XA 4FZ7A 4FKQA 5L2WA 2V7AA 5HBEA 5AP3A 1V0BA 4C02A 3KXHA 4TNDA 5ICPA 4IM2A 4RFMA 2F57A 4PTGA 3CS9A 3QRIA 5E8SA 4GG7A 2CSNA 4UYAA 4WIHA 3LJ2A 4BZOA 3GI3A 2XCKA 2RFEA 3SD0A 1OECA 1RDQE 3UOHA 4PQNA 1ZZLA 3PIZA 2YIWA 4M7IA 4M69A 5EOLA 5ETFA 4ZSJA 5JRSA 3ZXTA 4FV6A 4C36A 1GZKA 1Q99A 1RJBA 1NVRA 3EN9A 4IX6A 4E4XA 1MUOA 2GTMA 4O2ZA 4MQ2A 2XYNA 1OIYA 4FTKA 4QQCA 3QRJA 2WOUA 4XCUA 1PXJA 2IZUA 4JRNA 4LGHA 5TT7A 3TCPA 5B7VA 3C4CA 2YWVA 4X2GA 4HYIA 4O86A 5KMOA 2VUWA 3ZM9A 5DRBA 3SX9A 4D2PA 4K8AA 3P7CA 4HCTA 3E7VA 5CNNA 4FNWA 3EQGA 4ANSA 2R4BA 4KIKB 3D2KA 4ZSEA 4BDCA 1REKA 3DLZA 2C6OA 3LFAA 2A4LA 2VWVA 3TUCA 2HENA 2HZNA 4EJNA 5M57A 4IIRA 2X7OA 5E8UA 4IAYA 1OIQA 1SVEA 4JQEA 2W5BA 2HAKA 3E5AA 3B8QA 4IX5A 5EG3A 4B9DA 3FXZA 4D0WA 3H0ZA 3T8OA 4D9UA 3V5QA 2RFDA 2WIHA 3AOXA 4EHGA 2FYSA 4FKUA 1GJOA 2VX3A 2JC6A 2UZWE 2HZIA 3NEWA 4LGDA 4L7FA 5HVYA 2OKRA 3ZYAA 1ZYDA 2HZ0A 4NKSA 3KMWA 5IH5A 4HVSA 5FDPA 3FQSA 5IUHA 4GT4A 2XANA 2XF0A 3UO6A 4D1SA 3DB8A 5E9EA 2J0LA 4FTMA 5K5XA 4OBPA 3HDNA 1Y6BA 4U3YA 4FSNA 5LQFA 2XARA 1CKJA 1JNKA 4CVAA 4O6EA 3CQWA 4CKJA 3U87A 4AE9A 2CKOA 2PTKA 3VNTA 2JDVA 3ZRMA 5HKMA 3VBQA 1W2CA 4R7BA 3UP2A 1SNUA 4FTRA 2DS1A 4PP9A 3R02A 2X0OA 4EHVA 3ALOA 5HBHA 3SG8A 4FMQA 2IZSA 3SLSA 4WG4A 1H8FA 2ITNA 3ORPA 4ONAA 4XEYA 5EYDA 5DT0A 5HG8A 4A4XA 4XH6A 4BDEA 4YBKA 3PVUA 4C8BA 4OTWA 2Y8OA 1Q62A 3BX5A 3WZDA 1UVRA 5JKGA 3L9LA 4DBXA 2I40A 4DHFA 2JDOA 3OTVA 4ZLYA 3ATSA 3PVGA 3PPKA 3G51A 3GC7A 1G3NA 2Y4IB 4OT6A 4BIDA 2GSFA 4JL9A 5LMKC 2BIKB 4XLIA 4JAIA 3DBQA 4IAFA 3W2SA 1T46A 2W1IA 4Y83A 3OZ6A 4U42A 3PJ8A 5AR7A 3QU0A 1ST0A 3AC5A 5DE2A 1SMHA 4QMLA 2VTPA 1BL7A 5AA9A 1UWHA 5AP0A 3B2TA 3U6IA 2XJ0A 3E8CA 4QYHA 2C30A 2P2HA 4A4OA 4F1TA 4EH9A 5AR5A 3DXNA 4PDYA 3QFVA 5F95A 3NDMA 4EYJA 2X0QA 1YHWA 4MXYA 3SXFA 4LUDA 3U54A 1VYWA 2BRBA 5ACKA 3IW7A 4O7YA 3ENMA 4ZIMA 2F7XE 4TYHA 4WSYA 4MBJA 4GCJA 3A7FA 3Q6UA 4RJ4A 4IC8A 3DGKA 3VS3A 4H39A 3NYNA 3IW6A 4BWKA 4E5BA 3HYHA 4FRFA 5HTIA 4GFMA 5IQDA 3CGOA 3FY2A 2J0MB 3FE3A 3BBWA 1XBCA 4I6BA 1YHSA 2OO8X 3QWKA 3ORTA 5HG7A 3AC1A 3F2NA 4DFYA 1ST4A 4DGNA 4RSSA 3IOPA 5CLPA 2FH9A 5B2MA 2HK5A 1WBNA 2PVFA 4X3FC 3WZJA 4KS7A 1WVYA 2C3KA 4RPVA 4JBOA 5GINE 3MFUA 4BGQA 5J7HA 2R3KA 4X21A 3ZUVA 4YNOA 4B6LA 4YZMA 2PZPA 2W1CA 4KIQA 3R8ZA 3T3VA 1Q24A 2C3IB 4ZSLA 3VF8A 3DJ6A 5AP4A 2J9MA 1PXLA 3M2WA 2Z7SA 2UW0A 3EQIA 4Q9ZA 1QL6A 3HA8A 3VONA 4YJVA 3R8UA 5IZFA 5T6KA 3R1NA 4ZTRA 1OKWA 3CSVA 4G2FA 5AM7A 2XKFA 3QKKA 4C3PA 1BX6A 4IAZA 3H0YA 1H1QA 4HVGA 4YSMA 4ZTQA 4WRSA 4XBRA 2Y4PA 3QCSA 4RG0A 4XP2A 3AC2A 3PRIA 4YGAA 2BRMA 2YCFA 3ZZWA 1JKLA 4BDKA 2ITQA 5H2UA 4QTAA 4TT7A 4EUTA 2JBPA 5LWNA 4O81A 3F9NA 3KRJA 3UZPA 3PRFA 3CPCA 3ORLA 4GS6A 1UNLA 4O27B 4DFNA 3RPSA 2REIA 5HCZA 3W2PA 2PZIA 4E4NA 4RJ8A 5AV4A 1IEPA 2UZTA 4IACA 4FSWA 4PMTA 3LQ8A 3UMWA 2CGVA 2X7GA 4BJJB 3WF7A 5HO6A 3CTJA 4LRKA 2WTIA 2XEYA 1FMKA 3O17A 3P79A 4GT5A 3I5NA 3OC1A 4M3QA 5AUVA 4ZZMA 3V6SA 4OR5A 4O7LA 4HZSA 1J7UA 2Z02A 4PNIA 2IW6A 4HCVA 4JG6A 3W8LA 1SZMA 4RIYA 2W9ZB 2E9VA 5D7AA 4ACCA 3FSFA 4IEBA 4FA2A 2ZM4A 3C9WA 4R5YA 3Q96A 2VWUA 4OTGA 4L68A 4KRDA 3TL8A 3CBLA 4BIEA 4QEBA 3O50A 5HE2A 5TE0A 4BCFA 3EQDA 3VHEA 1WBSA 5CAOA 3L8VA 3PPZA 3LCSA 3PXRA 4WNMA 4BYJA 4F7NA 3Q9ZA 1OMWA 4DA5A 3R8MA 2AC3A 1W84A 3VBVA 3ZUTA 4IE9A 3MFRA 3W32A 2Y0AA 4D4YA 1H26A 3ROCA 4FJVA 2ZVAA 4GK2A 4TYEA 5HIBA 4ERKA 3TZMA 3HV3A 4YTFA 5B2LA 3GU8A 4DTBA 2C3LA 3BYUA 5M53A 5IUIA 3W0PA 4HW7A 2X2LA 3IDBA 3QX2A 1M2PA 5A6OA 4RZWA 1CTPE 4I21A 4N6ZA 3P78A 5HOAA 3O8TA 4UB7A 2BFYA 2Z8CA 3RM7A 5HIEA 3K3IA 2OIQA 1U4DA 4V0GA 3VS5A 5IA1A 2PUUA 2W7XA 1O6LA 3HMIA 5AP5A 2CNVA 3FI4A 3BU6A 3SQQA 2NRYA 2F2CB 3VUTA 2R3NA 3DNEA 2R3FA 3EMGA 4RX5A 3OWKA 4CG9A 2XK9A 4ZTSA 3VQUA 3F2AA 4DH5A 3UIUA 1NT2A 4FTCA 5CVHA 5FM3A 2OJ9A 2WMAA 5CSVA 4I0TA 3Q5IA 3RAIA 3W55A 4AN9A 3AQVA 4IQ6A 1L3RE 2R64A 4IC7A 3TMOA 5BX0A 2YHVA 2WMVA 1F3MC 4DGOA 4LMNA 2ZDTA 2WMQA 3PJ3A 2PWLA 3IQ7A 4I4EA 5FG8A 1M17A 5A9UA 5JEBA 5AV0A 3G90X 5GJDA 3S00A 3QD0A 2OZOA 2QVSE 4KA3A 2F2UA 4AS0A 2UVYA 4Q2AA 4IWPA 4YMJA 3FKNA 3L1SA 4DC2A 5FTOA 2W1HA 2WQOA 3Q4ZA 5H3QA 5HG5A 5BQ0A 2VTIA 1DI9A 2YDKA 3RMFA 2P55A 2XNMA 3LM0A 3UQCA 5DEWA 3LMGA 5C9CA 2J7TA 4CFWA 5IQIA 5EI2A 2C68A 4APPA 5EYCA 4F78A 3R9HA 2BZHB 4Y5QA 5HD4A 1GIIA 4DFUA 3MWUA 3TV6A 4TL0A 2CN5A 3PY1A 3W0OA 3ZFYA 3CR0A 4X3FB 2EWAA 3DK6A 3KK9A 1STCE 3R9OA 4DYMA 3QD4A 3OEZA 1BI7A 3WF5A 4DLJA 5KMIA 4ZY6A 4CKIA 4JG8A 1BI8A 3WBLA 4NKAA 1PXIA 2ITVA 1ZRZA 4O7RA 3WARA 5M56A 3PA5A 4OTQA 4WT6A 3N9XA 3MH1A 3GU6A 3LFSA 4O7WA 3FBVA 2ERZE 2VO3A 1LEWA 5CVGA 5BVWA 5LCKA 5EW8A 1MP8A 4ANQA 2QHMA 4DT8A 4LL0A 4LQMA 3KL8A 3NUUA 3QQKA 2PL0A 4ZJJA 2JAMA 5CAQA 5KHXA 5M4CA 5HD7A 4BCPA 2QKRA 1NVSA 3E8EA 5EYKA 4BC6A 4IB0A 5AV2A 1DAWA 2JDTA 1FVRA 3ORKA 3G2FA 3D5XA 3O23A 4FKWA 4JXFA 3D4QA 5F1ZA 3ULIA 1OL7A 3Q2JA 3II5A 3FV8A 2QO7A 4FTQA 4QNYA 2BAQA 3F82A 1XMMA 1PXOA 1J1CA 2VZ6A 4RT7A 5A46A 4O96A 4L53A 2PY3A 3WIGA 4RIXA 4E6CA 1X8BA 2IVTA 4AW0A 4Y72A 5TF9A 1GIHA 5FDXA 3OCGA 2UUEA 4F9BA 1UU9A 3G6GA 3LXNA 4IWDA 4IX4A 4EOSA 5CQWA 5DR9A 4BWPA 3OVVA 2PMOX 5FUTA 5EK7A 4Y5HA 3KXGA 5D9HA 5TR6A 4D5KA 4ERWA 5IG1A 2QO2A 4AZFA 3W0QA 3GC0A 5EQEA 2XIZA 3GENA 4EQCA 4AGDA 5JK3A 4MQ1A 4O84A 1R1WA 5J5TA 4BCQA 3RWPA 3FDNA 3NW7A 2ETMA 3OMVA 3KF4A 4IZYA 4AACA 5JT2A 4ZS4A 2VTHA 1WBWA 2ZB1A 4IAIA 2VX0A 4KIOA 2QR7A 4DFLA 2UVZA 3FMKA 3RK9A 4DG2E 5AR8A 5BMMA 3BWFA 3TZ8A 4C4FA 3FAAA 4S32A 3N4UA 4IB5A 1ZZ2A 5TO8A 4Z55A 3CKWA 1TFFA 4H05A 3V6RA 3RI1A 3BBTB 5IQGA 4YTCA 2QONA 4YJUA 4HVHA 4L3PA 2YERA 2XK3A 5KHWA 5AP1A 2KULA 1DS5A 1XH5A 2BZJA 2GHLA 2GNGA 3BCEA 3COKA 2VAGA 3FWQA 3HRFA 3KA0A 1OGYA 4BR3A 4MD8E 4TWNA 4NFNA 4BCGA 3ZH8A 2EXCX 4UN0C 2XM8A 4TKSA 2QODA 4GUBA 5IMEA 4K0YA 2I0EA 1IASA 4QMOA 3V5TA 3GCQA 2ZB0A 4H3PA 5AIKA 4GJ2A 5B0XA 3ZO3A 3Q60A 3DKGA 2OWBA 2UZEA 3A99A 3I1AA 3L9MA 3E3PA 5ETCA 5AV1A 5L6PA 4F9WA 2WTCA 3BYSA 3AGMA 3CD3A 3QHWA 4XOZA 3NSZA 4U6RA 4MD7E 3TNWA 4HVIA 4ALVA 4F4PA 3JYAA 4XHKB 1JWHA 4FVPA 1Q8ZA 2W96B 3QUEA 3UG1A 3PY0A 5BUIA 1U59A 3F69A 2PZYA 4XG4A 4FV0A 3OY3A 4FKPA 4TYHB 3OEFX 2C5XA 4BTFA 4BI1A 3MYGA 3UPXA 3V04A 3DAJA 5HNIX 2OK1A 2QLUA 2OICA 4U81A 5CU2A 5AUYA 3C4EA 4F1OA 3M1SA 4E5WA 1R78A 3WI6A 4FTTA 2R3GA 4AOTA 4ZSAA 3GB2A 4M69B 2B7AA 2V0DA 3UDBA 4R1YA 1TKIA 4C4HA 4NM3A 3QA0A 4J71A 4DTKA 1XBAA 4AA4A 4B8LA 3BHVA 4K18A 4ZEGA 3LMIA 3D7TB 4TN6A 4ZMFA 5C4LA 4FT3A 1GY3A 5KMNA 4O82A 4J8NA 3CIKA 3FLSA 4Y8DA 3UC4A 4BB4A 3POOA 1A9UA 1JSTA 3JVSA 5BPYA 2FSMX 3NYOA 4ITJA 2OW3A 3LFEA 4LL5A 3VRZA 2AYPA 3E62A 2RFNA 3V5WA 3VBTA 2ONLC 1H1PA 3CD8A 3GFWA 4FL1A 3L8SA 2F9GA 4IX3A 4MK0A 4OBQA 5ANJA 1TQIA 1H27A 5CI6A 5LXMA 5L6OA 4ACHA 2QOIA 4BDHA 4EH7A 4GVJA 2C5VA 4JQ8A 4XG6A 4P90A 4WUAA 4YO6A 1PW2A 4GKIA 1XH4A 3QQLA 1XO2B 3EWHA 4R3RA 5AUZA 3UPZA 4C3RA 2YAAA 4EK5A 1QPDA 2HZ4A 3LXKA 4E7WA 3MH0A 3NW5A 4RVMA 2ACXA 3R0TA 2J4ZA 3FZTA 4PUZA 3TTIA 4N4SA 2J5FA 4PL3A 4C4JA 4X6RA 4AXFA 3I81A 3WILA 4NCTA 2YZLA 3QQJA 5KZ0A 3DOGA 4X2FA 4XS2A 3HP5A 1FMOE 3GXLA 4P5QA 3LM5A 1YDTE 2YEXA 4M0YA 3LFQA 1GNGA 3BHHA 3LLAA 4R78A 4EKLA 5ETAA 4RWIA 4J95A 4FG7A 2WMXA 3R63A 2HY0A 3BZ3A 3GCSA 5AWMA 4O83A 3MBLA 4CGAA 3O51A 4DTAA 4H3BA 4XG8A 4EYMA 4L44A 4DF3A 4FT9A 3VUKA 2YITA 4NZWB 5L4QA 3TZ7A 3U9CA 3UO4A 1ZYJA 2E2BA 2JAVA 2Z2WA 4UWBA 3KIOC 5CVFA 3RWQA 3ZXZA 4C57A 3DQWA 3G5DA 4JX3A 3IS5A 4OTFA 4IADA 2CGWA 3V51A 3NZ0A 4FVQA 2W4OA 4KBCA 4WD5A 2ONLA 5HLNA 4PMPA 3FQEA 3KXZA 4EL9A 4RLLA 1XHAA 3KCKA 1U5QA 3W0NA 4PF4A 4N6YA 4UWYA 3KMUA 4W8EA 4AW5A 5KMKA 5A4CA 5HG9A 3UOKA 2VWYA 4UMRA 3DXQA 1ATPE 3HUBA 3CQUA 1HOWA 3BGQA 4UZHA 4MHAA 4V0GB 2VNWA 3BQCA 4RA4A 4NFMA 1PXMA 2OGVA 3NAXA 4JDKA 1KE9A 4R6VA 2O64A 5D11A 1PY5A 4F70A 1GAGA 3C5IA 3OWLA 3DCVA 3EFJA 2VWXA 4R7IA 3RM6A 5CEPA 5CXZA 3GU4A 3ERKA 3O96A 4CTBA 5AP7A 4UXQA 1WFCA 3HP2A 4NCTC 5FBNC 4GW8A 2QC6A 4KABA 4WG5A 4CXAA 4U40A 1PXKA 4ANMA 4JR7A 3W33A 1OL2A 2XALA 3HV4A 4O1OA 3V8SA 4AOIA 4EHZA 2UW8A 4GU6A 3OG7A 4YTHA 5F20A 2IZRA 1NXKA 4IB1A 4PTCA 3ZO1A 5AAGA 4IB3A 5LVMA 3NUXA 3DBFA 3P1AA 3EYHA 4CLJA 4NYEA 3I0QA 2WELA 1PRYA 4X3FA 3KRXA 3BL7A 2V55A 1K2PA 1XR1A 5IKWA 2B54A 3ZSHA 4PY1A 2BPMA 4MXZA 3QC9A 3CEKA 4C2VA 4FIGA 4LM5A 5GZAA 4EOPA 1OUYA 3HMPA 2GTNA 1KOAA 2WQMA 2V62A 2R3MA 4BGGA 4L67A 5FWKK 3FL4A 3KVWA 3FI3A 1M2RA 2BHHA 4UWCA 4CRLA 4D5HA 4RGJA 1URWA 2I0YA 4FV7A 3QD3A 2UZDA 2VV9A 4G34A 3NX8A 3MH3A 3MSSA 4YP8A 2IW8A 5AAEA 4DDGA 3IW4A 4DHIB 2WEVA 4IW0A 3TTJA 5BYZA 2BRGA 4PNKA 5FD2A 4P5ZA 4PDOA 5BYYA 3HRBA 3QXOA 4ZTHA 3FKOA 4D0XA 4WUNA 3EQBA 3Q4UA 2JDSA 4ZSGA 3VS1A 3FMNA 1YHVA 3CP9A 4UMTA 5HU9A 5L8LA 3ZSGA 3QYZA 3QCQA 1LPUA 1P14A 2G2FA 4QDVA 4F63A 3H30A 5IISA 3QQHA 4C38A 5HGIA 2UZNA 2GQSA 3EN7A 3PXQA 4ZZNA 3F5PA 2LAVA 1Y8YA 4EORA 3NFFB 5EI6A 5BVDA 3QRUA 2NPQA 3SOCA 3NVMB 4QDEA 1XKKA 3ZUUA 5HLWA 5HX6A 2GS7A 3TG1A 2HYYA 3VUDA 3UQGA 4IDTA 4O6LA 3PLSA 1QPCA 3DK3A 3MTFA 3OS3A 2BTSA 3TN8A 2VX1A 3PFQA 4R5SA 4FZDB 1H0WA 1SVGA 1TZDA 3V5JA 4AQCA 4HVDA 5CY3A 4O4EA 4AXDA 2VTNA 4I24A 4BIBA 3UJGA 2PVRA 3DTWA 4XBUA 5FEDA 2Y7JA 2JIVA 4QP4A 2EXEA 3H3CA 2AQXA 5A4LA 4XUFA 2PVKA 3DK7A 3KREA 4DDIA 3CGFA 3HKOA 3KQ7A 1E9HA 4G1WA 4OUCA 3HX4A 4XNEA 5LCJA 2FUMA 3RVGA 3EFLA 4KKGA 4XV1A 2C6EA 2FA2A 3KXXA 4O0RA 5HE1A 2O0UA 3BKBA 3OCBA 3TNHA 3BLQA 4K9YA 3W0SA 2CGXA 4EONA 3O2MA 3O8PA 4FKOA 3RNIA 1J91A 3L9PA 1W8CA 1YXUA 2XK6A 2FGIA 4EH4A 4C58A 4JBVA 3VBWA 2ITYA 4E20A 1IAHA 3RAHA 4MBLA 1J7LA 2B9JA 3BV3A 2OXXA 4O4FA 3SHEA 3U51A 2OZAB 3Q6WA 5EM8A 1BL6A 2ITOA 3QTQA 4RIWA 4TNBA 3W18A 4EOKA 4F0IA 2FB8A 2ZFYA 3L8PA 2JKQA 1O6KA 4FGRA 1BKXA 3QF9A 4Q5HA 5K9IA 1BLXA 3HAMA 4DEGA 5F94A 4HGTA 5K0KA 2C6KA 4I20A 4KRCA 1Q8YA 5EH0A 5FM2A 5CYIA 1H1SA 3C7QA 4JBPA 3MFSA 2OXYA 5CEKA 4FV1A 2VTLA 4Y85A 4I6LA 1JBPE 3PXKA 1ZMWA 5JRQA 1R0EA 2IVUA 1A06A 2UZLA 5JZNA 1Q5KA 3ZC6A 4I5MA 4RWKA 5C4KA 3D5VA 3F88A 3JXWA 5IA3A 4O0WA 3QLFA 2IZTA 2X9EA 1OPLA 3MA6A 4F9YA 3DS6A 2ZM1A 3CC6A 4FNYA 2X8IA 3FLNC 3R8LA 3TV4A 3W0MA 3QWJA 3ZU7A 4U41A 2ITUA 2ERKA 1Q41A 5DVRA 4EOLA 4C34A 1ND4A 3ET7A 4S34A 4I23A 4X2JA 2ZM3A 3SGCA 3FHRA 3VWAA 3NNWA 2GNJA 4A07A 2PUPA 3BGPA 3ZS5A 2QKWB 3DZOA 2BKZA 2JKMA 2W0JA 3KULB 4LI5A 5DEYA 4FV3A 2XNGA 4A9YA 4ORKA 3AXWA 4RIWB 3GCVA 5BVEA 4CCUA 2BRHA 2G15A 4I3ZA 2J51A 1K9AA 4KAOA 4UMUA 1B39A 3Q32A 4GRBA 4HGLA 3NIEA 2I0HA 1BMKA 4KINA 4O21A 3VUGA 1H1RA 4DEIA 5IQEA 2QU6A 4P2KA 5HBJA 5JFSA 4FTIA 2R7BA 1FBNA 3R1YA 3F2RA 2CJMA 3PWYA 3IGOA 3PYYA 1YQJA 3I79A 3PTGA 5HNGA 1H4LA 2PUNA 2YABA 3LCKA 3CQEA 3H4JA 2G9XA 3UVPA 4PWNA 4FIFA 4QP3A 4WBOA 4YZNA 4EEVA 5BMSA 4FTLA 1FGKA 5JGDA 3NPCA 5DMZA 4YC8A 1WVWA 3PJ1A 1OIRA 3EZRA 4LOQA 4E5AX 3AGLA 4QTCA 4FZFB 4M66A 4D2WA 5KCVA 3O7LD 3R28A