3LZBA

Egfr kinase domain complexed with an imidazo[2,1-b]thiazole inhibitor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
281
structure length
265
Chain Sequence
LLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMRKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Imidazo[2,1-b]thiazoles: multitargeted inhibitors of both the insulin-like growth factor receptor and members of the epidermal growth factor family of receptor tyrosine kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 85
structure length 265
sequence length 281
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lzbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lzbA01
4LI5A 1NY3A 2W1FA 4C61A 2XK8A 5E8VA 2BZKB 3Q6WA 1YI3A 3EFWA 4QNYA 5EDPA 3RVGA 2J5EA 1ZYCA 1APME 2CN8A 4NT4A 5DA3A 5J9LA 4XS2A 4FTCA 2G15A 3QTWA 3A7HA 3SXFA 2O65A 5IU2A 3C13A 1XH4A 3NUXA 4RX8A 2HZNA 3UPZA 2QOFA 5AX9A 1OITA 4C3PA 4H3PA 5BVNA 3LFNA 4EK3A 5CZIA 3V8TA 3V5PA 5ANDA 3QZIA 2QLUA 4GJ3A 4MXYA 3QRIA 3EFKA 2GNJA 4R6VA 4XYFA 3LW0A 4QYGA 4IAYA 3BQCA 5H8BA 2HELA 3F3ZA 3GC7A 3TUCA 5KMNA 2W96B 3UZTA 4NIFB 5HLNA 5JGDA 4FV2A 3UO5A 2W5HA 4MXOA 3U55A 4CFNA 4YJSA 3FUPA 4MHAA 3I5NA 4N70A 3F82A 4KBAA 5TT7A 4U6RA 1QL6A 2UVYA 2IZSA 3CS9A 3JUHA 4TYHB 4GYIA 1H0WA 4ZSEA 4QRCA 1O9UA 3E87A 4QT1A 2G2IA 1M7QA 3HKOA 3DBDA 2YJRA 4FTLA 2PZPA 3VBYA 4O7TA 5CSXA 5J7BA 3RK5A 2VTOA 3CGFA 4QNAA 4XG8A 3M42A 3FJQE 4TW9A 5M57A 3N4VA 2WMWA 3MBLA 4CMUA 5IQDA 1WBTA 5EW8A 4APCA 5J5TA 1U54A 2I0VA 2LGCA 5CU2A 2YM5A 4RBLA 5EOBA 4PQNA 3E8DA 3UMXA 1E1XA 1MUOA 5CF5A 3HA8A 5EM6A 3WBLA 4BL1A 4QMNA 4CQEA 1IA8A 3V51A 2XK4A 5LCJA 5EQEA 3SX9A 4CLIA 4BIDA 3R00A 5HVJA 4D2WA 5EW9A 5HIDA 2PVFA 2WTKB 2IZTA 3MH1A 5AUZA 5FEQA 3G33A 2BZJA 4JG7A 2W0JA 2GHLA 2BRMA 3KCFA 5B2LA 4ZLZA 4BKJA 2YLFA 3PG1A 5BVOA 3QALE 4I92A 4IZ7A 1PW2A 5TF9A 2ZVAA 4W9WA 5KNJA 4K1BA 4FT9A 3SW4A 3VJOA 4E1ZA 1PXLA 3CBLA 4LRKA 5HO7A 3MFSA 3P7AA 5DR2A 3ZCLA 1XH8A 5HHWA 5JRSA 3QRKA 3NLBA 2PVMA 2XEZA 1H1PA 2IPXA 3LFEA 4BTJA 2QI8A 3AQVA 4J96A 5DRDA 3VWAA 5KMOA 2CKEA 4O7WA 4XRJA 1Q8TA 4BDBA 2Q0NA 4E8AA 2REIA 4ZSJA 2XMYA 1Z5MA 3PE2A 3SV0A 3D2KA 4P5QA 3THBA 2YAAA 3LCTA 3TZ8A 5HX6A 3D0EA 5CT0A 4FGRA 1KSWA 3IPHA 1V0BA 4RLLA 2O3PA 4RIYA 4WRSA 4XG7A 1OMWA 3EZVA 5K0KA 5L3AA 4ZZMA 4F65A 2J6MA 3TACA 4U7ZA 2YLEA 2VTTA 4KINA 2XRWA 3PIXA 5F94A 4MTAA 3EYGA 3NR9A 4IB1A 4ZTNA 4A07A 3BE9A 4IZAA 1Q41A 4C2VA 3GCPA 2B7AA 2UW0A 4G3GA 1SMHA 3FMDA 4MAOA 4V04A 4FSTA 4AA4A 2ETMA 3NWWA 5K0XA 5D10A 3R1SA 3TV6A 4JQEA 5GHVA 1IAHA 3ZONA 5CASA 2YIYA 4D2VA 3H3CA 3U54A 5AP5A 3SDJA 3FAAA 1JLUE 1NVRA 2YIWA 3HMNA 2OJIA 4BDCA 4FKUA 3DAEA 3FLQA 4RG0A 3RI1A 3FKOA 3HYHA 4ZJJA 3NEWA 5H2UA 1RW8A 3DT1A 4QP6A 4EC9A 4M69A 4DYMA 4EOOA 5BVWA 4L3PA 4AZEA 4KKEA 4IVAA 2IZRA 1H8FA 2QOBA 4G16A 1E9HA 1XBBA 2HY81 4NM7A 4I5CA 3DS6A 4O6LA 4R5SA 4B7TA 4L7FA 4R1VA 3NAYA 1OKWA 1UNLA 4IAKA 3W2OA 3CJFA 2BKZA 2IVTA 2NO3A 4H39A 3VRZA 4WOVA 3C5IA 1AQ1A 3HECA 2B55A 5FLFA 1TKIA 3OCTA 4FEVA 4A4XA 1NXKA 4F9CA 4K33A 4FGBA 2WQBA 3ORTA 3KMUA 5E8YA 3KMMA 2WEVA 2AC5A 4E7WA 3RPSA 1XR1A 2W4KA 5IA4A 1OBGA 2QKWB 3E8CA 3FDNA 3MY0A 2VO3A 3PPJA 4L00A 3B2WA 3LIJA 1YHSA 3LQ8A 3KB7A 1XQZA 4QMTA 1R39A 1YOMA 2VX0A 3FPMA 4LV5A 1YI6A 4HVSA 3ZM4A 5D7VA 3FL4A 2YDIA 4UZDA 3D5XA 3VVHA 4H05A 1X8BA 4FTIA 3VULA 2C6OA 4WG5A 4WRGA 3ZDUA 4BZNA 4E6CA 3FL5A 2W9ZB 4OTQA 3F2AA 5IQCA 1OB3A 5I9VA 2ITVA 2NRYA 1G8SA 2I0YA 1L3RE 4YUQA 3UIMA 4EQCA 4FKRA 1H1SA 5LWMA 2QO9A 4GK4A 4ZZNA 4D5HA 3II5A 4AX8A 3IONA 4HNIA 4BDFA 4ZAUA 3SXRA 4F9WA 2G1TA 3KF7A 1ZARA 5KBRA 4IJ9A 3VS6A 3PA4A 1OVEA 3MPTA 1CKPA 3RMFA 3RZFA 2YM7A 4AZVA 2VWWA 3C4EA 3BGPA 1YDTE 4HZSA 1J7LA 2I0HA 2X8DA 4CYJA 1Q8YA 5AWMA 4IM2A 4GFGA 4QTEA 3OT8A 3GCUA 3C7QA 2FUMA 2QD9A 3QZHA 4MXXA 2R0UA 4EHZA 5L8JA 1ZZLA 3NIEA 3V6RA 3ZLXA 3BQRA 3DZQA 4RC3A 2GQGA 3KN5A 3RAHA 3RWPA 3EQHA 2G2FA 3VQUA 1FVVA 3VHKA 2VWZA 2IW8A 5I3OA 3P5KA 3JYAA 5IKWA 2V0DA 4UMQA 5CEMA 2R64A 1KE7A 2GFSA 2JIIA 4QYFA 3TG1A 3VBQA 5JQ5A 4KRDA 1OM1A 2YERA 3F5XA 5AV4A 2X2LA 2ZV7A 3UP7A 2VTHA 4C4FA 3BHTA 3FLNC 4ALWA 4RX9A 1OIRA 1URWA 5ANGA 4FV0A 3DBEA 3KRXA 3RINA 2BHEA 2F4JA 5EYKA 5EM7A 4MWHA 3VW6A 1GOLA 4BCIA 4EH8A 3JR1A 4AT3A 3LJ2A 5CF6A 4N57A 3HAMA 4NW5A 2XRUA 2OBJA 5CU3A 4GIHA 3EQCA 3NGAA 4FSYA 4GFMA 4R7IA 3C4WA 5EK7A 4C35A 2I0EA 3HL7A 4N0SA 5AV1A 2XYUA 4ZOGA 3U9NA 5DT4A 2P0CA 3IKAA 3R9RA 4DITA 5CZHA 4DGOA 2Z7QA 2EXEA 4FIHA 5AR2A 2I40A 2WQOA 4NCTA 4BKZA 4IAAA 4O96A 4TYGA 1UKIA 5FM3A 4KKGA 4OR5A 4YTCA 3VS4A 2C5VA 5FUTA 5ITAA 1GZOA 3LMIA 1UU7A 4DCEA 2W5AA 3PY0A 3AD5A 4O38A 3UGCA 3QQJA 3R8MA 2NRUA 3OBJA 2QR8A 4FV9A 5LVLA 3ZBXA 4A4LA 4ALVA 5BPYA 3QQFA 2C1BA 4ZJVA 3CIKA 2IVSA 3LPBA 2CLQA 4M8TA 2J2IB 2PZIA 4H1MA 4WNKA 5IEVA 4O81A 3SC1A 2E9UA 2J0LA 3FKNA 1KV2A 4LL0A 4ARKA 1KE8A 4XEYA 4DTBA 2XK9A 1YRPA 4GJ2A 2C0IA 4K11A 5CANA 4WG4A 5FXRA 5A4CA 5HKMA 4UXLA 1DAWA 3W18A 4O0WA 5A9UA 4JRVA 3OWJA 2BHHA 3GT8A 2VUWA 3CQWA 3TNHA 3TUDA 2XK6A 3OBGA 5DT0A 1ZYLA 3P7CA 5EDRA 3VF9A 1PHKA 2VTAA 3C0IA 4P5ZA 1M17A 3F3TA 5CF4A 3D7TB 5LMAA 3BELA 2GS2A 5TE0A 4EORA 4ERKA 2XCHA 3AMAA 4FOBA 5JT2A 2RKUA 3BYMA 1PRYA 2R3MA 4OW8A 5J9YA 1FMKA 3I0OA 2CCIA 3BGZA 4KABA 2YN8A 5DE2A 2CKQA 4FR4A 1FINA 3AT4A 4YZ9A 4C57A 2OXXA 3H9OA 4YHFA 1XH6A 3GCVA 4RVKA 5IQAA 5DR9A 4C3FA 5KZIA 3TDWA 4I21A 4YJRA 5HE0A 4F0GA 2C5OA 5CAVA 1J91A 3QKMA 3ZSGA 4BDDA 4CRSA 4ZY6A 3BYOA 4QMWA 4YZDA 3LMHA 2CHLA 3MESA 3TNIA 4TYIA 3DBFA 2X1NA 2QLQA 5LMKA 5JGBA 3DKFA 5M4FA 5BQ0A 5AP7A 2KULA 3FI3A 5EQPA 3ZH8A 2IVUA 4FNYA 4WG3A 5EOLA 3UIUA 2QNJA 4IWQA 4PL3A 4EHGA 5GINE 4BCKA 1V0PA 4FODA 4JQ8A 4F6SA 3OS3A 4BDKA 4B0GA 2XNPA 1PXNA 2WIHA 4RFYA 4RRVA 2WQEA 4F9AA 5E1EA 3UOLA 4QMLA 2A2AA 3TCPA 2C6DA 3A61A 3W8QA 3FY0A 3AC2A 3G0FA 4O21A 1JVPP 5IA2A 2JKQA 4HNFA 4U42A 3GOKA 5EHLA 2GDOA 1REKA 2J0KA 2ZM3A 3QBNA 4AT5A 3UO6A 3SOAA 2WMAA 3D7TA 3F5GA 3UVPA 2VX1A 2BDFA 3RPOA 2XKFA 4PNKA 1J7IA 1O6KA 5DBXA 2B9HA 4WKQA 4GK3A 3MFUA 4C4IA 3UZRA 4BIEA 4FZ6A 3BX5A 3ORIA 4RX7A 5CSVA 2PUNA 2YM4A 4BCHA 2YCRA 5I9WA 4RFZA 3HGKA 2CKOA 5ETFA 5FEEA 1GY3A 3F3UA 4RVMA 1G5SA 4D4RA 3R7YA 3DNDA 5M4CA 3ZYAA 2WTJA 3MVJA 4OAUC 4FZFB 5DH3A 1YHWA 3PLSA 4JVGA 4GU6A 4EWHA 1GAGA 3NNVA 4KSPA 2OO8X 2O8YA 4IHPA 3I7BA 4LQMA 4D0WA 4KA3A 5CI6A 4CFFA 1ZLTA 2WGJA 4AWIA 3ZEWA 4U45A 1L8TA 1RQQA 4BRXA 2XJ1A 4PPAA 4R78A 4I1ZA 4HGSA 3TI1A 4RWIA 4Y73A 4OTFA 4F9YA 2JBOA 3FSFA 3R9OA 3BHVA 3BWFA 4E73A 3EWHA 2RSVA 2EB2A 3GEQA 4PTGA 1JQHA 4NL0A 4EQMA 3HUBA 1IA9A 4PWNA 3CKWA 2F2CB 4AZTA 4MD8E 4NKAA 4TTHB 4BDHA 2YDJA 3COMA 5C8KA 3OROA 4GG5A 3MPAA 2GMXA 1BX6A 1PKGA 3F3VA 3UG2A 4EZ3A 2JIVA 4IX4A 3RBWA 4EK4A 4FKTA 5ANJA 5HNIX 2XB7A 3SD0A 3UZPA 4F70A 5IQHA 2WMBA 3MJ2A 2B9FA 3WZUA 1SM2A 4OTHA 3PE1A 3LVPA 1Z57A 4MNEB 5IQGA 3QTQA 2XUUA 2C5YA 4M67A 3BCEA 3OXZA 2YISA 4DFXE 3CJGA 1YOJA 5JZNA 4PY1A 3UYSA 2UVZA 1HCLA 3SRVA 3WF7A 1W8CA 2PTKA 3P23A 4OTWA 3I81A 4QMYA 5AJQA 4ZTRA 4A9RA 5L2IA 2B54A 1BUHA 2GTMA 5D11A 2JD5A 3KC3A 5E8SA 2G2HA 1OUKA 4QD6A 3Q3BA 3RM6A 3TKUA 3LFSA 3Q53A 5HD4A 1WBVA 4BZDA 2UZTA 3LQ3A 2XNBA 3DDPA 5ICPA 3FMMA 1BL6A 3F69A 4FL1A 4BGQA 2OG8A 4FL2A 4D58A 4FV3A 2GQRA 4XP2A 4NKSA 1OKZA 1H1WA 2CGXA 4YO6A 5CX9A 2BCJA 4IX3A 4YNOA 2FSOX 2YZAA 4S31A 4EBVA 3HZTA 3MSSA 2Y4IC 4AT4A 5KMIA 2YAKA 3BYVA 3N51A 4G1WA 4UX9A 3U8WA 5AR7A 5EG3A 3ZZWA 5E8XA 5J9ZA 5IQEA 4X6RA 2E9PA 3PPKA 5GIPE 2BZIB 3CQUA 3MH2A 2XH5A 2UW4A 2Y9QA 4EH9A 2QOCA 4F0IA 3CKXA 2ITQA 3HV7A 3Q2MA 3QGYA 5GJDA 1F3MC 3MS9A 3V8SA 4Q2AA 4DC2A 4FT0A 3WILA 4NU1A 1KE5A 3GXLA 4MNEA 4BHNA 3RJCA 1M14A 3ULZA 5AUUA 3QUEA 1PJKA 2O63A 4AN9A 3F66A 4FC0A 5HLWA 5IMEA 4DFUA 3QC9A 2RG5A 4RVTA 3C0GA 5L2TA 2EXCX 4L3LA 5HNGA 2OJGA 4FF8A 4C8BA 3DXQA 1IEPA 4JAIA 5K9IA 4YTIA 5C27A 3ZLYA 2BROA 3C4ZA 3ET7A 2E2BA 4I0SA 4RT7A 3UIBA 3LFFA 2F9GA 4G34A 4PL4A 1YXTA 3ORNA 3GC8A 5E90A 3MVLA 3H10A 5FDPA 4P7EA 3L9MA 4F99A 2VV9A 4I22A 2XNGA 2HWPA 5LCKA 2ITZA 4EZ7A 4G3CA 1MQBA 1OL5A 3BGQA 3EJ1A 4BGHA 5IMXA 2I1MA 2WU6A 3FE3A 3RPVA 4L9IA 4KUJA 3FLZA 3BE2A 2YCFA 2GS7A 3QGWA 2UW8A 4M15A 4XUFA 5L6WL 4O82A 1DS5A 2UZBA 4IM3A 4RMZA 4R3CA 5EI8A 5H8GA 1H1RA 2VTMA 4ZXTA 3ORKA 1J3HA 5A4EA 1YKRA 4FG7A 2Z8CA 4JS8A 5CAQA 4H1JA 3FXWA 1JNKA 2OH4A 4NM3A 1R78A 4YNEA 2LAVA 4C38A 4FV7A 3KXGA 2OJFE 3KXHA 4GEOA 2GNHA 4YJNA 5D9HA 3QCQA 4GIIA 2IW9A 3WF8A 4E26A 3HA6A 4RWLA 3T8OA 4BTMA 4ANLA 1XH7A 2WQNA 1H27A 4GT4A 5DG5A 5HG8A 3E62A 5F20A 2XKCA 4QPMA 3QRJA 5T3QA 4BZOA 4DEEA 4DTKA 5LQFA 5KMMA 4CTBA 3O17A 2R9SA 3GOPA 3GVUA 3PLAE 3EHAA 3P1AA 4HCUA 3NVMB 2X9EA 4JDJA 2P55A 4FTNA 4HOKA 3I6UA 5IDPA 5LVOA 3C0HA 3UOKA 5HG9A 2W1ZA 3PZHA 4WIHA 2IG7A 3LQ5A 3W32A 3TV4A 4EOQA 1UVRA 4RIWB 4DH1A 4G6NA 3CXWA 3LM5A 4QMXA 3WZJA 5AV2A 4FI1A 5EM8A 4MD7E 5E8TA 3BHUA 2WXVA 3QUPA 1MRYA 3SKCA 2J50A 5J95A 2FYSA 4CGAA 1PXOA 4EOMA 5B0XA 1DM2A 3ITZA 2X8IA 1CTPE 4Q9SA 4AW2A 1FVTA 4BI2A 1OBDA 4RJ6A 4RJ4A 3MY5A 4BB4A 4LGHA 4EKLA 4FYOA 4L42A 4LYNA 1U5RA 4RIXA 2QO7A 4MEDA 3EH9A 3MI9A 3WF6A 2VWXA 4FSWA 4MXZA 4XP3A 4ZIMA 3CEKA 3QTUA 4ANNA 5IPJA 3GFEA 5IQFA 3U87A 3GCQA 3N9XA 4X2FA 4MCVA 4GKHA 4CFUA 1O6LA 1JKLA 2W1IA 3QRUA 1F5QA 4NJ3A 4DINA 5GNKA 4I0RA 4Q9ZA 1UWHA 2UUEA 4FIGA 2PVHA 4TNDA 4NUSA 4QP1A 3HNGA 3FY2A 1H26A 4D2RA 2XJ0A 4KIKA 3UNKA 4IVDA 3H9FA 4YZCA 2JDRA 3DB6A 4C7TA 1B39A 5DEYA 4AF3A 3LFDA 4EHVA 3E64A 2RFDA 4HGTA 4FTJA 1VYZA 3PWDA 1JSUA 2QONA 2I6LA 2R3NA 1KOBA 2ZYBA 4H36A 4IADA 3QD3A 3GBZA 3BBTB 3Q5IA 4IANA 4RC4A 5C8MA 4FZDB 4D1XA 3PWYA 4GMYA 3JY9A 2HWOA 3LZBA 2XM9A 3Q5ZA 5HU3A 5M56A 3PSDA 5EI6A 1NW1A 3DNEA 4RGJA 5CSHA 4J8MA 4BI0A 4UWCA 2JDTA 1GIJA 4YGAA 3DLZA 4A06A 4DLIA 3QD2B 3R8VA 2BUJA 1URCA 3HV6A 2UW3A 4YHJA 3NNUA 4AP7A 3SOCA 3GI3A 4YZBA 2XNEA 4KRCA 4QTCA 3V3VA 3VF8A 4JQ7A 3ZLSA 2PYWA 2YM6A 4NZWB 4P2KA 1FOTA 4FTQA 4Y8DA 2PVLA 2OIBA 3KK9A 4X2KA 4KAOA 5GZ8A 3AGLA 4QO9A 4Z9LA 4J52A 4CVAA 4KIQA 3FZTA 4EK5A 2IO6A 4I23A 1U59A 4IB0A 4DG3E 1SNUA 4ENXA 3A60A 2C6IA 4ACDA 2W17A 2PUIA 5HI2A 1T45A 4C2WA 2OIDA 5FTOA 1TQIA 2XP2A 2UVXA 3IO7A 4IB3A 3UODA 5CEOA 2C5XA 2R3LA 1Y91A 2DYLA 4FZ7A 1AGWA 4PTCA 1W0XC 4CD0A 2R3KA 4LGDA 4BDAA 3AC8A 3CTHA 5FQDC 2HENA 2OZOA 3TUBA 3QHWA 1UNGA 3VNTA 5A4LA 2R3GA 4E6DA 4XV3A 3V8WA 4EBWA 3T3UA 4BTKA 2Y6OA 2PZYA 4PL5A 3UNJA 3TJDA 3OVVA 5CYIA 4UEUA 3OWPA 4AG8A 3GQLA 1BKXA 3DJ7A 3DPKA 3DJ6A 3ELJA 4L3JA 2FGIA 3DB8A 1T46A 4ONAA 2JBPA 1OI9A 4BDJA 4L68A 3G6HA 4FT3A 2XNNA 3QX2A 3PJ2A 4XHKB 3IW8A 3R30A 3R6XA 5IG1A 4CQGA 1P4OA 2VU3A 3C4XA 3A2CA 2ERKA 1VEBA 3UMWA 3AT3A 5E8ZA 2VAGA 4O22A 2UZLA 4J8NA 2UZUE 2WMTA 1EH4A 3FMNA 4JLCA 4FV8A 3QQHA 3PXZA 2HXLA 3KRLA 4EJ7A 3HAVA 4JBPA 1V0OA 2ONLC 3GU7A 4UALA 2V7OA 1KOAA 1LUFA 2XKDA 3CC6A 4NIFA 4MNFA 4QP2A 4C4HA 3E5AA 1WMKA 4KBCA 3R04A 2OKRA 3S95A 1H1QA 1ZYJA 4JJRA 4O91A 4BYJA 4ZTMA 4K9YA 5EHOA 4PP7A 1ZZ2A 1W98A 2BMCA 3HDNA 4LUDA 4TYHA 4FMQA 1V1KA 4RFMA 1VYWA 3A8XA 3PJ1A 2X7FA 4YHTA 3RPYA 1ZMVA 4PDSA 4FEUA 4UWYA 2OLCA 2YWPA 5A3XA 3R8UA 3HVCA 1Y6AA 4HYIA 3VS2A 1IR3A 3Q9XA 4GSBA 5ACBC 4WNPA 3QA8A 3V5WA 5AX3A 3SGCA 3GCSA 2YEXA 3B8QA 3ORLA 2XKEA 3T9TA 3UG1A 3Q4ZA 2PVNA 5LJJA 2WD1A 1TVOA 3HV4A 5AR3A 2GS6A 4GT5A 4TYEA 4KB8A 3W1FA 4BYIA 5K4JA 2KTYA 2PULA 5IQIA 3P79A 5HQ0A 5CQWA 3LFCA 4NWMA 2F7XE 4FTKA 4HVGA 3QYZA 1XBCA 2ETRA 3VS0A 3JVSA 2X7GA 3FQSA 3TNWA 4TKSA 2VGOA 4PMSA 4WUAA 2C0OA 4AGUA 3G15A 4WNMA 1BMKA 2PU8A 5CVHA 4O7VA 3MPMA 1P2AA 2WHBA 4X3FC 5KHXA 4BCMA 4U79A 4CSVA 1UU3A 3PVGA 4JI9A 1NVSA 4UZHA 5CEQA 1REJA 3BV2A 3NUYA 1XBAA 4MD9E 4RC2A 3QTZA 2C6LA 4R3PA 5H3QA 5HE1A 4EHEA 3G2FA 4IACA 4IBMA 2JKMA 2X81A 3KN6A 3Q32A 5KZ0A 3SA0A 5IH4A 1BI8A 4EH6A 4DH3A 5M4UA 3A7FA 3NUUA 2BFYA 2J0MB 4JT3A 4C0TA 3QKLA 3S4QA 4FUYA 1FGKA 3BEGA 4FNWA 4YJOA 1QPDA 3CY2A 4MBJA 2WU7A 3ZOSA 3LE6A 2RF9A 5KCVA 4Q5HA 3OMVA 2X9FA 4YC6A 4JDKA 5CXHA 3ZHPC 3PVBA 4ANBA 1J7UA 1YW2A 4QYEA 5HE3A 2G01A 4MVFA 3ZSIA 2G9XA 1H28A 5DHJA 4BWKA 3IGGA 1QMZA 3VJNA 5IUHA 2Q0BA 3ENHA 3EKNA 4U44A 2E9VA 5FXQA 3ERKA 2HOGA 3TTIA 3FKLA 4XX9A 5M4IA 4JNWA 3DXPA 3PSCA 1CSNA 4C62A 2C3JA 4E4MA 3O0GA 3AGMA 2HZ4A 4MKCA 5HBEA 4ZZOA 4FEWA 3PIYA 2CJMA 1NA7A 4FK3A 4M84A 4O0VA 4U81A 4Y72A 5ANKA 4BCOA 3MVHA 1OPLA 4C59A 2R3FA 4YSMA 2VWUA 3L9LA 4E93A 4W8DA 2Z2WA 4OTIA 5C4LA 3TKIA 5AIKA 5T68A 3E92A 3VUKA 3RCDA 3IOKA 4W4XA 3AC3A 1BL7A 4I6BA 2PVJA 3FXXA 3QXOA 5TKDA 3W2PA 3PXKA 4XV9A 3N4TA 3HEGA 4XG6A 3OXTA 5CU6A 4MXCA 4AA5A 4G17A 2B52A 2VNYA 5BVKA 3Q9WA 4AOJA 2JGZA 5CS6A 2HW7A 4IIRA 2Y4IB 5IISA 2R3JA 4ZTQA 4K6ZA 3F3WA 3L1SA 3Q4UA 1W83A 2J0JA 3R0TA 4O2PA 4QMZA 2ZV9A 5AP1A 4IAFA 3ODZX 3ZO4A 3SG9A 3NMUF 5AR8A 4O0UA 4BBFA 3DOGA 3NNXA 5DT3A 3D9VA 5EKOA 3FMEA 3LMGA 3C1XA 4FOCA 4EONA 4MF1A 4EUTA 5CAOA 5HCZA 4FKGA 3RWQA 4BWXA 5KHWA 5EFQA 4IMYA 4KIOA 3UQCA 1OZ1A 2EVAA 1JKSA 2GNIA 3E88A 3DBQA 2YIQA 3LXNA 4IM0A 4RVLA 3KKVA 4YC3A 3R8LA 3BHYA 5DIAA 2QR7A 3GU8A 3KY2A 1M2RA 4QQCA 3D4QA 4MBLA 1Q4LA 1DAYA 4FV6A 4GRBA 4ID7A 4K8AA 5CSPA 2JIUA 2P2HA 4XRLA 4AA0A 2PK9A 3I4BA 1PKDA 4FKJA 4CV9A 4LGGA 3KRRA 5KX8A 1ZAOA 2UW6A 3WF9A 3QUDA 2X4ZA 4FEXA 1FBNA 2PVYA 2XK7A 1YXXA 2WTDA 3OCGA 4FUXA 1OIYA 1OL6A 1JSVA 2W06A 4YTHA 4W4YA 3VO3A 4EWQA 4F4PA 2HIWA 4A9UA 3CE3A 3F7WA 1JAMA 3H0YA 3AMYA 5E4HA 1RDQE 4TPTA 1MQ4A 3QWKA 5JRQA 2CNVA 3R83A 5BUEA 4HVIA 3Q6UA 4AU8A 5L2WA 2CLXA 4I4FA 1KUTA 4K18A 1WCCA 4EH4A 5CF8A 4NH1A 5EQYA 3BYSA 1SVHA 2A1AB 3TM0A 3NYVA 2ETKA 5M55A 4DBNA 2W1DA 3DU8A 5DVRA 4D5KA 2Y4PA 3FMHA 2OK1A 4D9TA 3UE4A 1STCE 2VWVA 2F7EE 4USDA 3ZFMA 4EOSA 5IH5A 1TQMA 3EFLA 3DTWA 3O8TA 4CFWA 3W2RA 2AUHA 5IDNA 2B9JA 2WO6A 3FZSA 4KS8A 4PX6A 5CEKA 4FKLA 2H34A 3QQLA 4BCPA 1XH9A 4G9RA 4XMOA 4L6QA 1UV5A 4F7LA 4YMJA 3IK3A 1LEZA 3LCDA 4FTOA 3D5UA 3WF5A 1W7HA 3K54A 4BDGA 4EH3A 3NPCA 3GGFA 1SZMA 2C5NA 2XF0A 1P4FA 5HICA 3R22A 4A4OA 3ZM9A 4O0RA 1UNHA 2B53A 5DR6A 3VBXA 3ZU7A 4CMTA 2J4ZA 4G2FA 2ZMCA 1LR4A 2HZIA 4M3QA 4AW0A 4RLKA 5HBHA 2X8EA 3Q60A 4M13A 1ZOGA 4DAWA 4KIPA 3U6JA 2JITA 5HEZA 3RHXA 4DEHA 4OBOA 2JC6A 3KU2A 4E4LA 2OICA 5ANEA 2XEYA 3OTUA 4GFOA 5CU0A 3E93A 4ASZA 4ZTSA 5AAEA 4UYAA 3TNPC 4JX7A 3EL8A 4YBKA 2DS1A 3F5UA 3CR0A 4HGEA 3NSZA 1Q8UA 4LMUA 3T3VA 1HOWA 1YXUA 2ITTA 4MH7A 4PF4A 5A6OA 3DY7A 5I3RA 3ZUVA 2ZB0A 1FGIA 5HO6A 4BCJA 4DEIA 3OHTA 4D4SA 2WEIA 5E8WA 3FV8A 4R1YA 4APPA 4IWPA 2BR1A 2VX3A 4D2SA 5EW3A 4AACA 1P5EA 3G9NA 3ZFXA 4RZVA 5T6KA 3R7OA 4TL0A 2QG5A 4GH2A 2QOKA 2C3LA 1Q3WA 5KE0A 1DI8A 2X2MA 3OW3A 2C6EA 4FTUA 5B2KA 4PV0A 1ZYDA 4KBKA 4ANMA 2UV2A 4W8EA 3QF9A 1Q24A 5BX0A 3Q4TA 2QG7A 1PF8A 1WBWA 4LM5A 4RJ3A 1H07A 3QQGA 3ENMA 3AT2A 3QFVA 3EB0A 4DLJA 1PXJA 5IH6A 3MTLA 1GZ8A 3MN3A 4GG7A 4D9UA 4DGMA 2OU7A 4IDTA 4U9AA 3A8WA 3HRBA 3RNYA 3Q9ZA 1OECA 2VZ6A 3C9WA 3PA5A 5BYYA 2OGVA 4ZSGA 2Z60A 3O71A 2O2UA 4KKHA 3UO4A 4QP7A 3ZO3A 3PXRA 3IOPA 5HVYA 4OAVB 2CGVA 3AG9A 2VWYA 4G6LA 3M1SA 4FSNA 4L8MA 1YXSA 2J0IA 2YCSA 1XKKA 4UBAA 5CTPA 1WBOA 3CD8A 5HX8A 5EYDA 4J95A 3T9IA 1PMNA 2R3RA 5BVEA 3U4WA 4QPAA 5IA5A 4I0TA 4DTAA 5HE2A 4I41A 4I94A 4TZRA 3K2LA 4O0YA 3VS5A 2R5TA 4G3FA 3FMLA 3LJ1A 5LXMA 4CFVA 1SVGA 2BALA 3TKHA 5B7VA 4IWOA 3R01A 3RTPA 4OTPA 4DFBA 2HXQA 4JDIA 3KREA 4N4SA 4JX3A 2ITPA 2A4LA 3A4PA 5K5XA 2X2KA 3R2BA 1SYKA 2YIXA 4FZAB 4GCJA 1ZYSA 4AAAA 5IF1A 3PY3A 3QU0A 4QMMA 2W1HA 3UQGA 3DGKA 2JDOA 5AP4A 2X7OA 4I24A 4LRJA 3DFAA 1ZY5A 4L45A 3CD3A 4YR8A 2WMQA 4WA9A 3HLLA 4D1SA 5JFWA 3MW1A 3ZO2A 3P08A 2OFUA 3BKBA 4QTDA 2ZV2A 1GIIA 2P33A 2QOLA 2OXYA 1K9AA 4ITIA 2VRXA 3UPXA 1PMUA 3L8VA 1GJOA 5LVMA 3NDMA 3RAKA 4F09A 5CVFA 3R7IA 4CMOA 4AGDA 1PYXA 2GNFA 5D41A 5AP3A 2R7IA 2ZDTA 3L9PA 3E63A 3CLYA 4C4JA 5ACKA 1JSTA 3F7ZA 3IW6A 3PA3A 4IEBA 4IFCA 2WTVA 1Y8GA 2OIQA 4U41A 2WMUA 4PPBA 5CNOA 4L67A 3PRIA 4WO5A 5I0BA 4L7SA 3EN5A 3GP0A 3NVKI 3LCKA 1J1CA 3PRFA 2C3IB 4BR3A 5E91A 2W9FB 3FHRA 2VTNA 3E3BX 3BEAA 2GNLA 3W10A 4DG0E 2O5KA 5AA9A 2RFEA 3N4UA 5DGZA 4F7JA 4U97A 1OPJA 3EFJA 1PXKA 4G3EA 3GC9A 4XG3A 2QHMA 3R73A 3WIGA 3I6WA 5GZ9A 4YJTA 4O0TA 2HYYA 2OF4A 2C6KA 3Q4CA 2QU5A 3G51A 3UBDA 5HG5A 2XIYA 3UDBA 4EJNA 1J1BA 3OXIA 2WTWA 3GB2A 3QQUA 4P4CA 4ZLOA 2V22A 1YDSE 3EN4A 3MB7A 1O6YA 1UWJA 3UC3A 1CKIA 4BY9E 4Y85A 2W05A 3E3PA 2C6TA 2BTSA 5AV3A 2IW6A 2XIKA 2YDKA 4FX3A 2IWIA 2WZJA 3EN6A 5KUPA 3E8EA 3CGOA 3I1AA 4CG8A 2V5QA 4ASDA 5KBQA 2C47A 3WE4A 2VO7A 4JBVA 1BLXA 1ZMWA 3EOCA 1OL7A 4WUNA 4OT6A 5E9EA 1QPJA 5M44A 2PE0A 3LLAA 4UB7A 4F6UA 3O8PA 5L4QA 1YWNA 5BMSA 2VWIA 2WMXA 4QP4A 5AUVA 2YA9A 3H0ZA 4X3FB 3LM0A 3R7UA 1NVQA 2QKRA 2VTQA 3ROYA 4TXCA 2WMVA 2PMIA 4RZWA 1WBNA 4DH5A 3UOJA 4Y5QA 1CM8A 4XV2A 2JKOA 3QTRA 1Q3DA 3PYYA 4XV1A 3W55A 4HZRA 4RA5A 4Z7GA 1B6CB 4GKIA 3F2NA 3OOMA 3VUGA 3ZS5A 2ZJWA 4GUBA 2JKKA 3H4JA 4JDHA 4NCTC 5LVPA 5CLPA 4KS7A 4B99A 3DQWA 2EB3A 1OIQA 2R7BA 2JFMA 3PJCA 4FIJA 4UXQA 4C02A 5LWNA 4Y83A 4HGLA 3RAWA 1H08A 4FNXA 4HVHA 3NNWA 3V5TA 3OT3A 5E8UA 4IH8A 2YITA 3MY1A 3OEFX 4O1OA 3RGFA 5M53A 5CXZA 3F5PA 4DG2E 4EC8A 4BC6A 2JAVA 4YLLA 3QTIA 5GJFA 4AXAA 4F1TA 1ND4A 4IZ5A 4D4VA 3PXYA 5A4QA 2J5FA 2XBAA 2HCKA 3QL8A 2I7QA 3JY0A 3W2SA 4B6LA 1VJYA 3D14A 3R63A 4L52A 3TZ7A 2VTRA 3TWJA 3PY1A 2Y8OA 4L43A 4FKQA 4DFYA 5HNBA 3VUMA 3WIKA 3LXPA 3LFBA 4FT5A 1YXVA 5CY3A 5AAGA 4FKWA 3ZEPA 2OFVA 4FTMA 4LL5A 4Y95A 2A0CX 3KL8A 5FGKA 1I09A 4ASXA 3EKKA 3TTJA 1Q5KA 1F0QA 1ZY4A 4WNOA 3FZPA 4JG8A 2F7ZE 4O0SA 3DJ5A 3G90X 4FL3A 3M2WA 3WARA 3NUNA 4GVJA 5HTCA 5DPVA 5TOZA 4WBOA 4UYNA 3VN9A 4Z7HA 3KVWA 3QA0A 3ALNA 3RNIA 5CEPA 3R1QA 4TRLA 3CTJA 3IW5A 4QP9A 2ACXA 3HRFA 3PIZA 4WBBB 5EM5A 2XCKA 2GU8A 4O7SA 4EKKA 3FMKA 4CCBA 3OUKA 4E6AA 4X7QA 3IW4A 4XOYA 3OCBA 2DUVA 4DEAA 3F61A 4J53A 2HZ0A 4F08A 1ZXEA 5BUJA 3EQDA 3QHRA 5FRIA 3DZOA 5JMSA 3NAXA 3COKA 2YM8A 3OWLA 3MTFA 3MFTA 2QURA 4W4VA 3GU4A 4M97A 5LMKC 2XIZA 3OC1A 3LHJA 2JLDA 3KCKA 4CZUA 1YI4A 3UIXA 4L53A 4TWNA 4I5MA 5G1XA 4F63A 4F7NA 4OTGA 5EYMA 3UVRA 5JH6A 5M08A 5M09A 3AOXA 3TNQB 4PNIA 4QOXA 4ZTHA 3BZ3A 1AD5A 5E92A 5BVDA 4BICA 3R7VA 5AR4A 3IQ7A 4PMPA 4IJPA 3DKOA 1WZYA 1JPAA 5J7HA 2W4OA 4FKVA 3OCSA 3R1NA 4YLKA 2O64A 2R3OA 4ENYA 5A6NA 4UMUA 4FVQA 3MH0A 5FG8A 4AOTA 1M2QA 4OTRA 4FK6A 2RIOA 2WELA 3OFMA 4G5PA 3EMGA 4L44A 4DBXA 4JR3A 3LFQA 4QMVA 5FTQA 3FEGA 2RL5A 3FLWA 5CT7A 3R9HA 4MQ2A 4ANQA 1ZWSA 4IX6A 4AZWA 2VNWA 4B8LA 3KVXA 3HUCA 2YWVA 4XBUA 5I9XA 1KWPA 2VN9A 2O0UA 4U8ZA 1M2PA 2R3QA 4I4EA 4RIWA 4XJ0A 4DN5A 2W1CA 3JS2A 4M68A 4A9YA 4O7YA 2XBJA 2XJ2A 4IVBA 4X6QC 5DEWA 4RQVA 3QCSA 4WSYA 5I9ZA 2DWBA 3DLSA 3L8PA 3LCOA 4U5JA 3Q96A 1ZRZA 2VTSA 4LUEA 4BN1A 4BBEA 3CPBA 2BAJA 5HBJA 4DH7A 5F1ZA 4V0GB 2E9OA 4LG4A 4Q5EA 4QYYA 2OH0E 4BHZA 5HO8A 2CCHA 4BDEA 5AA8A 3FZ1A 3GQIA 1K2PA 3H30A 1WAKA 4PMTA 4TT7A 3B2TA 4HYHA 2FSLX 5AP2A 2Z7SA 5FBNC 4ZLYA 2EWAA 1M7NA 5CENA 4S33A 1U54B 2XVDA 3AXWA 3CTQA 3R2YA 4ZSLA 5CEIA 4MK0A 4P90A 4AOIA 2NNWB 4U3YA 4MBIA 3ZC6A 1A9UA 5FXSA 3FZOA 4GU9A 3KULB 5AR5A 3PTGA 2QU6A 4YPDA 5DMZA 5HD7A 5GIOE 1R1WA 3MVMA 4JIKA 3LOKA 4QP3A 3R71A 2P3GX 4DH8A 4YPSA 5C01A 1H01A 3FLSA 2CKPA 3ODYX 4IQ6A 3ETAA 3SXSA 1WVWA 2GSFA 4BBMA 1FMOE 3TN8A 3ZDIA 3RCJA 3DTCA 5CAUA 5L8LA 1SVEA 3Q9YA 4K0YA 4O84A 1PMVA 1YDRE 3NZ0A 5DFPA 4ZS0A 2OW3A 3FXZA 3ZBFA 3R9DA 4QMPA 5GJGA 4NTTA 1S9JA 3I5ZA 2BAKA 4IAZA 4I93A 5HG7A 2NP8A 3VHEA 4B4LA 4D28A 2QODA 2WB8A 2VWBA 3LCSA 3MWUA 3QTSA 2QO2A 2BRNA 4YURA 3OUNB 2EXMA 4V0GA 2W7XA 3NUAA 2F49A 4M66A 3U6IA 1SNXA 3SQQA 4YU2A 4GW8A 5EKNA 5BNJA 5HTBA 2B1PA 5ETIA 4M7IA 4DA5A 2PZRA 3VC4A 1GZKA 3HMOA 4RIYB 4XOZA 1YOLA 4A9TA 3ZC5A 4U40A 4FTAA 2OZAB 2ITNA 3PSBA 3MDYA 2GHGA 2BKKA 4QMQA 5LMBA 4C36A 4FG9A 2B9IA 3BRBA 2YFXA 3P7BA 4FV1A 3KULA 2R3HA 4PDOA 4QQ5A 4L01A 3IDPA 4XCUA 4IWDA 2RFNA 3GU5A 2ITOA 4XG2A 3RM7A 3RPRA 3VW8A 2C4GA 4ZS4A 3FMJA 4NM5A 4QMUA 3A62A 3A99A 3QLGA 4ZP5A 2Q83A 3HMPA 3BHHA 2BRGA 3ZTXA 5C8NA 3NYNA 4DHFA 3UNZA 2CDZA 4NM0A 3S1HA 3CQEA 4GK2A 4O27B 5BYZA 4EH7A 3KXMA 4JIAA 5ETAA 3SVVA 2BRHA 3BU3A 1IAJA 4DT8A 4M69B 4DE4A 1GIHA 3W16A 4EI4A 4O7RA 5JFSA 4NFMA 4HYUA 4ZTLA 5JN2A 4Y5HA 5D1JA 4DFZE 3RALA 3OOGA 1WVYA 3O7LD 2JEDA 1RJBA 3DK7A 1OIUA 4BVUA 2BFXA 4NFNA 5DLSA 4PDYA 2J90A 5CVGA 3PG3A 4IXPA 5FP6A 3DA6A 3TV7A 4EK8A 4EOLA 4EUUA 1CDKA 4NJDA 3HMMA 1U4DA 4TYJA 1KE9A 2XIXA 3BU6A 4FTRA 3E7OA 5AM7A 3GU6A 3ORXA 2BTRA 2UZVA 4JOAA 4CT1A 2OZAA 4I20A 2QVSE 3FC1X 4Z55A 1JWHA 2AC3A 3KK8A 3PVWA 3A7GA 2PL0A 4I6HA 5AUXA 3WYXA 3P86A 3W8LA 3ZRKA 1WBSA 3PZEA 1ERKA 2FO0A 3VAPA 4KNBA 5J79A 5L2QA 2C30A 4H3BA 2PMOX 2PUUA 3QYWA 2OSCA 4AS0A 5DI1A 4AFEA 2X0GA 5FBOA 4B8MA 4ZSAA 4GS6A 5KMLA 4FBXA 3KXNA 4RWJA 5AV0A 1U46A 3NCGA 5AIRA 4AW1A 1H24A 4MWIA 3DK6A 2WAJA 3AC4A 3ZUUA 2BRBA 4QYHA 5DN3A 4AN3A 4BI1A 4E6QA 5CAPA 1XWSA 3D94A 4JBOA 4F9BA 5HORA 2IJMA 3NIZA 2W1GA 5HTIA 3C5UA 5FEDA 4I3ZA 3U9CA 4NW6A 3DFCB 4KSQA 4Y46A 3DKCA 4DT9A 4AN2A 4FE2A 3DQXA 2J9MA 2QC6A 4DEDA 2VGPA 3IW7A 4MX9A 1LPUA 2EUFB 5EH0A 4M0ZA 4C58A 3RP9A 4CG9A 5IA3A 3KRWA 5HCXA 5AAFA 2YABA 3WYYA 3OD6X 4X0MA 3E8NA 1KE6A 3IDCA 5D12A 2X39A 2QOOA 4CEGA 3EIDA 4NSTA 2OWBA 3UOHA 2V55A 2Z7RA 3VS1A 1KV1A 4AUAA 2PE2A 4FT7A 4BWPA 3V5JA 3OF0A 5JZJA 2GQSA 3NW5A 3CSVA 4HYSA 2UW5A 5J1VA 2PVRA 2PWLA 4L46A 5HOAA 4Z3VA 3S0OA 3TIYA 4CLJA 3F88A 4WT6A 3TJCA 4BFMA 5B2MA 1FQ1B 4A7CA 5KO1A 2H96A 2ZOQA 1W84A 1ZMUA 2HY0A 4G5JA 5J1WA 3HX4A 3ID6C 3AC1A 3GENA 5EYCA 4W4WA 3C4FA 4AFJA 3D5VA 1JOWB 3QTXA 1K3AA 4E3CA 4DFNA 4FTTA 2A19B 2BVAA 4LV8A 3WZDA 1DI9A 2VTIA 1Q8WA 4IE9A 3VUHA 3CPCA 2Z02A 3DCVA 2PMNX 5DOSA 3COHA 4FV5A 4CKRA 2YM3A 1PMEA 4FIIA 4FVRA 2ZAZA 4YLJA 5AP0A 2BAQA 3VUTA 4USFA 2CNUA 2BPMA 3QZFA 4HCTA 5HLPA 3PJ8A 4BCQA 3EQIA 4FG8A 3KXXA 4DGLC 4PMMA 1XHAA 4CKIA 2ZM1A 2J51A 4XP0A 1RE8A 4NEUA 3WI6A 4X21A 3BLQA 4U3ZA 2X4FA 4CZYB 4WSQA 4DF3A 5M51A 3BIZA 4RWKA 3RHKA 4ALUA 4F7SA 2GPHA 5KKRC 2C1AA 4AE6A 3R8PA 4I6FA 4TWCA 4E4NA 4N6ZA 2P4IA 3DAKA 4FICA 4C4GA 1XH5A 2UZEA 3QKKA 4AW5A 3ZZEA 3S00A 3KA0A 4M12A 2OJJA 2UZDA 4RX5A 5IUIA 3ZUTA 2XZSA 4NTSA 4S34A 2YACA 3CCNA 4FYNA 5H9BA 3OWKA 4ANOA 3DV3A 5K3YA 5C4KA 2UW9A 5KMKA 4GYGA 2ITWA 3FHIA 5M07A 3PP0A 3UP2A 3ZRMA 3QC4A 4EK6A 3O8UA 1GNGA 3COIA 1QPEA 1W82A 2PZ5A 4EOKA 4QMSA 3EQRA 4EH2A 4AGWA 2JAMA 2PE1A 2ZM4A 4BDIA 1MP8A 5JQ8A 5JGAA 3NCZA 4EQUA 3F2RA 1YVJA 5AMNA 3SLSA 3LXLA 1BYGA 3NUSA 4GV1A 2ERZE 5JFXA 2YCQA 3QLFA 4HPTE 3EZRA 4HW7A 5ETCA 4O83A 1HCKA 5D7AA 2BIKB 3MYGA 4X2JA 3I60A 2JFLA 2YHVA 4MYGA 3ULIA 2FB8A 3KFAA 4LOPA 4HJOA 3VBTA 5CU4A 4ITHA 4BCFA 1Z9XA 4U0IA 3R02A 5HIBA 3WOWA 3FC2A 5I4NA 3P78A 5FM2A 2PMLX 4ZEGA 3KQ7A 4YP8A 2IZUA 2C68A 1UKHA 2WMRA 3AC5A 3HV5A 1G3NA 1U5QA 3HV3A 2JDVA 1Y57A 2XK3A 3LJ0A 1OKYA 4UMTA 3HDMA 3IDBA 3WE8A 3G6GA 3O50A 3L9NA 1OGUA 4ACGA 4BF2A 5GZAA 5I9YA 2CGUA 5JEBA 1A48A 3BLRA 1H4LA 3DBCA 3GFWA 4FKSA 2CPKE 5CSWA 1ZOEA 4IVCA 2GHMA 4MF0A 4EYMA 3FI8A 4R7BA 3EQBA 4YJPA 1UU8A 3P9JA 4XLVA 2WQMA 3TZMA 4MXAA 3ZRLA 4EZ5A 5L6PA 4RJ5A 3NUPA 4YO4A 2X6EA 3LAUA 1YHVA 3F9NA 4CXAA 3I79A 2PSQA 4K77A 1WBPA 1B38A 1H25A 2QQ7A 3OTVA 4AE9A 5JK3A 4J97A 3VBWA 3ZLWA 5E7RA 3O23A 4I5HA 3VBVA 5L2SA 4CCUA 1CKJA 1M52A 2FSMX 3OEZA 4YJUA 3KF4A 5FDXA 5LVNA 5ANOA 2C69A 3NW6A 2CN5A 4GVAA 4KWPA 2CMWA 4TY1A 1G8AA 4BIBA 4NYEA 3JPVA 5BUIA 5IA1A 4C3RA 4YC8A 4FEQA 3UJGA 2WMSA 4BCNA 2ITUA 2ESMA 2W1EA 3MFRA 3MIAA 2H9VA 1Y8YA 4H3QA 4D2TA 1R3CA 4LOOA 4DEBA 2GNGA 3QD0A 4R3RA 4ZMFA 2HW6A 3V5QA 3QQKA 2PVKA 3FYJX 5LARA 3DAJA 4OBPA 1OL2A 3NS9A 2OXDA 3O96A 3OY1A 4YZNA 4E5BA 2XNMA 3QWJA 4V01A 5FTGA 1WVXA 2XA4A 1UA2A 4OLIA 4CZTA 2UZNA 4X2GA 5FD2A 2PHKA 3QZGA 4BTFA 2WIPA 4IC8A 2W4JA 3REPA 4FIEA 4AGCA 3QAME 3POZA 3RZBA 4X2NA 2XIRA 4PRJA 3QRTA 3U51A 4JRNA 4YJVA 4QQJA 2WTKC 2CSNA 4LFIA 3BV3A 4LOQA 4RJ7A 1PXPA 4ACCA 1XJDA 1CMKE 3C50A 1H00A 2VO0A 2UZOA 1YQJA 5CQUA 3O7LB 5EI2A 3G9LX 1FVRA 4OT5A 1Q97A 4DEGA 4W9XA 4IAIA 1NT2A 4EOPA 5C9CA 3IS5A 4QPSA 3MGYA 4ZK5A 4RIOA 1PXIA 2XS0A 4D0XA 4E20A 5I5ZA 4DCAA 3V04A 3PJ3A 1S9IA 1OL1A 1QCFA 2XYNA 2Z7LA 4F1MA 5TR6A 4JG6A 3EQFA 2FH9A 4ZY4A 3G5DA 3VQHA 3QCXA 4MQ1A 4R8QA 3EYHA 1LP4A 4FNZA 1JBPE 5G6VA 4ACMA 2ZDUA 2Y6MA 3ZXTA 4YBJA 5HIEA 2PUPA 4TWPA 4PPCA 2NPQA 3R21A 3TIZA 4OGRA 3EN9A 5K4IA 3F6XA 4EOIA 5ANIA 5HU9A 2P2IA 1Y6BA 2YJSA 4WD5A 3TL8A 2W99B 3R8ZA 4JXFA 4ZMEA 2EU9A 3VRYA 1YWRA 2BIYA 2WPAA 4RPVA 2Y0AA 4PDPA 5J87A 2BDJA 5J5SA 2QOQA 3BLHA 4O7LA 1PY5A 3PPZA 3DKGA 1Q99A 4YTFA 3LLTA 5FWKK 5HVKA 4QTBA 4CFXA 4JL9A 4OBQA 3ANQA 4IZYA 3W33A 2VTLA 5DNRA 3UVQA 3W2CA 2V62A 2VO6A 5HZNA 3O51A 3NW7A 5DWRA 3SRVB 5J8IA 1QPCA 3BWJA 1E1VA 4RJ8A 1JKKA 3LFAA 2R4BA 3BU5A 2BZHB 4J98A 3SHEA 2DQ7X 1XO2B 2YIRA 2ZMDA 3GC0A 3FQHA 2WOUA 3HMIA 1BI7A 2R2PA 3R1YA 2RG6A 3ZFYA 5HCYA 3P0MA 4RQKA 3A7IA 1TQPA 3IG7A 3ACKA 3MH3A 3U4UA 5L6OA 1JKTA 3ZSHA 5TO8A 3PDTA 3LXKA 4YJQA 3ZO1A 2B0QA 3Q52A 5A46A 3SAYA 3FLYA 2HAKA 3MA6A 3ROCA 4FSRA 5A4TA 5JFVA 3JXWA 4CKJA 1VZOA 3FPQA 5IZFA 4ERWA 5C1QB 3V01A 3K5UA 5IUGA 4OUCA 4XNEA 4O1PA 4XLIA 3ATTA 3BYUA 3V5LA 3PXQA 4FSUA 3DDQA 3I0QA 4GUEA 2WTIA 4XH6A 3R7GA 2AYPA 2QCSA 2RGPA 3CP9A 3NYOA 4UY9A 5CALA 2F2UA 2WFYA 3EL7A 3HP2A 5IA0A 4O6EA 3D83A 3FQEA 4CRLA 4G9CA 4E5WA 3OP5A 2WOTA 4M14A 2ZV8A 4C34A 5FP5A 4ZY5A 2GCDA 4C33A 3MA3A 3G0EA 1OUYA 3KEXA 5F95A 4R7HA 5HGIA 3OZ6A 4D1ZA 1IG1A 4I5PA 3UTOA 5A14A 3D7ZA 1IRKA 4II5A 4G31A 4Z16A 2XNOA 1MRVA 2GTNA 2ITXA 2IVVA 3OY3A 4AZSA 2WTCA 4D2PA 4FSMA 5F9EA 2YZLA 3U6HA 4DGGA 4CNHA 3EQGA 4ITJA 4IC7A 4C4EA 4CT2A 2CNQA 3V6SA 4JR7A 5A54A 5C03A 4NK9A 4O86A 3D5WA 1YWVA 3PUPA 5IEYA 3KRJA 3QCYA 4USEA 5DYJA 3ORMA 2R0IA 4ORKA 4UWBA 4QQTA 3FYKX 3HRCA 5CI7A 2H6DA 4PTEA 2OF2A 3EN7A 5K5NA 2ONLA 3QD4A 3POOA 2GFCA 3ATSA 1UU9A 1I44A 2WKMA 5CWZA 3VIDA 3Q04A 5AUTA 3AD4A 4FSQA 4QMOA 4R77A 3PFQA 4AZFA 3RKBA 4UMRA 2WNTA 5BMMA 2X6DA 4RA4A 5JSMA 5HESA 3R28A 4IFGA 4ZJIA 3P4KA 4TWOA 3VS3A 3OW4A 4BKYA 4F0FA 4N6YA 2PY3A 5KMJA 5AP6A 2HK5A 1P14A 2VD5A 4E5AX 1MRUA 4ACHA 3QX4A 4EL9A 5I9UA 4G3DA 3MJ1A 4X3JA 3ALOA 3M11A 4K2RA 2IN6A 2R3PA 5EHYA 3MB6A 4B9DA 3I7CA 4UN0C 3D2IA 3JVRA 5DRBA 2UW7A 2F57A 4FV4A 2FSTX 5E1SA 4O7ZA 3WZKA 1WFCA 1R0PA 5F4NA 3SG8A 3RK9A 3NRMA 4ANSA 4EH5A 4CFMA 3HP5A 4BCGA 2FVDA 3GNIB 4IDVA 4EYJA 5AM6A 2V7AA 2VTJA 1Q8ZA 3W2QA 4GT3A 1ZOHA 3UYTA 5AUYA 3FBVA 2R3IA 5C26A 3H9RA 5LOHA 4J7BA 4HVDA 4FSZA 4GL9A 3ZXZA 1FPUA 2J7TA 3C4CA 4LMNA 3PP1A 4UV0A 2BILB 4X3FA 4EEVA 2PPQA 2QOIA 2B4SB 4FKIA 3BPRA 5JKGA 3RK7A 4F6WA 1R0EA 4QP8A 3OG7A 3K3JA 4HCVA 4I6QA 4E4XA 1GZNA 3ANRA 4RIXB 4XG9A 4EOJA 3Q2JA 3B8RA 5CNNA 3S3IA 3O2MA 3L8SA 3PVUA 4KD1A 3PXFA 3E7VA 3ORPA 3FZRA 3FWQA 1ATPE 3IECA 3VUDA 4IX5A 4D4YA 2UZWE 4DGNA 2ITYA 3L8XA 4G6OA 4YZMA 2JDSA 4KIKB 2OI4X 2XM8A 4S32A 4JAJA 3AMBA 4M0YA 3KGAA 4XG4A 5AUWA 4H58A 4RSSA 4IB5A 3C51A 4IW0A 1VR2A 3VUIA 4O0XA 3TZ9A 2VTPA 2W5BA 5AEPA 4OTDA 1Q61A 4FIFA 3NX8A 4FVPA 3S2PA 4PP9A 5KKRB 4CYIA 4YSJA 1LEWA 2ZB1A 4FKOA 3LKMA 4S30A 4TNBA 3ORZA 4J99A 4DFLA 4CTCA 3FI2A 4FKPA 3BI6A 3A4OX 3TT0A 1OKVA 3FI4A 4WHZA 3AD6A 3DK3A 5EDQA 2H8HA 3RAIA 3UQFA 3IGOA 1OPKA 3EQPA 2OJ9A 3KMWA 3TEIA 3K5VA 3ACJA 3UC4A 4U80A 3MV5A 4C37A 1PXMA 4O2ZA 3DXNA 4XBRA 4TN6A 5IQBA 3TDVA 2A27A 4PUZA 4F64A 2C3KA 3R9NA 1IASA 4HPUE 4BGGA 2Y7JA 2BDWA 3SW7A 4JBQA 3ZMMA 2C6MA 1PYEA 4O7NA 5AADA 3A7JA 4F1OA 2E9NA 3FSKA 2QHNA 4J71A 4J1RA 3NYXA 4LRMA 1Q62A 5BVFA 3GUBA 1H0VA 3QXPA 4V05A 4S2ZA 4D55A 5M06A 3WZEA 3CY3A 3TXOA 5BYLA 2QOHA 3MIYA 2FA2A 4FA2A 4UMPA 3K3IA 4CV8A 5IEXA 5AFVA 5L8KA 4U43A 3R7EA 2RFSA 3VS7A 3BBWA 2SRCA 1A06A 4R5YA 4A9SA 4ASEA 5H8EA 2CGWA 3KXZA 2C0TA 4AQCA 4QTAA 3D15A
chains in the Genus database with same CATH superfamily
4LI5A 1NY3A 2W1FA 4C61A 2XK8A 5E8VA 2BZKB 3Q6WA 1YI3A 3EFWA 4QNYA 5EDPA 3RVGA 2J5EA 1ZYCA 1APME 2CN8A 4NT4A 5DA3A 5J9LA 4XS2A 4FTCA 2G15A 3QTWA 3A7HA 3SXFA 2O65A 2ZFYA 5IU2A 3C13A 1XH4A 3NUXA 4RX8A 2HZNA 3AKLA 3UPZA 2QOFA 5AX9A 1OITA 4C3PA 4H3PA 5BVNA 3LFNA 4EK3A 5CZIA 3V8TA 3V5PA 5ANDA 3QZIA 2QLUA 4GJ3A 4MXYA 3QRIA 3EFKA 2GNJA 4R6VA 4XYFA 3LW0A 4QYGA 4IAYA 3BQCA 5H8BA 2HELA 3F3ZA 3GC7A 3TUCA 5KMNA 2W96B 3UZTA 4NIFB 5HLNA 5JGDA 4FV2A 3UO5A 2W5HA 4MXOA 3U55A 4CFNA 4YJSA 3FUPA 4MHAA 3I5NA 4N70A 4O4CA 3F82A 4KBAA 5TT7A 4U6RA 1QL6A 2UVYA 2IZSA 3CS9A 3JUHA 4TYHB 4GYIA 1H0WA 4ZSEA 4QRCA 1O9UA 3E87A 4QT1A 2G2IA 1M7QA 3HKOA 3DBDA 2YJRA 4FTLA 2PZPA 3VBYA 1ST4A 4O7TA 5CSXA 5J7BA 3RK5A 2VTOA 3CGFA 4QNAA 4XG8A 3M42A 3FJQE 4TW9A 5M57A 3N4VA 2WMWA 3MBLA 4CMUA 5IQDA 1WBTA 5EW8A 4APCA 5J5TA 1U54A 2I0VA 2LGCA 5CU2A 2YM5A 4RBLA 5EOBA 4PQNA 3E8DA 3UMXA 1E1XA 1MUOA 5CF5A 3HA8A 5EM6A 3WBLA 4BL1A 4QMNA 4CQEA 1IA8A 3V51A 2XK4A 5LCJA 4FRFA 5EQEA 3SX9A 4CLIA 4BIDA 3R00A 5HVJA 4D2WA 5EW9A 5HIDA 2PVFA 2WTKB 2IZTA 3MH1A 5AUZA 5FEQA 3G33A 2BZJA 4JG7A 2W0JA 2GHLA 2BRMA 3KCFA 5B2LA 4ZLZA 4BKJA 2YLFA 3PG1A 3W0PA 5BVOA 3QALE 4I92A 4IZ7A 1PW2A 5TF9A 2ZVAA 4W9WA 5KNJA 4K1BA 4FT9A 3SW4A 3VJOA 4E1ZA 1PXLA 3CBLA 4LRKA 5HO7A 3MFSA 3P7AA 5DR2A 3ZCLA 1XH8A 5HHWA 5JRSA 3QRKA 3NLBA 2PVMA 2XEZA 1H1PA 2IPXA 3LFEA 4BTJA 2QI8A 3AQVA 4J96A 5DRDA 3VWAA 5KMOA 2CKEA 4O7WA 4XRJA 1Q8TA 4BDBA 2Q0NA 4E8AA 2REIA 4ZSJA 2XMYA 1Z5MA 3PE2A 3SV0A 3D2KA 4P5QA 3THBA 2YAAA 3LCTA 3TZ8A 5HX6A 3D0EA 5CT0A 4FGRA 1KSWA 3IPHA 1V0BA 4RLLA 2O3PA 4RIYA 4WRSA 4XG7A 1OMWA 3EZVA 5K0KA 5L3AA 4ZZMA 4F65A 2J6MA 3TACA 4U7ZA 3UDZA 2YLEA 2VTTA 4KINA 2XRWA 3PIXA 5F94A 4MTAA 3EYGA 3NR9A 4IB1A 4ZTNA 4A07A 3BE9A 4IZAA 1Q41A 4C2VA 3GCPA 2B7AA 2UW0A 4G3GA 1SMHA 3FMDA 4MAOA 4V04A 4FSTA 4AA4A 2ETMA 3VONA 3NWWA 5K0XA 5D10A 3R1SA 3TV6A 4JQEA 5GHVA 1IAHA 3ZONA 5CASA 2YIYA 4D2VA 3H3CA 3U54A 5AP5A 3SDJA 3FAAA 1JLUE 1NVRA 2YIWA 3HMNA 2OJIA 4BDCA 4FKUA 3DAEA 3FLQA 4RG0A 3RI1A 3FKOA 3HYHA 4ZJJA 3NEWA 5H2UA 1RW8A 3DT1A 4QP6A 4EC9A 4M69A 4DYMA 4EOOA 5BVWA 4L3PA 4AZEA 4KKEA 4IVAA 2IZRA 1H8FA 2QOBA 4G16A 1E9HA 1XBBA 2HY81 4NM7A 4I5CA 3DS6A 4O6LA 4R5SA 4B7TA 4L7FA 4R1VA 3NAYA 1OKWA 1UNLA 4IAKA 3W2OA 3CJFA 3BL7A 2BKZA 2IVTA 2NO3A 4H39A 3VRZA 4WOVA 3C5IA 1AQ1A 3HECA 2B55A 5FLFA 1TKIA 3OCTA 4FEVA 4A4XA 1NXKA 4F9CA 4K33A 4FGBA 2WQBA 3ORTA 3KMUA 5E8YA 3KMMA 2WEVA 2AC5A 4E7WA 3RPSA 1XR1A 2W4KA 5IA4A 1OBGA 2QKWB 3E8CA 3FDNA 3MY0A 2VO3A 3PPJA 4L00A 3B2WA 3LIJA 1YHSA 3LQ8A 3KB7A 1XQZA 4QMTA 1R39A 1YOMA 2VX0A 3FPMA 4LV5A 1YI6A 4HVSA 3ZM4A 5D7VA 3FL4A 2YDIA 4UZDA 3D5XA 3VVHA 4H05A 1X8BA 4FTIA 3VULA 2C6OA 4WG5A 4WRGA 3ZDUA 4BZNA 4E6CA 2AEGA 3FL5A 2W9ZB 4OTQA 3F2AA 5IQCA 1OB3A 5I9VA 2ITVA 2NRYA 1G8SA 2I0YA 1L3RE 4YUQA 3UIMA 4EQCA 4FKRA 1H1SA 4LV7A 5LWMA 2QO9A 4GK4A 4ZZNA 4D5HA 3II5A 4AX8A 3IONA 4HNIA 4BDFA 4ZAUA 3SXRA 4F9WA 2G1TA 3KF7A 1ZARA 5KBRA 4IJ9A 3VS6A 3PA4A 1OVEA 3MPTA 1CKPA 3RMFA 3RZFA 2YM7A 4AZVA 2VWWA 3C4EA 3BGPA 3P5JC 1YDTE 4HZSA 1J7LA 2I0HA 3O5AA 2X8DA 4CYJA 1Q8YA 5AWMA 4IM2A 4GFGA 4QTEA 3OT8A 3GCUA 3C7QA 2FUMA 2QD9A 3QZHA 4MXXA 2R0UA 4EHZA 5L8JA 1ZZLA 3NIEA 3V6RA 3ZLXA 3BQRA 3DZQA 4RC3A 2GQGA 3KN5A 3RAHA 3RWPA 3EQHA 2G2FA 3VQUA 1FVVA 3VHKA 2VWZA 2IW8A 5I3OA 3P5KA 3JYAA 5IKWA 2V0DA 4UMQA 5CEMA 2R64A 1KE7A 2GFSA 2JIIA 4QYFA 3TG1A 3VBQA 5JQ5A 4KRDA 1OM1A 2YERA 3F5XA 5AV4A 2X2LA 2ZV7A 3UP7A 2VTHA 4C4FA 3BHTA 3FLNC 4ALWA 4RX9A 1OIRA 1URWA 5ANGA 4FV0A 3DBEA 3KRXA 3RINA 2BHEA 2F4JA 5EYKA 5EM7A 4MWHA 3VW6A 1GOLA 4BCIA 4EH8A 3JR1A 4AT3A 3LJ2A 5CF6A 3W0QA 4N57A 3HAMA 4NW5A 2XRUA 2OBJA 5CU3A 4GIHA 3EQCA 3NGAA 4FSYA 4GFMA 4R7IA 3C4WA 5EK7A 4C35A 2I0EA 3HL7A 4N0SA 5AV1A 2XYUA 4ZOGA 3U9NA 5DT4A 2P0CA 3IKAA 3R9RA 4DITA 5CZHA 4DGOA 2Z7QA 2EXEA 4FIHA 5AR2A 2I40A 2WQOA 4NCTA 4BKZA 4IAAA 4O96A 4TYGA 1UKIA 5FM3A 4KKGA 4OR5A 4YTCA 3VS4A 1XMMA 2C5VA 5FUTA 5ITAA 1GZOA 1OGYA 3LMIA 1UU7A 4DCEA 2W5AA 3PY0A 3AD5A 4O38A 3UGCA 3QQJA 3R8MA 2NRUA 3OBJA 2QR8A 4FV9A 5LVLA 3ZBXA 4A4LA 4ALVA 5BPYA 3QQFA 2C1BA 4ZJVA 3CIKA 2IVSA 3LPBA 2CLQA 4M8TA 2J2IB 2PZIA 4H1MA 4WNKA 5IEVA 4O81A 3SC1A 2E9UA 2J0LA 3FKNA 1KV2A 4LL0A 4ARKA 1KE8A 4XEYA 4DTBA 2XK9A 1YRPA 4GJ2A 2C0IA 4K11A 5CANA 4WG4A 5FXRA 5A4CA 3BL9A 5HKMA 4UXLA 1DAWA 3W18A 4O0WA 5A9UA 4JRVA 4QDVA 3OWJA 2BHHA 3GT8A 2VUWA 3CQWA 3TNHA 3TUDA 2XK6A 3OBGA 5DT0A 1ZYLA 3P7CA 5EDRA 3VF9A 4AQKA 1PHKA 2VTAA 3C0IA 4P5ZA 1M17A 3F3TA 5CF4A 3D7TB 5LMAA 3BELA 2GS2A 5TE0A 4EORA 4ERKA 2XCHA 3AMAA 4FOBA 5JT2A 2RKUA 3BYMA 1PRYA 2R3MA 4OW8A 5J9YA 3W0MA 1FMKA 3I0OA 2CCIA 3BGZA 4KABA 2YN8A 5DE2A 2CKQA 4FR4A 1FINA 3AT4A 4YZ9A 4C57A 2OXXA 3H9OA 4YHFA 1XH6A 3GCVA 4RVKA 5IQAA 5DR9A 4C3FA 5KZIA 3TDWA 4I21A 4YJRA 5HE0A 4F0GA 2C5OA 5CAVA 3AKJA 1J91A 3QKMA 3ZSGA 4BDDA 4CRSA 4ZY6A 3BYOA 4QMWA 4YZDA 3LMHA 2CHLA 3MESA 3TNIA 4TYIA 2XANA 3DBFA 2X1NA 2QLQA 5LMKA 5JGBA 3DKFA 5M4FA 5BQ0A 5AP7A 2KULA 3FI3A 5EQPA 3ZH8A 4O4FA 2IVUA 4FNYA 4WG3A 5EOLA 3UIUA 2QNJA 4IWQA 4PL3A 4EHGA 5GINE 4BCKA 1V0PA 4FODA 4JQ8A 4F6SA 3OS3A 4BDKA 4B0GA 2XNPA 1PXNA 2WIHA 4RFYA 4RRVA 2WQEA 4F9AA 5E1EA 3UOLA 4QMLA 2A2AA 3TCPA 2C6DA 3A61A 3W8QA 3FY0A 3AC2A 3G0FA 4O21A 1JVPP 5IA2A 3KIOC 2JKQA 4HNFA 4U42A 3GOKA 5EHLA 2GDOA 1REKA 2J0KA 2ZM3A 3QBNA 4AT5A 3UO6A 3SOAA 2WMAA 3D7TA 3F5GA 3UVPA 2VX1A 2BDFA 3RPOA 2XKFA 4PNKA 1J7IA 1O6KA 5DBXA 2B9HA 4WKQA 4GK3A 3MFUA 4C4IA 3UZRA 4BIEA 4FZ6A 3BX5A 3ORIA 4RX7A 5CSVA 2PUNA 2YM4A 4BCHA 2YCRA 5I9WA 4RFZA 3HGKA 2CKOA 5ETFA 5FEEA 4AAYA 1GY3A 3F3UA 4RVMA 1G5SA 4D4RA 3R7YA 3DNDA 5M4CA 3ZYAA 2WTJA 3MVJA 4OAUC 4FZFB 5DH3A 1YHWA 3PLSA 4JVGA 4GU6A 4EWHA 1GAGA 3NNVA 4KSPA 2OO8X 2O8YA 4IHPA 3I7BA 4LQMA 4D0WA 4KA3A 3NFGB 5CI6A 4CFFA 1ZLTA 2WGJA 4AWIA 3ZEWA 4U45A 1L8TA 1RQQA 4BRXA 2XJ1A 4PPAA 4R78A 4I1ZA 4HGSA 3TI1A 4RWIA 4Y73A 4OTFA 4F9YA 2JBOA 3FSFA 3R9OA 3BHVA 3BWFA 4E73A 3EWHA 2RSVA 2EB2A 3GEQA 4PTGA 1JQHA 4NL0A 4EQMA 3HUBA 1IA9A 4PWNA 3CKWA 2F2CB 4AZTA 4MD8E 4NKAA 4TTHB 4BDHA 2YDJA 3COMA 5C8KA 3OROA 4GG5A 3MPAA 2GMXA 1BX6A 1PKGA 3F3VA 3UG2A 4EZ3A 2JIVA 4IX4A 3RBWA 4EK4A 4FKTA 5ANJA 5HNIX 2XB7A 3SD0A 3UZPA 4F70A 5IQHA 2WMBA 3MJ2A 2B9FA 3WZUA 1SM2A 4OTHA 3PE1A 3LVPA 1Z57A 4MNEB 5IQGA 3QTQA 2XUUA 2C5YA 4O4EA 4M67A 3BCEA 3OXZA 2YISA 4DFXE 3CJGA 1YOJA 5JZNA 4PY1A 3UYSA 2UVZA 1HCLA 3SRVA 3WF7A 1W8CA 2PTKA 3P23A 4OTWA 3I81A 4QMYA 5AJQA 4ZTRA 4A9RA 5L2IA 2B54A 1BUHA 2GTMA 5D11A 4FJVA 2JD5A 3KC3A 4DDGA 5E8SA 2G2HA 1OUKA 4QD6A 3Q3BA 3RM6A 3TKUA 3LFSA 3Q53A 5HD4A 1WBVA 4BZDA 2UZTA 3W0RA 3LQ3A 2XNBA 3DDPA 5ICPA 3FMMA 1BL6A 1W2FA 3F69A 4FL1A 4BGQA 2OG8A 4FL2A 4D58A 4FV3A 2GQRA 4XP2A 4NKSA 1OKZA 1H1WA 2CGXA 4YO6A 5CX9A 2BCJA 4IX3A 4YNOA 2FSOX 2YZAA 4S31A 4EBVA 3HZTA 3MSSA 2Y4IC 4AT4A 5KMIA 2YAKA 3BYVA 3N51A 4G1WA 4UX9A 3U8WA 5AR7A 5EG3A 3ZZWA 5E8XA 5J9ZA 5IQEA 4X6RA 2E9PA 3PPKA 5GIPE 2BZIB 3CQUA 3MH2A 2XH5A 2UW4A 2Y9QA 4EH9A 2QOCA 4F0IA 3CKXA 2ITQA 3HV7A 3Q2MA 3QGYA 5GJDA 1F3MC 3MS9A 3V8SA 4Q2AA 4DC2A 4FT0A 3WILA 4NU1A 1KE5A 3GXLA 4MNEA 4BHNA 3RJCA 1M14A 3ULZA 5AUUA 3QUEA 1PJKA 2O63A 4AN9A 3F66A 4FC0A 5HLWA 5IMEA 4DFUA 3QC9A 2RG5A 4RVTA 3C0GA 5L2TA 2EXCX 4L3LA 5HNGA 2OJGA 4FF8A 4C8BA 3DXQA 1IEPA 4JAIA 5K9IA 4YTIA 5C27A 3ZLYA 2BROA 3C4ZA 3ET7A 2E2BA 4I0SA 4RT7A 3UIBA 3LFFA 2F9GA 4G34A 4PL4A 1YXTA 3ORNA 3GC8A 5E90A 3MVLA 3H10A 5FDPA 4P7EA 3L9MA 4F99A 2VV9A 4I22A 2XNGA 2HWPA 5LCKA 2ITZA 4EZ7A 4G3CA 1MQBA 1OL5A 3BGQA 3EJ1A 4BGHA 5IMXA 2I1MA 2WU6A 3FE3A 3RPVA 4L9IA 4KUJA 3FLZA 3BE2A 2YCFA 2GS7A 3QGWA 2UW8A 4M15A 4XUFA 5L6WL 4O82A 4F78A 1DS5A 2UZBA 4IM3A 4RMZA 4R3CA 5EI8A 5H8GA 1H1RA 2VTMA 4ZXTA 3ORKA 1J3HA 5A4EA 1YKRA 4FG7A 2Z8CA 4JS8A 5CAQA 4H1JA 3FXWA 1JNKA 2OH4A 4NM3A 1R78A 4YNEA 2LAVA 4C38A 4FV7A 3KXGA 2OJFE 3KXHA 4GEOA 2GNHA 4YJNA 5D9HA 3QCQA 4GIIA 2IW9A 3WF8A 4E26A 3HA6A 4RWLA 3T8OA 4BTMA 4ANLA 1XH7A 2WQNA 1H27A 4GT4A 5DG5A 5HG8A 2IEWA 3E62A 2XKCA 4QPMA 3QRJA 5F20A 5T3QA 4BZOA 4DEEA 4DTKA 5LQFA 5KMMA 4CTBA 3O17A 2R9SA 3GOPA 3GVUA 3PLAE 3EHAA 3P1AA 4HCUA 3NVMB 2X9EA 4JDJA 2P55A 4FTNA 4HOKA 3I6UA 5IDPA 5LVOA 3C0HA 3UOKA 5HG9A 2W1ZA 3PZHA 4WIHA 2IG7A 3LQ5A 3W32A 3TV4A 4EOQA 1UVRA 4RIWB 4DH1A 4G6NA 3CXWA 2X0QA 3LM5A 4QMXA 3WZJA 5AV2A 4FI1A 5EM8A 4MD7E 5E8TA 3BHUA 2WXVA 3QUPA 1MRYA 3SKCA 2J50A 5J95A 2FYSA 3W0SA 4CGAA 1PXOA 4EOMA 5B0XA 1DM2A 2X0OA 2X8IA 1CTPE 3ITZA 4Q9SA 1FVTA 4AW2A 4BI2A 1OBDA 4RJ6A 4RJ4A 3MY5A 4BB4A 4LGHA 4EKLA 4FYOA 4L42A 4LYNA 1U5RA 4RIXA 2QO7A 4MEDA 3EH9A 3MI9A 3WF6A 2VWXA 4FSWA 4MXZA 4XP3A 4ZIMA 3CEKA 3QTUA 4ANNA 5IPJA 3GFEA 5IQFA 3U87A 3GCQA 3N9XA 4X2FA 4MCVA 4GKHA 4CFUA 1O6LA 1JKLA 2W1IA 3QRUA 1F5QA 4NJ3A 4DINA 5GNKA 4I0RA 4Q9ZA 1UWHA 2UUEA 4FIGA 2PVHA 4TNDA 4NUSA 4QP1A 5BV3A 3HNGA 3FY2A 1H26A 4D2RA 2XJ0A 4KIKA 3UNKA 4IVDA 3H9FA 4YZCA 2JDRA 3DB6A 4C7TA 1B39A 5DEYA 4AF3A 3LFDA 4EHVA 3E64A 2RFDA 4HGTA 4FTJA 1VYZA 3PWDA 1JSUA 2QONA 2I6LA 2R3NA 1KOBA 2ZYBA 4H36A 4IADA 3QD3A 3GBZA 3BBTB 3Q5IA 4IANA 4RC4A 5C8MA 4FZDB 4D1XA 3PWYA 4GMYA 3JY9A 2HWOA 3LZBA 2XM9A 3Q5ZA 5HU3A 5M56A 3PSDA 5EI6A 1NW1A 3DNEA 4RGJA 5CSHA 4J8MA 4BI0A 4UWCA 2JDTA 1GIJA 4YGAA 3DLZA 4A06A 4DLIA 3QD2B 3R8VA 2BUJA 1URCA 3HV6A 2UW3A 4YHJA 3NNUA 4AP7A 3SOCA 3GI3A 4YZBA 2XNEA 4KRCA 4QTCA 3V3VA 3VF8A 4JQ7A 3ZLSA 2PYWA 2YM6A 4NZWB 4P2KA 1FOTA 4FTQA 4Y8DA 2PVLA 2OIBA 3KK9A 4X2KA 4KAOA 5GZ8A 3AGLA 4QO9A 4Z9LA 4J52A 4CVAA 4KIQA 3FZTA 4EK5A 2IO6A 4I23A 1U59A 4IB0A 4DG3E 1SNUA 4ENXA 3A60A 2C6IA 4ACDA 2W17A 2PUIA 5HI2A 1T45A 4C2WA 2OIDA 5FTOA 1TQIA 2XP2A 2UVXA 3IO7A 4IB3A 3UODA 5CEOA 2C5XA 2R3LA 1Y91A 2DYLA 4FZ7A 1AGWA 4PTCA 1W0XC 4CD0A 2R3KA 4LGDA 4BDAA 3AC8A 3CTHA 5FQDC 2HENA 2OZOA 3TUBA 3QHWA 1UNGA 3VNTA 5A4LA 2R3GA 4E6DA 4XV3A 3V8WA 4EBWA 3T3UA 4BTKA 2Y6OA 2PZYA 4PL5A 3UNJA 3TJDA 3OVVA 5CYIA 4UEUA 3OWPA 4AG8A 3GQLA 1BKXA 3DJ7A 3DPKA 3DJ6A 3ELJA 4L3JA 2FGIA 3DB8A 1T46A 4ONAA 2JBPA 1OI9A 4BDJA 4L68A 3G6HA 4FT3A 2XNNA 3QX2A 3PJ2A 4XHKB 3IW8A 3R30A 3R6XA 5IG1A 4CQGA 1P4OA 2VU3A 3C4XA 3A2CA 2ERKA 1VEBA 3UMWA 3AT3A 5E8ZA 2VAGA 4O22A 2UZLA 4J8NA 2UZUE 2WMTA 1EH4A 3FMNA 4JLCA 4FV8A 3QQHA 3PXZA 2HXLA 3KRLA 4EJ7A 3HAVA 4JBPA 1V0OA 2ONLC 3GU7A 4UALA 2V7OA 1KOAA 1LUFA 2XKDA 3CC6A 4NIFA 4MNFA 4QP2A 4C4HA 3E5AA 1WMKA 4KBCA 3R04A 2OKRA 3S95A 1H1QA 1ZYJA 4JJRA 4O91A 4BYJA 4ZTMA 4K9YA 5EHOA 4PP7A 1ZZ2A 1W98A 2BMCA 3HDNA 4LUDA 4TYHA 4FMQA 1V1KA 4RFMA 1VYWA 3A8XA 3PJ1A 2X7FA 4YHTA 3RPYA 1ZMVA 4PDSA 4FEUA 4UWYA 2OLCA 2YWPA 5A3XA 3R8UA 3HVCA 1Y6AA 4HYIA 3VS2A 1IR3A 3Q9XA 4GSBA 5ACBC 4WNPA 3QA8A 3V5WA 5AX3A 3SGCA 3GCSA 2YEXA 3B8QA 3ORLA 2XKEA 3T9TA 3UG1A 3Q4ZA 2PVNA 5LJJA 2WD1A 1TVOA 3HV4A 5AR3A 2GS6A 4GT5A 4TYEA 4KB8A 3W1FA 4LDTA 4BYIA 5K4JA 2KTYA 2PULA 5IQIA 3P79A 5HQ0A 5CQWA 3LFCA 4NWMA 2F7XE 4FTKA 4HVGA 3QYZA 1XBCA 2ETRA 3VS0A 3JVSA 2X7GA 3FQSA 3TNWA 4TKSA 2VGOA 4PMSA 4WUAA 2C0OA 4AGUA 3G15A 4WNMA 1BMKA 2PU8A 5CVHA 1ST0A 3MPMA 1P2AA 4O7VA 2WHBA 4X3FC 5KHXA 4BCMA 4U79A 4CSVA 1UU3A 3PVGA 4JI9A 3TYKA 1NVSA 4UZHA 5CEQA 1REJA 3BV2A 3NUYA 1XBAA 4MD9E 4RC2A 3QTZA 2C6LA 4R3PA 5H3QA 5HE1A 4EHEA 3G2FA 4IACA 4IBMA 2JKMA 2X81A 3KN6A 3Q32A 5KZ0A 3SA0A 5IH4A 1BI8A 4EH6A 4DH3A 5M4UA 3A7FA 3NUUA 2BFYA 2J0MB 4JT3A 4C0TA 3QKLA 3S4QA 4FUYA 1FGKA 3BEGA 4FNWA 4YJOA 1QPDA 3CY2A 4MBJA 2WU7A 3ZOSA 3LE6A 2RF9A 5KCVA 4Q5HA 3OMVA 2X9FA 4YC6A 4JDKA 5CXHA 3ZHPC 3PVBA 4ANBA 1J7UA 1YW2A 4QYEA 5HE3A 2G01A 4MVFA 3ZSIA 2G9XA 1H28A 5DHJA 4BWKA 3W0NA 3IGGA 1QMZA 3VJNA 5IUHA 2Q0BA 3ENHA 4QEBA 3EKNA 3TMOA 4U44A 2E9VA 5FXQA 3ERKA 2HOGA 3TTIA 3FKLA 4XX9A 5M4IA 4JNWA 3DXPA 3PSCA 1CSNA 4C62A 2C3JA 4E4MA 3O0GA 3AGMA 2HZ4A 4MKCA 5HBEA 4ZZOA 4FEWA 3PIYA 2CJMA 1NA7A 4FK3A 4M84A 4O0VA 4U81A 4Y72A 5ANKA 4BCOA 3MVHA 1OPLA 4C59A 2R3FA 4YSMA 2VWUA 3L9LA 4E93A 1W2CA 2Z2WA 4W8DA 4OTIA 5C4LA 3TKIA 5AIKA 5T68A 3E92A 3VUKA 3RCDA 3IOKA 4W4XA 3AC3A 1BL7A 4I6BA 2PVJA 3FXXA 3QXOA 5TKDA 3W2PA 3PXKA 4XV9A 3N4TA 3HEGA 4XG6A 3OXTA 5CU6A 4MXCA 4AA5A 4G17A 2B52A 2VNYA 5BVKA 3Q9WA 4AOJA 2JGZA 5CS6A 2HW7A 4IIRA 2Y4IB 5IISA 2R3JA 4ZTQA 4K6ZA 3PUFC 3F3WA 3L1SA 3Q4UA 1W83A 2J0JA 3R0TA 4O2PA 4QMZA 4DHZA 2ZV9A 5AP1A 4IAFA 3ODZX 3ZO4A 3SG9A 3NMUF 5AR8A 4O0UA 4BBFA 3DOGA 3NNXA 5DT3A 3D9VA 5EKOA 3FMEA 3LMGA 3C1XA 4FOCA 4EONA 4MF1A 4EUTA 5CAOA 5HCZA 1W2DA 4FKGA 3RWQA 4BWXA 5KHWA 5EFQA 4IMYA 4KIOA 3UQCA 1OZ1A 2EVAA 1JKSA 2GNIA 3E88A 3DBQA 2YIQA 3LXNA 4IM0A 4RVLA 3KKVA 4YC3A 3R8LA 3BHYA 5DIAA 2QR7A 3GU8A 3KY2A 1M2RA 4QQCA 3D4QA 4MBLA 1Q4LA 1DAYA 4FV6A 4GRBA 4ID7A 4K8AA 5CSPA 2JIUA 2P2HA 4XRLA 4AA0A 2PK9A 3I4BA 1PKDA 4FKJA 4CV9A 4LGGA 3KRRA 5KX8A 1ZAOA 2UW6A 3WF9A 3QUDA 2X4ZA 4FEXA 1FBNA 2PVYA 2XK7A 1YXXA 2WTDA 3OCGA 4FUXA 1OIYA 1OL6A 1JSVA 2W06A 4YTHA 4W4YA 3VO3A 4EWQA 4F4PA 2HIWA 4A9UA 3CE3A 3F7WA 1JAMA 3H0YA 3AMYA 5E4HA 1RDQE 4TPTA 1MQ4A 3QWKA 5JRQA 2CNVA 3R83A 5BUEA 4HVIA 3Q6UA 4AU8A 5L2WA 2CLXA 4I4FA 1KUTA 4K18A 1WCCA 4EH4A 5CF8A 4NH1A 5EQYA 3BYSA 1SVHA 2A1AB 3TM0A 3NYVA 2ETKA 5M55A 4DBNA 2W1DA 3DU8A 5DVRA 4D5KA 2Y4PA 3FMHA 2OK1A 4D9TA 3UE4A 1STCE 2VWVA 2F7EE 4USDA 3ZFMA 4EOSA 5IH5A 1TQMA 3EFLA 3DTWA 3O8TA 4CFWA 3W2RA 2AUHA 5IDNA 2B9JA 2WO6A 3FZSA 4KS8A 4PX6A 5CEKA 4FKLA 2H34A 3QQLA 4BCPA 1XH9A 4G9RA 4XMOA 4L6QA 1UV5A 4F7LA 4YMJA 2A98A 1LEZA 3IK3A 3LCDA 3D5UA 4FTOA 1W7HA 3K54A 3WF5A 4BDGA 4EH3A 3AKKA 3NPCA 3GGFA 1SZMA 2C5NA 2XF0A 1P4FA 5HICA 3R22A 4A4OA 3ZM9A 4O0RA 1UNHA 2B53A 5DR6A 3VBXA 3ZU7A 4CMTA 2J4ZA 4G2FA 2ZMCA 1LR4A 2HZIA 4M3QA 4AW0A 4RLKA 5HBHA 4DHIB 2X8EA 3Q60A 4M13A 1ZOGA 4DAWA 4KIPA 3U6JA 2JITA 5HEZA 3RHXA 4DEHA 2XARA 4OBOA 2JC6A 3KU2A 4E4LA 2OICA 5ANEA 2XEYA 3OTUA 4GFOA 5CU0A 3E93A 4ASZA 4ZTSA 5AAEA 4UYAA 3TNPC 3UDTA 4JX7A 3EL8A 4YBKA 2DS1A 3F5UA 3CR0A 4HGEA 3NSZA 1Q8UA 4LMUA 3T3VA 1HOWA 1YXUA 2ITTA 4MH7A 4PF4A 5A6OA 3DY7A 5I3RA 3ZUVA 2ZB0A 1FGIA 5HO6A 4BCJA 4DEIA 3OHTA 4D4SA 2WEIA 5E8WA 3FV8A 4R1YA 4APPA 4IWP