3LZBA

Egfr kinase domain complexed with an imidazo[2,1-b]thiazole inhibitor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
281
structure length
265
Chain Sequence
LLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMRKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
publication title Imidazo[2,1-b]thiazoles: multitargeted inhibitors of both the insulin-like growth factor receptor and members of the epidermal growth factor family of receptor tyrosine kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 265
sequence length 281
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lzbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lzbA01
2P3GX 4F09A 3FMMA 1CMKE 1GIHA 3BEAA 3FQHA 4OBOA 2JC6A 3PVWA 5E8TA 2BRGA 5L2QA 3JUHA 3CY2A 5FEEA 4Q9SA 1Q41A 1QMZA 3FI2A 4OTQA 5DRBA 5KO1A 3WF7A 4LRMA 3SC1A 3QGWA 3QQLA 1W82A 1PYXA 4BDJA 3UQCA 3V3VA 4GKIA 3TV6A 5CEKA 3H0YA 4FTAA 4M69B 4UXQA 2PVMA 3KXMA 1FGKA 2W06A 4FOBA 3ZC6A 5JT2A 5KMIA 5GZ9A 1LPUA 3AGMA 4PMPA 3KXXA 4KSPA 4U43A 4X3FB 3WZKA 4RA5A 4EUTA 3FMJA 3HECA 3CIKA 1T46A 3TKUA 4EH4A 4UYNA 5CAUA 3QUEA 4D0WA 4IB3A 2IG7A 3A4PA 3HMIA 5FG8A 2C0OA 3HGKA 3ALNA 3FHRA 3R28A 4JR3A 3HRBA 3NW6A 3P1AA 4KWPA 2J6MA 2YIQA 3G6HA 4RIYA 3G15A 3DCVA 4FKJA 4QO9A 1REKA 2C0IA 3VQHA 4ZLZA 3QYZA 2O0UA 1PW2A 4XRJA 4USFA 3NWWA 3TACA 2PZRA 3QKLA 2B7AA 4DTAA 1UU8A 4MQ1A 5T3QA 2X8DA 4KBCA 2W9FB 2BILB 2PZPA 1WBWA 3UZPA 3SXRA 4BTFA 4FV3A 3G33A 4B8MA 4Z3VA 2PMLX 2QLQA 4FZ7A 3R71A 3TNWA 3UVRA 3LXLA 4XS2A 2XRWA 3MVMA 4AUAA 5I9XA 3MFRA 4PP7A 4YJNA 2DQ7X 2E2BA 4E8AA 2ZMCA 3WILA 3I1AA 3P4KA 2VAGA 1K3AA 4DLIA 2REIA 4GYIA 3AGLA 3W2QA 4AXAA 5IA1A 3C13A 5CXHA 2VGPA 3HMOA 4NTSA 3RTPA 3SXSA 4R1VA 1YHSA 3CCNA 3ZLXA 1PXKA 2C5NA 3GU7A 5HQ0A 1NA7A 4CSVA 2CSNA 5CF8A 2OH4A 2QOQA 4XG6A 3QQHA 5EW8A 4QQTA 1OL7A 2G9XA 2PVHA 2WMVA 2GFCA 5CAQA 4GT3A 1O9UA 3QCYA 4Y46A 4YNOA 5AP3A 3DBFA 4B8LA 4S34A 4DH3A 3VN9A 4IEBA 4PQNA 4YZNA 4MNEA 1REJA 1Q24A 3F9NA 3EYGA 3PRFA 1Q8WA 4I4FA 4TKSA 3R02A 4WRSA 5ANEA 4AOIA 4CG9A 2BAJA 2Z7SA 3R7VA 4IWQA 1M7NA 4I5MA 4MKCA 4ENYA 2XK6A 3A60A 2PWLA 2OH0E 3PRIA 3QX4A 4G6NA 4QP2A 4CYJA 2HENA 3P7CA 5LXMA 3UG1A 2GHLA 5HG8A 4E6QA 4C58A 1RQQA 2X39A 4UB7A 4H3QA 4CQGA 4DFXE 2P4IA 4Q5EA 3GUBA 3CD3A 1OIRA 4MD7E 3BBTB 2XNGA 3Q9WA 2P0CA 4X7QA 5EG3A 2BAKA 2PZIA 5D11A 4AT5A 5IQFA 3IDBA 5J95A 3BYSA 4C4GA 3LJ1A 3DTWA 3QZHA 4PX6A 3HUBA 3R7OA 3RM6A 5J9YA 4NH1A 3VF9A 3BELA 5GIOE 3OEZA 2QHNA 1ZMUA 5ANJA 1OBDA 2WU6A 1KE5A 3VRYA 3JVSA 3COHA 2R4BA 3NIEA 5HE0A 2Q0BA 4EOQA 4L3LA 5E9EA 1GJOA 4FNXA 5ANKA 1JKSA 1NY3A 3QQKA 4H58A 4F70A 4QD6A 5A4QA 5E90A 3KB7A 3AT3A 2WIPA 5IZFA 2OJGA 3O0GA 2ZM4A 5EHLA 4C59A 5L6PA 3S1HA 4GFGA 3CR0A 1SVEA 5AX3A 4XP2A 2R3HA 3E87A 5AM6A 4NIFB 4Q2AA 4W4YA 4EUUA 5A46A 2RL5A 2VTRA 3GU4A 3DAKA 3O2MA 2XNOA 2BDJA 3KCKA 4PL3A 2FUMA 2RFSA 2EXEA 3FZSA 4OTPA 3VBTA 5IA0A 5H3QA 5LQFA 3QXOA 3W33A 4IAKA 2DWBA 4XG2A 4CFNA 3CXWA 5M57A 5FDXA 4NKAA 1ZOHA 4K18A 4FVPA 4YZDA 1P4OA 5J9LA 4BYJA 1JLUE 3GQLA 2E9PA 4FKTA 3POZA 1DI9A 5T6KA 1K9AA 2XM9A 5EFQA 5HE3A 3ZBXA 5IKWA 4AZWA 4EYJA 2QOLA 1JNKA 3VW8A 3NNWA 3C51A 3TUBA 3BPRA 5LOHA 1P5EA 3R01A 4F6SA 1OM1A 4XV2A 3LFCA 3C9WA 4ZZMA 2ONLA 4P5ZA 4F9WA 5ITAA 2V7OA 3FZRA 3NGAA 5KHWA 2W5AA 4C4HA 1OZ1A 2W4OA 4C4IA 3NLBA 4YMJA 2YITA 3I5NA 2QOBA 4M0ZA 1UNGA 2WXVA 4BCHA 4GKHA 2PE1A 3G0FA 5M44A 4XMOA 2JDSA 4GK4A 2BRNA 4W8EA 3OCSA 4NKSA 3W2PA 1H0WA 2HWPA 3DXPA 4JS8A 4NM3A 3LLTA 4QYHA 4EHVA 2V62A 2C5XA 4JAIA 4D2RA 5HKMA 3UZRA 2XMYA 2GCDA 4IVCA 3UO6A 1M7QA 4CVAA 2RF9A 2ZAZA 4K1BA 3E64A 5EYKA 2X4ZA 3EQBA 3ORLA 2ZDUA 4UZDA 4YPSA 4DTBA 2J5EA 3U6HA 4F6UA 3V8TA 4E1ZA 1VZOA 3WF9A 5BMMA 3UO5A 5DVRA 4JBVA 4ASDA 3QLGA 2I1MA 4MTAA 3OFMA 5HNIX 4RX7A 2PTKA 2PE2A 4QPAA 1JPAA 4UMTA 3H9OA 1JKLA 5F20A 4DGLC 3EB0A 3CTQA 5FBNC 1WBTA 1OIYA 4I0TA 4HCTA 4H3BA 2C6KA 1W83A 1BX6A 1DI8A 2VX3A 4YC8A 5DT3A 1FINA 2WIHA 3ZLYA 1H08A 4TYIA 2QONA 4PDOA 3PG1A 3MPMA 4BRXA 2OFVA 5IH6A 4M97A 1GZNA 4RIXB 3A2CA 4A9TA 2W1DA 3AT2A 3II5A 3Q04A 3R6XA 4X3JA 1OPJA 4LUDA 5DMZA 2F7ZE 4AOJA 2RFEA 2ITXA 3IOKA 3P7AA 3Q53A 4YBKA 4BDDA 1OL2A 2WTJA 1XHAA 3HEGA 3IOPA 4MXAA 4UALA 5TE0A 5CU0A 3JR1A 2BIKB 4QMZA 5LVOA 4GG7A 2QKRA 5DEWA 5CZHA 3OWLA 4JX3A 1GOLA 3ITZA 3QUDA 4WA9A 1OB3A 3QXPA 2VWYA 4XG4A 3W10A 3UOJA 3OXTA 5BVDA 5FM3A 5IUHA 2PVJA 1OECA 2DUVA 3DT1A 2CJMA 4YLKA 5LVLA 2RGPA 5ACBC 3W1FA 1Q62A 2OG8A 4BKZA 2W17A 3UQGA 2RG5A 3UNKA 3PXZA 4MAOA 4RFMA 3VUGA 3FZTA 2NP8A 5IA2A 4AACA 3KF7A 4G2FA 1SZMA 5L8LA 4IZYA 2H6DA 3DDPA 5CEOA 3NPCA 3PPKA 5EHYA 4IAYA 2PVYA 4IX5A 2WMXA 1UKHA 5IISA 3LE6A 2CHLA 5KBRA 4KIKA 4LGDA 2E9NA 4TY1A 3QTQA 3B8QA 4X0MA 2AUHA 4FZ6A 3R2BA 3V51A 5CZIA 1F0QA 5HBEA 2PVLA 4ALWA 4F9YA 4F9BA 4LV5A 1UWJA 3QCXA 4JBPA 3K3IA 3MJ2A 5F95A 2XYUA 4AQCA 3S4QA 3GGFA 4FNZA 3FJQE 4HJOA 3P7BA 3D5VA 3NUNA 2ITVA 3KVXA 4G3EA 4U41A 3QALE 3UIUA 4D1SA 3TDWA 2YM5A 4FIHA 3D83A 4J1RA 3RZBA 3NZ0A 2W0JA 4DINA 4EC8A 3NUAA 4GVAA 3POOA 5LARA 2OZAA 2A1AB 2GPHA 3JY9A 4AP7A 2IVTA 3KK8A 2XIZA 1ZYSA 4FZDB 4FKUA 4QTAA 5AA8A 4QMSA 1CM8A 3G0EA 2CKEA 5HG7A 1WVYA 5LMBA 2YCQA 1J3HA 5CSHA 4W4VA 2PHKA 4RG0A 4E73A 4FKOA 4OAVB 3R1SA 2J5FA 3U6JA 3BEGA 4XP0A 2VD5A 3CJGA 4TYEA 3RALA 3W16A 2CKOA 4M14A 4N4SA 4YSJA 1NXKA 4Y83A 1WVWA 2P2IA 4O38A 4A7CA 4F9AA 3PXYA 3F2AA 5KMMA 4AT3A 3ZXZA 4NFNA 3CD8A 2JKKA 2XK3A 3GXLA 3FZOA 4QMXA 4KIOA 3LFSA 1OPKA 1PMNA 4XLVA 4ALVA 5IDNA 1Y57A 4FTTA 1TQMA 4I5PA 5M07A 4EH5A 3I7CA 4DEGA 4WG3A 4ZTHA 3UTOA 5FDPA 2ZB1A 4FK6A 2QI8A 4FTLA 4BCKA 4LFIA 5EM6A 4ZTMA 3DK3A 4KS8A 2FGIA 3UYSA 2GHGA 5CYIA 3UOLA 1JKKA 3WZUA 5CF5A 2YDKA 3G2FA 4U0IA 4BZOA 1ZARA 2OJJA 3JVRA 4UXLA 4FIGA 4U3YA 2GSFA 3L8VA 3REPA 3R9HA 3VUHA 4DEDA 3MY1A 3TIYA 2QR8A 3UYTA 3I4BA 4BTJA 2R3RA 1WBNA 1SM2A 2W1EA 4FTNA 3SV0A 4YJTA 1BUHA 3D2KA 3BV2A 3RPSA 5F1ZA 4ERWA 3UZTA 3DB8A 2B1PA 4X3FC 3IECA 4BGGA 2J50A 2R3QA 1P2AA 2WOUA 4B4LA 3C4EA 1UU9A 2JDTA 2X8IA 2WB8A 5ANOA 2VTOA 3VJNA 3R2YA 3JY0A 4RX5A 5M09A 4CFVA 4Y95A 3AD6A 1R3CA 3DBDA 2Z7LA 5IQDA 2OJ9A 1KWPA 4FTKA 4XJ0A 3F69A 2BZIB 2R3LA 4L9IA 4LM5A 4YU2A 4QTEA 3W18A 3OHTA 1GNGA 4L46A 4DGOA 1ND4A 2JGZA 3ZLSA 4FYOA 5DRDA 3C4FA 3S2PA 3RCJA 3UDBA 5JKGA 4EJNA 4EH6A 2CKPA 5KZ0A 2I0EA 4I3ZA 3E7OA 5BUIA 4RVKA 4OTWA 1JSUA 2ZDTA 3F88A 3KEXA 1PKGA 4JDJA 5M55A 4E4XA 5M08A 3QRTA 4QP3A 1XQZA 4JR7A 5D1JA 2PE0A 2WQBA 3R30A 1YHWA 4KBAA 4PL5A 4W4XA 4XV1A 4PY1A 3MY0A 4MYGA 5B2KA 3QRUA 5IU2A 3Q2JA 4FYNA 4ZOGA 1O6KA 2J0LA 1VYWA 4UMQA 4FZAB 3HV4A 5JZJA 2VX1A 2WMSA 3BHUA 2YM3A 3F61A 2A0CX 3KCFA 4WO5A 4JG7A 5K4JA 3GCVA 4QQJA 3V01A 2WOTA 5AM7A 4DEBA 3LQ5A 3LM5A 5KHXA 4RX8A 4C4JA 5C9CA 3PJCA 1V0PA 2O2UA 3FLNC 4JQ8A 4EQCA 5FTGA 3HMMA 2OKRA 5AP7A 4A9YA 2PVFA 3QZIA 2OIDA 3R63A 5AV0A 4I21A 3LXKA 2ITTA 3DXNA 3V5TA 2R7BA 5CEQA 4JXFA 3V5JA 5GIPE 4F64A 1BKXA 3U4UA 3LCOA 4BCOA 3OROA 4GFMA 4BF2A 3PJ1A 3NR9A 5KMNA 4F4PA 3EQRA 4H39A 4O22A 1SYKA 2BAQA 4EK3A 4AGUA 5JGAA 3RNYA 4AS0A 5C4KA 3DK6A 3KF4A 4WSYA 4DGNA 4CFUA 4GIIA 2VTSA 4YURA 1BI8A 1JAMA 2HXLA 2C68A 4Y5QA 5AAEA 2BUJA 4M8TA 4ZTLA 3I0QA 2HZNA 3QZFA 4L44A 3W2OA 4E5WA 1URCA 2WQOA 3CPBA 4JRNA 2G2IA 5AP1A 3R7YA 3GENA 4YZCA 4D4YA 4DAWA 4QTDA 1NVQA 1IASA 5I9WA 2ZV8A 3AD5A 4E4LA 5CQWA 1YXVA 2CCIA 4FF8A 3BHTA 3O7LD 5AAFA 2R3IA 3CQUA 4AF3A 4O7VA 3LLAA 3KFAA 2CNQA 1MP8A 5D7AA 1UV5A 1OIQA 3ZO4A 3NEWA 4AA5A 2YIYA 3CLYA 4EWQA 5HU9A 5CEPA 3KMWA 4KRCA 4RWLA 2OWBA 3WYYA 3DBEA 1WFCA 4EH8A 2ETRA 5LMKA 2WMUA 3RAHA 3IW8A 3MYGA 3H10A 4DBNA 3PLAE 1YDSE 4DEEA 2NNWB 4NYEA 3QZGA 4OLIA 5CEMA 2UVYA 3ELJA 4ZEGA 4CV9A 2PSQA 1PXNA 3B2TA 3EL7A 4ZK5A 4J52A 4WUNA 3OT3A 1XBCA 3TL8A 2R3PA 2VTMA 3MA6A 3BCEA 4PTCA 5IMEA 3IKAA 3UNJA 4GU9A 5CANA 3FSKA 2XCHA 4MEDA 4J98A 4ZSLA 4BYIA 1DAYA 5L8KA 1W7HA 2V22A 1T45A 3ULZA 2HYYA 3JXWA 1YKRA 5AUVA 4O81A 2BRHA 4I6FA 5A4TA 5AEPA 3UO4A 4BBEA 3VS2A 5AAGA 3ZDIA 4D2PA 2QOKA 4EI4A 3TZMA 1KOBA 3MFUA 2XNNA 2OW3A 3LJ2A 3MI9A 3MTFA 4FT0A 3KN5A 1FGIA 3NAYA 3S3IA 4BTMA 1PXLA 3E8CA 5HD7A 4BDBA 3FYKX 2Y0AA 4I41A 5KNJA 2Z02A 1PXIA 1B6CB 4J99A 2OF4A 4RWKA 4CRLA 4EOIA 4O7LA 3EFLA 5B7VA 5T68A 5E1EA 4PDSA 5DH3A 3I6WA 4OBPA 4RJ6A 4FTJA 2UW0A 3UC3A 2XP2A 2GU8A 4HZRA 4EH9A 4QMTA 2R0IA 4LOOA 2XKEA 4RMZA 1DS5A 3FI3A 3FL5A 5FTQA 2BDWA 3BE9A 2GQRA 5HTIA 3P9JA 5IQBA 4NW5A 1HCLA 4DFLA 4L3JA 4I94A 3QHRA 4EOJA 2C3IB 3A99A 4FX3A 3VQUA 2H34A 5C26A 5EYDA 3G9NA 2VNYA 4F6WA 2EB2A 5KX8A 4DN5A 4RGJA 1VEBA 2OJIA 4FKPA 4BCIA 4FTUA 2IVUA 1CDKA 3BHYA 5AR3A 3OZ6A 4G5JA 2B52A 2GS6A 2UW9A 3TCPA 3KULB 3R83A 1FVVA 3MWUA 5A3XA 2YCRA 1UA2A 3ZFMA 4M69A 3MGYA 1GZKA 3O8TA 3MB6A 4V01A 1WVXA 5C8NA 5HD4A 4K77A 4E3CA 4BCJA 4O83A 1V0OA 2OIQA 3EKNA 1E1VA 4YHFA 1OITA 3ZFYA 5CASA 3VS7A 3EIDA 2C6EA 2R3FA 4XBUA 4BWPA 1W84A 3BYMA 3GT8A 5AV1A 3ZSIA 1KUTA 4XRLA 4NSTA 4JDHA 4F63A 4KABA 3O17A 4TWPA 3EN7A 2WD1A 4A9RA 2VWWA 4EZ3A 1AD5A 3WOWA 4EZ7A 4R8QA 3CPCA 4XV9A 2PUIA 2ZM3A 4G16A 4IQ6A 4ANQA 4YJQA 4IX3A 4ANOA 3F7WA 4AOTA 3R7EA 3LFDA 3FHIA 1U54A 5BQ0A 4IHPA 2QO9A 4QTCA 3FKLA 3FQEA 3QWJA 1PXOA 4RC2A 4UWCA 4DFYA 2I40A 3RPYA 3OWPA 5AUZA 4FTMA 3QLFA 3F3ZA 3OT8A 4H3PA 5LMAA 4DH7A 5EI6A 1H25A 3ZDUA 4YZMA 2O64A 5IQEA 3K3JA 3BV3A 3CE3A 5HIBA 4R7BA 3I5ZA 4EBWA 3HMPA 4ENXA 3WE8A 4EOPA 4JX7A 2BZKB 5BVKA 3ZYAA 1ZYLA 2JD5A 3QWKA 4C0TA 2C3LA 1Y6BA 1VYZA 3KY2A 1VR2A 4U79A 3DZOA 3EFWA 3RMFA 3W2RA 2GS2A 2IZRA 4D1XA 3U51A 4CD0A 3ZS5A 4I5HA 4IW0A 3TV7A 3GNIB 2IVSA 4FE2A 4HZSA 4G17A 4FV8A 3MH1A 4UWBA 1H24A 3ORZA 4FV4A 2YAAA 3VWAA 2HK5A 2Y4PA 3GP0A 1XH4A 4QMNA 2ZYBA 1U5QA 3QD2B 2FH9A 4U6RA 5JFVA 4KA3A 3VS0A 3VNTA 5DT4A 3PFQA 1H27A 3F66A 3O96A 3BQRA 4GT5A 3QRJA 4J8NA 4C33A 4EK8A 5K5XA 4JL9A 2BDFA 2YN8A 4YLLA 5HCXA 3D5UA 2X4FA 2BRMA 5K3YA 3LCSA 3OBJA 2X8EA 5L3AA 2VN9A 5JMSA 3PZEA 4JOAA 2YA9A 4X2KA 4O7ZA 2GQGA 3PXKA 2VWIA 3ZH8A 2Y7JA 3R8PA 3ZONA 2QOIA 3LW0A 4KUJA 5D9HA 3OWJA 4I20A 3UMWA 1CKPA 2C47A 4KD1A 4OTDA 5LCKA 5JRQA 3NNUA 3QYWA 4O7RA 2VU3A 5ANGA 3F7ZA 4UV0A 3VC4A 1YXXA 2C1AA 5E8SA 3E63A 5A4EA 4M84A 3QTXA 2C4GA 2CPKE 3HAMA 3RHKA 1J7IA 2RFNA 4WBOA 4L01A 3Q96A 3EZVA 2X1NA 4YC3A 4IAAA 4TNDA 5DWRA 3BBWA 1YWVA 4X2GA 1BL6A 3RZFA 5JGBA 4LUEA 3ZHPC 1IRKA 3CGFA 4Q5HA 3HZTA 2BFXA 3KXNA 3FXWA 2VO3A 1XH8A 4MXZA 5HOAA 4YTHA 2VUWA 4GJ3A 4M7IA 1OKZA 4FT7A 4QMYA 3R21A 4WD5A 3DXQA 1XH9A 4CKRA 2B54A 1PJKA 2B4SB 3UJGA 3FMLA 4R7HA 5CAVA 3LFFA 3L1SA 1WBSA 3PWDA 5CT7A 2O8YA 1YXSA 3GEQA 4D2WA 3GC7A 3UOHA 3R9OA 2BALA 1M2PA 3EQGA 4FVRA 4O1PA 4CLIA 3PIXA 4A06A 5AR2A 4ANSA 4IJPA 2AC5A 3GB2A 4J96A 5FXRA 4HYHA 3DQWA 4I24A 4L43A 4ITIA 2X9EA 4RJ7A 3TI1A 4F0FA 4LRKA 2C6LA 4WNPA 4FZFB 4II5A 3DS6A 4IX4A 5CF4A 3PA4A 3MBLA 1G8AA 3DNDA 2W1FA 4I6HA 4FSMA 3E93A 4FSRA 4O84A 4M0YA 2X2KA 3FMDA 4BBFA 5JK3A 1L3RE 4BDAA 2XCKA 5IEYA 1W0XC 3W8LA 4GL9A 3KREA 4FI1A 4WT6A 3G6GA 3D9VA 5HCYA 3A7JA 4YO6A 5CS6A 4NWMA 4JIKA 4EOMA 4BN1A 5DN3A 3C4XA 2FSMX 2Y6MA 5FM2A 2ZV9A 4RIWB 4WNOA 3UIXA 2C3KA 3OOGA 2VTJA 4O7NA 3LFNA 3CTJA 1UKIA 1OGUA 5EW9A 2XIXA 4ZLYA 4LOPA 3ZLWA 3ZUVA 3FE3A 4PNKA 3UPZA 4BB4A 4DH5A 5EM8A 1PMUA 4BICA 3NRMA 4ZS0A 2PVKA 4O2PA 5BYLA 5DI1A 4X6RA 3MDYA 3VVHA 1OL5A 4O0SA 5BMSA 3IPHA 3RPRA 4YJVA 3RWQA 5AUXA 3EYHA 2QOOA 3PE1A 3FXZA 3D7TA 1YWNA 1LP4A 5HVKA 5FD2A 4MBLA 2CNUA 4ZMFA 4BDKA 4RC3A 4IFGA 5JEBA 2WTDA 3Q4CA 4RIYB 4XG9A 2W05A 3P79A 4IX6A 3NX8A 1J1BA 4ALUA 1H01A 1ZYCA 3BGZA 3SG8A 4GIHA 3DU8A 4RVMA 5GJDA 3W2CA 5J5TA 2ERZE 2YM4A 2W7XA 1HOWA 1HCKA 4ZJIA 3IW4A 3WE4A 2XS0A 3LCKA 5IMXA 1OMWA 2CGUA 2UVZA 3SRVA 3R8UA 3QHWA 1J1CA 1UNLA 4B99A 1UU3A 5EI8A 4BCFA 4A07A 3H9RA 3KRRA 4J53A 2PMOX 4LQMA 3QTZA 4YGAA 5TR6A 5BPYA 4IB0A 3KKVA 5FRIA 4YZBA 2XKDA 4TWCA 1S9IA 1LUFA 2ITYA 2JEDA 4O0RA 5HCZA 5GJFA 3WF5A 2W96B 5E8VA 3TZ9A 4A9SA 5A4CA 3PY0A 4HPUE 5FWKK 3NUSA 4ZZNA 2H8HA 4I93A 4TW9A 1V0BA 2VTNA 3TM0A 5M4CA 3UP2A 4NCTA 3Q9XA 4O0TA 3VULA 4AW5A 3GC9A 1PYEA 3ORXA 3JS2A 3PPZA 3ZBFA 3E5AA 4C02A 3D5XA 2XNMA 1XR1A 4E5AX 1YDTE 3Q2MA 3NSZA 4MNEB 2HCKA 3BIZA 2WMQA 2JAMA 4HGLA 3MY5A 4L67A 4EH3A 4D1ZA 2I6LA 4CKJA 3IONA 4U45A 5H2UA 2VZ6A 1K2PA 5J9ZA 2Y8OA 4S31A 4ZY4A 1WBOA 5G6VA 2P2HA 4AGCA 3IW6A 3LFQA 4KRDA 1YI4A 4HVGA 4QMVA 5G1XA 4CGAA 2ITPA 3PXRA 4MD8E 3KRXA 4BHZA 1FOTA 1LEZA 2QC6A 4UBAA 5JFWA 4R6VA 4P4CA 1WMKA 4E6AA 5HLNA 1R0EA 3TKIA 3AD4A 4PL4A 2WMAA 2GNGA 1UVRA 2Z8CA 3ZEWA 4D2SA 3F3TA 2QG7A 5IQIA 3UGCA 3HUCA 3Q4UA 4WKQA 3ODZX 5KMOA 4FEUA 3P5KA 3V8WA 2X7GA 3RK7A 3Q5ZA 3OY1A 4ZZOA 3V04A 4MXXA 3OD6X 1PRYA 2GNHA 2OO8X 3FYJX 3SDJA 5IQHA 3S00A 3GCSA 4XOYA 1Q3WA 2A27A 4FV6A 1Q3DA 3FBVA 3U54A 2J2IB 4QYYA 4D4SA 5A54A 4GT4A 4BBMA 4EYMA 2EUFB 2BPMA 5BUEA 3P08A 4FKRA 4C3RA 1YI6A 4E93A 5KMKA 4BZNA 3SG9A 4N70A 2XIKA 5EOBA 2GTNA 3PG3A 5AR8A 3VS1A 1H1SA 4XOZA 4FKWA 2UW3A 4S2ZA 4IAZA 4D55A 2OXXA 2QKWB 3TNPC 4C3PA 2P33A 3A7HA 4GVJA 3U6IA 3MVHA 3QQGA 5FP6A 4JQEA 2XF0A 3KU2A 4YJOA 3FPMA 2WQMA 5EDPA 3D5WA 4FG9A 4G34A 1WBVA 2I0YA 3EQFA 5D10A 2OU7A 2XVDA 3K5UA 4RQKA 3FAAA 3T3UA 4OTGA 2HZ0A 3RAIA 4Y5HA 4BI1A 5FLFA 4TN6A 3NCGA 3H4JA 5CWZA 3L9PA 4C35A 1H1PA 1FMOE 5K5NA 1KE9A 2IZSA 1SVGA 3CEKA 4QPSA 4K0YA 2R2PA 3BU3A 3ZM9A 2CCHA 4XNEA 3DFCB 4FNWA 5J87A 4AFEA 2GS7A 4AU8A 4KAOA 3R1NA 4ZJJA 3C7QA 3NW5A 2OFUA 3HNGA 3SKCA 4ZTNA 4PNIA 4V05A 4DG0E 1L8TA 1QPDA 4G3GA 2PMNX 4RLKA 3ROCA 2R3JA 1W98A 3IDCA 2ZJWA 5CSWA 5HGIA 4B9DA 4C36A 5J7BA 1IEPA 2NPQA 5CI7A 2PPQA 5EDRA 5LVNA 5JGDA 4C38A 4BL1A 3DZQA 4FT9A 3IGOA 3TKHA 3LFBA 1FBNA 3ZO2A 3K5VA 3T9IA 2C6TA 5A14A 2W1HA 3FMNA 4PF4A 3U8WA 1YXUA 2IO6A 3AQVA 5JN2A 5L6OA 3WF6A 2JDRA 3Q4TA 3TJDA 4BC6A 5H9BA 3TWJA 4B7TA 4JG8A 4K11A 3BHHA 4DFZE 3FEGA 4L6QA 4O7TA 4RSSA 5AP2A 5F4NA 4DGMA 4AW0A 5JSMA 3D0EA 3C50A 3EQPA 3OOMA 2C6MA 2HXQA 3SQQA 2ESMA 2Y9QA 3PSBA 5I4NA 5KBQA 4JLCA 4RVTA 4MBIA 3F2NA 2YWPA 3MFTA 3MVJA 4AWIA 2ZOQA 3ZTXA 3ID6C 4QRCA 5E1SA 3DQXA 5CSXA 3P0MA 4LMNA 4L42A 5FUTA 5L2SA 4IDTA 2PUUA 4QP8A 4BWKA 4TPTA 3FMKA 3E92A 3GCPA 3OXIA 5H8BA 2UW8A 2XK4A 1H1RA 4RZVA 2R64A 3VBXA 3GVUA 3FI4A 4G3FA 4PMSA 5C1QB 2ZV7A 3HL7A 3NUPA 3I0OA 1AGWA 4R5YA 2QD9A 4AGDA 4BIEA 5JFSA 2HAKA 3NNXA 4KS7A 4E6DA 4JT3A 4AFJA 3F6XA 2E9VA 2G2FA 4BDEA 2FYSA 2CLQA 4USDA 4TYJA 1XO2B 4R3PA 4LV8A 4EHGA 5AR5A 3ORIA 4GS6A 4MF0A 4D9UA 3A62A 4D5KA 2GNJA 2G01A 4PPBA 4DG3E 2JDOA 3HP2A 4EONA 5E92A 3KRLA 4AZVA 4TYHA 2HY0A 3ZEPA 1G3NA 4NZWB 4RJ4A 3V5PA 4O7SA 5E7RA 3N51A 4FL1A 2YM7A 5E8ZA 3FZPA 2J51A 3NUXA 5B2LA 2EVAA 2QCSA 2X9FA 3EWHA 3IGGA 3QQJA 3GC8A 3TZ8A 4PV0A 3IG7A 4R5SA 3ZM4A 3A7FA 3OS3A 5D41A 3MH0A 2B9FA 4EWHA 4U81A 4KBKA 5C03A 3LJ0A 3KGAA 2CNVA 1JBPE 1O6LA 3OY3A 4ZTSA 4TL0A 2W5HA 2ITOA 3FV8A 4WG4A 4G9CA 3QC4A 3H30A 5GNKA 4D9TA 2JBOA 2C1BA 3MW1A 2X6DA 4IM2A 1PXMA 2V5QA 3CQEA 3QRKA 2FA2A 3O8PA 3ORTA 4XLIA 5BYYA 1J7UA 4DCAA 3PVUA 3SAYA 2F57A 3MH2A 2XJ1A 5CF6A 4YTCA 4BKYA 5E8UA 2UZUE 2BFYA 4C34A 3TDVA 3B2WA 4GK2A 4UX9A 4HVHA 2WMTA 2OJFE 3CKXA 3ORNA 4RWIA 3R7UA 3CC6A 1M17A 2XKCA 3K2LA 4LGGA 4TWNA 3VUMA 4A4XA 3UNZA 5AUYA 2OZAB 5TT7A 3OWKA 4HGEA 4J97A 2GTMA 2X7OA 4L53A 4ORKA 4MXOA 5FEDA 2Z7QA 2OIBA 4DITA 2HW6A 2WO6A 3F5XA 2IZTA 3UIMA 3SX9A 3LKMA 1AQ1A 1V1KA 5DEYA 3SVVA 3ET7A 4RZWA 3DAEA 2ZVAA 4OT5A 2FSOX 3CBLA 4ASEA 2EU9A 5L6WL 4IZAA 3OC1A 4ZTRA 4FVQA 3KXGA 5A6OA 2XA4A 3DJ6A 4K2RA 1P14A 4CTCA 1QCFA 5ANIA 2PY3A 4CV8A 3BI6A 4EOOA 4GEOA 3BZ3A 4HCVA 4DA5A 4V0GA 3DDQA 3PP0A 2Q83A 4O0UA 1Y91A 4ZTQA 3QTIA 2BZJA 5CVFA 3P86A 4NK9A 1XJDA 4AZSA 4GU6A 5DR9A 4IBMA 2XK9A 3MPAA 4JRVA 4DH8A 3ZZWA 2JBPA 4WBBB 3Q9ZA 4XV3A 3QA8A 2VX0A 2RG6A 4IDVA 3G5DA 3U55A 4RVLA 2SRCA 1ZY4A 2IVVA 5BNJA 4RJ5A 1FVTA 5EQPA 3LPBA 4FL3A 4MF1A 5ETFA 5AFVA 1BI7A 3PA3A 5EKOA 4ANNA 3R8MA 2ERKA 3Q3BA 1Q61A 3U9NA 2A19B 2C5VA 4NFMA 2XM8A 4JAJA 5DGZA 2PK9A 2QNJA 5BVOA 5ICPA 4FBXA 1JVPP 4IAIA 5DG5A 4AAAA 4IZ5A 3BYUA 4FGBA 4O27B 5IF1A 3QX2A 3L9LA 5HIEA 2ITUA 3MN3A 5L4QA 3UC4A 4ZMEA 3R9RA 4EHEA 3PA5A 3HAVA 2VWXA 3A4OX 5KKRB 4IFCA 1E1XA 3EN9A 3KULA 4EH7A 3RVGA 4R3RA 5AUWA 1RDQE 1QPCA 2YIRA 2IWIA 2OI4X 3GC0A 2OICA 4BR3A 4FR4A 2JIVA 4C3FA 2JITA 2XEYA 4ZJVA 2IW6A 3LFAA 3PJ2A 2W1GA 4YJUA 1EH4A 3IW5A 3DKGA 2JAVA 5CSPA 3RJCA 1XBAA 4L3PA 3ZO3A 4O6LA 4WNMA 3KXZA 4BDHA 3TJCA 1PMVA 3BYVA 4FL2A 1H0VA 3C5UA 3FY0A 2OLCA 4DT8A 3FC1X 1Z57A 3HP5A 5FQDC 4AN2A 5EOLA 4P5QA 2F4JA 1B38A 2BR1A 2OBJA 4RC4A 4RT7A 1E9HA 2W1ZA 1O6YA 4S30A 4F1TA 5AUUA 2CKQA 3PPJA 4X2JA 4FEXA 2BHHA 2VTLA 2BROA 2W1CA 3I79A 4RIOA 1TQPA 2WKMA 4EK5A 2XEZA 4A9UA 2BKKA 2YACA 3F3VA 3NUUA 2YFXA 4FOCA 4YHTA 4TT7A 5KUPA 2CN8A 1NT2A 3EKKA 4GYGA 4O86A 3ORMA 3ZSGA 3ZMMA 3DPKA 4XYFA 3TXOA 3QU0A 5E8XA 2OGVA 1TVOA 3IDPA 2WMRA 3LM0A 5L2TA 3DK7A 3BU5A 4IMYA 2GNIA 3F5UA 1KSWA 3C1XA 3O50A 5HG9A 4RPVA 4ZY6A 3MVLA 5ETCA 4DG2E 4DT9A 3OCTA 1SVHA 2XNEA 3TTIA 4NTTA 3V6RA 3ZSHA 2IPXA 2A2AA 5C8KA 1U46A 4YJPA 2WEIA 2WTKB 2VTHA 3C4CA 2BTRA 5HO8A 1ATPE 3KRJA 4W9XA 2RSVA 3PJ8A 3HLLA 5FP5A 1RJBA 4WIHA 1YOJA 3ACKA 2J0MB 5AV3A 4C4FA 2WEVA 4R3CA 4IXPA 3VBWA 2ITWA 4KKHA 4AW2A 3IO7A 1H28A 5M56A 1S9JA 4RRVA 5BVFA 2QHMA 3MFSA 1RE8A 5AR4A 2ZM1A 3NAXA 3HV3A 2VV9A 3RM7A 2XYNA 3HVCA 3L8SA 3ALOA 3ETAA 2W4JA 3F5GA 3MPTA 4OW8A 4QP4A 2W99B 1Q8UA 4QYEA 4CKIA 5DLSA 2H96A 4F08A 2XUUA 5M4UA 2XNPA 4AE9A 4J71A 4GMYA 4CZUA 4RJ3A 4X3FA 4BDCA 4YHJA 4FA2A 5DHJA 4QQCA 4MH7A 1WBPA 3QTSA 4IIRA 3VS6A 4CFWA 1CKIA 5IH5A 5I9ZA 1IA8A 4JDKA 4ACHA 4FKQA 3NVKI 4C61A 2Y4IB 4E7WA 5IDPA 4GJ2A 5HVJA 5HE1A 1W8CA 1R0PA 3FSFA 4J8MA 4X6QC 5JH6A 2R3OA 2GNLA 1LR4A 4QMLA 1ZZLA 3PDTA 3R0TA 4Y73A 2PZYA 2PU8A 1NVRA 3PY1A 4DEIA 1R78A 2ZMDA 3Q6WA 3EZRA 4DHFA 2F9GA 2F7EE 3NIZA 3R1QA 4FIIA 5TOZA 4BDIA 3JPVA 4J95A 4O7WA 4U5JA 2ITZA 4FIJA 5E8YA 4ZSEA 2H9VA 3R1YA 1F5QA 5CXZA 5AP4A 3OMVA 4C2WA 1ZOGA 3QFVA 3QA0A 2NO3A 1UU7A 3VUTA 4NM7A 5JQ5A 4E4MA 3AC1A 3FLSA 3DAJA 1OKWA 2AC3A 2E9OA 1M14A 4O21A 2I7QA 1R1WA 5K0KA 4V04A 3O51A 5IG1A 4OT6A 3FDNA 3PE2A 1UNHA 3EQCA 1FQ1B 5HIDA 4MX9A 3UBDA 2ONLC 4OTFA 3PP1A 4HNIA 4O6EA 4X21A 1YOMA 2HELA 2WMBA 3E8NA 3DKCA 5HHWA 3COKA 4QP6A 2W5BA 2QOHA 2XBAA 4OGRA 2WMWA 2YDJA 4QMWA 2X81A 3SA0A 4YTIA 3SGCA 4LMUA 4BI2A 3HKOA 3DTCA 4M67A 3WIGA 4BKJA 2C0TA 2PMIA 2W9ZB 1H00A 1UWHA 3F3UA 4BIBA 2GDOA 4ASZA 5IUIA 3FUPA 4JBOA 3VIDA 1YHVA 3EQHA 2YLFA 2R3KA 4O96A 5JZNA 2VWVA 2EXCX 3HV7A 5KMJA 5KMLA 2BKZA 4IC8A 1IAJA 5CI6A 1U59A 3KMUA 4AZTA 2WQNA 3G9LX 4QMMA 4U97A 5AA9A 4U44A 3ZFXA 4GK3A 5LVMA 3UVPA 4CYIA 5EYMA 4BDFA 3LCTA 5EQEA 2G2HA 3BLRA 1Q4LA 1BLXA 4RIWA 5M51A 1MRYA 4R7IA 4HOKA 1H07A 3B8RA 3KK9A 4G31A 4CCBA 4E4NA 3BKBA 4IAFA 4RQVA 4ANMA 3GI3A 3Q60A 1NW1A 2R7IA 3FLWA 3ATTA 3RWPA 1TKIA 5I9VA 2BRBA 3W55A 2UZVA 3ANQA 4FIFA 4IJ9A 4W4WA 4AN9A 4LYNA 4G1WA 4L45A 4GSBA 4A4LA 2IW9A 3N4UA 4RJ8A 5AADA 1CKJA 3CSVA 4D2TA 4JVGA 4DFBA 3AMBA 3EFJA 4MK0A 4LL5A 5M4IA 3MA3A 2EB3A 4ZSGA 4EEVA 1TQIA 2YERA 2YM8A 4FK3A 4JNWA 4G6OA 4XP3A 1ZMWA 4FEQA 4EKKA 3OBGA 4RWJA 2UZDA 2WHBA 3GCQA 4E26A 4FODA 4EORA 3QD0A 4MBJA 1ZXEA 4IZ7A 2FSTX 3GU8A 2VGOA 2GMXA 4B6LA 4FKGA 4PUZA 1Y8YA 3EN4A 1ZY5A 3QD4A 3CY3A 4TZRA 4DEAA 4BCPA 4NIFA 3FI8A 1U54B 2HZIA 3I7BA 3QQFA 4HGTA 1OBGA 4CCUA 1YI3A 2RFDA 2UZBA 4NJDA 4G3DA 2B9IA 3DBQA 3KVWA 4YJSA 1IG1A 3COIA 4WSQA 4YBJA 2BHEA 4AZEA 1ZZ2A 3TNIA 5LVPA 4BI0A 5IEXA 4NM5A 2C69A 4YUQA 2WGJA 3QUPA 3SXFA 5I3OA 4YLJA 2UZWE 5TO8A 2OF2A 4CMOA 4HPTE 5F9EA 4KB8A 1BL7A 4MQ2A 4EK4A 4Z9LA 3EH9A 4ITHA 3R04A 4NEUA 4XEYA 2UW5A 5HX6A 2V0DA 5HBJA 4D4RA 5HBHA 4ASXA 3LQ3A 3C0IA 3VW6A 4IVAA 1SNUA 3MESA 1QL6A 4FKVA 4F1MA 4M66A 4ZIMA 3TEIA 3VHKA 4CT1A 1PHKA 3SD0A 4F7SA 5IA4A 4IANA 3R73A 3P23A 4JI9A 4FTOA 3OCBA 2XIYA 3SLSA 5I9YA 2GFSA 2QURA 3PUPA 2B0QA 4Z7HA 5FXQA 3M2WA 1OL1A 3ZU7A 4AW1A 3PWYA 3EMGA 3ODYX 2X7FA 3S0OA 4IWPA 1JSTA 4U42A 5HEZA 3CGOA 4NJ3A 2UZTA 5HZNA 3WBLA 3E7VA 4O0XA 2JKOA 2FVDA 3BYOA 3H9FA 3MTLA 4NW6A 4FKSA 3VBVA 3EQDA 5J79A 3TNQB 2F49A 4X2NA 4CTBA 4G3CA 2BZHB 3VAPA 4CXAA 3UE4A 3GBZA 4I0RA 3RPOA 3BX5A 4O2ZA 5DPVA 3RGFA 3FWQA 4FG8A 4FSWA 3ZRLA 4AX8A 3PSDA 3LAUA 4O0YA 3I81A 3OW3A 5CAOA 3N9XA 2QU5A 4U40A 3R7IA 2BMCA 3LMGA 3FLYA 4TTHB 3DFAA 5L2WA 2CLXA 4FMQA 3BLQA 1ERKA 4U8ZA 4NL0A 2VTQA 4ZP5A 4O7YA 3DKFA 4I6BA 3JYAA 4D28A 2A4LA 2RIOA 2XK8A 4RFZA 5CNOA 5AWMA 3RKBA 5K0XA 3HA8A 3TT0A 4QYFA 3S95A 4AT4A 4EKLA 2O5KA 5C4LA 4MXYA 4XUFA 2X6EA 4E6CA 1CTPE 3GOKA 4M13A 4RIXA 5D7VA 3PIYA 5CENA 4ANLA 4UEUA 4F9CA 2O65A 4BZDA 2C30A 4N0SA 5GINE 4IB1A 4LOQA 2VTPA 4H1JA 1JQHA 3TUDA 2VTTA 5EK7A 2QO7A 4FV2A 4FEWA 3DBCA 3NCZA 3OUKA 4OTHA 4UZHA 4HNFA 4W8DA 4EZ5A 4DCEA 3QTRA 3V5LA 5IQCA 2YZLA 2C5OA 4FSZA 2B9JA 3ZRMA 5H8EA 5AUTA 4PDPA 3AC5A 2PVRA 4U80A 3TV4A 3BQCA 3RBWA 1H8FA 5AP0A 1QPEA 3E88A 5J5SA 3NYOA 4RLLA 1FMKA 2C5YA 2VTIA 3WF8A 4O82A 3NW7A 5A6NA 1PF8A 4APCA 2QG5A 3ZOSA 1ZWSA 3DNEA 3Q32A 4QT1A 4N57A 5KKRC 3FXXA 4YSMA 4HW7A 3KMMA 5FGKA 4Y72A 3R22A 2R3NA 3F82A 2XB7A 3CS9A 4EQUA 4JG6A 4FV9A 3VUKA 4D0XA 4FC0A 5HLPA 4Z55A 4ZLOA 1OI9A 1Q99A 2GNFA 3NNVA 2ETMA 3QGYA 4H1MA 4IACA 3AMAA 5DYJA 4CZYB 2Q0NA 4FEVA 2BTSA 4IM0A 1GZ8A 4PDYA 2WFYA 1YRPA 3THBA 4M3QA 4LG4A 4R78A 4DF3A 4DH1A 1YW2A 4FV0A 1WAKA 3GU5A 5B2MA 3LXPA 5J8IA 4Q9ZA 4IWDA 4CZTA 2J9MA 2VO7A 4HGSA 2UVXA 2CMWA 4QP9A 5CTPA 4MVFA 4AZFA 5AP5A 3OG7A 3SW7A 4IE9A 2BVAA 1BYGA 4NU1A 4WOVA 3FY2A 5ANDA 4F7NA 2W4KA 2X2MA 3A61A 3PXQA 4FG7A 2EWAA 4FUYA 2CN5A 5E4HA 3HX4A 4QMQA 3UVQA 4C4EA 2CGVA 3VS5A 4OR5A 3O8UA 3MJ1A 5HI2A 3T3VA 3R8LA 3AT4A 3D7TB 3WZDA 4TNBA 4F7LA 4U9AA 4C62A 3DJ7A 5J1VA 4FV7A 4QMOA 4FSTA 4C7TA 3FQSA 3QTWA 3ACJA 3NVMB 2OXDA 3EN5A 3ZXTA 5BX0A 5I3RA 3QC9A 5BVEA 2ETKA 1G5SA 1ZMVA 4YJRA 4IWOA 5DIAA 5GJGA 4NT4A 4KSQA 5M53A 3A8WA 4FSYA 4OBQA 4ITJA 4WNKA 3UOKA 3VUIA 4F1OA 1XH5A 1YQJA 3OW4A 2WTKC 4FSNA 4JJRA 4M12A 2YDIA 4ZY5A 4Z7GA 5EDQA 3SRVB 2PULA 4CMUA 3ORPA 4XG3A 3LCDA 1OIUA 4RBLA 1APME 3ZZEA 4CQEA 3MB7A 4XCUA 4S33A 1YWRA 4GRBA 3ATSA 3IK3A 2CDZA 2UV2A 4KNBA 4IC7A 3WZEA 4EQMA 2F7XE 4GCJA 5LCJA 4XHKB 1KE6A 1DM2A 2HIWA 5E91A 3SHEA 5AX9A 2LAVA 3BWJA 3OF0A 2Z2WA 5IQAA 5HTBA 4U3ZA 3GQIA 4UWYA 3WARA 4QYGA 4C2VA 2ACXA 1X8BA 3AG9A 2KTYA 4MXCA 3OUNB 5ETIA 3U4WA 3DY7A 5EM7A 4YR8A 2BIYA 2QO2A 3TIZA 4CFMA 3QD3A 1VJYA 3Q9YA 4FV1A 3C5IA 4EOKA 2UZLA 1STCE 2J7TA 5J7HA 3OXZA 3MS9A 3LMHA 5LMKC 3PXFA 4TRLA 4JBQA 2QLUA 4QPMA 2Y4IC 4EOLA 3O23A 4GUBA 1H26A 4QP1A 3OTVA 4YNEA 2Y6OA 2V55A 2X0GA 1JOWB 2JFLA 3FMHA 3A7GA 3ZUUA 1A9UA 3BGPA 1RW8A 4RA4A 3EN6A 2WU7A 4O0VA 4MD9E 2W1IA 3HRFA 3TZ7A 4FTIA 4L8MA 3Q5IA 3PSCA 4F0GA 4LRJA 4FNYA 1MRUA 2YABA 4P7EA 4KKGA 3EJ1A 4R1YA 5AMNA 1G8SA 1GZOA 2R3MA 2WTIA 1F3MC 5K9IA 3F2RA 3RI1A 4UMUA 3M1SA 5C8MA 4D2VA 4KIPA 4FSQA 4PMMA 3FPQA 3V6SA 3NMUF 2R9SA 1M2QA 4ZSAA 3QF9A 5TF9A 5DOSA 3H3CA 3GCUA 3PVBA 4GW8A 3L8XA 3IS5A 2WELA 3ZC5A 2ZB0A 5GZAA 4K33A 3TUCA 3HDNA 1KOAA 4F99A 5HG5A 4D58A 4BCQA 4FIEA 4CMTA 2QR7A 3UODA 4IVBA 2Z7RA 4FSUA 1Q8TA 3QBNA 5CVHA 4IH8A 3EOCA 1ZAOA 2RKUA 3FKOA 4LL0A 4TWOA 2OSCA 2OXYA 4FT5A 3OVVA 4EOSA 3BGQA 4PPCA 2YIWA 4Z16A 3D14A 2XRUA 2O63A 4E20A 3C0HA 3ZCLA 1DAWA 1PMEA 1GIJA 2G1TA 4HYSA 3SOCA 4PMTA 5FTOA 1ZYJA 4YC6A 1MQ4A 2F2UA 4N6YA 2JFMA 5IQGA 4FUXA 2YLEA 4FKLA 1KV1A 5LJJA 5BUJA 4DFNA 5CVGA 3ENHA 5DT0A 3HV5A 3ERKA 3G51A 5EI2A 2QOFA 4IADA 3ENMA 2OK1A 3DKOA 5CSVA 3L9MA 2YM6A 4BGHA 2ITQA 4HYIA 3VBQA 1LEWA 2C6OA 1ZYDA 4O1OA 4CT2A 5KCVA 1OUYA 4QP7A 1YOLA 1YDRE 3GOPA 4BFMA 4ACCA 2I0VA 3LVPA 4MCVA 5HU3A 1OVEA 3CQWA 2WQEA 5C01A 4HYUA 4PWNA 3I60A 1ZOEA 1A06A 2R3GA 5HLWA 4KIKB 4Y85A 3D94A 2JIIA 3NYVA 4ONAA 2J90A 3DOGA 4ID7A 4OUCA 3KC3A 4CFXA 4X2FA 4GFOA 4AA4A 5HESA 2JKMA 3ORKA 1Q8ZA 5E8WA 4DTKA 4MNFA 3WZJA 2IZUA 1A48A 4DBXA 4EH2A 1FPUA 2WTVA 2YCSA 1Q8YA 4UN0C 3F5PA 5EW3A 3GFEA 4YZ9A 2CGWA 3R8ZA 3RINA 5AJQA 2J4ZA 1IA9A 3RNIA 3DLSA 3FLQA 2PYWA 2YISA 3AC2A 4UY9A 5LWMA 2J0KA 4I6QA 5HVYA 4AGWA 3LHJA 4H36A 4HCUA 1Y6AA 3AXWA 3LOKA 3R9NA 2PUNA 2YWVA 2G15A 1J7LA 4G9RA 2UZEA 2QVSE 1BMKA 3R8VA 3EHAA 3L8PA 5IUGA 1J91A 5HO6A 4DGGA 4EBVA 5CY3A 4YTFA 2HOGA 4YP8A 5CU2A 4ZSJA 5IA3A 4I23A 2XNBA 1QPJA 4L7FA 5M4FA 5AV4A 2C3JA 4I4EA 3LMIA 2YIXA 4WRGA 3AC3A 3O7LB 4B0GA 4P2KA 2VO0A 4I0SA 3K54A 4FTRA 3Q6UA 3CP9A 4BWXA 2WZJA 3D15A 2VWUA 4CFFA 4EHZA 4M15A 3VJOA 3PIZA 3RK9A 2YJRA 3VS4A 1U5RA 3HYHA 3DA6A 5CALA 4CNHA 3PVGA 2FO0A 3IQ7A 5C27A 3V8SA 1PXPA 4BCGA 1YXTA 3AC4A 3A8XA 3QKMA 4P90A 3BWFA 4IVDA 2HZ4A 5CNNA 4D4VA 3R00A 4PRJA 5EHOA 4FV5A 4CEGA 3E62A 5IH4A 3V5WA 3VF8A 3RPVA 2VWZA 2PZ5A 3Q52A 5J1WA 4TXCA 3VO3A 4BVUA 4Y8DA 5EQYA 1XKKA 5B0XA 3G90X 4NM0A 2VWBA 3WI6A 2Z60A 1XH6A 3QCSA 4QNYA 5BVWA 3DV3A 5ETAA 5DFPA 1Y8GA 2PL0A 5I9UA 2YAKA 3MSSA 4AG8A 4PPAA 5HNGA 4XG8A 3T9TA 5CQUA 4BTKA 2QQ7A 3CKWA 4PTEA 5H8GA 5I0BA 1KE7A 4CLJA 5K4IA 4F65A 1JWHA 5CLPA 1OUKA 4IM3A 4O0WA 4GV1A 2XH5A 5D12A 4TYHB 3UMXA 3HDMA 4KIQA 1MUOA 3NYXA 3R7GA 4GUEA 5HICA 3D4QA 4EJ7A 3U87A 4C37A 1IAHA 5M06A 3D7ZA 2NRYA 3NS9A 4CRSA 3OP5A 4F0IA 4QMUA 5I5ZA 5AP6A 4K9YA 4AE6A 3PZHA 3NDMA 4I5CA 4TYGA 2HY81 4FTQA 3RHXA 4HVDA 1P4FA 3L9NA 3LFEA 2XZSA 4DYMA 4S32A 2J0JA 3KN6A 1SMHA 4LI5A 3RP9A 5BVNA 4K6ZA 1PXJA 4LGHA 3H0ZA 5FXSA 2JDVA 1YVJA 5BYZA 2XIRA 1JKTA 3R9DA 3T8OA 3ZO1A 3ZRKA 3ROYA 2X2LA 4EK6A 3W32A 1NVSA 4U7ZA 5DA3A 3DJ5A 1H1QA 4FGRA 4L00A 3BHVA 2JLDA 3F3WA 2GHMA 4BDGA 4UMRA 5DNRA 2XJ0A 5EH0A 4ZXTA 5IA5A 4M68A 4ARKA 3PYYA 4F7JA 4CG8A 4EC9A 1XWSA 3EQIA 1H1WA 4JQ7A 3FLZA 4GG5A 2JKQA 5AIKA 5DE2A 5CEIA 2IW8A 2OZOA 3UIBA 2FSLX 5HORA 5HTCA 3TN8A 5IPJA 3DB6A 2GQSA 3ULIA 1KV2A 3GFWA 4I1ZA 4PTGA 5JQ8A 3COMA 1R39A 2QU6A 1OKYA 5TKDA 2O3PA 3E3BX 3E8EA 1B39A 4K8AA 3ANRA 2R0UA 3QKKA 4QNAA 1JSVA 2ZV2A 5FBOA 3VS3A 4UMPA 1GAGA 1URWA 1XH7A 3AMYA 3BLHA 3FL4A 3A7IA 1OKVA 2DYLA 1Q5KA 1KE8A 1OL6A 2WAJA 4FICA 2ITNA 4JDIA 4I92A 4RX9A 5A9UA 4A4OA 5CU4A 5CX9A 1FVRA 3FKNA 4ZS4A 2UZNA 3VBYA 1H4LA 5L8JA 3RCDA 3U9CA 3KQ7A 5DR2A 4USEA 4L68A 3M42A 3HA6A 4PP9A 4DE4A 3BE2A 3W8QA 2IJMA 4ZAUA 2C6DA 2VO6A 3DLZA 3QRIA 3O71A 3RAWA 1GY3A 3P78A 3EFKA 3AC8A 2UW4A 4V0GB 1GIIA 4BCNA 4MHAA 3N4VA 2QODA 3GU6A 3NYNA 5KE0A 1MRVA 2JIUA 3SW4A 2XK7A 1M2RA 3BU6A 3LQ8A 4AN3A 3LZBA 3MV5A 4O91A 4QMPA 3UPXA 4FTCA 2BCJA 3QAME 4HVSA 2QOCA 2WTWA 2XKFA 3UP7A 2YEXA 3TG1A 5AR7A 2HWOA 3PJ3A 3LIJA 4MWIA 2UW6A 3LXNA 5AIRA 5DR6A 4OTRA 4HVIA 2CGXA 4WHZA 5L2IA 4N6ZA 1I44A 4XH6A 2XBJA 3UG2A 4QOXA 3QTUA 5JFXA 5CU6A 2VNWA 2I0HA 3VUDA 3D2IA 3WIKA 4JIAA 2UZOA 2HW7A 3HRCA 3FMEA 3KRWA 1PKDA 4KKEA 1U4DA 4BY9E 1M52A 5CU3A 5GHVA 3C4ZA 5HE2A 2R5TA 3PTGA 4WUAA 3HV6A 4L7SA 2AYPA 4BIDA 4DLJA 4ACMA 4DFUA 1Z5MA 4YPDA 3AOXA 1PY5A 3CTHA 3MIAA 5F94A 4H05A 4NUSA 1Z9XA 3N4TA 3MIYA 3WYXA 4KINA 4DEHA 3ZUTA 2EXMA 3PY3A 5DBXA 2VTAA 4G5PA 4RFYA 5ACKA 3M11A 2V7AA 1Q97A 5LWNA 4XX9A 4D5HA 4APPA 3TTJA 2KULA 1IR3A 3FZ1A 1WZYA 3NUYA 4XBRA 5JRSA 3PLSA 3TNHA 4C57A 4C8BA 4ANBA 3KL8A 3I6UA 4L52A 1SNXA 3C0GA 3SOAA 3Q4ZA 2B55A 2P55A 4I22A 5HX8A 5A4LA 2IN6A 2B53A 5CAPA 5EKNA 2WNTA 3EL8A 1OPLA 2XJ2A 2B9HA 3OEFX 3QCQA 4XG7A 4YO4A 4AA0A 4BGQA 5IEVA 4E5BA 4FT3A 3HMNA 3KXHA 4EL9A 2WPAA 3MH3A 3VHEA 2YZAA 4GH2A 4QTBA 5EM5A 3OTUA 3KA0A 4G6LA 2UUEA 3QQUA 5KZIA 2FB8A 4WG5A 4ERKA 3W2SA 2NRUA 4NCTC 3UQFA 1CSNA 2C6IA 1ZRZA 4MWHA 3RAKA 3E8DA 4W9WA 3FC2A 5AV2A 2J0IA 2VRXA 2LGCA 4UYAA 1I09A 4J7BA 3QL8A 1WCCA 4OAUC 3BRBA 1ZLTA 3RK5A 4BHNA 2WTCA 5EYCA 3CJFA 1MQBA 5FEQA 2E9UA 2YCFA 1XBBA 2YJSA 4QQ5A 5HNBA 3VRZA 3V5QA 4R77A 2F2CB 3IW7A 2YHVA 5HO7A 4FKIA 4IB5A 2DS1A 3OCGA 4DC2A 3DGKA 5GZ8A 4BCMA 3C4WA 3E3PA 2PVNA 4ACDA 2PUPA 2UW7A 5CT0A 4ACGA 4OTIA
chains in the Genus database with same CATH superfamily
2P3GX 4F09A 3FMMA 1CMKE 1GIHA 3BEAA 3FQHA 4OBOA 2JC6A 3PVWA 5E8TA 2BRGA 5L2QA 3JUHA 3CY2A 5FEEA 4Q9SA 1Q41A 1QMZA 3FI2A 4OTQA 5DRBA 5KO1A 1XMLA 3WF7A 4LRMA 3SC1A 2A98A 3QGWA 3QQLA 1W82A 1PYXA 4BDJA 3UQCA 3V3VA 4GKIA 3TV6A 5CEKA 3H0YA 4FTAA 4M69B 4UXQA 2PVMA 3KXMA 1FGKA 2W06A 4FOBA 3ZC6A 5JT2A 5KMIA 5GZ9A 1LPUA 3AGMA 4PMPA 3KXXA 4KSPA 4U43A 4X3FB 3WZKA 4RA5A 4EUTA 3FMJA 3HECA 3CIKA 1T46A 3TKUA 4EH4A 4UYNA 5CAUA 3QUEA 4D0WA 4IB3A 2IG7A 3A4PA 3HMIA 5FG8A 2C0OA 3HGKA 3ALNA 3FHRA 3R28A 4JR3A 3HRBA 3NW6A 3P1AA 4KWPA 2J6MA 2YIQA 3G6HA 4RIYA 3G15A 3DCVA 4FKJA 4QO9A 1REKA 2C0IA 3VQHA 4ZLZA 3QYZA 2O0UA 1PW2A 4XRJA 4USFA 3NWWA 3TACA 2PZRA 3QKLA 2B7AA 4DTAA 1UU8A 4MQ1A 5T3QA 2X8DA 4KBCA 2W9FB 2BILB 2PZPA 1WBWA 3UZPA 3SXRA 4BTFA 4FV3A 3G33A 4B8MA 4Z3VA 2PMLX 2QLQA 4FZ7A 3R71A 3TNWA 3UVRA 3LXLA 4XS2A 2XRWA 3MVMA 4AUAA 5I9XA 3MFRA 4PP7A 4YJNA 2DQ7X 2E2BA 4E8AA 2ZMCA 3WILA 3I1AA 3P4KA 2VAGA 1K3AA 4DLIA 2REIA 4GYIA 3AGLA 3W2QA 4AXAA 5IA1A 3C13A 5CXHA 2VGPA 3HMOA 4NTSA 3RTPA 3SXSA 4R1VA 1YHSA 3CCNA 3ZLXA 1PXKA 2C5NA 3GU7A 5HQ0A 1NA7A 4CSVA 2CSNA 5CF8A 2OH4A 2QOQA 4XG6A 3QQHA 5EW8A 4QQTA 1OL7A 2G9XA 2PVHA 2WMVA 2GFCA 5CAQA 4GT3A 1O9UA 3QCYA 4Y46A 4YNOA 5AP3A 3DBFA 4B8LA 4S34A 4DH3A 4AXDA 3VN9A 4IEBA 4PQNA 4YZNA 4MNEA 1REJA 1Q24A 3F9NA 3EYGA 3PRFA 1Q8WA 4I4FA 4TKSA 3R02A 4WRSA 5ANEA 4AOIA 1XMMA 3W0MA 4CG9A 2BAJA 2Z7SA 3R7VA 4IWQA 1M7NA 4I5MA 4MKCA 4ENYA 2XK6A 3A60A 2PWLA 2OH0E 3PRIA 3QX4A 4G6NA 4QP2A 4CYJA 2HENA 3P7CA 3W0PA 5LXMA 3UG1A 2GHLA 5HG8A 4E6QA 4C58A 1RQQA 2X39A 4UB7A 4H3QA 4CQGA 4DFXE 2P4IA 2X0PA 3GUBA 4Q5EA 3CD3A 1OIRA 4MD7E 3BBTB 2XNGA 3Q9WA 2P0CA 4X7QA 5EG3A 2BAKA 2PZIA 4O4FA 5D11A 4AT5A 5IQFA 3IDBA 5J95A 3BYSA 4C4GA 3LJ1A 3DTWA 3QZHA 4PX6A 3HUBA 3R7OA 3RM6A 5J9YA 4NH1A 3VF9A 3BELA 5GIOE 3OEZA 2QHNA 1ZMUA 5ANJA 1OBDA 2WU6A 1KE5A 3VRYA 3JVSA 3COHA 2R4BA 3NIEA 5HE0A 3AKKA 2Q0BA 4EOQA 4L3LA 5E9EA 1GJOA 4FNXA 5ANKA 1JKSA 1NY3A 3QQKA 4H58A 4F70A 4QD6A 5A4QA 5E90A 3KB7A 3AT3A 2WIPA 5IZFA 2AEGA 2OJGA 3O0GA 2ZM4A 5EHLA 4C59A 5L6PA 3S1HA 4GFGA 3CR0A 1SVEA 5AX3A 4XP2A 2R3HA 3E87A 5AM6A 4NIFB 4Q2AA 4W4YA 4EUUA 5A46A 2RL5A 2VTRA 3GU4A 3DAKA 3O2MA 2XNOA 2BDJA 3KCKA 4PL3A 2FUMA 2RFSA 2EXEA 3FZSA 4OTPA 3VBTA 5IA0A 5H3QA 5LQFA 3QXOA 3W33A 4IAKA 2DWBA 4XG2A 4CFNA 3CXWA 5M57A 5FDXA 4NKAA 1ZOHA 4K18A 4FVPA 4YZDA 1P4OA 5J9LA 4BYJA 1JLUE 3GQLA 2E9PA 4FKTA 3POZA 1DI9A 5T6KA 1K9AA 2XM9A 5EFQA 5HE3A 3ZBXA 5IKWA 4AZWA 4EYJA 2QOLA 1JNKA 3VW8A 3NNWA 3C51A 3TUBA 3BPRA 5LOHA 1P5EA 3R01A 4F6SA 1OM1A 4XV2A 3LFCA 3C9WA 4ZZMA 2ONLA 4P5ZA 4F9WA 5ITAA 2V7OA 3FZRA 3NGAA 5KHWA 2W5AA 4C4HA 1OZ1A 2W4OA 4C4IA 3NLBA 4YMJA 2YITA 3I5NA 2QOBA 4M0ZA 1UNGA 2WXVA 4BCHA 4GKHA 2PE1A 3G0FA 5M44A 4XMOA 2JDSA 4GK4A 2BRNA 4W8EA 3OCSA 4NKSA 3W2PA 1H0WA 2HWPA 3DXPA 4JS8A 4NM3A 3LLTA 4QYHA 4EHVA 2V62A 2C5XA 4JAIA 4D2RA 4FRFA 5HKMA 3UZRA 2XMYA 2GCDA 4IVCA 3UO6A 1M7QA 4CVAA 2RF9A 2ZAZA 4K1BA 3E64A 3TMOA 5EYKA 2X4ZA 3EQBA 3ORLA 2ZDUA 4UZDA 4YPSA 4DTBA 2J5EA 3U6HA 4F6UA 3V8TA 4E1ZA 1VZOA 3WF9A 5BMMA 3UO5A 5DVRA 4JBVA 4ASDA 3QLGA 2I1MA 4MTAA 3OFMA 5HNIX 4RX7A 2PTKA 2PE2A 4QPAA 1JPAA 4UMTA 3H9OA 1JKLA 5F20A 4DGLC 3EB0A 3CTQA 5FBNC 1WBTA 1OIYA 4I0TA 4HCTA 4H3BA 2C6KA 1W83A 1BX6A 1DI8A 2VX3A 4YC8A 5DT3A 1FINA 2WIHA 3ZLYA 1H08A 4TYIA 2QONA 4PDOA 3PG1A 3MPMA 4BRXA 2OFVA 5IH6A 4M97A 1GZNA 4RIXB 3A2CA 4A9TA 2W1DA 3AT2A 3II5A 3Q04A 3R6XA 4X3JA 1OPJA 4LUDA 5DMZA 2F7ZE 4AOJA 2RFEA 2ITXA 3IOKA 3P7AA 3Q53A 4YBKA 4BDDA 1OL2A 2WTJA 1XHAA 3HEGA 3IOPA 4MXAA 4UALA 5TE0A 5CU0A 3JR1A 2BIKB 4QMZA 5LVOA 4GG7A 2QKRA 5DEWA 5CZHA 3OWLA 4JX3A 1GOLA 3ITZA 3QUDA 4WA9A 1OB3A 3QXPA 2VWYA 4XG4A 3W10A 3UOJA 3OXTA 5BVDA 5FM3A 5IUHA 2PVJA 1OECA 2DUVA 3DT1A 2CJMA 4YLKA 5LVLA 2RGPA 5ACBC 3W1FA 1Q62A 2OG8A 4BKZA 2W17A 3UQGA 2RG5A 3UNKA 3PXZA 4MAOA 4RFMA 3VUGA 3FZTA 2NP8A 5IA2A 4AACA 3KF7A 4G2FA 1SZMA 5L8LA 4IZYA 2H6DA 3W0NA 3DDPA 5CEOA 3NPCA 3PPKA 5EHYA 4IAYA 2PVYA 4IX5A 2WMXA 1UKHA 5IISA 3LE6A 2CHLA 5KBRA 4KIKA 4LGDA 2E9NA 4TY1A 3QTQA 3B8QA 4X0MA 2AUHA 4FZ6A 3R2BA 3V51A 5CZIA 1F0QA 5HBEA 2PVLA 4ALWA 4F9YA 4F9BA 4LV5A 1UWJA 3QCXA 4JBPA 3K3IA 3MJ2A 5F95A 2XYUA 4AQCA 3S4QA 3GGFA 4FNZA 3FJQE 4HJOA 3P7BA 3D5VA 3NUNA 2ITVA 3KVXA 4G3EA 4U41A 3QALE 3UIUA 4D1SA 3TDWA 2YM5A 4FIHA 3D83A 4J1RA 3RZBA 3NZ0A 2W0JA 4DINA 4EC8A 3NUAA 4GVAA 3POOA 5LARA 2OZAA 2A1AB 2GPHA 3JY9A 4AP7A 2IVTA 3KK8A 2XIZA 1ZYSA 4DHIB 4FZDB 4FKUA 4QTAA 5AA8A 4QMSA 1CM8A 3G0EA 2CKEA 5HG7A 1WVYA 5LMBA 2YCQA 1J3HA 5CSHA 4W4VA 2PHKA 4RG0A 4E73A 4FKOA 4OAVB 3R1SA 2J5FA 3U6JA 3BEGA 4XP0A 2VD5A 3CJGA 4TYEA 3RALA 3W16A 2CKOA 4M14A 4N4SA 4YSJA 1NXKA 4Y83A 1WVWA 2P2IA 4O38A 4A7CA 4F9AA 3PXYA 3F2AA 5KMMA 4AT3A 3ZXZA 4NFNA 3CD8A 2JKKA 2XK3A 3GXLA 3FZOA 4QMXA 4KIOA 3LFSA 1OPKA 1PMNA 4XLVA 4ALVA 5IDNA 1Y57A 4FTTA 1TQMA 4I5PA 5M07A 4EH5A 3BLAA 3I7CA 4DEGA 4WG3A 4ZTHA 3UTOA 5FDPA 2ZB1A 4FK6A 2QI8A 4FTLA 4BCKA 4LFIA 5EM6A 4ZTMA 3DK3A 4KS8A 2FGIA 3UYSA 2GHGA 5CYIA 3UOLA 1JKKA 3WZUA 5CF5A 2YDKA 3G2FA 4U0IA 4BZOA 1ZARA 2OJJA 3JVRA 4UXLA 4FIGA 4U3YA 2GSFA 3L8VA 3REPA 3R9HA 3VUHA 4DEDA 3MY1A 3TIYA 2QR8A 3UYTA 3I4BA 4BTJA 2ZFYA 2R3RA 1WBNA 1SM2A 2W1EA 4FTNA 3SV0A 4YJTA 1BUHA 3D2KA 3BV2A 3RPSA 5F1ZA 4ERWA 3UZTA 3DB8A 2B1PA 4X3FC 3IECA 4BGGA 2J50A 2R3QA 1P2AA 2WOUA 4B4LA 3C4EA 1UU9A 2JDTA 2X8IA 2WB8A 5ANOA 2VTOA 3VJNA 3R2YA 3JY0A 4RX5A 5M09A 4CFVA 4Y95A 3AD6A 1R3CA 3DBDA 2Z7LA 5IQDA 2OJ9A 1KWPA 4FTKA 4XJ0A 3F69A 2BZIB 2R3LA 4L9IA 4LM5A 4YU2A 4QTEA 3W18A 3OHTA 1GNGA 4L46A 4DGOA 1ND4A 2JGZA 3ZLSA 4FYOA 5DRDA 3C4FA 3S2PA 3RCJA 3UDBA 5JKGA 4EJNA 4EH6A 2CKPA 5KZ0A 2I0EA 4I3ZA 3E7OA 5BUIA 4RVKA 4OTWA 1JSUA 2ZDTA 3F88A 3KEXA 1PKGA 4JDJA 5M55A 4E4XA 5M08A 3QRTA 4QP3A 1XQZA 4JR7A 5D1JA 2PE0A 2WQBA 3R30A 1YHWA 4KBAA 4PL5A 4W4XA 4XV1A 4PY1A 3MY0A 4MYGA 5B2KA 3QRUA 5IU2A 3Q2JA 4FYNA 4ZOGA 1O6KA 2J0LA 1VYWA 4UMQA 3W0SA 4FZAB 3HV4A 2IF8A 5JZJA 2VX1A 2WMSA 3BHUA 2YM3A 3F61A 2A0CX 3KCFA 4WO5A 4JG7A 5K4JA 3GCVA 4QQJA 3V01A 2WOTA 5AM7A 4DEBA 3LQ5A 3LM5A 5KHXA 4RX8A 4C4JA 5C9CA 3PJCA 3UDSA 1V0PA 2O2UA 3FLNC 4JQ8A 4EQCA 5FTGA 3HMMA 2OKRA 5AP7A 4A9YA 2PVFA 3QZIA 2OIDA 3R63A 5AV0A 4I21A 3LXKA 2ITTA 3DXNA 3V5TA 2R7BA 5CEQA 4JXFA 1ST4A 3V5JA 5GIPE 4F64A 1BKXA 3U4UA 3LCOA 4BCOA 3OROA 4GFMA 4BF2A 3PJ1A 3NR9A 5KMNA 4F4PA 3EQRA 4H39A 4O22A 1SYKA 2BAQA 4EK3A 4AGUA 5JGAA 3RNYA 4AS0A 5C4KA 3DK6A 3KF4A 4WSYA 4AXCA 4DGNA 4CFUA 4GIIA 2VTSA 4YURA 1BI8A 1JAMA 2HXLA 2C68A 4Y5QA 5AAEA 2BUJA 4M8TA 4ZTLA 3I0QA 2HZNA 3QZFA 4L44A 3W2OA 4E5WA 1URCA 2WQOA 3CPBA 4JRNA 2G2IA 5AP1A 3R7YA 3GENA 4YZCA 4D4YA 4DAWA 4QTDA 1NVQA 1IASA 5I9WA 2ZV8A 3AD5A 4E4LA 5CQWA 1YXVA 2CCIA 4FF8A 3BHTA 3O7LD 5AAFA 2R3IA 3CQUA 4AF3A 4O7VA 3LLAA 3KFAA 2CNQA 1MP8A 5D7AA 1UV5A 1OIQA 3ZO4A 3NEWA 4AA5A 2YIYA 3CLYA 4EWQA 5HU9A 5CEPA 3KMWA 4KRCA 4BJJB 4RWLA 2OWBA 3WYYA 3DBEA 1WFCA 4EH8A 2ETRA 5LMKA 2WMUA 3RAHA 3IW8A 3MYGA 3H10A 4DBNA 3PLAE 1YDSE 4DEEA 2NNWB 4NYEA 3QZGA 4OLIA 5CEMA 2UVYA 3ELJA 4ZEGA 4CV9A 2PSQA 1PXNA 3B2TA 3EL7A 4ZK5A 4J52A 4WUNA 3OT3A 1XBCA 3TL8A 2R3PA 2VTMA 3MA6A 3BCEA 4PTCA 5IMEA 3IKAA 3UNJA 4GU9A 5CANA 3FSKA 2XCHA 4MEDA 4J98A 4ZSLA 4BYIA 1DAYA 5L8KA 1W7HA 2V22A 1T45A 2IEWA 3ULZA 2HYYA 3JXWA 1YKRA 5AUVA 4O81A 2BRHA 4I6FA 5A4TA 5AEPA 3UO4A 4BBEA 3VS2A 5AAGA 3ZDIA 4D2PA 2QOKA 4EI4A 3TZMA 1KOBA 3MFUA 2XNNA 2OW3A 3LJ2A 3MI9A 3MTFA 4FT0A 3KN5A 1FGIA 3NAYA 3S3IA 4BTMA 1PXLA 3E8CA 5HD7A 4BDBA 3FYKX 2Y0AA 4I41A 5KNJA 2Z02A 1PXIA 1B6CB 4J99A 2OF4A 4RWKA 4CRLA 4EOIA 4O7LA 1ST0A 3EFLA 5B7VA 5T68A 5E1EA 4PDSA 5DH3A 3I6WA 4OBPA 4RJ6A 4FTJA 2UW0A 3UC3A 2XARA 2XP2A 2GU8A 4HZRA 4EH9A 4QMTA 2R0IA 4LOOA 2XKEA 4RMZA 1DS5A 3FI3A 3FL5A 5FTQA 2BDWA 3BE9A 2GQRA 5HTIA 3P9JA 5IQBA 4NW5A 1HCLA 4DFLA 4L3JA 4I94A 3QHRA 4EOJA 2C3IB 3A99A 4FX3A 3VQUA 2H34A 5C26A 5EYDA 3G9NA 2VNYA 4F6WA 2EB2A 5KX8A 4DN5A 4RGJA 1VEBA 2OJIA 4FKPA 4BCIA 4FTUA 2IVUA 1CDKA 3BHYA 5AR3A 3OZ6A 4G5JA 2B52A 2GS6A 2UW9A 3TCPA 3KULB 3R83A 1FVVA 3MWUA 5A3XA 2YCRA 1UA2A 3ZFMA 4M69A 3MGYA 1GZKA 3O8TA 3MB6A 4V01A 1WVXA 5C8NA 5HD4A 4K77A 4E3CA 4BCJA 4O83A 1V0OA 2OIQA 3EKNA 1E1VA 4YHFA 1OITA 3ZFYA 5CASA 3VS7A 3EIDA 2C6EA 2R3FA 4XBUA 4BWPA 1W84A 3BYMA 3GT8A 5AV1A 3ZSIA 1KUTA 4XRLA 4NSTA 4JDHA 4F63A 4KABA 3O17A 4TWPA 3EN7A 2WD1A 4A9RA 2VWWA 4EZ3A 1AD5A 3WOWA 4EZ7A 4R8QA 3CPCA 4XV9A 3P5JC 2PUIA 2ZM3A 4G16A 4IQ6A 4ANQA 4YJQA 4IX3A 4ANOA 3F7WA 4AOTA 3R7EA 3LFDA 3FHIA 1U54A 5BQ0A 4IHPA 2QO9A 4QTCA 3FKLA 3FQEA 3QWJA 1PXOA 4RC2A 4UWCA 4DFYA 2I40A 3RPYA 3OWPA 5AUZA 4FTMA 3QLFA 3F3ZA 3OT8A 4H3PA 5LMAA 4DH7A 5EI6A 1H25A 3ZDUA 4YZMA 2O64A 5IQEA 3K3JA 3BV3A 3CE3A 5HIBA 4R7BA 3I5ZA 4EBWA 3HMPA 4ENXA 3WE8A 4EOPA 4JX7A 2BZKB 5BVKA 3ZYAA 1ZYLA 2JD5A 3QWKA 4C0TA 2C3LA 3BL7A 1Y6BA 1VYZA 3KY2A 1VR2A 4U79A 3DZOA 2NYAA 3EFWA 3RMFA 3W2RA 2GS2A 2IZRA 4D1XA 3U51A 4CD0A 3ZS5A 4I5HA 4IW0A 3TV7A 3GNIB 2IVSA 4FE2A 4HZSA 4G17A 4FV8A 3MH1A 4UWBA 1H24A 3ORZA 4FV4A 2YAAA 3VWAA 2HK5A 2Y4PA 3GP0A 1XH4A 4QMNA 2ZYBA 1U5QA 3QD2B 2FH9A 4U6RA 5JFVA 4KA3A 3VS0A 3VNTA 5DT4A 3PFQA 1H27A 3F66A 3O96A 3BQRA 4GT5A 3QRJA 4J8NA 4C33A 4EK8A 5K5XA 4JL9A 2BDFA 2YN8A 4YLLA 5HCXA 3D5UA 2X4FA 2BRMA 5K3YA 3LCSA 3OBJA 2X8EA 4O4DA 5L3AA 2VN9A 5JMSA 3PZEA 4O4CA 4JOAA 2YA9A 4X2KA 4O7ZA 2GQGA 3PXKA 2VWIA 3ZH8A 2Y7JA 3R8PA 3ZONA 2QOIA 3LW0A 4KUJA 5D9HA 3OWJA 4I20A 3UMWA 1CKPA 2C47A 4KD1A 4OTDA 5LCKA 5JRQA 3NNUA 3QYWA 4O7RA 2VU3A 5ANGA 3F7ZA 4UV0A 3VC4A 1YXXA 2C1AA 5E8SA 3E63A 5A4EA 4M84A 3QTXA 2C4GA 2CPKE 3HAMA 3RHKA 1J7IA 2RFNA 4WBOA 4L01A 3Q96A 3EZVA 2X1NA 4YC3A 4IAAA 4TNDA 5DWRA 3BBWA 1YWVA 4X2GA 1BL6A 3RZFA 5JGBA 4LUEA 3ZHPC 1IRKA 3CGFA 4Q5HA 3HZTA 2BFXA 3KXNA 3FXWA 2VO3A 1XH8A 4MXZA 5HOAA 4YTHA 2VUWA 4GJ3A 4M7IA 1OKZA 4FT7A 4QMYA 3R21A 4WD5A 3DXQA 1XH9A 4CKRA 2B54A 1PJKA 2B4SB 3UJGA 3FMLA 4R7HA 5CAVA 3LFFA 3L1SA 1WBSA 3PWDA 5CT7A 3PFYA 2O8YA 1YXSA 3GEQA 4D2WA 3GC7A 3UOHA 3R9OA 2XAOA 2BALA 1M2PA 3EQGA 4FVRA 4O1PA 4CLIA 3PIXA 4A06A 5AR2A 4ANSA 4IJPA 2AC5A 3GB2A 4J96A 5FXRA 4HYHA 3DQWA 4I24A 4L43A 4ITIA 2X9EA 4RJ7A 3TI1A 4F0FA 4LRKA 2C6LA 4WNPA 4FZFB 4II5A 3DS6A 4IX4A 5CF4A 3PA4A 3MBLA 1G8AA 3DNDA 2W1FA 4I6HA 4FSMA 3E93A 4FSRA 4O84A 4M0YA 2X2KA 3FMDA 4BBFA 5JK3A 1L3RE 4BDAA 2XCKA 5IEYA 1W0XC 3W8LA 4GL9A 3KREA 4FI1A 4WT6A 3G6GA 3D9VA 5HCYA 3A7JA 4YO6A 5CS6A 4NWMA 4JIKA 4EOMA 4BN1A 5DN3A 3C4XA 2FSMX 2Y6MA 5FM2A 2ZV9A 4RIWB 4WNOA 3UIXA 2C3KA 3OOGA 2VTJA 4O7NA 3LFNA 3CTJA 1UKIA 1OGUA 5EW9A 2XIXA 4ZLYA 4LOPA 3ZLWA 3ZUVA 3FE3A 4PNKA 3UPZA 4BB4A 4DH5A 5EM8A 1PMUA 4BICA 3NRMA 4ZS0A 2PVKA 4O2PA 5BYLA 5DI1A 4X6RA 3MDYA 3VVHA 1OL5A 4O0SA 5BMSA 3IPHA 3RPRA 4YJVA 3RWQA 5AUXA 3EYHA 2QOOA 3PE1A 3FXZA 3D7TA 1YWNA 1LP4A 5HVKA 5FD2A 4MBLA 2CNUA 4ZMFA 4BDKA 4RC3A 4IFGA 5JEBA 2WTDA 3Q4CA 4RIYB 4XG9A 2W05A 3P79A 4IX6A 3NX8A 1J1BA 4ALUA 1H01A 1ZYCA 3BGZA 3SG8A 4GIHA 3DU8A 4RVMA 5GJDA 3W2CA 5J5TA 2ERZE 2YM4A 2W7XA 1HOWA 1HCKA 4ZJIA 4QEBA 3IW4A 3WE4A 2XS0A 3LCKA 5IMXA 1OMWA 2CGUA 2UVZA 3SRVA 3R8UA 3QHWA 1J1CA 3ML1A 1UNLA 4B99A 1UU3A 5EI8A 4BCFA 4A07A 3H9RA 3KRRA 4J53A 2PMOX 4LQMA 3QTZA 4YGAA 5TR6A 5BPYA 4IB0A 3KKVA 5FRIA 4YZBA 2XKDA 4TWCA 1S9IA 1LUFA 2ITYA 2JEDA 4O0RA 5HCZA 5GJFA 3WF5A 2W96B 5E8VA 3TZ9A 4A9SA 5A4CA 3PY0A 4HPUE 5FWKK 3NUSA 4ZZNA 2H8HA 4I93A 4TW9A 1V0BA 2VTNA 3TM0A 5M4CA 3UP2A 2XALA 4NCTA 3Q9XA 4O0TA 3VULA 4AW5A 3GC9A 1PYEA 3ORXA 3JS2A 3PPZA 3ZBFA 3E5AA 4C02A 3D5XA 2XNMA 1XR1A 4E5AX 1YDTE 3Q2MA 3NSZA 4MNEB 2HCKA 3BIZA 2WMQA 2JAMA 4HGLA 3MY5A 4L67A 4EH3A 4D1ZA 2I6LA 4CKJA 3IONA 4U45A 5H2UA 2VZ6A 1K2PA 5J9ZA 2Y8OA 4S31A 4ZY4A 1WBOA 4AXFA 5G6VA 2P2HA 4AGCA 3IW6A 3LFQA 4KRDA 1YI4A 4HVGA 4QMVA 5G1XA 4CGAA 2ITPA 3PXRA 4MD8E 3KRXA 4BHZA 1FOTA 1LEZA 2QC6A 4UBAA 5JFWA 4R6VA 4P4CA 1WMKA 4E6AA 5HLNA 1R0EA 3TKIA 3AD4A 4PL4A 2WMAA 2GNGA 1UVRA 2Z8CA 3ZEWA 4D2SA 3F3TA 2QG7A 5IQIA 3UGCA 3HUCA 3Q4UA 4WKQA 3ODZX 5KMOA 4FEUA 3P5KA 3V8WA 2X7GA 3RK7A 3Q5ZA 3OY1A 4ZZOA 3V04A 4MXXA 3OD6X 1PRYA 2GNHA 2OO8X 3FYJX 3SDJA 5IQHA 3S00A 3GCSA 4XOYA 1Q3WA 2A27A 4FV6A 1Q3DA 3FBVA 3U54A 2J2IB 4QYYA 4D4SA 5A54A 4GT4A 4BBMA 4EYMA 2EUFB 2BPMA 5BUEA 3P08A 4FKRA 4C3RA 1YI6A 4E93A 2XAMA 5KMKA 4BZNA 3SG9A 4N70A 2XIKA 5EOBA 2GTNA 3PG3A 5AR8A 3VS1A 1H1SA 4XOZA 4FKWA 2UW3A 4S2ZA 4IAZA 4D55A 2AQXA 2OXXA 2QKWB 3TNPC 4C3PA 2P33A 3A7HA 4GVJA 3U6IA 3MVHA 3QQGA 5FP6A 4JQEA 3O5AA 2XF0A 3KU2A 4YJOA 3FPMA 2WQMA 5EDPA 3D5WA 4FG9A 4G34A 1WBVA 2I0YA 3EQFA 5D10A 2OU7A 2XVDA 3K5UA 4RQKA 3FAAA 3T3UA 4OTGA 2HZ0A 3RAIA 4Y5HA 4BI1A 5FLFA 4TN6A 3NCGA 3H4JA 5CWZA 3L9PA 4C35A 1H1PA 1FMOE 5K5NA 1KE9A 2IZSA 1SVGA 3CEKA 4QPSA 4K0YA 2R2PA 3BU3A 3ZM9A 2CCHA 4XNEA 3DFCB 4FNWA 5J87A 4AFEA 2GS7A 4AU8A 4KAOA 3R1NA 4ZJJA 3C7QA 3NW5A 2OFUA 3HNGA 3SKCA 4ZTNA 4PNIA 4V05A 4DG0E 1L8TA 1QPDA 4G3GA 2PMNX 4RLKA 3ROCA 4QDVA 2R3JA 1W98A 3IDCA 2ZJWA 5CSWA 5HGIA 4B9DA 4C36A 5J7BA 1IEPA 2NPQA 5CI7A 2PPQA 5EDRA 5LVNA 5JGDA 4C38A 4BL1A 3DZQA 4FT9A 3IGOA 3TKHA 3LFBA 1FBNA 3ZO2A 3K5VA 3T9IA 2C6TA 5A14A 2W1HA 3FMNA 4PF4A 3U8WA 1YXUA 2IO6A 3AQVA 5JN2A 5L6OA 3WF6A 2JDRA 3Q4TA 3TJDA 4BC6A 5H9BA 3TWJA 4B7TA 4JG8A 4K11A 3BHHA 4DFZE 3FEGA 4L6QA 4O7TA 4RSSA 5AP2A 5F4NA 4DGMA 4AW0A 5JSMA 3D0EA 3C50A 3EQPA 3OOMA 2C6MA 2HXQA 3SQQA 2ESMA 2Y9QA 3PSBA 5I4NA 5KBQA 4JLCA 4RVTA 4MBIA 3F2NA 2YWPA 3MFTA 3MVJA 4AWIA 2ZOQA 3ZTXA 3W0QA 3ID6C 4QRCA 5E1SA 3DQXA 5CSXA 3P0MA 4LMNA 4L42A 5FUTA 5L2SA 4IDTA 2PUUA 4QP8A 4BWKA 4TPTA 3FMKA 3E92A 3GCPA 3OXIA 5H8BA 2UW8A 2XK4A 1H1RA 4RZVA 2R64A 3VBXA 3GVUA 3FI4A 4G3FA 4PMSA 5C1QB 2ZV7A 3HL7A 3NUPA 3I0OA 1AGWA 4R5YA 2QD9A 4AGDA 4BIEA 5JFSA 2HAKA 3NNXA 4KS7A 4E6DA 4JT3A 4AFJA 3F6XA 2E9VA 2G2FA 4BDEA 2FYSA 2CLQA 4USDA 4TYJA 4FJVA 1XO2B 4R3PA 4LV8A 4EHGA 5AR5A 3ORIA 4GS6A 4MF0A 4D9UA 3A62A 4D5KA 2GNJA 2G01A 4PPBA 4DG3E 2JDOA 3HP2A 4EONA 5E92A 3KRLA 4AZVA 4TYHA 2HY0A 3ZEPA 1G3NA 4NZWB 4RJ4A 3V5PA