3LZBA

Egfr kinase domain complexed with an imidazo[2,1-b]thiazole inhibitor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
281
structure length
265
Chain Sequence
LLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMRKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Imidazo[2,1-b]thiazoles: multitargeted inhibitors of both the insulin-like growth factor receptor and members of the epidermal growth factor family of receptor tyrosine kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 85
structure length 265
sequence length 281
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lzbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lzbA01
2W5BA 4E6AA 3UG1A 3RTPA 4FR4A 3TTJA 2OSCA 4GJ2A 3ZU7A 4AT5A 5HG7A 4ZTRA 4GKHA 4X3FB 4PDOA 3M2WA 3F61A 4BI0A 1GZKA 4CCUA 3AGMA 4QTDA 3LCDA 3WF7A 2CNQA 1CSNA 5LQFA 1ZZ2A 5AEPA 2RFEA 2HY0A 4E6QA 4IM3A 4IZYA 5IQGA 4GVJA 4M8TA 2PYWA 3U55A 4CXAA 5LVMA 4XG4A 1SVHA 4JX3A 3VF9A 5D41A 2NPQA 4BN1A 5FEEA 5KMOA 3S1HA 4B9DA 1OPJA 3FE3A 4IHPA 3PXRA 5EYMA 4YTHA 1J7LA 3KXNA 3E92A 2QOQA 5B2LA 2AC3A 3FI2A 2R3PA 5T3QA 5E1SA 2C68A 2O63A 2GNJA 3DNDA 4MF0A 4WIHA 5IUGA 4DF3A 2GSFA 1CTPE 2RFSA 4QP2A 4YZ9A 4MHAA 3RK7A 4IFCA 2G9XA 5CS6A 2R7IA 3FV8A 2VX1A 3I0OA 3CXWA 3KXMA 3HP2A 5I9YA 2UV2A 3QGYA 2XMYA 4FNYA 5IPJA 2P2HA 1H24A 3AD5A 2QOBA 4M84A 3HRBA 5E4HA 4JDJA 3DBQA 3ZHPC 5AUZA 4ERKA 3HMOA 4NZWB 4MYGA 3KRLA 2F2CB 3F3TA 4RT7A 3ZC6A 2OFVA 1F3MC 1ZZLA 2J51A 4IVBA 3RP9A 4FG7A 4C38A 1NT2A 4DTAA 2W4OA 3NPCA 4L52A 3QXPA 3D2IA 1SNXA 3OEZA 3GT8A 4I93A 5FBNC 5GJDA 5FRIA 3ZFYA 3WIKA 4CMOA 4HCTA 4G6NA 5E92A 4C4GA 2VWYA 3VF8A 4BBEA 3MIYA 4MBJA 2RG6A 4ACMA 4LQMA 4D4YA 4LRMA 2CDZA 2EXCX 5HO6A 4IMYA 5A4CA 1QPCA 4B4LA 1PMUA 2XP2A 4FIFA 3DB6A 3FKLA 4J99A 4DFZE 2YCRA 4O1OA 2E2BA 5IDPA 2YM8A 4C62A 3R8UA 4ACGA 4DG2E 5CU4A 2ZDTA 3F66A 1O6YA 4CQEA 2YDKA 3Q3BA 3S00A 1V0BA 3FMNA 5JH6A 2HZIA 2PMNX 1WBWA 4OTDA 4XP2A 3SHEA 3TACA 3VJNA 4M15A 3P9JA 4EOQA 4YO4A 4RJ3A 5J5SA 3VW8A 2VV9A 4N6ZA 4YJSA 3Q4TA 4WRSA 4CLJA 3VO3A 3SOCA 2B9FA 2ZAZA 2V22A 5C03A 1YWVA 5HTBA 1H1RA 1FPUA 2XIZA 2YABA 3PY1A 4FTRA 4FV7A 3HDNA 4XP3A 4ASEA 2GTNA 4CQGA 3HAMA 3K5VA 3KXZA 5DEYA 4OTWA 3SRVA 1G3NA 4QP4A 3Q96A 2C6EA 3IGGA 4PTCA 3VQHA 3WZJA 4Q5EA 4E5AX 2IVTA 4UYNA 5HE3A 2CKQA 3DXQA 4APCA 4ZK5A 2YCSA 4I4FA 4D5HA 4FKUA 4EH7A 1YOLA 5FM2A 2C5XA 3I5NA 5HIBA 1IG1A 4U44A 3ZO2A 4CFXA 2Z7SA 3KY2A 4NEUA 4NCTC 3LZBA 4FYNA 3QQFA 1Y91A 2C6MA 4RA4A 3BU5A 2YN8A 4R3RA 5ANDA 5L3AA 2FSTX 1PXMA 3EZRA 4BGGA 4R7BA 2F7XE 5AIRA 2GMXA 4RBLA 2UW6A 5CEMA 3TUDA 3G6GA 4FZ7A 4WNMA 4UMRA 4OT5A 5F1ZA 4BI2A 2WTVA 3QALE 3ZRLA 4CZYB 4PY1A 3ODYX 1O9UA 3COHA 2C3IB 4LV8A 3MPTA 4ZMFA 4GVAA 3G90X 2UW9A 3EQPA 3QRUA 3NIZA 2OW3A 4MXXA 3AMYA 1YI3A 3KRXA 3QRKA 3T9IA 3MFTA 1GY3A 2QR8A 3GC7A 4I6HA 4UEUA 4YSJA 2W1HA 4FSTA 3UC3A 4ITIA 5KMMA 2JC6A 2C3KA 2CCHA 4NW5A 2VGPA 3KK9A 4RJ8A 2Q0BA 2BFXA 4LUEA 4A9SA 4E26A 2R3QA 2UZTA 3C4ZA 2FUMA 4X3FC 1H1SA 5TO8A 3IONA 2GPHA 5A4EA 3OEFX 3GVUA 4KS8A 3D5UA 2WMRA 4JOAA 3PJ2A 2QOOA 3TUCA 3G2FA 1QCFA 3TIZA 1JWHA 3HL7A 3VUGA 1WBTA 2OJGA 3EQIA 5AWMA 5HBEA 1H26A 4HVHA 3IS5A 3QD3A 3HRCA 1YRPA 3IGOA 4U0IA 1RQQA 3PZEA 3R2YA 3RINA 4IB0A 4JT3A 4AWIA 4YUQA 2ITOA 5EHYA 2ZB1A 2P3GX 4NM5A 4R77A 5DT3A 3OG7A 3L9PA 4DGMA 4FKVA 5C8KA 1QL6A 3UO4A 3V3VA 4PPBA 1W0XC 4I3ZA 4I94A 4F0IA 4U3ZA 2HCKA 3NEWA 4FV9A 3LFAA 3RNIA 1PXIA 3AC8A 3QWKA 4UMUA 3NUAA 5EG3A 5IQCA 1Y8YA 4A06A 1Y6BA 4GCJA 3MY5A 4RIYB 2ZM1A 3F3UA 5TR6A 2QVSE 5AP1A 3ORKA 1XWSA 5C27A 4I24A 5IZFA 4L3PA 2BAQA 3BHYA 3FXZA 3EWHA 3MH0A 1YI4A 3UZRA 4I0RA 3R8ZA 3UC4A 2XUUA 3U6HA 3MJ2A 4L00A 5LVPA 5I3RA 4QNAA 1Q8UA 3LFQA 2YAAA 4MKCA 4YNEA 2Z7LA 2Y4PA 4AFJA 3DTWA 4F08A 4R7IA 5CF4A 3TV4A 4DITA 5J1VA 3DFAA 3DKCA 2ERZE 1DAYA 4GYIA 3KREA 2RSVA 3KVWA 1YKRA 5HIEA 2B9HA 2IZUA 4HYSA 4KBKA 4U79A 4QTEA 1OUKA 4BKZA 3GC8A 1PMEA 4PP7A 4O7TA 4WG3A 3NDMA 4CFFA 5LOHA 1PXKA 4O0UA 4D2WA 4KA3A 1ND4A 2AYPA 3W8LA 2X8EA 5I9WA 2XJ2A 4U40A 5FG8A 3TIYA 1J7UA 4G3GA 4QQJA 2UW7A 3DJ6A 4L44A 4D1XA 5L6WL 4I1ZA 2W1ZA 2OI4X 3EJ1A 1OBGA 2UZDA 3CQEA 3F5PA 2QO7A 5EW3A 4TNDA 3NSZA 5H8GA 5BYYA 3EYGA 1BLXA 3CTQA 2YDJA 3FSKA 4JRVA 4DFLA 4CTBA 3IKAA 3K3IA 1LPUA 2WTCA 2BAKA 4F7NA 3QKMA 5BVDA 2OK1A 4F65A 1OITA 3D7TB 1ATPE 1JNKA 5CX9A 1ZRZA 2O3PA 2KTYA 3BE9A 3PTGA 3QQJA 2F7EE 2XJ0A 4FT0A 4NFMA 4XG2A 2JIIA 5HGIA 3PXKA 4EK5A 4IAYA 5CY3A 1FQ1B 4PL4A 2XBJA 4O83A 1PYEA 4U97A 2ETMA 3CJGA 3CR0A 3ORZA 4G17A 2W9FB 4EHGA 4NYEA 4TYHA 3AC4A 1WBOA 3KXXA 5A4QA 2VTIA 2HOGA 4DGGA 3U4UA 4JAIA 3KFAA 4GU6A 4MD8E 4EOIA 4KIOA 2Y4IC 3V5QA 2YWVA 3GP0A 4NUSA 4O38A 3OXZA 4G3DA 3ZBFA 2P2IA 4G3FA 4RVTA 1BL7A 3ZXZA 4F1OA 4U43A 2V7AA 4HPUE 4W8DA 4YU2A 5M07A 4FI1A 4G3EA 4GYGA 3TZMA 4MD9E 4LYNA 5CEOA 3UOKA 5L8KA 3ZH8A 3ID6C 4AS0A 4KUJA 4HYIA 1OKWA 2HXLA 4DN5A 4UXLA 3LLTA 1UVRA 3UMXA 4BHZA 2QONA 4D5KA 5KKRC 4I4EA 3H9FA 4A07A 3AGLA 2CMWA 1ZYCA 4WBBB 4A4XA 1PF8A 3NWWA 2ITWA 4D1SA 5L6OA 5M44A 4FVPA 5M51A 2C0TA 1YDSE 1ZMWA 1CKPA 4V0GB 1M14A 5DN3A 2ITNA 3DXPA 4I6FA 3P7AA 4O7ZA 2PZRA 3U54A 3VBQA 4CFNA 3BEAA 2UW3A 3OMVA 5H8BA 4AA0A 4D9TA 4GEOA 5L4QA 4EZ3A 4MNEA 3FI8A 3FXWA 4USDA 5KMLA 4O2ZA 2PVYA 2WTWA 3Q32A 4ALWA 4FSWA 3PE1A 4YBKA 4YSMA 3LLAA 3Q4UA 4F0FA 3E3BX 4BTFA 4NH1A 3ELJA 1REJA 4EH5A 3HX4A 3KULB 3ZCLA 4TWOA 2ITPA 5DHJA 3FI4A 4BKJA 2HY81 3FEGA 1LR4A 4M69B 5HVJA 4E4NA 5I4NA 2CLXA 3AT2A 3S4QA 3W16A 2BDWA 4RVLA 4N0SA 4KRDA 3ZLYA 4GSBA 4DH7A 3DCVA 4TL0A 4HW7A 3BU6A 5B7VA 3BELA 4GT5A 4Q9SA 5AR5A 4LMNA 1A48A 1PXJA 3RAWA 4RFMA 2XZSA 3PXYA 1OL7A 2OIBA 3P86A 4ITJA 1Z5MA 3I7BA 4ZSJA 4J96A 4P2KA 4ZTLA 1OECA 4FV4A 4C34A 3AMAA 5CTPA 3N51A 4AG8A 2VAGA 4YZMA 3C50A 2WOUA 2I0HA 2WU7A 1PXNA 3ET7A 1V0OA 3KCFA 5KE0A 1TQPA 3P0MA 3REPA 2W1IA 4C4JA 4JVGA 3OCSA 5CT0A 2YHVA 3P08A 1W83A 1IAJA 2VN9A 4BDKA 3PSBA 3QCSA 5KMKA 2WMXA 4LI5A 5I3OA 2BZJA 1XJDA 3R1SA 4CRSA 4DLIA 3FMMA 5JK3A 4PUZA 3EFKA 3A61A 5TF9A 3FMHA 1WVWA 4BRXA 5CAPA 4BYJA 5J7HA 3CBLA 1ZWSA 3DNEA 4W4YA 3KL8A 4WOVA 2PHKA 3R8MA 4PNKA 5AUTA 3TJDA 4B7TA 3FDNA 5M06A 4YBJA 4AACA 2ITYA 3HA8A 4EOLA 4XEYA 1OKVA 3BGPA 1KSWA 1ZMUA 4FTIA 3BV3A 5I9UA 2C6KA 2QU5A 4M14A 4GG5A 3SD0A 3QKLA 2CPKE 4XH6A 2W0JA 4J97A 4FV0A 5CAQA 3MY0A 5CSHA 1IASA 3KVXA 1OIQA 3CC6A 2CSNA 3M11A 2XIYA 5JZJA 3WILA 1JSTA 1YDRE 2B4SB 4YJPA 4RJ6A 4BB4A 4M67A 4TWNA 5AR8A 3MVJA 3RJCA 3KRJA 2VNYA 3DS6A 4TN6A 3MV5A 4BCNA 4E3CA 4LV5A 4RMZA 5HQ0A 2A1AB 3LIJA 4A4OA 3U6IA 3HEGA 4RJ4A 3NNUA 4ZXTA 4XG3A 4DEAA 4O2PA 4IEBA 2YWPA 3ZM9A 3PWYA 3WE8A 4IVAA 4FTUA 1KV1A 4RC2A 2VTPA 1T46A 2X1NA 3JXWA 2VTNA 1PXPA 3QRJA 5HEZA 2QO9A 2V5QA 2PU8A 3QZGA 4FL2A 4GT3A 3PUPA 5AUYA 3V8SA 1LEWA 2OF2A 5DR6A 5ETCA 2GS2A 1REKA 2IVUA 3TUBA 4H1MA 3EN4A 4JLCA 4O7NA 4X21A 4AW2A 4E73A 2WPAA 4RC3A 3C0HA 1CKJA 4PDYA 2WTDA 5FEQA 3QCXA 3VS1A 3PVUA 4ID7A 2WMAA 2QG7A 4RFZA 2X9FA 3G51A 2Z02A 4JI9A 3RGFA 2WMSA 1MRYA 1U5RA 5JGAA 4NJ3A 5KUPA 3H0YA 1MUOA 3A8XA 2G2IA 2BZIB 2XF0A 4O22A 4OAVB 2IO6A 4QYGA 2ONLC 3H0ZA 3D83A 3RM6A 4IAZA 3WI6A 3W1FA 5K5NA 4AW5A 3FPMA 4OTIA 2YERA 2WQBA 2XIRA 5H8EA 1CKIA 1UNHA 4M66A 2YIRA 4DEDA 5FM3A 4BGQA 2HAKA 2JDVA 4OTGA 5GHVA 3OWLA 5HESA 3RPYA 1KOBA 4E93A 3NR9A 5LMKC 5C01A 1QPDA 3V6RA 4EBWA 5EM7A 4O91A 4IX6A 4UZHA 3CD8A 4K9YA 5ANEA 3E62A 2OWBA 1YI6A 2C1BA 1XHAA 4ZAUA 1Q3DA 2WOTA 3P1AA 4KRCA 5EK7A 5F95A 4LOPA 5AA9A 3RPVA 5HD7A 3R7VA 3HP5A 4UZDA 5EW8A 3QKKA 4WA9A 2PUNA 2RF9A 5JEBA 2BTRA 3OVVA 4ZY6A 4FEWA 2R3HA 2XNMA 3Q53A 4CFWA 3FQSA 3IW8A 3VNTA 3MGYA 1A9UA 3NIEA 5AP6A 4HVSA 4JAJA 4MQ2A 5HE2A 2PZ5A 2C30A 1ZYSA 3DAJA 5D7AA 5I9VA 3NVMB 3SGCA 2JAVA 5CSVA 3RZFA 3HNGA 4CD0A 3W2SA 5HO8A 4EHZA 3DTCA 3CY3A 3FMDA 4L3LA 5LXMA 1I09A 1OVEA 3T3VA 2J9MA 3G0FA 3NNWA 2C6LA 3MPMA 3TKHA 3PWDA 4F1TA 5CU0A 4HZRA 2UW8A 1SM2A 2XEYA 4PNIA 3PA3A 3RAIA 3R8PA 1CMKE 3MB7A 5E8SA 3L9LA 4QP1A 3C1XA 3NYNA 4N70A 5AR2A 1GIJA 4C61A 3QTIA 4IZ5A 3UOLA 4F9YA 2ACXA 3NW5A 3F88A 3Q6WA 1XBCA 4IAAA 2HZ0A 4ZEGA 3VUKA 3GU5A 3QFVA 1IAHA 3VUDA 3VC4A 1B6CB 2BALA 1UV5A 3A7JA 3EFWA 3QXOA 4F9WA 2WO6A 5CWZA 3P78A 4HVDA 4FKJA 4DFUA 3O23A 4FODA 3R1NA 3CPCA 2OJIA 5G1XA 4DGLC 3FMKA 4MEDA 1H07A 2XYUA 1YVJA 1TVOA 2C0OA 3OROA 5IA2A 4J8NA 2A19B 3QX2A 2ZV7A 4KBAA 3TDVA 4H3QA 3OWJA 4ONAA 3IO7A 5EM6A 5IA3A 3GNIB 5F20A 2CNVA 2BTSA 5J87A 3MJ1A 4R3CA 3O7LD 3RK9A 3I1AA 3DBDA 1TKIA 2VWIA 4L46A 2IWIA 3BYOA 4Y5QA 4ZJVA 4BCOA 2YM3A 3C5UA 3W18A 4EUUA 3LCTA 5HU9A 5AUWA 1ZAOA 4W9XA 2W06A 5HICA 4PTGA 4QP7A 3WZDA 3I6WA 3DU8A 2C5YA 2UZOA 5CI6A 2G15A 2YISA 5HCYA 3QYZA 2VO6A 3PPZA 3KU2A 4AU8A 4P5ZA 4G6LA 4LGDA 4U5JA 5GIPE 2NP8A 4OBQA 3MESA 3OY3A 2WEVA 3F7ZA 2VNWA 1W82A 4FVQA 4MCVA 3L9NA 3F5UA 4F9BA 4C4IA 2YIXA 4U41A 3KK8A 4UBAA 2NRYA 4C7TA 2YLFA 1JAMA 4X2GA 1Q99A 2V7OA 3CP9A 3V5PA 2JBOA 2WMVA 3VHEA 4I5MA 2QNJA 4OW8A 3PXQA 2X6EA 3QD4A 4EH3A 2OICA 3MA6A 4A9TA 3CKXA 4BZNA 1Q24A 2QCSA 4MNFA 4AA5A 4CMTA 4BIBA 3C4EA 3MPAA 2R2PA 1H01A 3OBGA 5ETFA 3HV3A 2GNIA 3QQUA 2XEZA 4LOQA 4XG9A 3P79A 3OXTA 1WAKA 4C2VA 5HBHA 4B8LA 2UVZA 4NM0A 1M2QA 3PP1A 3ZMMA 3BZ3A 4EH8A 4JQ8A 3E8EA 3VUIA 3AG9A 2QKRA 4EJ7A 2JKMA 4TY1A 3JUHA 5CSPA 4MBIA 4C8BA 1Q8TA 4CTCA 1KE9A 3QHRA 4QMUA 3V5WA 3OXIA 1Q3WA 1XBBA 2Z7RA 3OW4A 2ITTA 3CLYA 3LFDA 4G9CA 4GL9A 4NIFB 5DGZA 5BVKA 5ETIA 4YPDA 5BYZA 3TKIA 2ITVA 3SC1A 3A2CA 3NNXA 2OXYA 2PVJA 1YHWA 2VTQA 1J91A 4IVDA 2IW8A 3UGCA 2QLUA 4EOMA 4CKRA 3PPKA 2HWPA 2FH9A 2XB7A 4H1JA 5GZAA 4E5WA 4EH4A 2XK7A 3QUDA 2YM7A 5H2UA 3NUUA 4YO6A 3CIKA 4I0TA 4FTMA 3ZM4A 2QURA 5DG5A 3D94A 4HZSA 3HZTA 4AGWA 5M08A 5B2MA 2G1TA 2W99B 3JPVA 4O0RA 5M4UA 1O6KA 2Y0AA 1NVRA 4FTTA 4FTNA 4TZRA 1WCCA 2C5OA 2JIVA 4S31A 4AUAA 4C4FA 3TV7A 4DHFA 4E6CA 3KA0A 4PDPA 2QQ7A 3OF0A 3V5LA 3WZKA 4CSVA 3FL5A 5AUUA 1Z9XA 3N4TA 2C47A 1IA8A 3ZSGA 4ZZMA 3OCGA 4JRNA 3ZSIA 2GDOA 1OMWA 3U6JA 3CQWA 4C02A 4W4XA 2I40A 3EL8A 4JBQA 4ZP5A 4BL1A 2NRUA 5GZ9A 1P2AA 2YJRA 2YA9A 4QMOA 4ZTHA 3TZ7A 2J50A 4O81A 1K9AA 3RHKA 4ENYA 3MA3A 4LRKA 4IW0A 4ALVA 1W98A 3TNQB 3RWPA 2H9VA 4CFMA 5EHLA 4EQCA 5IEXA 2IVVA 3E93A 4BBMA 1DS5A 2HXQA 2WGJA 3EQGA 3SOAA 4ZY5A 1O6LA 5CEIA 1DAWA 3O2MA 1APME 1BI8A 4A4LA 4IWOA 5HX6A 3ZDIA 3OP5A 3QTXA 4RC4A 2F2UA 2IJMA 5JFSA 4RJ7A 3ZLXA 5L2WA 1OL2A 3FLWA 4K2RA 4RIWA 2A27A 4NTSA 3SXFA 4DH3A 2XK4A 5EYCA 4TWCA 4RRVA 5JRQA 3POOA 3D5VA 4RVKA 5FEDA 3EQRA 4AP7A 4DE4A 3PY3A 4WUNA 2Y6MA 5KX8A 3AC5A 5E8XA 4ZS4A 4FT3A 5AFVA 2V62A 3COIA 5JFVA 5HE0A 1ZOGA 4J53A 1HCLA 4XLIA 2WNTA 3CE3A 2F49A 4FTJA 4WHZA 4DEBA 1FMOE 2R3GA 2ZVAA 5IQDA 3MH1A 1H00A 4HCUA 5GJFA 5AP7A 5GNKA 2W17A 4K33A 4A9UA 3IW5A 5AR7A 3QZHA 4AOIA 4F64A 2ETKA 4HGTA 4NKAA 3PA5A 4YJUA 5FUTA 3GOPA 3QTZA 4L45A 4YJTA 2FVDA 4DT8A 4O0WA 3RAKA 2XH5A 2GFCA 5AM7A 4I41A 4YZDA 5ANOA 3KRRA 2CN5A 4IX5A 4E4MA 3QUEA 4QYFA 5CU2A 1JPAA 2PUIA 2WMQA 4GT4A 3FJQE 4P90A 5A14A 3I79A 2B0QA 2PZPA 3QU0A 3BLRA 5AP4A 4CFVA 4ALUA 3CGFA 4S32A 1P4FA 4DH5A 5ANKA 1ZYDA 4FKRA 3FPQA 5FP6A 5BVWA 2WFYA 3EN9A 1YXUA 5L2SA 3AOXA 1OUYA 1UKIA 1MQ4A 3BKBA 3CEKA 4FVRA 4QMPA 4YJNA 4D4RA 3SG9A 2VGOA 3UPZA 2BROA 2HW7A 4BDJA 3DK6A 4EQUA 5GZ8A 4FIJA 1UU7A 4HGLA 4RWLA 5BVOA 4KWPA 4FTCA 2LAVA 4HOKA 4NTTA 4FIHA 5HLWA 3PZHA 4S34A 3KRWA 3UJGA 3G15A 4P7EA 5CENA 2PVHA 2UVXA 3KC3A 3BGQA 4EC8A 4FK6A 3NAYA 2F9GA 2C0IA 1KE5A 4DCAA 3KMWA 4TNBA 3MN3A 2YM4A 4KIQA 4X6QC 3VN9A 4DLJA 3U4WA 1GAGA 4I92A 1E1XA 2E9NA 3BPRA 2OXXA 4G34A 3FZOA 3UDBA 4C3PA 4AX8A 5A4TA 4M68A 4KB8A 3C0GA 2Y4IB 4QMXA 3BWFA 1YWNA 3SLSA 5AAGA 3Q04A 3IDCA 5EQPA 5ITAA 1U59A 3NYOA 4LRJA 3Q9YA 1Q62A 4WO5A 2BILB 4JG7A 4M0YA 4R1VA 5EKOA 3RCJA 2XK3A 1BKXA 3FC2A 4L68A 1NVSA 3UBDA 3PJCA 2UW0A 2QC6A 2IG7A 4O0TA 2C1AA 2P55A 2YIWA 3ZZEA 3ZRKA 3BHVA 5LMAA 3ALNA 2BCJA 4NU1A 1WBPA 3E8NA 4RIXB 5D7VA 3DV3A 3RPRA 4BYIA 3UYSA 4WBOA 3F3VA 2GHLA 4KKGA 2C5NA 4DFXE 5KKRB 2WB8A 3ANRA 4NFNA 4OLIA 5DI1A 1UU3A 5CYIA 2YAKA 3FC1X 3GFWA 5IH5A 5IG1A 3D2KA 4BWPA 5L8LA 2EXMA 4JBOA 5CU3A 2R3LA 4E8AA 4IB5A 3ULIA 3WZEA 2BDJA 1AD5A 4IB3A 3GCSA 5HLPA 3OUKA 2WTJA 3OWKA 4O6LA 3SX9A 3T3UA 3WYYA 2Y6OA 2VWVA 2R3MA 4O7VA 2X4FA 3FI3A 1F0QA 4R5YA 2W5HA 4XYFA 4I0SA 4GUBA 4WNOA 2J6MA 5BMSA 3VS5A 3FL4A 5HORA 5LVNA 3GB2A 3UIUA 3IOKA 4PV0A 1UWJA 3RPSA 4B99A 4OT6A 2DYLA 3RCDA 3PG3A 4OAUC 3ORNA 4EHVA 3P5KA 2I0VA 4BCMA 3E64A 2QHMA 5C8NA 2FSLX 4OUCA 4Y95A 2QOIA 1JSVA 3CD3A 3BWJA 3VULA 3WE4A 4DBXA 5IMXA 1URCA 5IA1A 4RVMA 5IA5A 3UVQA 4AGCA 4BKYA 4AW0A 3NW7A 3HV4A 2DS1A 4D4VA 4BY9E 2JKKA 4CV8A 4YTIA 4O6EA 2WMWA 3LPBA 2XRUA 3UO5A 2W7XA 3R83A 5M09A 3E88A 4E4LA 3WBLA 3ZUVA 4LG4A 4O7WA 3R00A 4PMPA 2JKQA 3A7FA 4G31A 4IH8A 2XVDA 4JL9A 3G33A 3OCTA 3QA0A 3UOJA 3I0QA 1J3HA 2OJJA 3MDYA 4RQVA 4TTHB 3ZO4A 3MVMA 4C37A 4QRCA 5CZIA 2WD1A 4Y8DA 3IW4A 2AC5A 4IE9A 2X9EA 2JD5A 1CM8A 1LEZA 3CCNA 3NX8A 3NUPA 4DT9A 5ANGA 2GCDA 2JFMA 3BHTA 4BDCA 4BHNA 4BDEA 3TZ9A 1FMKA 2G2HA 3JYAA 3V04A 4O7SA 4MNEB 3OZ6A 3GU4A 1OGUA 2XNPA 3KQ7A 4FKQA 5K3YA 3ZSHA 2XKEA 2WELA 3R28A 3BYMA 5HOAA 4GJ3A 1AQ1A 4FA2A 2JBPA 3VVHA 4F6UA 2WTIA 3A4PA 4QPAA 4CG9A 3HA6A 4OTQA 4Y83A 3DXNA 4G9RA 2C3JA 2WQEA 3DKGA 2FYSA 2PZYA 4FKLA 2XNGA 4BDIA 3TNWA 4D2PA 1R1WA 3R6XA 2ESMA 3JY0A 3L8VA 4ZLYA 5D10A 3LJ2A 4FNXA 2WEIA 3DPKA 5D12A 1YDTE 3MTFA 4C57A 3BBWA 4ZLOA 1XH5A 2RL5A 3KB7A 5L2TA 3C51A 4FV2A 3IOPA 5AX3A 4AF3A 1BL6A 4BDDA 2JGZA 4FE2A 2ZV2A 3L1SA 4IACA 1ZY4A 3TKUA 3DQWA 3NW6A 2X4ZA 3UO6A 4FKIA 3ITZA 3RVGA 3QTSA 2Z8CA 4AZWA 3HLLA 4BCHA 4FEVA 3PJ3A 4DG0E 4FSUA 2OGVA 3ZYAA 3ZS5A 2H8HA 4QMTA 4YURA 2PMLX 2UZEA 4ZOGA 3U9NA 1L3RE 4JDKA 2Q83A 5HTIA 4CNHA 3BQRA 2W4KA 4CMUA 3NYXA 4GK2A 5KBRA 4QP8A 5BVEA 4AE6A 4E1ZA 3OOMA 4UB7A 1WFCA 4YNOA 2WMUA 3MFSA 4BTJA 1YHSA 2X8IA 4EBVA 3D14A 2ZM4A 5LWMA 5TT7A 3OHTA 4ZLZA 3FLQA 4F0GA 1M7QA 2ITXA 4TRLA 3PA4A 3QLGA 4JR7A 1RW8A 1GIIA 4GS6A 2BMCA 5DA3A 3QA8A 4MD7E 4Q9ZA 5IUHA 2BRNA 2PUPA 2XA4A 4XX9A 2V55A 2E9OA 2PVMA 4K11A 4FC0A 4FGBA 4Y85A 4CGAA 1QPJA 4G3CA 2E9UA 3ZUUA 4HVGA 4EH9A 3PIYA 3DFCB 3OTUA 3BU3A 2QOLA 3AT3A 4JJRA 5E91A 4UY9A 1A06A 4QTBA 3N4UA 2ETRA 2PMOX 2KULA 3S95A 2B7AA 3PXFA 2G2FA 1Q61A 4FK3A 2IW6A 1MRVA 1Q97A 1KE6A 5JZNA 3B8RA 4G16A 4LUDA 4EK4A 3EHAA 5AJQA 4YJQA 1H0VA 2BRMA 4GH2A 1U54B 3HUBA 4D2SA 1JVPP 4QMWA 4WNKA 3QGWA 5J95A 4WG4A 3R01A 5ACKA 4PL5A 5JSMA 3BYSA 4YLJA 5CZHA 4ASZA 1K3AA 4CCBA 4U45A 4EK8A 5HO7A 1XR1A 4DCEA 4H39A 3O71A 3UQCA 1PMVA 4RZWA 1H1PA 1PY5A 1H1WA 1UNGA 3GBZA 3LAUA 4X6RA 4ZSEA 3VBYA 4IWDA 2JDSA 2OZAB 3UIXA 3IK3A 3RAHA 3LCSA 4AOJA 3L8SA 2OO8X 2YLEA 4XNEA 2BPMA 2X8DA 4D28A 5IDNA 2UW4A 3NCGA 3TV6A 3A7IA 5FDPA 3ZZWA 3WF8A 4O82A 2VZ6A 3PLSA 4J8MA 4CYIA 3BCEA 3QC9A 2QR7A 3R02A 4XOYA 4UMPA 5FTGA 2OF4A 2R4BA 1YOMA 3DLZA 3GI3A 2YZLA 3GQLA 3LMIA 3MFUA 4FKTA 2B55A 4YHFA 4AT3A 1PHKA 4B0GA 5JFWA 2ZMCA 3LFEA 5KCVA 5DFPA 5CU6A 4AZFA 4FEUA 4AXAA 1V1KA 3AD6A 5IF1A 3AMBA 3C13A 4L67A 1SZMA 5FLFA 4A9YA 4D2VA 4QQ5A 2XCKA 4LGHA 5B2KA 4ZY4A 3R22A 2QODA 5F9EA 3UIBA 3BHHA 5M4FA 3AD4A 5HCXA 3FQEA 3SXSA 2X81A 2J0LA 4O1PA 3FMEA 4YGAA 3D5WA 4DFYA 3FYJX 4MWHA 3K5UA 1R0PA 4M0ZA 4ZSLA 3ZONA 4CZTA 4ANMA 3MWUA 3C4FA 5IMEA 5HKMA 4BVUA 4FNZA 4BWXA 2JDTA 3PG1A 4TYIA 4TYGA 3Q5IA 2W1GA 4FG8A 4M97A 2XJ1A 1B38A 4M7IA 4QMNA 1F5QA 4BTMA 3ZRMA 3A7HA 3OC1A 3JS2A 3Q4ZA 1YXXA 4EONA 3D7TA 4Z7HA 5CF6A 2VWXA 4EKLA 4IFGA 3DBCA 3BYUA 4C36A 3W2OA 4KSQA 2E9VA 5DMZA 3R30A 2W9ZB 4GIIA 5IEVA 3QTQA 4IANA 4WKQA 4LM5A 4F6SA 2PMIA 2Z7QA 2ITZA 1ZOEA 1YXVA 5CF5A 3DZQA 4MWIA 5CASA 3VW6A 3QCYA 1XKKA 5EW9A 3DOGA 5DE2A 2BKKA 4F99A 1BX6A 4QMVA 3PJ8A 5J1WA 3DAKA 4A7CA 1YQJA 3C9WA 3VUTA 2QI8A 4YZCA 3IPHA 3QZIA 3L8PA 4JQ7A 5IQAA 1ZMVA 4YZBA 4DFBA 4O21A 4Q5HA 4G1WA 2W1CA 4R78A 2I0EA 3QD0A 5EOBA 4UWYA 4UALA 5LCJA 2BDFA 3B8QA 5LMBA 5EDQA 4FTAA 1R78A 5CXZA 3Q9ZA 2OBJA 4GUEA 1ZYLA 4FX3A 2NO3A 1PXOA 1YOJA 1PKGA 3IG7A 4AZTA 2X39A 4LOOA 4D2RA 4N57A 3ORMA 5DLSA 5IKWA 4TT7A 4UV0A 4Y72A 3ZFMA 2DQ7X 4YJRA 3HVCA 4FF8A 4V0GA 3O17A 3VWAA 2ITUA 3PE2A 2BRHA 3CQUA 1PMNA 4HNIA 4KKHA 3Q2MA 3NUXA 3EH9A 4QOXA 2RG5A 4ACHA 4TYJA 5I9ZA 3PJ1A 3VS4A 3A99A 3RPOA 5DR9A 4AW1A 4L42A 5KHWA 1P14A 4YR8A 3DLSA 2RIOA 2J2IB 1R39A 4GFOA 5CNOA 1MP8A 4GV1A 2UZNA 2QHNA 2C6IA 5HG9A 5E8TA 3A7GA 4KSPA 3KULA 5M4IA 3LJ0A 5M56A 4O7RA 3SVVA 5C9CA 4M69A 4BCFA 3QYWA 5IH4A 1OBDA 2Y8OA 4UWCA 3HRFA 3EQFA 4HYUA 4KD1A 5IUIA 3QL8A 1UWHA 2ZM3A 4O86A 4FYOA 3K54A 2P0CA 4IVCA 1SMHA 3I4BA 1QPEA 1K2PA 3L9MA 4FTQA 2J7TA 2PUUA 1JOWB 3QQHA 4U42A 2W1EA 3W33A 5HZNA 5E8WA 5A46A 2EU9A 3QC4A 4WNPA 4JX7A 3LM5A 5EHOA 4J71A 4WD5A 3VS0A 2QO2A 3F82A 4W9WA 5EYKA 1G8AA 3C5IA 3OD6X 4QYYA 5DYJA 4S33A 3RNYA 1V0PA 1GIHA 1WBSA 3LJ1A 3ZDUA 4F09A 2WHBA 3TDWA 3LXLA 4PTEA 1FGKA 5JT2A 3F69A 3H30A 2O2UA 4FSZA 5EQYA 3FKNA 3JVSA 3VUHA 5CEKA 4FTLA 4NKSA 1WZYA 3LFSA 2IW9A 5J7BA 4GMYA 3EQBA 5DEWA 4GRBA 5CI7A 2GNFA 3BV2A 4AT4A 4JIAA 4MXOA 3QTRA 1GZ8A 3BE2A 5KNJA 4XP0A 4ZMEA 2REIA 3DJ5A 2ITQA 4TWPA 4O0SA 2PVRA 4ASXA 2UW5A 5EYDA 2C3LA 2A0CX 3F5XA 4KIKB 4UXQA 2PTKA 1OL1A 2BKZA 2XIKA 3K3JA 3IDBA 4QYHA 5KMNA 4K1BA 1OIYA 4DEIA 3LFCA 2F7ZE 4IXPA 4BDBA 3WARA 3DKOA 5K9IA 3EB0A 5FBOA 3QQKA 5AADA 3F3WA 2GFSA 4ANQA 2RFDA 2HK5A 3UQFA 1JBPE 4CG8A 3R04A 2XNEA 4JG8A 1E9HA 2B54A 2GHMA 2CKPA 3I7CA 1J1BA 3G5DA 2VO3A 5JN2A 2OZOA 3C0IA 3FZRA 4PWNA 3SXRA 1JLUE 2JIUA 4Y5HA 4MTAA 4USFA 2I0YA 5AM6A 1XH9A 3QWJA 4BDGA 5DRBA 2YJSA 3H10A 5FTQA 4CYJA 1U4DA 4H36A 5EI2A 3ATSA 2SRCA 2WMBA 2VTLA 4MH7A 5JMSA 4TKSA 4CRLA 1ZARA 5GIOE 2BRGA 3UODA 4WSYA 2HELA 3UMWA 1UNLA 4F70A 1BMKA 4IZAA 4CKIA 4RX5A 5IU2A 5K5XA 2C5VA 2ZV8A 4QMSA 4XJ0A 4AAAA 4FT9A 1JKKA 4E7WA 5ANIA 5H3QA 4I21A 3R9OA 4XUFA 2CJMA 3FYKX 3JY9A 2R3NA 4XCUA 3S2PA 1OKZA 3GCUA 3GXLA 2VWBA 1EH4A 3DT1A 2UZUE 3KF7A 5EI8A 3NS9A 3VHKA 4ANSA 2VU3A 2VX0A 3D0EA 3DZOA 3G6HA 3NUNA 4RIWB 4DINA 2GHGA 4JG6A 2YM5A 3SDJA 1IRKA 4BCIA 4HGSA 2WZJA 2QG5A 1GOLA 2J0MB 3F2NA 4KS7A 5CQWA 3NUSA 3ROYA 4RWKA 4Y73A 2UZVA 3TJCA 5J9LA 4D4SA 4EOOA 1JSUA 5D9HA 4FUYA 3UYTA 2QKWB 1YW2A 2XS0A 3MY1A 1JKTA 3OCBA 2W1FA 2Y7JA 5LJJA 3VRYA 4IQ6A 2GNGA 2PVKA 3UVPA 1H27A 3HDMA 5IA0A 4PPCA 3V5JA 1KWPA 2PL0A 5LCKA 2BAJA 2IZRA 4AGDA 5BUEA 4I20A 4EEVA 1WBVA 3O8PA 3ZO1A 2XRWA 4FGRA 3GU8A 3OT8A 1H08A 3I60A 3O50A 3DA6A 5KZIA 4UN0C 2EVAA 2JDOA 3L8XA 4FTOA 4W4WA 4N4SA 3R8VA 3NCZA 4RFYA 3RI1A 3A8WA 3LCKA 4CVAA 1VEBA 5IEYA 4W8EA 3RHXA 1NXKA 2BIKB 5BX0A 2VUWA 4X2NA 3DDQA 2CGUA 4NJDA 2WQOA 4AN9A 5AR4A 2R64A 4JDHA 3W8QA 5AP2A 1Q8YA 5LWNA 2A4LA 5JGDA 3ZO3A 4EORA 5E7RA 5EKNA 5B0XA 4DA5A 1DI8A 4R8QA 4X7QA 1KV2A 3H4JA 3Q5ZA 4FKPA 2PVLA 4A9RA 3FLNC 1CDKA 3H9OA 2OH4A 4GFMA 5HVYA 3DGKA 5BVNA 1G8SA 4P5QA 3SAYA 3FSFA 5CSWA 4J52A 4PP9A 2ZV9A 4QPMA 3OTVA 2R3JA 3QUPA 1STCE 4AZVA 3T9TA 3SRVB 5FXRA 5JFXA 3EFLA 3LFBA 4NM3A 3UPXA 3U87A 1WVXA 3QTWA 1XH6A 2OH0E 4M13A 3FMLA 2HENA 2AUHA 3WF6A 3LKMA 4NWMA 4GW8A 3BGZA 4FOBA 2X2LA 4OTRA 5AV4A 3VS2A 5HNGA 3WF5A 2JEDA 3EN7A 4FIIA 5ICPA 5L6PA 2JDRA 3A62A 1NVQA 2XKFA 4ZTMA 4U7ZA 1OPKA 3KXHA 2OKRA 2F4JA 5DWRA 4DTBA 3NAXA 2WXVA 4Z9LA 4CLIA 2XM8A 5E8ZA 2VTHA 2O5KA 1W7HA 2WMTA 4BDHA 4MXZA 3R2BA 4ZTNA 3Q9XA 3KF4A 5CLPA 4ZTQA 4EUTA 5J79A 4PQNA 1M7NA 4WRGA 3VIDA 2FSMX 2R5TA 3PVGA 4FKGA 1LP4A 3Q60A 4XG6A 3BLHA 2CGVA 2IN6A 5F4NA 4U80A 2XK9A 1MRUA 3I81A 5HLNA 4FBXA 1P4OA 3PY0A 5CALA 1FBNA 2CCIA 3QRTA 4U6RA 1ZXEA 4CFUA 3IDPA 4GU9A 4XS2A 1XH7A 5IQIA 2IPXA 4TYEA 3CPBA 3NYVA 4RGJA 1XH4A 4X0MA 3WF9A 3ZLWA 1WMKA 4L01A 3LE6A 1YWRA 4BF2A 4D1ZA 1I44A 1JKLA 4QT1A 4KAOA 3RK5A 3UP2A 3EIDA 2PWLA 4X2JA 2XK8A 4FSNA 3W2CA 5IQBA 4CV9A 5K4JA 2J0KA 1XO2B 4GIHA 3ZFXA 3QQLA 5GINE 2I1MA 3CTJA 3E63A 2GQRA 2ZB0A 5M4CA 4PMMA 5HNBA 4JR3A 1Q41A 2EXEA 5E1EA 4HPTE 3C4XA 4J1RA 4M12A 5C4KA 3TZ8A 3A4OX 2BHEA 2PVNA 3PYYA 4IIRA 4IJ9A 5KBQA 4XV3A 3R63A 4YLKA 5BYLA 2P33A 4HJOA 4EOJA 4IX3A 2CKOA 4FNWA 1YHVA 2VTJA 2WQNA 4AZEA 2HYYA 2E9PA 2OG8A 2QOHA 3FAAA 4YP8A 3ZBXA 4EZ5A 5LVOA 3NMUF 4I6QA 1Q8WA 3F2AA 3CGOA 3R21A 4NIFA 4UMTA 5KZ0A 4BC6A 5CSXA 2ERKA 4DH1A 1P5EA 3WZUA 3CTHA 1OI9A 4QTCA 4KABA 2XBAA 4NCTA 4JIKA 2R3FA 4TW9A 1PW2A 2H96A 3WYXA 4HNFA 4EI4A 3BLQA 1UU9A 2YZAA 3TL8A 2YM6A 4BICA 5E8VA 1R3CA 1QMZA 4FZFB 4X2FA 4YHJA 1WVYA 4BIDA 2OU7A 2C4GA 4DGNA 3U8WA 2VTOA 1XQZA 4FG9A 2BZKB 4YZNA 2XKDA 4FL1A 3KMUA 4LL5A 3DQXA 1IR3A 2XNBA 4YC6A 4L43A 3UNZA 3VQUA 5E8YA 4MX9A 3TTIA 2BFYA 3ETAA 3HMPA 4QP9A 5AIKA 4EKKA 3E87A 5AAEA 3IW6A 2H34A 3E3PA 4EOSA 2UZLA 3DBEA 4YHTA 4KNBA 5HU3A 3P4KA 3UIMA 1L8TA 4EK3A 4UWBA 4BCPA 4C4HA 2XNNA 4EH2A 3BHUA 2OIDA 3SV0A 4FOCA 4K18A 3R8LA 3H3CA 2IZSA 4X3FA 4LFIA 3DKFA 2P4IA 4RIOA 5A6OA 3HKOA 3QRIA 4KBCA 4PMSA 5IQHA 3KKVA 3EKKA 3ENHA 3MS9A 4BWKA 4D58A 4Z16A 5FQDC 2UZWE 4ARKA 3QF9A 4IZ7A 4UYAA 5HG5A 4DGOA 4DEGA 3G9NA 3C7QA 2CLQA 1XBAA 4EOKA 5EDPA 3TNPC 4HVIA 3R9RA 2CN8A 5EM8A 4R1YA 4C35A 1H25A 3ZLSA 4EYMA 1SNUA 5EDRA 3MTLA 2GNLA 4EC9A 1S9IA 5TKDA 1H0WA 4LGGA 5K0XA 4FKWA 3BQCA 2O0UA 4ENXA 3D9VA 3ERKA 3S3IA 1J7IA 3ACJA 5A54A 3MFRA 2YACA 1GJOA 2BZHB 4YTCA 5HBJA 4AZSA 1RDQE 2EB3A 3LVPA 4NT4A 3CY2A 4TYHB 5DIAA 4JBPA 2W1DA 4J95A 4K6ZA 1Q5KA 4QO9A 4Z3VA 1GZOA 3FY0A 2UVYA 3QHWA 3LMGA 5DPVA 5JRSA 3RZBA 5FGKA 4RJ5A 3FMJA 3PVBA 3ZUTA 4CKJA 5DOSA 4BFMA 3NUYA 4IJPA 2C6TA 5AP5A 3N4VA 3FBVA 4Y46A 2ZMDA 4YC8A 3R9NA 2W05A 3ORLA 5E9EA 2YEXA 3TEIA 3EL7A 3RM7A 3OWPA 4APPA 1OKYA 2GU8A 3LFNA 4BCJA 4FV6A 4V05A 3V6SA 3S0OA 3VUMA 5AMNA 2C69A 1OIRA 1Y57A 4ORKA 2QLQA 5T68A 1PJKA 4XOZA 4E20A 4H58A 1AGWA 3SW7A 3BX5A 4ZJJA 2PVFA 2PPQA 4EL9A 3VBTA 4CT2A 3R73A 3F7WA 4RX9A 5TOZA 3V5TA 4MXCA 1UU8A 4OBOA 4YJOA 4C58A 5BUIA 4ACCA 3TT0A 5M57A 4FEXA 1PKDA 2X7OA 3ZOSA 2HZ4A 3DDPA 4P4CA 5A9UA 3LW0A 2EUFB 3F9NA 3DK3A 4MXYA 1T45A 2C6DA 4RSSA 4DC2A 4GKIA 2XCHA 4DAWA 4DYMA 3VBXA 4QQTA 1M52A 3AQVA 3ODZX 3MSSA 4EZ7A 1G5SA 3FLYA 3EYHA 4FSYA 3DAEA 4WT6A 2ZJWA 1YXSA 5EQEA 3EN5A 3IECA 3TM0A 1UKHA 3PPJA 5CEQA 5CEPA 3FZPA 3GGFA 1IA9A 1E1VA 5BVFA 1FINA 4BDAA 2GS7A 3FXXA 4QD6A 1ZOHA 1DI9A 3WIGA 4Q2AA 3V51A 3TNIA 4GK4A 4C2WA 3UNJA 5HVKA 2FA2A 3NZ0A 5CAVA 1FGIA 4G5PA 5EH0A 3KN6A 4ZSAA 5D1JA 2VRXA 3BRBA 2GQSA 1FVTA 3RBWA 3CS9A 3AC2A 4IWQA 4U8ZA 4IWPA 2F57A 2VO0A 1MQBA 4O84A 1M2RA 3FKOA 3R9DA 4BIEA 4G6OA 3GFEA 4XRLA 1DM2A 1PXLA 3ORXA 3FLSA 4ZZNA 2G01A 4QPSA 4J7BA 5JQ5A 3HV6A 2R9SA 1TQIA 5ETAA 2XIXA 1FOTA 4F9CA 1OZ1A 4FV3A 4J98A 4C33A 4BZOA 4YMJA 4RIXA 4YPSA 4BGHA 2YCQA 5BUJA 5C26A 4IAKA 4PL3A 4JQEA 2OXDA 4MBLA 2BIYA 5LVLA 5FXQA 3PXZA 1NA7A 2C6OA 4BBFA 4DG3E 4QTAA 3KCKA 4RLLA 4S2ZA 3Q4CA 4L7SA 1ZLTA 3OFMA 1RE8A 4K8AA 3K2LA 3TNHA 1KUTA 2OLCA 4I23A 2PE1A 4NM7A 3A60A 2GTMA 2HZNA 4ZJIA 1GZNA 1OL6A 2R7BA 4V01A 5HCZA 4F4PA 2XNOA 2JFLA 4FV5A 3SKCA 4FSQA 5FTOA 2GNHA 3PSCA 3LMHA 5E90A 5AAFA 4O96A 4S30A 1Y6AA 3NGAA 3VAPA 4FMQA 4O27B 4OTFA 3ORIA 5FDXA 3DB8A 4FZDB 3RWQA 4C3RA 3W10A 2VTSA 3QTUA 2PK9A 3B2TA 2PSQA 2ZDUA 2O64A 2PZIA 3W2PA 4F7JA 3GCPA 3LXPA 3KMMA 3QZFA 4FT5A 4YLLA 3ALOA 1RJBA 4AE9A 4EYJA 4F9AA 2R3OA 4RA5A 4RIYA 4YC3A 3PVWA 4FL3A 4MF1A 1VYWA 4PDSA 2IZTA 2W96B 1TQMA 4RWJA 3QD2B 5DNRA 3GOKA 4X2KA 4QMZA 4Z7GA 5A4LA 3BI6A 3LXKA 4AQCA 2CNUA 4WG5A 3OY1A 4FKSA 3FUPA 3HUCA 4MAOA 4QP3A 4ZSGA 2OJ9A 5IQEA 4XMOA 3COMA 1J1CA 2WTKB 4XV1A 5DVRA 1BI7A 4L3JA 5A6NA 2FSOX 2FO0A 5BNJA 2VWZA 3D5XA 4D0WA 4E6DA 3MBLA 3QQGA 3OT3A 3M1SA 4DBNA 3PSDA 3ATTA 4CEGA 4EOPA 4ERWA 4XG7A 4IAFA 3M42A 4O0VA 5HTCA 5KMJA 4E4XA 5A3XA 2R3IA 5C4LA 5CNNA 2X0GA 3HMNA 4IAIA 5AP0A 5EM5A 5T6KA 2J90A 3ZC5A 4C3FA 1FVVA 3F5GA 3QLFA 3R1QA 1H1QA 2EB2A 4XV2A 4FZAB 1XH8A 3R7YA 3TN8A 3UQGA 4AFEA 4G5JA 4Z55A 5I0BA 4ASDA 4IC8A 5ANJA 3II5A 5HI2A 3OBJA 3W32A 5AP3A 4USEA 3UE4A 4OTHA 4OR5A 4QMYA 2VO7A 2R3RA 1R0EA 3FHRA 5EI6A 5FP5A 4C59A 4FICA 3EZVA 2QU6A 4IBMA 3POZA 4YTFA 3GC9A 3HV7A 2VX3A 3RKBA 3Q2JA 3TXOA 2VD5A 3TI1A 3FHIA 3ZXTA 2QOFA 5L2IA 4OGRA 3UNKA 3R71A 5BMMA 3GC0A 3PRIA 2CGXA 4V04A 4MK0A 3RMFA 4FT7A 4JS8A 5KMIA 4RQKA 1HOWA 3KEXA 2J5FA 3AXWA 3JVRA 4MXAA 2B9IA 2WIHA 4GG7A 4ACDA 1WBNA 1KOAA 2ZOQA 3QX4A 4IADA 4R7HA 2I6LA 2UUEA 1JKSA 2XYNA 3LQ5A 3QBNA 5I9XA 4ANBA 4HCVA 4NSTA 2J5EA 2V0DA 3OUNB 4EH6A 5M55A 3TG1A 2JITA 1VR2A 2VTRA 4QMLA 3R7EA 4I5HA 3LOKA 4ITHA 4EHEA 3MVHA 2HIWA 4HYHA 2Y9QA 3FQHA 3OOGA 5IISA 4H3BA 4ANNA 3BBTB 2XKCA 2IVSA 3OW3A 2PE0A 4M3QA 3HMIA 3W2RA 3HAVA 3P7BA 2VWUA 1OIUA 2WU6A 2YFXA 5HD4A 2ONLA 2VTMA 4GK3A 3VBWA 4D0XA 1H8FA 1H4LA 2OFUA 4X3JA 3G9LX 4EK6A 1NY3A 4JXFA 3HGKA 2YCFA 5FD2A 4XHKB 4NL0A 3I6UA 5G6VA 3HMMA 3QCQA 4FIEA 2H6DA 3MIAA 3MB6A 3BYVA 4FUXA 1KE7A 4G2FA 4K0YA 5LMKA 3CSVA 2YDIA 3Q9WA 2YITA 1U46A 1X8BA 3R7UA 3NLBA 4F7SA 1SYKA 3AC1A 3PLAE 4C4EA 1W84A 4UX9A 3PFQA 2X7FA 1U54A 4EWQA 3O96A 3FY2A 4DFNA 4WSQA 5H9BA 3PP0A 3B2WA 2NNWB 3O8UA 4U81A 3GU6A 3H9RA 2VTAA 5JQ8A 3NVKI 1M2PA 4KKEA 4XBRA 3THBA 3E8DA 1ZY5A 3UZPA 4BCQA 3O51A 5HNIX 1U5QA 5L8JA 4AN3A 2OZAA 2R0IA 5E8UA 5IQFA 5GJGA 5DT4A 4C0TA 3UZTA 3F6XA 5EOLA 3ROCA 4D2TA 2B53A 5LARA 3GU7A 1SVEA 3BEGA 3P7CA 2Z2WA 4PF4A 5K0KA 1OPLA 5CXHA 3ORTA 4FZ6A 2FB8A 2WIPA 3N9XA 3E7OA 2DWBA 4FV8A 3SG8A 1OM1A 4TXCA 3EOCA 5DH3A 3JR1A 4L7FA 4QNYA 2CHLA 3EQDA 3UVRA 2WKMA 3PDTA 1Z57A 5DRDA 5CVHA 2OIQA 5I5ZA 2Z60A 2YIYA 3P23A 2J0JA 1PRYA 2XM9A 4DEHA 5K4IA 3GEQA 5HIDA 3DY7A 4IM2A 2WTKC 4F63A 4YJVA 1VYZA 2ZYBA 4XLVA 2HW6A 3E5AA 3LQ8A 2VWWA 2X6DA 5IH6A 1IEPA 5CANA 4F7LA 4BCKA 3EMGA 5CQUA 4FKOA 4BTKA 2RGPA 3CKWA 5KO1A 2LGCA 2XK6A 2BUJA 2DUVA 4JDIA 1LUFA 3UP7A 4FSMA 3ZTXA 2R3KA 2WQMA 3LM0A 1NW1A 5AUVA 1URWA 5DR2A 2X2KA 5DBXA 2JKOA 4FSRA 4I5CA 4PRJA 3LCOA 4II5A 3W2QA 4OBPA 2B52A 4L53A 2QD9A 3W55A 3O8TA 2BR1A 3MW1A 5HG8A 2UZBA 3BIZA 5EFQA 3C4WA 3TWJA 2W4JA 3CJFA 4O7LA 1M17A 4L6QA 3MH2A 3R7GA 2VTTA 3FLZA 3F2RA 4PX6A 2O8YA 4DEEA 3LHJA 5C1QB 3LFFA 4BZDA 4D55A 3EN6A 4MVFA 4H05A 2GS6A 4DH8A 1Q8ZA 4D9UA 3WOWA 3GQIA 4BDFA 1ERKA 5TE0A 2J4ZA 2QOCA 5L2QA 5AV1A 3R7IA 4QQCA 4ANOA 4IB1A 3ANQA 3PRFA 4NK9A 4W4VA 3COKA 3DK7A 3FZSA 4RX7A 1OL5A 3R7OA 3RALA 1BYGA 3V8WA 4AOTA 3ENMA 2R0UA 1W8CA 3R0TA 2QOKA 4PMTA 4RPVA 5AR3A 4FTKA 4U9AA 4IC7A 4I6BA 5IA4A 4ZZOA 4RWIA 1VZOA 2X2MA 5J9YA 4EJNA 2CKEA 2JAMA 3QAME 3PIZA 4EWHA 1UA2A 2RKUA 4I22A 5AV3A 3U51A 3ULZA 4QMQA 4RZVA 4XBUA 4ANLA 3AC3A 3UTOA 3DBFA 1VJYA 1B39A 1H28A 3MH3A 4LL0A 4NW6A 3NRMA 5D11A 3HYHA 3PIXA 5FXSA 4PPAA 4JNWA 1Y8GA 3FWQA 3GCQA 1BUHA 4R5SA 2PE2A 4RLKA 3ORPA 3VJOA 4AN2A 4HGEA 4FV1A 5FWKK 5DT0A 4EQMA 3GENA 5AX9A 3VS6A 4BCGA 4F1MA 2Q0NA 4XV9A 3GCVA 5AV2A 5CVFA 3IQ7A 5HE1A 1KE8A 4F6WA 5CAUA 2B9JA 3T8OA 5AUXA 3OS3A 4AA4A 5HHWA 5KHXA 2RFNA 4RG0A 4CT1A 5HX8A 4O7YA 1YXTA 3MYGA 5C8MA 3VBVA 3V01A 4KIPA 4ZS0A 3ACKA 4I5PA 5F94A 2PULA 4ZTSA 3SA0A 3EQHA 3Q52A 5AV0A 5CT7A 3KN5A 3SQQA 4IDTA 1ZYJA 5CVGA 4O0YA 1SVGA 2JLDA 4CZUA 3UOHA 4QP6A 3LXNA 3VS7A 4RX8A 2YIQA 3Q6UA 3ZEPA 2CGWA 3FZTA 3EKNA 4OTPA 3VRZA 3SW4A 2O65A 5JKGA 1PYXA 2B1PA 3O0GA 4E5BA 2GQGA 3LQ3A 3D15A 3TCPA 4B6LA 1GNGA 3D7ZA 4O0XA 3U9CA 4R6VA 4XG8A 3ZEWA 1FVRA 5AA8A 5BPYA 3EQCA 2X7GA 2EWAA 3NNVA 2W5AA 2WAJA 2BVAA 3D4QA 3E8CA 4QYEA 5BQ0A 4IM0A 3HV5A 4MQ1A 1S9JA 4H3PA 4B8MA 4L8MA 5CF8A 4JBVA 5J8IA 2BHHA 4AGUA 4LMUA 4L9IA 4KIKA 2BRBA 4IX4A 4BR3A 2I7QA 2HWOA 2A2AA 1JQHA 5CAOA 1OB3A 3FZ1A 4DTKA 2J0IA 3F3ZA 3VS3A 3C4CA 5JGBA 3IW7A 2OJFE 3KXGA 3EFJA 3HECA 4K77A 4WUAA 3I5ZA 2FGIA 3UG2A 1HCKA 3MI9A 4KINA 5J9ZA 3KGAA 1Q4LA 5M53A 4FEQA 3G0EA 4QMMA 3V8TA 4GFGA 2PY3A 4UMQA 5J5TA 4R3PA 4TPTA 4U3YA 5ACBC 3E7VA 4N6YA 3DJ7A 4ZIMA 4BI1A 3O7LB 4IDVA 4XRJA 3MVLA 3AT4A 3R1YA 4FIGA 3R9HA 3GUBA
chains in the Genus database with same CATH superfamily
2W5BA 4E6AA 3UG1A 3UDSA 3RTPA 4FR4A 3TTJA 2OSCA 4GJ2A 3ZU7A 4AT5A 5HG7A 4ZTRA 4GKHA 4X3FB 4PDOA 3M2WA 3F61A 4BI0A 1GZKA 4CCUA 3AGMA 4QTDA 3LCDA 3WF7A 2CNQA 1CSNA 5LQFA 1ZZ2A 5AEPA 2RFEA 2HY0A 4E6QA 4IM3A 4IZYA 5IQGA 4GVJA 4M8TA 2PYWA 3U55A 4CXAA 5LVMA 4XG4A 1SVHA 4JX3A 3VF9A 5D41A 2NPQA 4BN1A 5FEEA 5KMOA 3S1HA 4B9DA 1OPJA 3FE3A 4IHPA 3PXRA 5EYMA 4YTHA 1J7LA 3KXNA 3E92A 2QOQA 5B2LA 2AC3A 3FI2A 2R3PA 4O4DA 2X0QA 5T3QA 5E1SA 2C68A 2O63A 2GNJA 3DNDA 4MF0A 4WIHA 5IUGA 4DF3A 2GSFA 1CTPE 2RFSA 4QP2A 4YZ9A 4MHAA 3RK7A 4IFCA 2G9XA 5CS6A 2R7IA 3FV8A 2VX1A 3I0OA 3CXWA 3KXMA 3HP2A 5I9YA 2UV2A 3QGYA 2XMYA 4FNYA 5IPJA 2P2HA 1H24A 3AD5A 2QOBA 4M84A 3HRBA 5E4HA 4JDJA 3DBQA 3ZHPC 5AUZA 4ERKA 3HMOA 4NZWB 4MYGA 3KRLA 2F2CB 3F3TA 4RT7A 3ZC6A 2OFVA 1F3MC 1ZZLA 2J51A 4IVBA 3RP9A 4FG7A 4C38A 1NT2A 4DTAA 2W4OA 3NPCA 4L52A 3QXPA 3D2IA 1SNXA 3OEZA 3GT8A 4I93A 5FBNC 5GJDA 5FRIA 3ZFYA 3WIKA 4CMOA 4HCTA 4G6NA 5E92A 4C4GA 2VWYA 3VF8A 4BBEA 3MIYA 4MBJA 2RG6A 4ACMA 4LQMA 4D4YA 4LRMA 2CDZA 2EXCX 5HO6A 4IMYA 5A4CA 1QPCA 4B4LA 1PMUA 2XP2A 4FIFA 3DB6A 3FKLA 4J99A 4DFZE 2YCRA 4O1OA 2E2BA 5IDPA 2YM8A 4C62A 3R8UA 4ACGA 4DG2E 5CU4A 2ZDTA 3F66A 2XANA 1O6YA 4CQEA 2YDKA 3Q3BA 3S00A 1V0BA 3FMNA 5JH6A 2HZIA 2PMNX 1WBWA 4OTDA 4XP2A 3SHEA 3TACA 3VJNA 4M15A 3P9JA 3UDZA 4EOQA 4YO4A 4RJ3A 5J5SA 3VW8A 2VV9A 4N6ZA 4YJSA 3Q4TA 4WRSA 4CLJA 3VO3A 3SOCA 2B9FA 2ZAZA 2V22A 5C03A 1YWVA 5HTBA 1H1RA 1FPUA 2XIZA 2YABA 3PY1A 4FTRA 4FV7A 3HDNA 4XP3A 4ASEA 2GTNA 4CQGA 3HAMA 4QDVA 3K5VA 3KXZA 5DEYA 4OTWA 3SRVA 1G3NA 4QP4A 3Q96A 2C6EA 3IGGA 4PTCA 3VQHA 3WZJA 4Q5EA 4I6LA 4E5AX 2IVTA 4UYNA 5HE3A 2CKQA 3DXQA 4APCA 4ZK5A 2YCSA 4I4FA 4D5HA 4FKUA 4EH7A 1YOLA 5FM2A 2C5XA 3I5NA 5HIBA 1IG1A 4U44A 3ZO2A 4CFXA 2Z7SA 3KY2A 4NEUA 4NCTC 3LZBA 4FYNA 3QQFA 1Y91A 2C6MA 4RA4A 3BU5A 2YN8A 4R3RA 5ANDA 5L3AA 2FSTX 1PXMA 3EZRA 4BGGA 4R7BA 2F7XE 5AIRA 2GMXA 4RBLA 2UW6A 5CEMA 3TUDA 3G6GA 4FZ7A 4WNMA 4UMRA 4OT5A 5F1ZA 4BI2A 2WTVA 3QALE 3ZRLA 4CZYB 4PY1A 3ODYX 1O9UA 3COHA 2C3IB 4LV8A 3MPTA 4ZMFA 4GVAA 3G90X 2UW9A 3EQPA 3QRUA 3NIZA 2OW3A 4MXXA 3AMYA 1YI3A 3KRXA 3QRKA 3T9IA 3MFTA 1GY3A 2QR8A 3GC7A 4I6HA 4UEUA 4YSJA 2W1HA 4FSTA 3UC3A 4ITIA 5KMMA 2JC6A 2C3KA 2CCHA 4NW5A 2VGPA 3KK9A 4RJ8A 2Q0BA 2BFXA 4LUEA 4A9SA 4E26A 2R3QA 2UZTA 3C4ZA 2FUMA 4X3FC 1H1SA 5TO8A 3IONA 2GPHA 5A4EA 3OEFX 3GVUA 4KS8A 3D5UA 2WMRA 4JOAA 3PJ2A 2QOOA 3TUCA 3G2FA 1QCFA 3TIZA 1JWHA 3HL7A 3VUGA 1WBTA 2OJGA 3EQIA 5AWMA 5HBEA 1H26A 4HVHA 3IS5A 3QD3A 3HRCA 1YRPA 3IGOA 4U0IA 1RQQA 3PZEA 3R2YA 3RINA 4IB0A 4JT3A 4AWIA 4YUQA 2ITOA 5EHYA 2ZB1A 2P3GX 4NM5A 4R77A 5DT3A 3OG7A 3L9PA 4DGMA 4FKVA 5C8KA 1QL6A 3UO4A 3V3VA 4PPBA 1W0XC 4I3ZA 4I94A 4F0IA 4U3ZA 2HCKA 3NEWA 4FV9A 3LFAA 3RNIA 1PXIA 3AC8A 3QWKA 4UMUA 3NUAA 5EG3A 5IQCA 1Y8YA 4A06A 1Y6BA 4GCJA 3MY5A 4RIYB 2ZM1A 3F3UA 5TR6A 2QVSE 5AP1A 3ORKA 1XWSA 5C27A 4I24A 5IZFA 4L3PA 4BJJB 2BAQA 3BHYA 3FXZA 3EWHA 3MH0A 1YI4A 3UZRA 4I0RA 3R8ZA 3UC4A 2XUUA 3U6HA 3MJ2A 4L00A 5LVPA 5I3RA 4QNAA 1Q8UA 3LFQA 2YAAA 4MKCA 4YNEA 2Z7LA 2Y4PA 4AFJA 3DTWA 4F08A 4R7IA 5CF4A 3TV4A 4DITA 5J1VA 3DFAA 3DKCA 2ERZE 1DAYA 4GYIA 3KREA 2RSVA 3KVWA 1YKRA 5HIEA 4JMQA 2B9HA 2IZUA 4HYSA 4KBKA 4U79A 4QTEA 1OUKA 4BKZA 3GC8A 1PMEA 4PP7A 4O7TA 4WG3A 3NDMA 4CFFA 5LOHA 1PXKA 4O0UA 4D2WA 4KA3A 1ND4A 2AYPA 3W8LA 3BL9A 2X8EA 5I9WA 2XJ2A 4U40A 5FG8A 3TIYA 1J7UA 4G3GA 4QQJA 2UW7A 3DJ6A 4L44A 4D1XA 5L6WL 4I1ZA 2W1ZA 2OI4X 3EJ1A 1OBGA 2UZDA 3CQEA 3F5PA 2QO7A 5EW3A 4TNDA 3NSZA 5H8GA 5BYYA 3EYGA 1BLXA 3CTQA 2YDJA 3FSKA 4JRVA 4DFLA 4CTBA 3IKAA 3K3IA 1LPUA 2WTCA 2BAKA 4F7NA 3QKMA 5BVDA 2OK1A 4F65A 1OITA 3D7TB 1ATPE 1JNKA 5CX9A 1ZRZA 2O3PA 2KTYA 3BE9A 3PTGA 3QQJA 2F7EE 2XJ0A 4FT0A 4NFMA 4XG2A 2JIIA 5HGIA 3PXKA 4EK5A 4IAYA 5CY3A 1FQ1B 4PL4A 2XBJA 4O83A 1PYEA 4U97A 2ETMA 3CJGA 3CR0A 3ORZA 4G17A 2W9FB 4EHGA 4NYEA 4TYHA 3AC4A 2X0PA 1WBOA 3KXXA 5A4QA 2VTIA 2HOGA 4DGGA 3U4UA 4JAIA 3KFAA 4GU6A 4MD8E 4EOIA 4KIOA 2Y4IC 3V5QA 1VLRA 3GP0A 4NUSA 4O38A 2YWVA 1G8KA 3OXZA 4G3DA 3ZBFA 2P2IA 4G3FA 4RVTA 1BL7A 3ZXZA 4F1OA 4U43A 2V7AA 4HPUE 4W8DA 4YU2A 5M07A 4FI1A 4G3EA 4GYGA 3TZMA 4MD9E 4LYNA 5CEOA 3UOKA 5L8KA 3ZH8A 3ID6C 4AS0A 4KUJA 4HYIA 1OKWA 2HXLA 4DN5A 4UXLA 3LLTA 1UVRA 3UMXA 4BHZA 2QONA 4D5KA 5KKRC 4I4EA 3H9FA 4A07A 3AGLA 2CMWA 1ZYCA 4WBBB 4A4XA 1PF8A 3NWWA 2ITWA 4D1SA 5L6OA 5M44A 4FVPA 5M51A 3AKLA 2C0TA 1YDSE 1ZMWA 1CKPA 4V0GB 1M14A 5DN3A 2ITNA 3DXPA 4I6FA 3P7AA 4O7ZA 2PZRA 3U54A 3VBQA 4CFNA 3BEAA 2UW3A 3OMVA 5H8BA 4AA0A 4D9TA 4GEOA 5L4QA 2AEGA 4EZ3A 4MNEA 3FI8A 3FXWA 4USDA 5KMLA 4O2ZA 2PVYA 2WTWA 3Q32A 4ALWA 4FSWA 3PE1A 4YBKA 4YSMA 3LLAA 3Q4UA 4F0FA 3E3BX 4BTFA 1TFFA 4NH1A 3ELJA 1REJA 4EH5A 3HX4A 3KULB 3ZCLA 4TWOA 2ITPA 5DHJA 3FI4A 4BKJA 2HY81 3FEGA 1LR4A 4M69B 5HVJA 4E4NA 5I4NA 2CLXA 3AT2A 3S4QA 3W16A 2BDWA 4RVLA 4N0SA 4KRDA 3ZLYA 4GSBA 4DH7A 3DCVA 4TL0A 4HW7A 3BU6A 5B7VA 3BELA 4GT5A 4Q9SA 5AR5A 2IF8A 4LMNA 1A48A 1PXJA 3RAWA 4RFMA 2XZSA 3PXYA 1OL7A 2OIBA 3P86A 4ITJA 1Z5MA 3I7BA 4ZSJA 4J96A 4P2KA 4ZTLA 1OECA 4FV4A 4C34A 3AMAA 5CTPA 3N51A 4AG8A 2VAGA 4YZMA 3C50A 2WOUA 2I0HA 2WU7A 1PXNA 3ET7A 1V0OA 3KCFA 5KE0A 1TQPA 3P0MA 3REPA 2W1IA 4C4JA 4JVGA 4LV7A 3OCSA 5CT0A 2YHVA 3P08A 1W83A 1IAJA 2VN9A 4BDKA 3PSBA 3QCSA 5KMKA 2WMXA 4LI5A 5I3OA 2BZJA 1XJDA 3R1SA 4CRSA 4DLIA 3FMMA 5JK3A 4PUZA 3EFKA 3A61A 5TF9A 3FMHA 1WVWA 4BRXA 5CAPA 4BYJA 5J7HA 3PUFC 3CBLA 1ZWSA 3DNEA 4W4YA 3KL8A 4WOVA 2PHKA 3R8MA 4PNKA 5AUTA 3TJDA 4B7TA 3FDNA 5M06A 4YBJA 4AACA 2ITYA 3HA8A 4EOLA 4XEYA 1OKVA 3BGPA 1KSWA 1ZMUA 4FTIA 3BV3A 5I9UA 2C6KA 2QU5A 4M14A 4GG5A 3SD0A 3QKLA 2CPKE 4XH6A 2W0JA 4J97A 4FV0A 5CAQA 3MY0A 5CSHA 1IASA 3KVXA 1OIQA 3CC6A 2CSNA 3M11A 2XIYA 5JZJA 3WILA 1JSTA 1YDRE 2B4SB 4YJPA 4RJ6A 4BB4A 3BLAA 4M67A 4TWNA 5AR8A 3MVJA 3RJCA 3KRJA 2VNYA 3DS6A 4TN6A 3MV5A 4BCNA 4E3CA 4LV5A 4RMZA 5HQ0A 2A1AB 3LIJA 4A4OA 3U6IA 3HEGA 4RJ4A 3NNUA 4ZXTA 4XG3A 3W0QA 4DEAA 4O2PA 4IEBA 2YWPA 3ZM9A 3PWYA 3WE8A 4IVAA 4FTUA 1KV1A 4RC2A 2VTPA 1T46A 2X1NA 3JXWA 2VTNA 1PXPA 3QRJA 5HEZA 2QO9A 2V5QA 2PU8A 3QZGA 4FL2A 4GT3A 3PUPA 5AUYA 3V8SA 1LEWA 2OF2A 5DR6A 5ETCA 2GS2A 1REKA 2IVUA 3TUBA 4H1MA 3EN4A 4JLCA 4O7NA 4X21A 4AW2A 4E73A 2WPAA 4RC3A 3C0HA 1CKJA 4PDYA 2WTDA 5FEQA 3QCXA 3VS1A 3PVUA 4ID7A 2WMAA 2QG7A 4RFZA 2X9FA 3G51A 2Z02A 4JI9A 3RGFA 2WMSA 1MRYA 1U5RA 5JGAA 4NJ3A 5KUPA 3H0YA 1MUOA 3A8XA 2G2IA 2BZIB 2XF0A 4O22A 4OAVB 2IO6A 4QYGA 2ONLC 3H0ZA 3D83A 3RM6A 4IAZA 3WI6A 3W1FA 5K5NA 4AW5A 3FPMA 4OTIA 2YERA 2WQBA 2XIRA 5H8EA 1CKIA 1UNHA 4M66A 2YIRA 4DEDA 5FM3A 4BGQA 2HAKA 2JDVA 4OTGA 5GHVA 3OWLA 5HESA 2X0OA 1KOBA 3RPYA 3NR9A 4E93A 5LMKC 5C01A 1QPDA 3V6RA 4EBWA 5EM7A 4O91A 4IX6A 4UZHA 3CD8A 4K9YA 5ANEA 4O4CA 3E62A 2OWBA 1YI6A 2C1BA 1XHAA 4ZAUA 1Q3DA 2WOTA 3P1AA 4KRCA 5EK7A 5F95A 4LOPA 5AA9A 3RPVA 5HD7A 3R7VA 3HP5A 4UZDA 5EW8A 3QKKA 4WA9A 2PUNA 2RF9A 5JEBA 2BTRA 3OVVA 4ZY6A 4FEWA 2R3HA 2XNMA 3Q53A 4CFWA 3FQSA 3IW8A 3VNTA 3MGYA 1A9UA 3NIEA 5AP6A 4HVSA 4JAJA 4MQ2A 5HE2A 2PZ5A 2C30A 1ZYSA 3DAJA 5D7AA 5I9VA 3NVMB 3SGCA 2JAVA 5CSVA 3RZFA 3HNGA 4CD0A 3W2SA 5HO8A 4EHZA 3DTCA 3CY3A 3FMDA 4L3LA 5LXMA 1I09A 1OVEA 2A98A 3T3VA 2J9MA 3G0FA 3NNWA 2C6LA 3MPMA 3TKHA 3PWDA 4F1TA 5CU0A 4HZRA 3VONA 2UW8A 1SM2A 2XEYA 4PNIA 3PA3A 3RAIA 3R8PA 1CMKE 3MB7A 5E8SA 3L9LA 4QP1A 3C1XA 3NYNA 4N70A 5AR2A 1GIJA 4C61A 3QTIA 4IZ5A 3UOLA 4F9YA 3ML1A 2ACXA 3NW5A 3F88A 3Q6WA 1XBCA 4IAAA 2HZ0A 4ZEGA 3VUKA 1ST4A 3GU5A 3QFVA 1IAHA 3VUDA 3VC4A 1B6CB 2BALA 1UV5A 3A7JA 3EFWA 3QXOA 4F9WA 2WO6A 5CWZA 3P78A 4HVDA 4FKJA 4DFUA 3O23A 4FODA 3R1NA 3CPCA 2OJIA 5G1XA 4DGLC 3FMKA 4MEDA 1H07A 2XYUA 1YVJA 1TVOA 2C0OA 3OROA 5IA2A 4J8NA 2A19B 3QX2A 2ZV7A 4KBAA 3TDVA 4H3QA 3OWJA 4ONAA 3IO7A 5EM6A 5IA3A 3GNIB 5F20A 2CNVA 2BTSA 5J87A 3MJ1A 4R3CA 3O7LD 3RK9A 3I1AA 3DBDA 1TKIA 2VWIA 4L46A 2IWIA 3BYOA 4Y5QA 4ZJVA 4BCOA 2YM3A 3C5UA 3W18A 4EUUA 3LCTA 5HU9A 5AUWA 1ZAOA 4W9XA 2W06A 5HICA 4PTGA 4QP7A 3WZDA 3I6WA 3DU8A 2C5YA 2UZOA 5CI6A 2G15A 2YISA 5HCYA 3QYZA 2VO6A 3PPZA 3KU2A 4AU8A 4P5ZA 4G6LA 4LGDA 4U5JA 5GIPE 2NP8A 4OBQA 3MESA 3OY3A 2WEVA 3F7ZA 2VNWA 1W82A 4FVQA 4MCVA 3L9NA 3F5UA 4F9BA 4C4IA 2YIXA 4U41A 3KK8A 4UBAA 2NRYA 4C7TA 2YLFA 1JAMA 4X2GA 1Q99A 2V7OA 3CP9A 3V5PA 2JBOA 2WMVA 3VHEA 4I5MA 2QNJA 4OW8A 3PXQA 2X6EA 3QD4A 4EH3A 2OICA 3MA6A 4A9TA 3CKXA 4BZNA 1Q24A 2QCSA 4MNFA 4AA5A 4CMTA 4BIBA 3C4EA 3MPAA 2R2PA 1H01A 3OBGA 5ETFA 3HV3A 2GNIA 3QQUA 2XEZA 4LOQA 4XG9A 3P79A 3OXTA 1WAKA 4C2VA 5HBHA 4B8LA 2UVZA 4NM0A 1M2QA 3PP1A 3ZMMA 3BZ3A 4EH8A 4JQ8A 3E8EA 3VUIA 3AG9A 2QKRA 4EJ7A 2JKMA 4TY1A 3JUHA 5CSPA 2ZFYA 4MBIA 4C8BA 1Q8TA 4CTCA 1KE9A 3QHRA 4QMUA 3V5WA 3OXIA 1Q3WA 1XBBA 2Z7RA 3OW4A 2ITTA 3CLYA 3LFDA 4G9CA 4GL9A 4NIFB 5DGZA 5BVKA 5ETIA 4YPDA 5BYZA 3TKIA 2ITVA 3SC1A 3A2CA 3NNXA 2OXYA 2PVJA 1YHWA 2VTQA 1J91A 4IVDA 2IW8A 3UGCA 2QLUA 4EOMA 4CKRA 3PPKA 2HWPA 2FH9A 2XB7A 4H1JA 5GZAA 4E5WA 4EH4A 2XK7A 3QUDA 2YM7A 5H2UA 3NUUA 4YO6A 3CIKA 4I0TA 4FTMA 3ZM4A 2QURA 5DG5A 3D94A 4HZSA 3HZTA 4AGWA 5M08A 5B2MA 2G1TA 2W99B 3JPVA 4O0RA 5M4UA 1O6KA 4MUQA 2Y0AA 1NVRA 4FTTA 4FTNA 4TZRA 1WCCA 2C5OA 2JIVA 4S31A 4AUAA 4C4FA 3TV7A 4DHFA 4E6CA 3KA0A 4PDPA 2QQ7A 3OF0A 3V5LA 3WZKA 4CSVA 3FL5A 5AUUA 1Z9XA 3N4TA 2C47A 1IA8A 3ZSGA 4ZZMA 3OCGA 4JRNA 3ZSIA 2GDOA 1OMWA 3U6JA 3CQWA 4C02A 4W4XA 2I40A 3EL8A 4JBQA 4ZP5A 4BL1A 2NRUA 5GZ9A 1P2AA 2YJRA 2YA9A 4QMOA 4ZTHA 3TZ7A 2J50A 4O81A 1K9AA 3RHKA 4ENYA 3MA3A 4LRKA 4IW0A 4ALVA 1W98A 3TNQB 3RWPA 2H9VA 4CFMA 5EHLA 4EQCA 5IEXA 2IVVA 3E93A 4BBMA 3KIOC 1DS5A 2HXQA 2WGJA 3EQGA 3SOAA 4ZY5A 1O6LA 5CEIA 1DAWA 3O2MA 1APME 1BI8A 4A4LA 4IWOA 5HX6A 3ZDIA 3OP5A 3QTXA 4RC4A 2F2UA 2IJMA 5JFSA 4RJ7A 3ZLXA 5L2WA 1OL2A 3FLWA 4K2RA 4RIWA 2A27A 4NTSA 3SXFA 4DH3A 2XK4A 5EYCA 4TWCA 4RRVA 5JRQA 3POOA 3D5VA 4RVKA 5FEDA 3EQRA 4AP7A 4DE4A 3PY3A 4WUNA 2Y6MA 5KX8A 3AC5A 5E8XA 4ZS4A 4FT3A 5AFVA 2V62A 3COIA 5JFVA 5HE0A 1ZOGA 4J53A 1HCLA 4XLIA 2WNTA 3CE3A 2F49A 4FTJA 4WHZA 4DEBA 1FMOE 2R3GA 2ZVAA 5IQDA 3MH1A 2XALA 1H00A 4HCUA 5GJFA 5AP7A 5GNKA 2W17A 4K33A 4A9UA 3IW5A 5AR7A 3QZHA 4AOIA 4F64A 2ETKA 4HGTA 4NKAA 3PA5A 4YJUA 5FUTA 3GOPA 3QTZA 4L45A 4YJTA 2FVDA 4DT8A 4O0WA 3RAKA 2XH5A 2GFCA 5AM7A 4I41A 4YZDA 5ANOA 3KRRA 2CN5A 4IX5A 4E4MA 3QUEA 4QYFA 5CU2A 1JPAA 2PUIA 2WMQA 4GT4A 3TYKA 3FJQE 4P90A 5A14A 3I79A 2B0QA 2PZPA 3QU0A 3BLRA 5AP4A 4CFVA 4ALUA 3CGFA 4S32A 1P4FA 4DH5A 5ANKA 1ZYDA 4FKRA 3FPQA 5FP6A 5BVWA 2WFYA 3EN9A 1YXUA 5L2SA 3AOXA 1OUYA 1UKIA 1MQ4A 3BKBA 3CEKA 4FVRA 4QMPA 4YJNA 4D4RA 3SG9A 2VGOA 3UPZA 4DDGA 2BROA 2HW7A 4BDJA 3DK6A 4EQUA 5GZ8A 4FIJA 1UU7A 4HGLA 4RWLA 5BVOA 4KWPA 4FTCA 2LAVA 4HOKA 4NTTA 4FIHA 5HLWA 3PZHA 4S34A 3KRWA 3UJGA 3G15A 4P7EA 5CENA 2PVHA 2UVXA 3KC3A 3BGQA 4EC8A 4FK6A 3NAYA 2F9GA 2C0IA 1KE5A 4DCAA 3KMWA 4TNBA 3MN3A 2YM4A 4KIQA 4X6QC 3VN9A 4DLJA 3U4WA 1GAGA 4I92A 1E1XA 2E9NA 3BPRA 2OXXA 4G34A 3FZOA 3UDBA 4C3PA 4AX8A 5A4TA 4M68A 4KB8A 3C0GA 2Y4IB 4QMXA 3BWFA 1YWNA 3SLSA 5AAGA 3Q04A 3IDCA 5EQPA 5ITAA 1U59A 3NYOA 4O4FA 4LRJA 3Q9YA 1Q62A 4WO5A 2BILB 4JG7A 4M0YA 4R1VA 5EKOA 3RCJA 2XK3A 1BKXA 3FC2A 4L68A 1NVSA 3UBDA 3PJCA 2UW0A 2QC6A 4O4BB 4DHZA 2IG7A 4O0TA 2C1AA 2P55A 2YIWA 3ZZEA 3ZRKA 3BHVA 5LMAA 3ALNA 2BCJA 4NU1A 1WBPA 3E8NA 4RIXB 5D7VA 3DV3A 3RPRA 4BYIA 3UYSA 4WBOA 3F3VA 2GHLA 4KKGA 2C5NA 4DFXE 5KKRB 2WB8A 3ANRA 4NFNA 4OLIA 5DI1A 1UU3A 5CYIA 2YAKA 3FC1X 3GFWA 5IH5A 5IG1A 3D2KA 4BWPA 5L8LA 2EXMA 4JBOA 5CU3A 2R3LA 4E8AA 4IB5A 3ULIA 3WZEA 2BDJA 1AD5A 4IB3A 3GCSA 5HLPA 3OUKA 2WTJA 3OWKA 4O6LA 3SX9A 3T3UA 3WYYA 2Y6OA 2VWVA 2R3MA 4O7VA 2X4FA 3FI3A 1F0QA 4R5YA 2W5HA 4XYFA 4I0SA 4GUBA 4WNOA 2J6MA 5BMSA 4AXEA 3VS5A 3FL4A 5HORA 5LVNA 3GB2A 3UIUA 3IOKA 4PV0A 1UWJA 3RPSA 4B99A 4OT6A 2DYLA 3RCDA 3PG3A 4OAUC 3ORNA 4EHVA 3P5KA 2I0VA 4BCMA 3E64A 2QHMA 5C8NA 2FSLX 4OUCA 4Y95A 2QOIA 1JSVA 3CD3A 3BWJA 3VULA 3WE4A 4DBXA 5IMXA 1URCA 5IA1A 4RVMA 5IA5A 3UVQA 4AGCA 4BKYA 4AW0A 3NW7A 3HV4A 2DS1A 4D4VA 4BY9E 2JKKA 4CV8A 4YTIA 4O6EA 2WMWA 3LPBA 2XRUA 3UO5A 2W7XA 3R83A 5M09A 3E88A 4E4LA 3WBLA 3ZUVA 4LG4A 4O7WA 3R00A 4PMPA 2XARA 2JKQA 3A7FA 4G31A 4IH8A 2XVDA 4JL9A 3G33A 3OCTA 3QA0A 3UOJA 3I0QA 1J3HA 2OJJA 3MDYA 4RQVA 4TTHB 3ZO4A 3MVMA 4C37A 4QRCA 5CZIA 2WD1A 4Y8DA 3IW4A 2AC5A 4IE9A 2X9EA 2JD5A 1CM8A 1LEZA 3CCNA 3NX8A 3NUPA 4DT9A 5ANGA 2GCDA 2JFMA 3BHTA 4BDCA 4BHNA 4BDEA 3TZ9A 1FMKA 2G2HA 3JYAA 3V04A 4O7SA 4MNEB 3OZ6A 3GU4A 1OGUA 2XNPA 3KQ7A 4FKQA 5K3YA 3ZSHA 2XKEA 2WELA 3R28A 3BYMA 5HOAA 4GJ3A 1AQ1A 4FA2A 2JBPA 3AKJA 3VVHA 4F6UA 2WTIA 3UDTA 3A4PA 4QPAA 4CG9A 3HA6A 4OTQA 4Y83A 3DXNA 4G9RA 2C3JA 2WQEA 3DKGA 2FYSA 2PZYA 4FKLA 2XNGA 4BDIA 3TNWA 4D2PA 1R1WA 3R6XA 2ESMA 3JY0A 3L8VA 4ZLYA 5D10A 3LJ2A 4FNXA 2WEIA 3DPKA 5D12A 1YDTE 3MTFA 4C57A 3BBWA 4ZLOA 1XH5A 2RL5A 3KB7A 5L2TA 3C51A 4FV2A 3IOPA 5AX3A 4AF3A 1BL6A 4BDDA 2JGZA 4FE2A 2ZV2A 3L1SA 4IACA 1ZY4A 3TKUA 3DQWA 3NW6A 2X4ZA 3UO6A 4FKIA 3ITZA 3RVGA 3QTSA 2Z8CA 4AZWA 3HLLA 4BCHA 4FEVA 3PJ3A 4DG0E 4FSUA 2OGVA 3ZYAA 3ZS5A 2H8HA 4QMTA 4YURA 2PMLX 2UZEA 4ZOGA 3U9NA 1L3RE 4JDKA 2Q83A 5HTIA 1TZDA 4CNHA 3BQRA 2W4KA 4CMUA 3NYXA 4GK2A 5KBRA 4QP8A 5BVEA 4AE6A 4E1ZA 3OOMA 4UB7A 1WFCA 4YNOA 2WMUA 3MFSA 4BTJA 3W0PA 1YHSA 2X8IA 4EBVA 4AXFA 3D14A 2ZM4A 5LWMA 5TT7A 3OHTA 4ZLZA 3FLQA 4F0GA 1M7QA 2ITXA 4TRLA 3PA4A 3QLGA 4JR7A 1RW8A 1GIIA 4GS6A 2BMCA 5DA3A 3QA8A 4MD7E 4Q9ZA 5IUHA 2BRNA 2PUPA 3PFYA 2XA4A 4XX9A 2V55A 2AQXA 2E9OA 2PVMA 4K11A 4FC0A 4FGBA 4Y85A 4CGAA 1QPJA 4G3CA 2E9UA 3ZUUA 4HVGA 4EH9A 3PIYA 3DFCB 4AAYA 3OTUA 3BU3A 2QOLA 3AT3A 4JJRA 5E91A 4UY9A 1A06A 4QTBA 3N4UA 2ETRA 2PMOX 2KULA 3S95A 2B7AA 3PXFA 2G2FA 1Q61A 4FK3A 2IW6A 1MRVA 1Q97A 1KE6A 5JZNA 3B8RA 4G16A 4LUDA 4EK4A 3EHAA 5AJQA 4YJQA 1H0VA 2BRMA 4GH2A 1U54B 3HUBA 4D2SA 1JVPP 4QMWA 4WNKA 3QGWA 5J95A 4WG4A 3R01A 5ACKA 4PL5A 5JSMA 3BYSA 4YLJA 5CZHA 4ASZA 1K3AA 4CCBA 4U45A 4BJJA 4EK8A 5HO7