4PPBA

Itk kinase domain with compound 28 (n-{1-[(1s)-3-(dimethylamino)-1-phenylpropyl]-1h-pyrazol-4-yl}-6-(1h-pyrazol-4-yl)-1h-indazole-3-carboxamide)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
264
structure length
239
Chain Sequence
b'SVIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAESG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Discovery and optimization of indazoles as potent and selective interleukin-2 inducible T cell kinase (ITK) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 67
structure length 239
sequence length 264
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ppbA00
3WARA 3VS6A 3I5ZA 5EHOA 3E7OA 3VUKA 4Z55A 4J97A 3LW0A 5HLWA 2R3PA 2VTRA 3HDMA 3R00A 3HV6A 3OG7A 3QA8A 5BVNA 4L7SA 3EMGA 1NVSA 2C6EA 4IJ9A 3PXFA 4C8BA 2VTSA 4EH2A 2WTKB 1H01A 4H3QA 3I7BA 3BE2A 3QUPA 4U81A 2VAGA 3R7GA 5EYKA 3DOGA 2AYPA 3UMXA 2LAVA 2J2IB 5J9LA 5I9XA 4MEDA 1SYKA 3EFWA 3AMBA 1Q8UA 2ITTA 5I9UA 4FV1A 4JVGA 4XV1A 4C0TA 3LCDA 2Y9QA 3SXRA 2VTMA 3MIYA 4AZFA 2I0YA 3UIMA 4BHZA 5H8GA 5C01A 4ALUA 5M44A 1RDQE 3ZFYA 2C6LA 3L8XA 3THBA 4C61A 1OPLA 3BV3A 2EU9A 3KXXA 4A7CA 3F5UA 5L6PA 4ZLYA 4G5JA 4IAFA 2OJ9A 4EYMA 2R3LA 1JKLA 1TVOA 4L8MA 4DFLA 1OPJA 2IVSA 4MF1A 1Y6AA 3DK7A 3DT1A 4FZ6A 3VNTA 4PV0A 1APME 1Q3DA 1NVRA 2OH4A 3NNWA 2YISA 5DVRA 5LCJA 2OXXA 3ULIA 2UZTA 3CS9A 3S2PA 4BWXA 4DAWA 4DH7A 1J1BA 2XKCA 5BVDA 3LCSA 4GG5A 3U9CA 5EDRA 5EM6A 5BNJA 1YXVA 5DT3A 4GYIA 2W1DA 3QTZA 4ERKA 4RIWA 3KULA 2BVAA 4IWQA 3UQFA 2HYYA 2YITA 4IC7A 4JRVA 4QMLA 1OECA 4I5CA 5AV4A 4OBOA 3QUEA 4O6EA 3AT4A 2W5AA 2OU7A 4RX9A 4TYHB 4P2KA 4MQ2A 5E8UA 4U97A 3VJNA 2Y6OA 2R5TA 5FTOA 4LMUA 5M56A 5K0XA 4NU1A 3OFMA 3SX9A 3DZOA 1F0QA 4ERWA 3KXMA 2VTHA 2IW6A 3Q96A 3NR9A 4O91A 4PL4A 4FNYA 3QFVA 4UWYA 3F5PA 1AQ1A 1GZNA 2QOCA 3OCBA 3CTHA 3R7IA 3QRJA 2C3JA 4EUTA 3HUBA 5HTCA 3QD2B 5TE0A 3WZDA 4EJNA 3QL8A 5IUIA 2X39A 3TUCA 3MN3A 4YPDA 4WSQA 4ZTNA 4PUZA 3EQRA 3FPMA 4JG6A 5HGIA 4F0FA 3Q9XA 2FSOX 5CEIA 1TQIA 3V5PA 3DB8A 5IG1A 2HY0A 4EC8A 3TIYA 3PIXA 2GDOA 4TWCA 2V55A 4C3FA 3OWPA 2C0TA 3CR0A 2ESMA 3DKOA 3WZJA 4PMTA 3SKCA 5DBXA 3QD3A 3HEGA 4WOVA 3VBYA 1P2AA 2WQOA 3OY1A 3UPZA 1JKKA 1OKZA 1GZOA 3MBLA 2E2BA 1V0BA 2UW6A 5C26A 2Z8CA 5DEYA 2W4KA 3BU6A 3PA3A 4EBVA 4TYIA 4FKOA 3BYSA 3SRVA 5AR5A 5TKDA 3FY2A 4F63A 1PXLA 4TTHB 5CEPA 2J5EA 1LEWA 3QHRA 4C4HA 2BPMA 3C5UA 1PXOA 2NP8A 4GT5A 5A54A 1PXKA 5ANEA 1MQ4A 4F64A 4FT3A 4PDSA 4RZVA 2XIXA 4JLCA 4BKJA 1O6YA 3NPCA 2C6DA 4UZHA 4FICA 3ZM4A 3VS5A 3DNDA 4C35A 5IEYA 4NH1A 4ITHA 4PNKA 3R01A 4L68A 5CSXA 2XIZA 1J1CA 1OUKA 3BQRA 4C62A 4RIXB 2PZPA 4FV7A 3QTWA 5J5SA 4ZS0A 4H1JA 3FZTA 3D5UA 3LFFA 4F7SA 3Q2MA 1PMVA 3DBEA 5E8ZA 3ACJA 4DGMA 4FODA 4RC3A 2R3IA 3RZFA 3W8LA 3C0GA 2XVDA 2BROA 2UVYA 3NYVA 5HKMA 3MV5A 4YJUA 3MTFA 4EOLA 3DJ6A 3O17A 3MWUA 5LMKC 4M84A 4EH6A 4QMVA 3G0EA 4PNIA 3ROCA 4UZDA 1UU7A 5EHLA 4CV8A 1PXPA 5G6VA 5HOAA 4DITA 1DAYA 3MFRA 3VAPA 4J8NA 4F09A 3QC4A 3NYOA 5KMJA 4GH2A 4N6ZA 3PY1A 4NM0A 2X8EA 3A4OX 4ZY5A 3OXZA 2BDWA 3VS7A 4CD0A 1PKGA 2XM9A 4EONA 4D0XA 2WQEA 1FOTA 4XG7A 2VX3A 3CGOA 4EH9A 3PXRA 3R1QA 4L67A 4Z7HA 5JFWA 3PVBA 2NO3A 4U45A 3OT8A 1STCE 4HGTA 5J79A 3ZUVA 4NFNA 2C68A 3BE9A 3EFLA 4AU8A 5IA3A 4BKZA 4FR4A 5CSHA 3GVUA 2W9ZB 4TPTA 4JQ7A 2HXLA 3LFDA 4CEGA 1M14A 4M66A 4ASZA 4BTFA 2PSQA 4YC8A 4YPSA 3L8VA 1GIIA 1JKTA 3C51A 3Q52A 1ZRZA 3KGAA 3FMNA 3E64A 4OTDA 5FP6A 4G3DA 1XH9A 2ZYBA 4XOZA 4BCPA 3BLHA 1UNLA 4OTRA 5HVJA 3MA6A 3EQFA 2B9HA 4CQGA 4QYFA 5ACBC 3ZFXA 3NW6A 2WEIA 1REJA 4O0TA 3EWHA 4AQCA 4F9CA 5JQ8A 1Z57A 1ZMVA 2FA2A 4WG4A 5ANKA 3F61A 2C6KA 3FUPA 4FX3A 5AR7A 5GHVA 5HZNA 3UBDA 4Y95A 2VO0A 3LFNA 3Q9WA 1OIUA 5HEZA 2CGUA 3JS2A 5EYMA 4E93A 2VX0A 5E91A 3C4WA 2WELA 2YZAA 4MD8E 3WE8A 2W1CA 3MH1A 1U54A 4I24A 5IZFA 4Y72A 3M2WA 3GGFA 3PA5A 2YDKA 5CQWA 4KIPA 2VWXA 4AUAA 5B2LA 5EK7A 4BDAA 4FV6A 4CSVA 2BZKB 2HZIA 2QLUA 1WBTA 3VO3A 5M4UA 3VS0A 2HY81 1ZYLA 3PY0A 3I6WA 2GMXA 5FM3A 3UC3A 3W32A 3FI4A 1K3AA 1J91A 3BYMA 4UXQA 4GG7A 4UY9A 3TG1A 4LUEA 3KC3A 3K5UA 3BBTB 4D5KA 2Y6MA 2QONA 3E88A 3Q4CA 4LGDA 3ZBXA 4HVDA 3KMMA 4G6OA 5HE0A 2C6IA 4IAIA 1VR2A 4RVLA 1DI8A 5E8WA 5CF8A 2KULA 3V51A 4C37A 4I5HA 3BLRA 5DA3A 3HNGA 3C4FA 1UVRA 3TJDA 4L46A 4QP2A 1YWRA 2OZAA 4WT6A 4XV3A 3ZMMA 3IS5A 4NIFB 5JT2A 3FSFA 2IVVA 3QTIA 1YWNA 4HGLA 3SXFA 5IUHA 3UMWA 3EN6A 3P7AA 2E9UA 2YM4A 1V0OA 3A99A 1PMUA 4IM0A 3DJ7A 4IAZA 3LJ2A 4IVCA 3Q53A 4IM3A 4O38A 5HO6A 4F6WA 4YJSA 4CZUA 4O2ZA 2ETKA 2YJSA 3FV8A 4H1MA 5LMKA 2BRHA 3BX5A 2VTTA 2ITVA 3IW6A 4M7IA 3ENMA 5AP6A 5HG7A 4ANSA 4J98A 5BYYA 4JXFA 4PPAA 4FYOA 3CY3A 3EJ1A 2IZRA 4MCVA 2RFSA 5DT4A 4CFUA 2GPHA 5KZIA 1H1QA 2O2UA 2X9EA 4CRSA 4JDKA 4AOIA 5IU2A 1RQQA 5L2IA 2BHHA 3TKUA 2UZLA 1H08A 1VZOA 1GAGA 2FYSA 2XF0A 4B6LA 5I9YA 3AMAA 4I4FA 3DJ5A 4D58A 3OEFX 2UZUE 3UVRA 4RJ5A 3DQWA 5DMZA 1PKDA 4EZ5A 1DI9A 1A06A 2W9FB 4K0YA 4NJDA 3RM7A 5H2UA 4BDJA 4DTKA 3DAJA 2R3HA 5CU2A 2XIRA 4YZDA 4DEAA 4IZ5A 5AP0A 5IH4A 2B55A 2DYLA 3LJ0A 3QQGA 2BALA 3KVWA 3TNHA 3U51A 5KZ0A 3WIKA 1UWHA 4EL9A 4OR5A 4AT4A 5CXHA 3DU8A 3VBVA 1KOAA 3QKLA 4XUFA 4ZK5A 5ITAA 1EH4A 3ZBFA 4IX6A 1JKSA 2X4FA 1UA2A 3A4PA 4GVAA 4LOPA 4AE6A 3WOWA 2XA4A 2ETMA 4NJ3A 2PZ5A 5K3YA 1QPJA 4TW9A 5CLPA 3AQVA 1VYWA 3SVVA 4IAYA 2X4ZA 4OGRA 1M17A 3DDPA 4BTJA 1U5QA 4BDHA 2YIYA 3R28A 3NS9A 3NNVA 2B9IA 4XBUA 1O6LA 1PW2A 1FPUA 4BCIA 4S2ZA 3DAEA 4Z16A 5CF5A 4A4OA 4EZ7A 3H0YA 2QOQA 4M69B 3W2OA 5E8SA 4FL3A 5F20A 5LXMA 4LV8A 4QQJA 2IZSA 4IVAA 5DHJA 4G3CA 4XP3A 5L6WL 4B0GA 1F5QA 4HYSA 3NAXA 3Q5ZA 2JIVA 2WMTA 4FSYA 2UVZA 4D2SA 4OAUC 3E87A 3ZRKA 5HBJA 3DV3A 4RWLA 2J6MA 2X9FA 3GT8A 4TYJA 1I09A 1XWSA 4G2FA 1MRYA 3RPRA 4K77A 5LVMA 2GNGA 4K1BA 3TZ9A 2I6LA 4YSJA 3UVQA 2R0IA 1IEPA 4NK9A 3L9LA 5EKOA 3WIGA 4CCUA 5FG8A 4NM3A 5JGDA 5ETIA 1SMHA 3MDYA 2BRMA 3UO5A 2C1BA 1T45A 3OBJA 2O0UA 4FTMA 4FOBA 3VVHA 3UTOA 2VWBA 4BIBA 5FXRA 3RTPA 4C4IA 3F7WA 4GL9A 2CJMA 2JFMA 4DH1A 3QAME 4UBAA 4BI2A 4B8LA 4WNPA 4MXZA 4E5WA 2VD5A 3KRRA 2RFNA 5AM7A 4GFMA 2ACXA 4KSQA 2C3IB 2BFYA 2GFSA 3WZKA 4RVKA 2CHLA 1YW2A 3FXWA 3NCGA 4QMNA 4LL5A 3L9MA 4G6NA 4YNEA 2B53A 2C3KA 3H30A 3R63A 4MXYA 2P0CA 2VTLA 2W17A 3R1NA 4X0MA 3P0MA 4M0ZA 4FT9A 4I6QA 2YM7A 1YHWA 2QI8A 3S00A 3NUXA 3NLBA 3V5LA 4CTBA 4ENXA 4FSQA 4TWPA 4F4PA 4GMYA 5CEKA 3KQ7A 3P08A 3BYOA 4CV9A 2NRUA 5IEVA 4KABA 3D2KA 2QHNA 3ZLYA 4F7NA 3PZHA 4RG0A 5DR9A 4E6CA 4LGGA 2PMIA 4FV0A 4DFYA 2W4JA 2JITA 3I1AA 1UNHA 4PF4A 4Y8DA 2OXYA 2I0EA 5JMSA 2GHLA 5AUVA 3UGCA 3NAYA 2JD5A 1YXUA 3OZ6A 4X2JA 2R3KA 3RAKA 3V6RA 2F57A 4IX5A 4LV5A 4X3FB 3FZ1A 4KIKA 2JAVA 4HW7A 3U6JA 3RM6A 1B6CB 3JY0A 3K2LA 4ZTHA 2RFEA 4QNYA 5BUEA 3SW7A 4UV0A 2H9VA 3V5WA 4YBKA 4I41A 3VC4A 1OZ1A 4X2KA 3TEIA 2R4BA 4IX3A 1Q5KA 2Q0NA 2P2IA 3MYGA 4EHGA 4FVQA 5F1ZA 4BCOA 5IA2A 2GTMA 4FOCA 3W2CA 2PVKA 2ZV7A 2P2HA 2DS1A 2JC6A 4YJVA 3EQPA 3RAIA 5CQUA 3QC9A 4JIKA 3GU8A 4U41A 3NUPA 3TNQB 3KFAA 4YURA 3QZHA 4DH5A 1XH4A 4D2RA 2E9NA 3VUHA 5CAVA 2XJ1A 2YDJA 4Q5HA 3ZHPC 5ANOA 4ACDA 4K33A 4F9YA 1P5EA 3KXGA 4ZJJA 1M52A 4FK6A 4O2PA 4U3YA 5EM5A 4W4YA 1WMKA 2I0VA 3U87A 3KK9A 1NXKA 3ET7A 5CU6A 3WZEA 2WIHA 2XJ0A 4DG3E 3BHHA 3HMOA 4S32A 2YM5A 5DR6A 2VX1A 5BVWA 1U46A 2W1GA 3A8XA 3ORNA 1FVTA 1GNGA 3FYKX 4BC6A 5JZNA 3I5NA 2W1EA 3EQBA 4MVFA 1WVYA 4HCVA 5E8XA 4DGNA 4BRXA 5F4NA 3WF6A 4F1TA 3ZC6A 3MPTA 4G9CA 3R8LA 3DGKA 1KE6A 3QU0A 3KEXA 4O6LA 4WBBB 4FKWA 2HZ4A 5FLFA 5A4TA 5AUUA 1WVWA 4KKHA 4CZTA 5D12A 4FK3A 5C03A 2WTWA 3UC4A 4J95A 3U4WA 2OIDA 2W7XA 2YWPA 5DG5A 5TOZA 2PK9A 1W8CA 5J7BA 2EWAA 2PE1A 5H9BA 2Z7RA 4ZSLA 4GVJA 2C0IA 2XBJA 3EQDA 4RVTA 2XNPA 4NSTA 4QPSA 5HVKA 2WQNA 3PFQA 4G9RA 5CAUA 2W4OA 3QZFA 3R8MA 2YM6A 3IW4A 5H8BA 4A4XA 5BQ0A 5M51A 1XKKA 5AR3A 3DB6A 3EIDA 4BKYA 1H4LA 3MH2A 4Y5HA 2XK4A 3K3JA 4HPUE 2OH0E 3MFUA 5AP5A 4DCEA 4OTHA 3KXNA 2EUFB 1WAKA 3NSZA 4M15A 2ZJWA 3CKWA 3GUBA 2P3GX 3BGZA 5KMNA 3HL7A 4EOOA 5A6NA 4HCTA 5B2KA 3OTVA 4Y83A 2O65A 4CFWA 3HMIA 3COMA 1WBWA 3AOXA 3FLWA 4JBVA 2C30A 1ZMUA 2QCSA 3V8TA 3KMWA 1OUYA 3PXZA 5DN3A 2XP2A 4EOMA 4IW0A 4EUUA 2F7ZE 4C33A 3F2NA 4TY1A 1OKYA 4FKQA 1R3CA 4L45A 3TXOA 4BYJA 4B7TA 4PPCA 5IEXA 3UQGA 3ZONA 5T6KA 4FV5A 2PZIA 3QTQA 4JNWA 3VHEA 2OSCA 4FIGA 4YZCA 1OL7A 4M13A 1H00A 5CI6A 4HOKA 3MA3A 3V5QA 3UIUA 2IO6A 2GNJA 3NEWA 4OT6A 3DDQA 3RMFA 1UV5A 4U40A 3IO7A 1P4FA 1CSNA 5IH6A 3SOCA 3DKFA 2XRUA 4FSNA 3S4QA 2UW0A 3OHTA 4KB8A 3OW3A 3TIZA 3S0OA 3EN5A 4FG7A 1R1WA 5GZAA 2WMRA 3R7UA 2IW9A 4JDHA 3Q5IA 4DGLC 4RFYA 4BF2A 1YOLA 3ACKA 5DNRA 1H0WA 4U0IA 1BLXA 4UYNA 1PF8A 2XK8A 3CY2A 3GFEA 3KF7A 3SW4A 2BRGA 2HZ0A 4IWOA 4M67A 3CPBA 3GCPA 4JQ8A 2WTIA 1YQJA 3JUHA 4X3FC 3P4KA 4ZSGA 1VYZA 4C4FA 3MJ1A 4YJOA 3ZO4A 3DLZA 2XYNA 4F0GA 2XRWA 4YHJA 1M7QA 4QTEA 4PL5A 4TRLA 4AW1A 4F1OA 2UZDA 2YAKA 5EDPA 3GCUA 1L3RE 5K4IA 3P79A 5JGAA 3UP7A 1BL7A 4DFZE 4BCKA 3FWQA 4F08A 1KE5A 4GUEA 2YCRA 2O5KA 5AUXA 3ZLXA 4WNMA 4R7HA 2BR1A 2QG5A 2W0JA 5CSWA 5AX3A 3POZA 2HXQA 2V7AA 5AR8A 1TQPA 5FQDC 3S3IA 5KCVA 4IIRA 2J7TA 3G5DA 5IMXA 3NX8A 5J1VA 2C3LA 2WXVA 1M2RA 4EOSA 3MSSA 1ZZLA 2YIWA 4E5BA 5JQ5A 3MJ2A 3PJ1A 3FZSA 5AAGA 4IFGA 5J7HA 2JIUA 3Q32A 5FM2A 5J87A 3ZRLA 1IR3A 5HU3A 1Y8GA 3OEZA 4AW2A 3PIYA 3SXSA 3KL8A 1PJKA 3E8CA 3ZEWA 5BYZA 2HOGA 3QX2A 1ZY4A 4NT4A 3QWJA 4RIYA 2XK9A 5CSVA 3AD5A 4N70A 1Z9XA 5CF6A 4F65A 4ZP5A 2F49A 2OF4A 3F7ZA 3SV0A 5LMBA 3FSKA 5IA1A 2YACA 2GNFA 3NUYA 2QHMA 3ZUTA 5A4LA 4BDCA 2ITYA 2OJJA 5CEOA 4GEOA 3MS9A 4I92A 1TKIA 5AWMA 3UOLA 1Z5MA 4OBQA 1RE8A 4QYEA 3CGFA 5A46A 3FJQE 3GCQA 3C50A 2VTAA 1XO2B 4AGUA 4F99A 5HIEA 3UQCA 3BKBA 1G3NA 3DBDA 4IH8A 4WNKA 4X6QC 3O8TA 3PIZA 3S95A 2XM8A 3F88A 3VW8A 4L9IA 4FIIA 4P5ZA 3UNJA 3UIXA 3QLGA 2ZV8A 4R5YA 2Y4IC 2A2AA 2J0MB 2R3JA 4W8EA 5CY3A 3RAHA 5ETFA 5KMOA 3HX4A 3BWJA 4E73A 4WUNA 3GP0A 4E6QA 4FG9A 3PTGA 1A9UA 2AC3A 2XKDA 2J5FA 4IADA 3O7LB 2PL0A 4PPBA 5DLSA 4E4LA 4F6UA 5L2WA 4TNBA 4MXXA 4AFEA 4KRCA 4OTIA 3T9TA 5BMSA 1UNGA 3PJ2A 4IACA 2OBJA 5D10A 3W55A 4A06A 4ACGA 4HYUA 1OB3A 4V01A 4IXPA 4DLJA 3QUDA 4E4MA 2YABA 3PJCA 4USEA 5AUYA 1B39A 4U42A 5GJFA 4CMOA 2CDZA 5M53A 5CENA 4E4NA 1OIYA 3QD0A 4XNEA 4MD7E 3MB7A 5CT0A 4BDFA 1JSUA 2QOKA 2GSFA 2JAMA 2YAAA 5B7VA 5C8KA 3BU3A 3CD3A 3HV4A 4OUCA 4PDOA 4D5HA 5KMIA 4ASDA 4TZRA 1R39A 5EI6A 3FI3A 3QCSA 4QPMA 4FZFB 4IVBA 3VBTA 5HX8A 4QP7A 3V5JA 3LQ5A 3MH3A 2W5HA 4A9SA 4R8QA 5K5NA 4I22A 3I81A 1WBPA 2QC6A 5I5ZA 1SM2A 3IOPA 3O7LD 4M12A 3OCGA 1Q8YA 2QQ7A 4R1YA 4V0GB 3R30A 4X3FA 3F3TA 2FH9A 4UX9A 3KRXA 2CLQA 2IJMA 3MPMA 2J9MA 4G34A 4E4XA 4FF8A 4RJ3A 3HRBA 2F4JA 4BYIA 2XMYA 3P9JA 2BCJA 3PPZA 4LI5A 3ITZA 5FD2A 4E5AX 2C0OA 4M14A 1G5SA 4FZ7A 4ZY4A 2VRXA 3UJGA 4IQ6A 4L52A 4RJ8A 5CEMA 3DTCA 4LL0A 3GBZA 3FMJA 4U6RA 5EI2A 3W2PA 5M55A 4O0RA 5AUZA 4EOQA 2IVUA 5AIRA 3O8UA 2FO0A 3VW6A 3BYVA 4K2RA 4YZBA 2J0IA 5DRDA 4BCGA 4CMTA 2W06A 3GCVA 3EL7A 1WBVA 3MPAA 4X2FA 4OLIA 1OKWA 1P4OA 4GK2A 3W10A 1JBPE 3AXWA 3D5VA 4BDEA 5E92A 3QCXA 3AC3A 4J96A 2B9FA 4J1RA 4AGWA 4C2WA 3ZRMA 4MBJA 1URCA 3KRWA 4FI1A 4EHZA 4W9WA 3UYTA 3UNKA 5ANJA 4QO9A 4YZ9A 2VTOA 2RG5A 3FI2A 3R9DA 4FKJA 2UZOA 3G33A 3L9NA 4U80A 4CFVA 5HCYA 2BAJA 3OW4A 3S1HA 2WTKC 4X3JA 5AM6A 5CXZA 3R0TA 3C4EA 3MW1A 5HVYA 3H9OA 3BHYA 3H9RA 4IWDA 4FKRA 5C27A 3D94A 3FMHA 3LCTA 2C6MA 4DFXE 3ZO1A 3OXTA 1JQHA 2X81A 2JKQA 3D7TB 3LFQA 4DHFA 5KKRB 2WKMA 5FDXA 2VTQA 3CLYA 3I60A 4XP0A 3RKBA 4PY1A 2H8HA 3NW7A 2J0KA 3NUSA 2OK1A 3IONA 3FY0A 3PVUA 2PVRA 4JBPA 3ALNA 3LFSA 5FEDA 3A60A 5BVFA 4CLIA 4RJ4A 3ORKA 1ZYSA 2VTNA 3FL5A 2ZM1A 2UW5A 4YC3A 3T3UA 3F69A 1M2QA 4AW5A 3CTJA 2FSLX 2PTKA 3D5WA 3UZPA 4C57A 3TACA 3QWKA 4GYGA 5EW3A 4ZXTA 2VTPA 4XHKB 2QURA 4CCBA 3KN5A 4JR7A 3TZMA 3VBQA 4CYIA 5J5TA 1CDKA 5I3RA 2F9GA 2G2FA 5HTIA 5EYCA 4ZLZA 2IWIA 4LM5A 3NYNA 4JX3A 4XS2A 5AP2A 4QP1A 4S31A 3LPBA 3NRMA 1S9JA 2XEYA 4C58A 3VWAA 4CKJA 2GQGA 4GU9A 4MHAA 4OTGA 2XNBA 4QOXA 5BVKA 3VBXA 3GOPA 3KN6A 2H34A 1CKIA 1DM2A 3V04A 3ZFMA 4CNHA 3MI9A 4IAKA 1JLUE 3H10A 1VJYA 5EOLA 1W82A 2QOOA 4MTAA 2GFCA 5EM8A 2PVHA 1OIQA 3OOMA 4KD1A 4YZNA 2WU6A 3KKVA 1YXXA 3QLFA 3OXIA 3QCQA 4LQMA 4I0SA 4OTPA 4X7QA 4YJRA 5ANGA 4YO6A 4QP6A 5EW9A 3ROYA 3W33A 4YSMA 5K5XA 1FQ1B 2R3QA 4OTQA 2JDVA 3V01A 2GU8A 4ZTSA 5LARA 2R2PA 3FQSA 4WIHA 5CU4A 2QOIA 2WQMA 3OT3A 5HORA 2ZDTA 1X8BA 2QO2A 4X2GA 4FC0A 1S9IA 3HGKA 2R3NA 4I1ZA 4ZSJA 4YP8A 3KY2A 3TKHA 3HUCA 4A9UA 4FKIA 4GT3A 3SD0A 4BCHA 3Q4ZA 4N6YA 4JIAA 1IASA 4FKVA 4E1ZA 4AZTA 4HNFA 3REPA 4YHTA 4YJPA 5LQFA 5CX9A 2XCKA 2ITXA 4MXCA 5AUWA 5L2QA 4KBKA 4HGEA 3UNZA 4DH8A 3DZQA 4LRJA 1F3MC 3G6HA 4EQMA 3TUBA 3DFAA 3ULZA 5JEBA 4EBWA 2UUEA 2VO3A 3QGWA 4C59A 4RWIA 5J9ZA 1QMZA 2XIKA 3OWJA 4CFMA 1E1XA 4YLKA 4QQTA 3TCPA 1P14A 3GCSA 2OF2A 2CSNA 4MNEA 4RQKA 2GNLA 2C1AA 3O96A 2J90A 3LAUA 3MFTA 5DPVA 4CTCA 4W4VA 3CJFA 4U7ZA 2WTVA 5CYIA 3H4JA 3UYSA 3VS2A 3EOCA 1MUOA 4F9AA 4GT4A 2OXDA 2ZDUA 4IB3A 4LRKA 2V22A 4AW0A 5BPYA 4BGQA 2I40A 2IN6A 4MBLA 5LVNA 4N4SA 2JDSA 3F3VA 4XH6A 2EXMA 3R83A 5HESA 4C3RA 1ZOHA 5AADA 3D83A 4CVAA 1Y8YA 5HE2A 5IA4A 2W05A 3MY5A 4F70A 3E8DA 5AP7A 3LCOA 3VRZA 3RHKA 4BFMA 5C8NA 4APCA 5JFXA 4GFGA 2R3RA 2VTIA 1WVXA 3W8QA 4L6QA 1ATPE 2P55A 4BTMA 3MVJA 4YMJA 3FL4A 3HRFA 2F7XE 2GHMA 4ANBA 2BDFA 3JVRA 2OJGA 2BRNA 4N0SA 1ZWSA 4XG8A 3DA6A 5E8YA 3JPVA 3MH0A 3R8UA 3LFCA 4ZOGA 5FDPA 5L8KA 4G6LA 4TNDA 4ANMA 4ARKA 3I0OA 5A4EA 2X0GA 1VEBA 3PE1A 3ZSGA 1ZZ2A 4IFCA 2PVJA 3W1FA 4IMYA 4U79A 2B52A 4DEIA 4PTCA 3OBGA 5FTQA 4ZEGA 4D55A 2HCKA 4USDA 4A9TA 3HECA 5KBRA 4JG8A 4XG4A 3ORPA 4L7FA 1CKPA 3IW8A 3EYGA 3ZS5A 4DG0E 5KMLA 2BZIB 3D7ZA 3RI1A 1E1VA 2O63A 4I21A 1GZKA 3LFBA 4I0TA 2X7FA 1O6KA 4RSSA 3U6IA 5G1XA 5TF9A 5L6OA 1YKRA 3M42A 2I1MA 3QHWA 3VBWA 4TKSA 4TYGA 2PUUA 4IB5A 5M4FA 2XBAA 4MAOA 2ITUA 3BGQA 4QMPA 4Z3VA 2C6OA 3C9WA 5J9YA 4TYHA 4RZWA 4Y85A 4J71A 1W7HA 3CBLA 4C4GA 4F1MA 4RC2A 4WG3A 4R1VA 5IA5A 5CT7A 5I3OA 5IDNA 4CLJA 5E8VA 1QL6A 2H96A 5ANDA 4D2PA 3R04A 4IANA 2XYUA 1XQZA 1K2PA 4Q2AA 3CCNA 4IX4A 2OJFE 4RPVA 3FQHA 5IA0A 3VJOA 3K5VA 1JSVA 2WPAA 4G31A 4XRLA 5C1QB 4FNXA 2BZJA 3E8EA 4FTJA 4DYMA 3EFKA 4L00A 3QBNA 5FP5A 2W5BA 3UIBA 3VUMA 4LOQA 4KBCA 4F0IA 4APPA 4UMUA 2VZ6A 4ZJIA 2J51A 4BGHA 1YDSE 1H28A 4AZSA 1JSTA 1U59A 3PPKA 2V7OA 4XG6A 1YHSA 4FTOA 4YZMA 4FBXA 2X6EA 2ITZA 4FTUA 5K4JA 4Q9ZA 3FQEA 5D9HA 1QPEA 3OMVA 2XNEA 3LCKA 4FIFA 1FGKA 1SVGA 2F7EE 3ZXTA 3Q6WA 4B9DA 5AAEA 5I9VA 1AGWA 3GU7A 4NKSA 5EDQA 2YEXA 4CRLA 2R7IA 3IQ7A 3PJ8A 3NCZA 4IWPA 3RGFA 4CYJA 2AC5A 4RGJA 2CGXA 3GC7A 4LFIA 2XNMA 4W8DA 5CU3A 3FMMA 3COIA 5CZHA 2VU3A 3P7BA 2ETRA 3ZTXA 3PPJA 2HW6A 4EQCA 2ZV2A 1KV1A 2CKEA 3QQKA 2EXCX 4B99A 5A14A 4HZSA 4IC8A 2W1HA 2XJ2A 2HK5A 2JKOA 3TJCA 5CANA 1WBNA 4IDVA 2UZWE 4Y73A 4U3ZA 2CN5A 4UWBA 3B8QA 2VGOA 5JFVA 2GCDA 3TWJA 4XOYA 4HNIA 3ZSHA 5AA8A 5AV3A 3RWPA 4P7EA 2OO8X 2GS6A 4RIXA 4UWCA 4D9TA 1Q61A 1CTPE 4RIWB 4BCMA 4DH3A 3KULB 2WFYA 2WMQA 5A6OA 5EH0A 4HPTE 4MXAA 1Q41A 2ZVAA 5K0KA 4XG2A 3AC5A 4EH8A 4JBQA 1Y91A 3BHVA 4CFNA 2C5NA 3SC1A 4YO4A 2ZB0A 3OF0A 3E3BX 4IZAA 2ITNA 5AMNA 3IG7A 3UG1A 3IKAA 3EYHA 1ZMWA 3QYWA 1OVEA 2ZM4A 3EHAA 5KMKA 2ZMDA 4FVPA 4I94A 3EQIA 3PRIA 3E5AA 4BDBA 2BKZA 1H25A 3ORXA 2OFUA 3FLNC 1PMNA 4ZTLA 1GZ8A 2WGJA 3GXLA 3OVVA 4FTAA 3GENA 3II5A 3RZBA 5T68A 3HV3A 1Q62A 2EVAA 5AX9A 4CFXA 3UZTA 1HCKA 4ANOA 5IKWA 2QLQA 4ACHA 3LE6A 4R3CA 3GU4A 3KRJA 2JLDA 4EI4A 2R0UA 2UZEA 5BMMA 3FXZA 3ZO2A 2CLXA 4C3PA 1GIJA 3DK6A 3NIEA 1GY3A 4D1XA 3KMUA 3C4CA 4YNOA 2RL5A 2W99B 4KS7A 1AD5A 3HV5A 3KXZA 4J52A 3EKKA 1ZOEA 2EB3A 3M11A 3SDJA 3PA4A 3U8WA 4AF3A 4C02A 2HAKA 1ZYJA 1YRPA 3RK9A 4FIJA 5D1JA 5LWNA 5HNBA 3FKOA 4GJ3A 2X2KA 3MGYA 4KS8A 3ELJA 3LXKA 4JRNA 4R3PA 2VUWA 4II5A 3KU2A 3NIZA 2Y7JA 3SRVB 3EFJA 3M1SA 4BB4A 4BBFA 2JFLA 3OROA 3QD4A 4IBMA 2XNNA 3VUIA 1WFCA 4O0YA 3DFCB 3RP9A 3EN4A 3AC8A 3FLYA 1SVHA 3VHKA 4ZZMA 3DBQA 3BPRA 3SOAA 4ZAUA 4ASXA 5AP3A 1XHAA 1SZMA 2G1TA 2QOBA 5IDPA 1OL6A 2X2LA 4LG4A 2WZJA 5AJQA 2CPKE 1NA7A 3A2CA 2SRCA 5D41A 1YI4A 3D5XA 4MBIA 3ANRA 4FT5A 3VS4A 1BI7A 3DTWA 4EKLA 2XNOA 4FV4A 2WMBA 2UW9A 2G9XA 4RX7A 2ERZE 2R3OA 4G3GA 3CKXA 3VUDA 5I9ZA 3AC2A 2YA9A 4HYHA 5IH5A 2IZUA 1ERKA 4PTGA 2A19B 5DFPA 2C5YA 3OC1A 1BL6A 3OP5A 5CAQA 4D9UA 4GJ2A 5KBQA 3W2SA 4FV9A 2DQ7X 3TUDA 3PYYA 4XX9A 2ZMCA 3HDNA 4QNAA 4YJTA 4JL9A 3QX4A 5HCZA 3DBCA 4UB7A 4V04A 1DAWA 2RKUA 3QTXA 3DNEA 3R7EA 4AACA 4E7WA 2HWPA 3F66A 4TYEA 5EG3A 2FVDA 3IW7A 3FAAA 4JG7A 1YI6A 4R6VA 5HD7A 3BHTA 5ICPA 4PL3A 3C1XA 4QQCA 4D2VA 4I5PA 2XUUA 3TL8A 1LR4A 3PRFA 3PP1A 5E90A 4YTCA 4XRJA 4AE9A 2C5OA 3LFAA 3ENHA 3F82A 3G2FA 3E93A 4NIFA 4O0SA 4R3RA 4ZSEA 3R8PA 3VF9A 1IRKA 4IM2A 3L8PA 5LCKA 3ORLA 4YU2A 3UODA 5I0BA 1W98A 3WI6A 4FVRA 4RLKA 5DIAA 1PXMA 3P23A 3GQLA 3GFWA 4EH3A 4OT5A 2CMWA 4JJRA 1UKIA 4PX6A 2XKEA 4FKSA 3BZ3A 4BWPA 3ORTA 2OIQA 3EN9A 3QF9A 3LXLA 4KA3A 4FTIA 3WILA 2O8YA 2PMNX 2O3PA 5CVGA 4AWIA 4HVIA 3L1SA 5HU9A 2WHBA 3EQGA 4BICA 4PQNA 5CNNA 3AC4A 4H58A 4TT7A 3IGOA 4K8AA 2HZNA 1Q99A 3JXWA 3R9NA 4RIOA 5ANIA 4U8ZA 3TTIA 2WQBA 2PY3A 4IJPA 5GNKA 3FHRA 2YM3A 5I4NA 3LZBA 4X6RA 5ETCA 4QPAA 3PXKA 2EXEA 1FGIA 3F3WA 3DQXA 5DGZA 3A62A 1MP8A 1XBCA 1ZY5A 3A61A 4M68A 4QMSA 4PMPA 4X21A 2Z2WA 1WBOA 3QTRA 1OL5A 4NM5A 3DPKA 4D4VA 1FMOE 1YI3A 2EB2A 2PVMA 3Q60A 3ZLWA 2BMCA 2XNGA 4JI9A 4QTCA 1UKHA 3LHJA 3QRIA 1U54B 3R1YA 2HWOA 4FSZA 2FUMA 4H3PA 4EK6A 4WG5A 1PMEA 1Q8WA 3HV7A 4I5MA 1PXJA 3Q3BA 4ALVA 5FEEA 5M4CA 1BYGA 1YOMA 4P90A 2OICA 4QP9A 1U5RA 2PHKA 4LOOA 3A7HA 2E9OA 1JVPP 3QYZA 4HJOA 3HA8A 3P7CA 4G3EA 3BRBA 3MIAA 3VRYA 3MVLA 4NCTC 5DI1A 3ZU7A 3PY3A 3IK3A 5GZ9A 2PVLA 3D0EA 3FHIA 3LM5A 4FSWA 4KAOA 4FUYA 4JOAA 3Q04A 2P33A 5ETAA 4FNWA 3E92A 5BVOA 5JN2A 1XJDA 2JGZA 4XP2A 5L2TA 4FMQA 3G0FA 4D4SA 4RJ7A 3G9LX 1XBBA 4OBPA 3HA6A 2OZAB 4GS6A 1QPDA 3Q4UA 3W16A 4M69A 4FKUA 3QRUA 3T9IA 3TNIA 1W0XC 4O27B 3TV6A 3ZUUA 3JVSA 1BMKA 5HO7A 3E63A 1KSWA 4QYHA 3R2BA 5H8EA 3MY1A 4I4EA 4QMTA 3VUTA 4BCNA 4EORA 5B2MA 3QRKA 3E7VA 1QPCA 5K9IA 2VNWA 3MB6A 2QVSE 3QA0A 3CP9A 4IDTA 5A4CA 4RQVA 4MD9E 2BIKB 1UU3A 4CKIA 3ODYX 1Y57A 4J8MA 3KCFA 2X7GA 3P5KA 3PSCA 1OI9A 3WF5A 2G01A 2FB8A 5HIDA 1PY5A 3OS3A 3V8SA 5DT0A 4EOPA 4BBMA 3NUNA 4AP7A 4BDGA 2WTDA 3R2YA 4DEHA 2VO7A 5FXQA 5CASA 1OITA 3LM0A 2VWVA 4EC9A 3R8ZA 3GI3A 1HCLA 4FSRA 4ZZOA 5HD4A 4GCJA 3QQLA 5HNGA 4AA0A 2YCQA 3ETAA 3HMNA 3V5TA 4R7IA 3GU6A 4AAAA 5IPJA 5FEQA 1RJBA 2QO9A 1ZAOA 3O0GA 4Y5QA 5BVEA 5JK3A 3E62A 2UZBA 4GRBA 5LVLA 4EKKA 4C38A 4WO5A 1IA8A 2PMOX 3H0ZA 1TQMA 2ITPA 3BHUA 5HO8A 1RW8A 5ACKA 3QQHA 1KWPA 1GJOA 2CN8A 4ASEA 3FMLA 4BI0A 1PHKA 3MFSA 4ZTMA 2C5XA 3UE4A 2C47A 4NEUA 4RVMA 3GQIA 4BVUA 5AEPA 5HTBA 3KXHA 3Q4TA 3ORMA 3RPSA 4O22A 5J8IA 3DCVA 5AR2A 3AT3A 3A7IA 4MK0A 3GNIB 1XH6A 4UYAA 2GS7A 1UU9A 3QGYA 3PWDA 3G9NA 4HVGA 1T46A 4AX8A 2X7OA 4F9BA 2OKRA 4MF0A 1BKXA 4YC6A 2R64A 4ZSAA 3RWQA 3GB2A 3Q9ZA 3C7QA 4OTWA 4C4EA 2XEZA 3U4UA 3ZDIA 4NTTA 3UOJA 4ZY6A 4EYJA 5EKNA 3OY3A 1Q24A 3W18A 2E9PA 2VO6A 3EL8A 1XBAA 4FTNA 4ANLA 4BDIA 5JRQA 4FKPA 5HICA 1V1KA 4EOJA 4EK5A 2JDRA 4O0UA 4I20A 2BIYA 3RK7A 3RPVA 4CMUA 4BI1A 4YGAA 2YJRA 3NWWA 2XK7A 4FA2A 1OKVA 3QXOA 1LP4A 4EK3A 5CALA 4YTHA 5JKGA 4EWHA 3NDMA 3ANQA 3EH9A 2Z60A 5DRBA 4GFOA 4I23A 2QKWB 2JDTA 2JDOA 1XH8A 4ANQA 4QTDA 5AUTA 5KNJA 1SNXA 2A27A 3B2WA 4QT1A 1PYEA 3BU5A 4BWKA 3A7JA 4RFZA 1H1WA 2JKKA 4PMMA 3Q6UA 1YOJA 4LYNA 3WF9A 4E3CA 3B8RA 5HLNA 2VN9A 1XH5A 3DS6A 4DEDA 4CXAA 1YDTE 3RINA 3OWKA 3TI1A 3PVWA 1OL1A 2BFXA 5GZ8A 2PVFA 2PZRA 3R71A 5DH3A 5LJJA 3CQEA 1UU8A 4NCTA 4QMMA 1PYXA 4XV2A 2Z7QA 3RHXA 4AZVA 2Y4PA 4W9XA 4KBAA 4P4CA 5JRSA 2YN8A 3C0IA 3RPYA 2O64A 1ZXEA 5F9EA 2REIA 4RWJA 1OGUA 2A0CX 4BL1A 2GNHA 5L2SA 1HOWA 2PVNA 5HG8A 5CSPA 4AOTA 3CJGA 2W1IA 3AC1A 3PXQA 2YHVA 4QMYA 2XCHA 3ZZEA 2QOLA 4MH7A 4IZ7A 4D4RA 3MVHA 4O1PA 4YJNA 3V8WA 3C0HA 3QCYA 1GOLA 4AGDA 4FSUA 2PWLA 4BCFA 3CC6A 1H24A 3AGMA 3F3UA 4GV1A 3HVCA 1WZYA 1K9AA 3POOA 2VV9A 4NW6A 2JKMA 1H1RA 1LEZA 2BUJA 2OWBA 3FZRA 2ONLC 5CVFA 3NNXA 3BV2A 4C2VA 2QKRA 2XKFA 3FC1X 3PXYA 2QNJA 1Q3WA 1Y6BA 2YIXA 4Q9SA 2RGPA 2VWZA 3FBVA 4FNZA 3ZLSA 3GEQA 3AD4A 4EOKA 3VQHA 3AG9A 3COKA 4B8MA 3HMPA 1OMWA 3DKGA 4K6ZA 4NUSA 4YLLA 3CE3A 3ZCLA 3HLLA 2QR8A 2HW7A 4HCUA 3WF7A 3WYXA 4K18A 3R6XA 3C4XA 1NVQA 2VWWA 1WBSA 2B9JA 3DY7A 1JWHA 1I44A 3AMYA 3BEGA 3LLTA 4QP3A 4WBOA 2PE0A 3C13A 4MNFA 4BDDA 5F95A 4P5QA 1M2PA 3BGPA 4KIKB 5FGKA 2YDIA 3UPXA 3W2QA 5M4IA 4XMOA 2WOUA 2CCHA 4A4LA 4FV3A 4L3LA 2UVXA 1QCFA 4AN2A 1YWVA 4BZOA 5LVOA 4AZWA 4HVHA 4FKTA 3R02A 4I3ZA 1LUFA 4TL0A 2BHEA 3EN7A 4GK4A 1KV2A 4TWOA 4TXCA 5JZJA 2OG8A 3LXPA 5EI8A 4DEBA 5DR2A 2J0JA 4MYGA 1KE7A 4RT7A 4NTSA 4FV8A 5D11A 3RCDA 3U6HA 1FINA 4FGBA 4EHVA 3P86A 4K11A 4K9YA 3DKCA 3LOKA 4AFJA 1YDRE 1DS5A 2VNYA 2B1PA 2WIPA 3PWYA 3IPHA 4S30A 4WKQA 3FPQA 2NPQA 2Y0AA 2R3MA 5CS6A 2QOFA 2WEVA 3ORZA 4ONAA 3UOHA 3PUPA 5L8LA 1BUHA 3L8SA 4EEVA 3GOKA 3IW5A 3L9PA 2ZM3A 5CTPA 4LMNA 4U43A 4KNBA 2QO7A 4UALA 4NWMA 3E3PA 3QZGA 4H39A 4RRVA 3OUKA 2RF9A 4IB1A 5AP4A 4JT3A 3LMGA 4D0WA 3P78A 3I79A 1H26A 2R9SA 3SHEA 1GIHA 5HG9A 3VUGA 4EZ3A 4ZTRA 5AAFA 4O0VA 4HZRA 1JNKA 2YLFA 4E6AA 3QKKA 3BWFA 3C4ZA 5AV1A 2QODA 1W83A 5LWMA 4QMOA 2J4ZA 4YLJA 3H3CA 4Z7GA 5E7RA 3WF8A 4OAVB 5GJGA 3BEAA 3JYAA 3QQJA 3LIJA 4JDIA 3UVPA 5LOHA 5B0XA 2PE2A 5L8JA 3UDBA 4ZIMA 2WAJA 2X8DA 2XB7A 2YIQA 4JS8A 1SNUA 4UMTA 5HE1A 3LQ8A 4FT7A 4YJQA 2F2CB 2WMWA 4AOJA 1Q4LA 4PP9A 4M3QA 4I6BA 4UEUA 5EYDA 2W1FA 4WHZA 3SLSA 2WOTA 3ZXZA 3BQCA 3N9XA 4CFFA 2UW4A 3V3VA 3SAYA 5D7VA 3QQFA 2VWIA 2XZSA 4QP8A 4FTLA 1MQBA 3T3VA 3H9FA 4NKAA 3R7VA 2W96B 5T3QA 2CGVA 3BI6A 3R73A 4XJ0A 5J1WA 4YBJA 3AT2A 4FV2A 4M97A 4BBEA 4DG2E 2QU5A 4O96A 1MRUA 2V5QA 4Q5EA 4A9YA 1SVEA 2X8IA 3U9NA 5C9CA 4KKEA 4FZAB 4WSYA 3RK5A 4L3JA 1REKA 4MX9A 1BX6A 2DUVA 3FMEA 4GIHA 4XLIA 4KRDA 4DLIA 4FL1A 2WB8A 4BDKA 4ZJVA 5A3XA 3WBLA 2ONLA 3ALOA 2OW3A 5IUGA 4EOIA 4BGGA 2G2HA 3ZSIA 1XH7A 4MWIA 5KKRC 4RA4A 1JPAA 3FKNA 4USFA 2J0LA 3NUUA 3IDBA 4GW8A 5FBNC 2YIRA 4OTFA 4ZZNA 4B4LA 2A1AB 3ZDUA 1H07A 4AZEA 2RFDA 2QU6A 2PZYA 5HLPA 5FRIA 4IVDA 2W1ZA 1OIRA 2XH5A 3PG3A 3UO4A 3GC0A 4FSMA 1FVRA 1ZYCA 3I7CA 4D4YA 5CAOA 4GK3A 4Y46A 5M57A 1FVVA 2GNIA 2YFXA 2ITOA 4F7LA 4AXAA 1H8FA 4TWNA 1B38A 4NM7A 3AGLA 4BIDA 5E8TA 4UMRA 2XK6A 5CVHA 4O0XA 2OZOA 4RMZA 3FLSA 3PVGA 4J53A 3PSBA 3PJ3A 5KUPA 4U5JA 4FKLA 3MTLA 4RJ6A 3D14A 5HE3A 1JAMA 3I0QA 2XK3A 3O50A 4UMPA 3FZPA 2F2UA 5EOBA 5AIKA 2AUHA 3HP2A 4L3PA 3VS1A 3D2IA 3TNWA 4NFMA 4UMQA 1WCCA 2VGPA 3EQCA 4KIQA 3F9NA 4BTKA 3TV7A 2FSMX 3NW5A 4JX7A 5AV2A 4ENYA 4YR8A 3HKOA 4EH4A 3I4BA 4ITIA 3KB7A 4QYYA 1JOWB 3FZOA 2WNTA 3WZUA 2WU7A 3ZC5A 4KWPA 3FC2A 3F5GA 3KA0A 2BAKA 4FTCA 2X6DA 3PG1A 2GHGA 1KE8A 5HNIX 4CT1A 1U4DA 2VWYA 2ERKA 4W4XA 3RBWA 3DLSA 4XBRA 4I6FA 4BHNA 2WTJA 5FXSA 3IOKA 3TT0A 3DXNA 2GS2A 1PXNA 2VWUA 3RALA 4BCJA 3KRLA 2LGCA 2OFVA 3QKMA 4A07A 4A9RA 1Q8ZA 2XIYA 4V0GA 4L43A 1LPUA 4RIYB 3VULA 3O8PA 1Q8TA 2WMVA 4V05A 3QRTA 4IHPA 4IAAA 4CT2A 3FLQA 5TT7A 2G2IA 2Q0BA 1OM1A 3OCTA 5EHYA 2CCIA 4JAIA 5A4QA 4BN1A 1BI8A 4DN5A 5KO1A 2QR7A 3TN8A 4FTRA 4HGSA 4RBLA 4U9AA 4QMUA 4JQEA 4S33A 3G51A 2BTRA 2BDJA 4QMXA 3OWLA 5FWKK 2FGIA 5KX8A 5AR4A 2HENA 4L01A 3A8WA 5EM7A 4EK8A 4C34A 4G17A 2IW8A 4BZNA 5HIBA 2PMLX 2RIOA 5CF4A 3OTUA 5KHXA 4FG8A 2R3FA 3NYXA 2B54A 4G1WA 2R7BA 1CKJA 4DEEA 3RVGA 2B7AA 3IGGA 3VF8A 2BAQA 2OIBA 3GU5A 4UXLA 5AA9A 4FT0A 2JBOA 5CU0A 3QTSA 1OL2A 4IZYA 1XR1A 4L44A 1H1PA 4AG8A 3TZ7A 4PWNA 1H1SA 4QD6A 2ZB1A 2I0HA 3A7FA 4J7BA 2UZVA 3IECA 4AN9A 4C7TA 4FTKA 4H36A 5KMMA 3PLSA 3CQUA 5JGBA 5CNOA 3D7TA 4BIEA 4FYNA 4JBOA 4XV9A 2ZAZA 3R7OA 2BILB 3TNPC 3K54A 4PMSA 5JFSA 5EFQA 4PRJA 2UW7A 3LFEA 3Q9YA 3F3ZA 4O1OA 5DE2A 4EH7A 4QMQA 3EQHA 3TTJA 4WA9A 3RNYA 5BUJA 4CQEA 4EHEA 4EWQA 2YCSA 3MVMA 1ZYDA 5H3QA 2YERA 4PP7A 3EZRA 4KIOA 4D2TA 4ZTQA 4QRCA 5DEWA 4CZYB 4DEGA 2J50A 5CAPA 1CMKE 3GC9A 3O2MA 3R9OA 3FXXA 3D15A 4LRMA 2DWBA 2R3GA 4QTAA 1YHVA 5JH6A 4I0RA 4GSBA 3ODZX 3I6UA 4EK4A 4ZLOA 4YUQA 1V0PA 4FIHA 3UP2A 5FBOA 4E8AA 4KSPA 3TZ8A 4MQ1A 5J95A 4XYFA 2P4IA 3D4QA 2Z7SA 2BTSA 3F6XA 4HYIA 4D1SA 4O0WA 4XEYA 5L3AA 2WO6A 5KE0A 4FKGA 3KVXA 1M7NA 2V0DA 3B2TA 4WRSA 3ZOSA 1NY3A 4RC4A 3R1SA 4XG9A 5DWRA 3COHA 4H3BA 2KTYA 3IDPA 4TN6A 4HVSA 3P1AA 1IG1A 3BYUA 2ZV9A 2BZHB 4KKGA 3RNIA 3QQUA 1URWA 1ZARA 2YCFA 4FL2A 4YTIA 4BCQA 2A4LA 5CEQA 3ZH8A 4G3FA 2BRBA 4QP4A 2C4GA 3G90X 3JY9A 4I93A 5HQ0A 3TV4A 3UOKA 4JDJA 4DGOA 3F5XA 5HBHA 1FMKA 2UW3A 3CQWA 2V62A 3EZVA 4NW5A 4O21A 4AT3A 3WYYA 1J3HA 5GJDA 3K3IA 3IDCA 3CPCA 4DINA 5AP1A 4FTTA 4WNOA 2GTNA 1YXSA 4YHFA 2B4SB 3LJ1A 3ERKA 4DGGA 4E6DA 3FDNA 4PDPA 3LXNA 5TR6A 3FE3A 4RLLA 1PXIA 2JBPA 3EB0A 4AA5A 3MY0A 2WMSA 4FZDB 3FLZA 3R22A 2UV2A 2RSVA 3PZEA 3VQUA 1R0EA 3RPOA 5HHWA 3VIDA 3VS3A 4DBNA 5TO8A 1W84A 4F6SA 3FKLA 4QYGA 3ZYAA 2XS0A 5BUIA 3CIKA 5BX0A 2HIWA 4DFNA 5CWZA 2FSTX 4MKCA 2WMXA 1OPKA 3BBWA 5I9WA 1UWJA 5D7AA 3TKIA 4YTFA 1R78A 3BLQA 2RG6A 4AA4A 5C8MA 3D9VA 4ALWA 3R7YA 4WD5A 1H0VA 4G16A 4AS0A 4ANNA 3RCJA 3ZZWA 4X2NA 5E1SA 1E9HA 3AD6A 4MXOA 4NZWB 3WE4A 2C69A 2Y4IB 4FEQA 4KINA 5HG5A 4RX5A 5HI2A 2OGVA 2X2MA 4I6HA 1O9UA 5LVPA 3F2AA 1YXTA 2QOHA 4XG3A 2ZOQA 4Z9LA 3R21A 5IF1A 2ITQA 3E8NA 4JAJA 3DAKA 4ITJA 4WUAA 4AN3A 4J99A 3GC8A 3KF4A 4M0YA 4QMZA 5A9UA 4CKRA 4IE9A 3NGAA 5AV0A 3BCEA 4S34A 4MWHA 1KOBA 4F9WA 3RAWA 2OI4X 3BELA 3N51A 3NNUA 4C36A 3HZTA 4G5PA 2H6DA 4E20A 4GIIA 3UG2A 4M8TA 4BZDA 3BIZA 2CGWA 4RA5A 4FSTA 5F94A 4EH5A 3CXWA 5CZIA 5HX6A 4EQUA 4D28A 3HRCA 1R0PA 2E9VA 2YLEA 4PTEA 3HYHA 4W4WA 2X1NA 4WRGA 3HMMA 4L53A 3EKNA 3OUNB 3RJCA 2WMAA 3CEKA 3FMDA 3QTUA 4IEBA 2WMUA 1ZOGA 4FTQA 2UZNA 1KE9A 1MRVA 3PE2A 2IVTA 3A7GA 2C5VA 3SQQA 2IZTA 3OOGA 3ZO3A 4C4JA 5L4QA 2WD1A 5DOSA 5EW8A 3ZEPA 4GU6A 3R9HA 3O23A 4GUBA 3UO6A 3V6SA 3LVPA 4OW8A 2JIIA 3O71A 4RX8A 4D1ZA 4DC2A 3PP0A 4F7JA 5CI7A 4XCUA 5HCXA 2ITWA 3QXPA 5LMAA 1ZLTA 2WTCA 3FMKA 3QALE 3SA0A 4LGHA 3OCSA 4ID7A 2Y8OA 4ACMA 4QQ5A 5IISA 4D2WA 4QTBA 3VN9A 2PVYA 4FIEA 4IB0A 3PSDA 3FYJX 3QZIA 4L42A 2YM8A 2JEDA 2HELA 2QD9A 3G6GA 3CTQA 2Z7LA 3NZ0A 4LUDA 4RFMA 4RWKA 5HBEA 1Q97A 1H27A 3R8VA 5E1EA 5KHWA 4QMWA 5JSMA 4UN0C 3O51A 3T8OA 4AT5A 2OJIA 4JR3A 1CM8A 4R5SA 3CD8A 3KCKA 3DK3A 4FUXA 2UW8A 3HP5A 4AGCA 1YVJA 2VTJA 3OD6X 4XLVA 3ORIA 3DBFA 2G15A 4MNEB 5IMEA 2NRYA 4ACCA 3KK8A 4U44A 2C6TA 4E26A 3W2RA
chains in the Genus database with same CATH superfamily
3WARA 3VS6A 3I5ZA 5EHOA 3E7OA 3VUKA 4Z55A 4J97A 3LW0A 5HLWA 2R3PA 2VTRA 3HDMA 3R00A 3HV6A 3OG7A 3QA8A 5BVNA 4L7SA 3EMGA 1NVSA 2C6EA 4IJ9A 3PXFA 4C8BA 2VTSA 4EH2A 2WTKB 1H01A 4H3QA 3I7BA 3BE2A 3QUPA 4U81A 2VAGA 3R7GA 5EYKA 3DOGA 2AYPA 3UMXA 2LAVA 2J2IB 5J9LA 5I9XA 4MEDA 1SYKA 3EFWA 3AMBA 1Q8UA 2ITTA 5I9UA 4FV1A 4JVGA 4XV1A 4C0TA 3LCDA 2Y9QA 3SXRA 2VTMA 3MIYA 4AZFA 2I0YA 3UIMA 4BHZA 5H8GA 5C01A 4ALUA 5M44A 1RDQE 3ZFYA 2C6LA 3L8XA 3THBA 4C61A 1OPLA 3BV3A 2EU9A 3KXXA 4A7CA 3F5UA 5L6PA 4ZLYA 4G5JA 4IAFA 2OJ9A 4EYMA 2R3LA 1JKLA 1TVOA 4L8MA 4O4FA 1OPJA 4DFLA 2IVSA 4MF1A 1Y6AA 3DK7A 3DT1A 4FZ6A 3VNTA 4PV0A 1APME 1Q3DA 1NVRA 2OH4A 3NNWA 2YISA 5DVRA 5LCJA 2OXXA 3ULIA 2UZTA 3CS9A 3S2PA 4BWXA 4DAWA 4DH7A 1J1BA 2XKCA 5BVDA 3LCSA 4GG5A 3U9CA 5EDRA 5EM6A 5BNJA 1YXVA 5DT3A 4GYIA 2W1DA 3QTZA 4ERKA 4RIWA 3KULA 2BVAA 4IWQA 3UQFA 2HYYA 2YITA 4IC7A 4JRVA 4QMLA 1OECA 4I5CA 5AV4A 4OBOA 3QUEA 4O6EA 3AT4A 2W5AA 2OU7A 4RX9A 4TYHB 4P2KA 4MQ2A 5E8UA 4U97A 3VJNA 2Y6OA 2R5TA 5FTOA 4LMUA 5M56A 5K0XA 4NU1A 3OFMA 3SX9A 3DZOA 1F0QA 4ERWA 3KXMA 2VTHA 2IW6A 3Q96A 3NR9A 4O91A 4PL4A 4FNYA 3QFVA 4UWYA 3F5PA 1AQ1A 1GZNA 2QOCA 3OCBA 3CTHA 3R7IA 3QRJA 2C3JA 4EUTA 3HUBA 5HTCA 3QD2B 5TE0A 3WZDA 4EJNA 3QL8A 5IUIA 2X39A 3TUCA 3MN3A 4YPDA 4WSQA 4ZTNA 4PUZA 3EQRA 3FPMA 4JG6A 5HGIA 4F0FA 3Q9XA 2FSOX 5CEIA 1TQIA 3V5PA 3DB8A 5IG1A 2HY0A 4EC8A 3TIYA 3PIXA 2GDOA 4TWCA 2V55A 4C3FA 3OWPA 2C0TA 3CR0A 2ESMA 3DKOA 3WZJA 4PMTA 3SKCA 5DBXA 3QD3A 3HEGA 4WOVA 3VBYA 1P2AA 2WQOA 3OY1A 3UPZA 1JKKA 1OKZA 1GZOA 3MBLA 2E2BA 1V0BA 2UW6A 5C26A 2Z8CA 5DEYA 2W4KA 3BU6A 3PA3A 4EBVA 4TYIA 4FKOA 2X0OA 3BYSA 3SRVA 5AR5A 5TKDA 3FY2A 4F63A 1PXLA 4TTHB 5CEPA 2J5EA 1LEWA 3QHRA 4C4HA 2BPMA 3C5UA 1PXOA 2NP8A 4GT5A 5A54A 1PXKA 5ANEA 1MQ4A 4F64A 4FT3A 4PDSA 4RZVA 2XIXA 4JLCA 4BKJA 1O6YA 3NPCA 2C6DA 4UZHA 4FICA 3ZM4A 3VS5A 3DNDA 4C35A 5IEYA 4NH1A 4ITHA 4PNKA 3R01A 4L68A 5CSXA 2XIZA 1J1CA 1OUKA 3BQRA 4C62A 4RIXB 2PZPA 4FV7A 3QTWA 5J5SA 4ZS0A 4H1JA 3FZTA 3D5UA 3LFFA 4F7SA 3Q2MA 1PMVA 3DBEA 5E8ZA 3ACJA 4DGMA 4FODA 4RC3A 2R3IA 3RZFA 3W8LA 3C0GA 2XVDA 2BROA 2UVYA 3NYVA 5HKMA 3MV5A 4YJUA 3MTFA 4EOLA 3DJ6A 3O17A 3MWUA 5LMKC 4M84A 4EH6A 4QMVA 3G0EA 4PNIA 3ROCA 4UZDA 1UU7A 5EHLA 4CV8A 1PXPA 5G6VA 5HOAA 4DITA 1DAYA 3MFRA 3VAPA 4J8NA 4F09A 3QC4A 3NYOA 5KMJA 4GH2A 4N6ZA 3PY1A 4NM0A 2X8EA 3A4OX 4ZY5A 3OXZA 2BDWA 3VS7A 4CD0A 1PKGA 2XM9A 4EONA 4D0XA 2WQEA 1FOTA 4XG7A 2VX3A 3CGOA 4EH9A 3PXRA 3R1QA 4L67A 4Z7HA 5JFWA 3PVBA 2NO3A 4U45A 3OT8A 1STCE 4HGTA 5J79A 3ZUVA 4NFNA 2C68A 3BE9A 3EFLA 4AU8A 5IA3A 4BKZA 4FR4A 5CSHA 3GVUA 2W9ZB 4TPTA 4JQ7A 2HXLA 3LFDA 4CEGA 1M14A 4M66A 4ASZA 4BTFA 2PSQA 4YC8A 4YPSA 3L8VA 1GIIA 1JKTA 3C51A 3Q52A 1ZRZA 3KGAA 3FMNA 3E64A 4OTDA 5FP6A 4G3DA 1XH9A 2ZYBA 4XOZA 4BCPA 3BLHA 1UNLA 4OTRA 5HVJA 3MA6A 3EQFA 2B9HA 4CQGA 4QYFA 5ACBC 3ZFXA 3NW6A 2WEIA 1REJA 4O0TA 3EWHA 4AQCA 4F9CA 5JQ8A 1Z57A 1ZMVA 2FA2A 4WG4A 5ANKA 3F61A 2C6KA 3FUPA 4FX3A 5AR7A 5GHVA 5HZNA 3UBDA 4Y95A 2VO0A 3LFNA 3Q9WA 1OIUA 5HEZA 2CGUA 3JS2A 5EYMA 4E93A 2VX0A 5E91A 3C4WA 2WELA 2YZAA 4MD8E 3WE8A 2W1CA 3MH1A 1U54A 4I24A 5IZFA 4Y72A 3M2WA 3GGFA 3PA5A 2YDKA 5CQWA 4KIPA 2VWXA 4AUAA 5B2LA 5EK7A 4BDAA 4FV6A 4CSVA 2BZKB 2HZIA 2QLUA 1WBTA 3VO3A 5M4UA 3VS0A 2HY81 1ZYLA 3PY0A 3I6WA 2GMXA 5FM3A 3UC3A 3W32A 3FI4A 1K3AA 1J91A 3BYMA 4UXQA 4GG7A 4UY9A 3TG1A 4LUEA 3KC3A 3K5UA 3BBTB 4D5KA 2Y6MA 2QONA 3E88A 3Q4CA 4LGDA 3ZBXA 4HVDA 3KMMA 4G6OA 5HE0A 2C6IA 4IAIA 1VR2A 4RVLA 1DI8A 5E8WA 5CF8A 2KULA 3V51A 4C37A 4I5HA 3BLRA 5DA3A 3HNGA 3C4FA 1UVRA 3TJDA 4L46A 4QP2A 1YWRA 2OZAA 4WT6A 4XV3A 3ZMMA 3IS5A 4NIFB 5JT2A 3FSFA 2IVVA 3QTIA 1YWNA 4HGLA 3SXFA 5IUHA 3UMWA 3EN6A 3P7AA 2E9UA 2YM4A 1V0OA 3A99A 1PMUA 4IM0A 3DJ7A 4IAZA 3LJ2A 4IVCA 3Q53A 4IM3A 4O38A 5HO6A 4F6WA 4YJSA 4CZUA 4O2ZA 2ETKA 2YJSA 3FV8A 4H1MA 5LMKA 2BRHA 3BX5A 2VTTA 2ITVA 3IW6A 4M7IA 3ENMA 5AP6A 5HG7A 4ANSA 4J98A 5BYYA 4JXFA 4PPAA 4FYOA 3CY3A 3EJ1A 2IZRA 4MCVA 2RFSA 5DT4A 4CFUA 2GPHA 5KZIA 1H1QA 2O2UA 2X9EA 4CRSA 4JDKA 4AOIA 5IU2A 1RQQA 5L2IA 2BHHA 3TKUA 2UZLA 1H08A 1VZOA 1GAGA 2FYSA 2XF0A 4B6LA 5I9YA 3AMAA 4I4FA 3DJ5A 4D58A 3OEFX 2UZUE 3UVRA 4RJ5A 4O4DA 3DQWA 5DMZA 1PKDA 4EZ5A 1DI9A 1A06A 2W9FB 4K0YA 4NJDA 3RM7A 5H2UA 4BDJA 4DTKA 3DAJA 2R3HA 5CU2A 2XIRA 4YZDA 4DEAA 4IZ5A 5AP0A 5IH4A 2B55A 2DYLA 3LJ0A 3QQGA 2BALA 3KVWA 3TNHA 3U51A 5KZ0A 3WIKA 1UWHA 4EL9A 4OR5A 4AT4A 5CXHA 3DU8A 3VBVA 1KOAA 3QKLA 4XUFA 4ZK5A 5ITAA 1EH4A 3ZBFA 4IX6A 1JKSA 2X4FA 1UA2A 3A4PA 4GVAA 4LOPA 4AE6A 3WOWA 2XA4A 2ETMA 4NJ3A 2PZ5A 5K3YA 1QPJA 4TW9A 5CLPA 3AQVA 1VYWA 3SVVA 4IAYA 2X4ZA 4OGRA 1M17A 3DDPA 4BTJA 1U5QA 4BDHA 2YIYA 3R28A 3NS9A 3NNVA 2B9IA 4XBUA 1O6LA 1PW2A 1FPUA 4BCIA 4S2ZA 3DAEA 4Z16A 5CF5A 4A4OA 4EZ7A 3H0YA 2QOQA 4M69B 3W2OA 5E8SA 4FL3A 5F20A 5LXMA 4LV8A 4QQJA 2IZSA 4IVAA 5DHJA 4G3CA 4XP3A 5L6WL 4B0GA 1F5QA 4HYSA 3NAXA 3Q5ZA 2JIVA 2WMTA 4FSYA 2UVZA 4D2SA 4OAUC 3E87A 3ZRKA 5HBJA 3DV3A 4RWLA 2J6MA 2X9FA 3GT8A 4TYJA 1I09A 1XWSA 4G2FA 1MRYA 3RPRA 4K77A 5LVMA 2GNGA 4K1BA 3TZ9A 2I6LA 4YSJA 3UVQA 2R0IA 1IEPA 4NK9A 3L9LA 5EKOA 3WIGA 4CCUA 5FG8A 4NM3A 5JGDA 5ETIA 1SMHA 3MDYA 2BRMA 3UO5A 2C1BA 1T45A 3OBJA 2O0UA 4FTMA 4FOBA 3VVHA 3UTOA 2VWBA 4BIBA 5FXRA 3RTPA 4C4IA 3F7WA 4GL9A 2CJMA 2JFMA 4DH1A 3QAME 4UBAA 4BI2A 4B8LA 4WNPA 4MXZA 4E5WA 2VD5A 3KRRA 2RFNA 5AM7A 4GFMA 2ACXA 4KSQA 2C3IB 2BFYA 2GFSA 3WZKA 4RVKA 2CHLA 1YW2A 3FXWA 3NCGA 4QMNA 4LL5A 3L9MA 4G6NA 4YNEA 2B53A 2C3KA 3H30A 3R63A 4MXYA 2P0CA 2VTLA 2W17A 3R1NA 4X0MA 3P0MA 4M0ZA 4FT9A 4I6QA 2YM7A 1YHWA 2QI8A 3S00A 3NUXA 3NLBA 3V5LA 4CTBA 4ENXA 4FSQA 4TWPA 4F4PA 4GMYA 5CEKA 3KQ7A 3P08A 3BYOA 4CV9A 2NRUA 5IEVA 4KABA 3D2KA 2QHNA 3ZLYA 4F7NA 3PZHA 4RG0A 5DR9A 4E6CA 4LGGA 2PMIA 4FV0A 4DFYA 2W4JA 2JITA 3I1AA 1UNHA 4PF4A 4Y8DA 2OXYA 2I0EA 5JMSA 2GHLA 5AUVA 3UGCA 3NAYA 2JD5A 1YXUA 3OZ6A 4X2JA 2R3KA 3RAKA 3V6RA 2F57A 4IX5A 4LV5A 4X3FB 3FZ1A 4KIKA 2JAVA 4HW7A 3U6JA 3RM6A 1B6CB 3JY0A 3K2LA 4ZTHA 2RFEA 4QNYA 5BUEA 3SW7A 4UV0A 2H9VA 3V5WA 4YBKA 4I41A 3VC4A 1OZ1A 4X2KA 3TEIA 2R4BA 4IX3A 1Q5KA 2Q0NA 2P2IA 3MYGA 4EHGA 4FVQA 5F1ZA 4BCOA 5IA2A 2GTMA 4FOCA 3W2CA 2PVKA 2ZV7A 2P2HA 2DS1A 2JC6A 4YJVA 3EQPA 3RAIA 5CQUA 3QC9A 4JIKA 3GU8A 4U41A 3NUPA 3TNQB 3KFAA 4YURA 3QZHA 4DH5A 1XH4A 4D2RA 2E9NA 3VUHA 5CAVA 2XJ1A 2YDJA 4Q5HA 3ZHPC 5ANOA 4ACDA 4K33A 4F9YA 1P5EA 3KXGA 4ZJJA 1M52A 4FK6A 4O2PA 4U3YA 5EM5A 4W4YA 1WMKA 2I0VA 3U87A 3KK9A 1NXKA 3ET7A 5CU6A 3WZEA 2WIHA 2XJ0A 4DG3E 3BHHA 3HMOA 4S32A 2YM5A 5DR6A 2VX1A 5BVWA 1U46A 2W1GA 3A8XA 3ORNA 1FVTA 1GNGA 3FYKX 4BC6A 5JZNA 3I5NA 2W1EA 3EQBA 4MVFA 1WVYA 4HCVA 5E8XA 4DGNA 4O4EA 4BRXA 5F4NA 3WF6A 4F1TA 3ZC6A 3MPTA 4G9CA 3R8LA 3DGKA 1KE6A 3QU0A 3KEXA 4O6LA 4WBBB 4FKWA 2HZ4A 5FLFA 5A4TA 5AUUA 1WVWA 4KKHA 4CZTA 5D12A 4FK3A 5C03A 2WTWA 3UC4A 4J95A 3U4WA 2OIDA 2W7XA 2YWPA 5DG5A 5TOZA 2PK9A 1W8CA 5J7BA 2EWAA 2PE1A 5H9BA 2Z7RA 4ZSLA 4GVJA 2C0IA 2XBJA 3EQDA 4RVTA 2XNPA 4NSTA 4QPSA 5HVKA 2WQNA 3PFQA 4G9RA 5CAUA 2W4OA 3QZFA 3R8MA 2YM6A 3IW4A 5H8BA 4A4XA 5BQ0A 5M51A 1XKKA 5AR3A 3DB6A 3EIDA 4BKYA 1H4LA 3MH2A 4Y5HA 2XK4A 3K3JA 4HPUE 2OH0E 3MFUA 5AP5A 4DCEA 4OTHA 3KXNA 2EUFB 1WAKA 3NSZA 4M15A 2ZJWA 3CKWA 3GUBA 2P3GX 3BGZA 5KMNA 3HL7A 4EOOA 5A6NA 4HCTA 5B2KA 3OTVA 4Y83A 2O65A 4CFWA 3HMIA 3COMA 1WBWA 3AOXA 3FLWA 4JBVA 2C30A 1ZMUA 2QCSA 3V8TA 3KMWA 1OUYA 3PXZA 5DN3A 2XP2A 4EOMA 4IW0A 4EUUA 2F7ZE 4C33A 3F2NA 4TY1A 1OKYA 4FKQA 1R3CA 4L45A 3TXOA 4BYJA 4B7TA 4PPCA 5IEXA 3UQGA 3ZONA 5T6KA 4FV5A 2PZIA 3QTQA 4JNWA 3VHEA 2OSCA 4FIGA 4YZCA 1OL7A 4M13A 1H00A 5CI6A 4HOKA 3MA3A 3V5QA 3UIUA 2IO6A 2GNJA 3NEWA 4OT6A 3DDQA 3RMFA 1UV5A 4U40A 3IO7A 1P4FA 1CSNA 5IH6A 3SOCA 3DKFA 2XRUA 4FSNA 3S4QA 2UW0A 3OHTA 4KB8A 3OW3A 3TIZA 3S0OA 3EN5A 4FG7A 1R1WA 5GZAA 2WMRA 3R7UA 2IW9A 4JDHA 3Q5IA 4DGLC 4RFYA 4BF2A 1YOLA 3ACKA 5DNRA 1H0WA 4U0IA 1BLXA 4UYNA 1PF8A 2XK8A 3CY2A 3GFEA 3KF7A 3SW4A 2BRGA 2HZ0A 4IWOA 2A98A 4M67A 3CPBA 3GCPA 4JQ8A 2WTIA 1YQJA 3JUHA 4X3FC 3P4KA 4ZSGA 1VYZA 4C4FA 3MJ1A 4YJOA 3ZO4A 3DLZA 2XYNA 4F0GA 2XRWA 4YHJA 1M7QA 4QTEA 4PL5A 4TRLA 4AW1A 4F1OA 2UZDA 2YAKA 5EDPA 3GCUA 1L3RE 5K4IA 3P79A 5JGAA 3UP7A 1BL7A 4DFZE 4BCKA 3FWQA 4F08A 1KE5A 4GUEA 2YCRA 2O5KA 5AUXA 3ZLXA 4WNMA 4R7HA 2BR1A 2QG5A 2W0JA 5CSWA 5AX3A 3POZA 2HXQA 2V7AA 5AR8A 1TQPA 5FQDC 3S3IA 5KCVA 4IIRA 2J7TA 3G5DA 5IMXA 3NX8A 5J1VA 2C3LA 2WXVA 1M2RA 4EOSA 3MSSA 1ZZLA 2YIWA 4E5BA 5JQ5A 3MJ2A 3PJ1A 3FZSA 5AAGA 4IFGA 5J7HA 2JIUA 3Q32A 5FM2A 5J87A 3ZRLA 1IR3A 5HU3A 1Y8GA 3OEZA 4AW2A 3PIYA 3SXSA 3KL8A 1PJKA 3E8CA 3ZEWA 5BYZA 2HOGA 3QX2A 1ZY4A 4NT4A 3QWJA 4RIYA 2XK9A 5CSVA 3AD5A 4N70A 1Z9XA 5CF6A 4F65A 4ZP5A 2F49A 2OF4A 3F7ZA 3SV0A 5LMBA 3FSKA 5IA1A 2YACA 2GNFA 3NUYA 2QHMA 3ZUTA 5A4LA 4BDCA 2ITYA 2OJJA 5CEOA 4GEOA 3MS9A 4I92A 1TKIA 5AWMA 3UOLA 1Z5MA 4OBQA 1RE8A 1W2FA 4QYEA 3CGFA 5A46A 3FJQE 3GCQA 3C50A 2VTAA 1XO2B 4AGUA 4F99A 5HIEA 3UQCA 3BKBA 1G3NA 3DBDA 4IH8A 4WNKA 4X6QC 3O8TA 3PIZA 3S95A 2XM8A 3F88A 3VW8A 4L9IA 4FIIA 4P5ZA 3UNJA 3UIXA 3QLGA 2ZV8A 4R5YA 2Y4IC 2A2AA 2J0MB 2R3JA 4W8EA 5CY3A 3RAHA 5ETFA 5KMOA 3HX4A 3BWJA 4E73A 4WUNA 3GP0A 4E6QA 4FG9A 3PTGA 1A9UA 2AC3A 2XKDA 2J5FA 4IADA 3O7LB 2PL0A 4PPBA 5DLSA 4E4LA 4F6UA 5L2WA 4TNBA 4MXXA 4AFEA 4KRCA 4OTIA 3T9TA 5BMSA 1UNGA 3PJ2A 4IACA 2OBJA 5D10A 3W55A 4A06A 4ACGA 4HYUA 1OB3A 4V01A 4IXPA 4DLJA 3QUDA 4E4MA 2YABA 3PJCA 4USEA 5AUYA 1B39A 4U42A 5GJFA 4CMOA 2CDZA 5M53A 5CENA 4E4NA 1OIYA 3QD0A 4XNEA 4MD7E 3MB7A 5CT0A 4BDFA 1JSUA 2QOKA 2GSFA 2JAMA 2YAAA 5B7VA 5C8KA 3BU3A 3CD3A 3HV4A 4OUCA 4PDOA 4D5HA 5KMIA 4ASDA 4TZRA 1R39A 5EI6A 3FI3A 3QCSA 4QPMA 4FZFB 4IVBA 3VBTA 5HX8A 4QP7A 3V5JA 3LQ5A 3MH3A 2W5HA 4A9SA 4R8QA 5K5NA 4I22A 3I81A 1WBPA 2QC6A 5I5ZA 1SM2A 3IOPA 3O7LD 4M12A 3OCGA 1Q8YA 2QQ7A 4R1YA 4V0GB 3R30A 4X3FA 3F3TA 2FH9A 4UX9A 3KRXA 2CLQA 2IJMA 3MPMA 2J9MA 4G34A 4E4XA 4FF8A 4RJ3A 3HRBA 2F4JA 4BYIA 2XMYA 3P9JA 2BCJA 3PPZA 4LI5A 3ITZA 5FD2A 4E5AX 2C0OA 4M14A 1G5SA 4FZ7A 4ZY4A 2VRXA 3UJGA 4IQ6A 4L52A 4RJ8A 5CEMA 3DTCA 4LL0A 3GBZA 3FMJA 4U6RA 5EI2A 3W2PA 5M55A 4O0RA 5AUZA 4EOQA 2IVUA 5AIRA 3O8UA 2FO0A 3VW6A 3BYVA 4K2RA 4YZBA 2J0IA 5DRDA 4BCGA 4CMTA 2W06A 3GCVA 3EL7A 1WBVA 3MPAA 4X2FA 4OLIA 1OKWA 1P4OA 4GK2A 3W10A 1JBPE 3AXWA 3D5VA 4BDEA 5E92A 3QCXA 3AC3A 4J96A 2B9FA 4J1RA 4AGWA 4C2WA 3ZRMA 4MBJA 1URCA 3KRWA 4FI1A 4EHZA 4W9WA 3UYTA 3UNKA 5ANJA 4QO9A 4YZ9A 2VTOA 2RG5A 3FI2A 3R9DA 4FKJA 2UZOA 3G33A 3L9NA 4U80A 4CFVA 5HCYA 2BAJA 3OW4A 3S1HA 2WTKC 4X3JA 5AM6A 5CXZA 3R0TA 3C4EA 3MW1A 5HVYA 3H9OA 3BHYA 3H9RA 4IWDA 4FKRA 5C27A 3D94A 3FMHA 3LCTA 2C6MA 4DFXE 3ZO1A 3OXTA 1JQHA 2X81A 2JKQA 3D7TB 3LFQA 4DHFA 5KKRB 2WKMA 5FDXA 2VTQA 3CLYA 3I60A 4XP0A 3RKBA 4PY1A 2H8HA 3NW7A 2J0KA 3NUSA 2OK1A 3IONA 3FY0A 3PVUA 2PVRA 4JBPA 3ALNA 3LFSA 5FEDA 3A60A 5BVFA 4CLIA 4RJ4A 3ORKA 1ZYSA 2VTNA 3FL5A 2ZM1A 2UW5A 4YC3A 3T3UA 3F69A 1M2QA 4AW5A 3CTJA 2FSLX 2IF8A 2PTKA 3D5WA 3UZPA 4C57A 3TACA 3QWKA 4GYGA 5EW3A 4ZXTA 2VTPA 4XHKB 2QURA 4CCBA 3KN5A 4JR7A 3TZMA 3VBQA 4CYIA 5J5TA 1CDKA 5I3RA 2F9GA 2G2FA 5HTIA 5EYCA 4ZLZA 2IWIA 4LM5A 3NYNA 4JX3A 4XS2A 5AP2A 4QP1A 4S31A 3LPBA 3NRMA 1S9JA 2XEYA 4C58A 3VWAA 4CKJA 2GQGA 4GU9A 4MHAA 4OTGA 2XNBA 4QOXA 5BVKA 3VBXA 3GOPA 3KN6A 2H34A 1CKIA 1DM2A 3V04A 3ZFMA 4O4CA 4CNHA 3MI9A 4IAKA 1JLUE 3H10A 1VJYA 5EOLA 1W82A 2QOOA 4MTAA 2GFCA 5EM8A 2PVHA 1OIQA 3OOMA 4KD1A 4YZNA 2WU6A 3KKVA 1YXXA 3QLFA 3OXIA 3QCQA 4LQMA 4I0SA 4OTPA 4X7QA 4YJRA 5ANGA 4YO6A 4QP6A 5EW9A 3ROYA 3W33A 4YSMA 5K5XA 1FQ1B 2R3QA 4OTQA 2JDVA 3V01A 2GU8A 4ZTSA 5LARA 2R2PA 3FQSA 4WIHA 5CU4A 2QOIA 2WQMA 3OT3A 5HORA 2ZDTA 1X8BA 2QO2A 4X2GA 4FC0A 1S9IA 3HGKA 2R3NA 4I1ZA 4ZSJA 4YP8A 3KY2A 3TKHA 3HUCA 4A9UA 4FKIA 4GT3A 3SD0A 4BCHA 3Q4ZA 4N6YA 4JIAA 1IASA 4FKVA 4E1ZA 4AZTA 4HNFA 3REPA 4YHTA 4YJPA 5LQFA 5CX9A 2XCKA 2ITXA 4MXCA 5AUWA 5L2QA 4KBKA 4HGEA 3UNZA 4DH8A 3DZQA 4LRJA 1F3MC 3G6HA 4EQMA 3TUBA 3DFAA 3ULZA 5JEBA 4EBWA 2UUEA 2VO3A 3QGWA 4C59A 4RWIA 5J9ZA 1QMZA 2XIKA 3OWJA 4CFMA 1E1XA 4YLKA 4QQTA 3TCPA 1P14A 3GCSA 2OF2A 2CSNA 4MNEA 4RQKA 2GNLA 1TZDA 2C1AA 2J90A 3LAUA 3O96A 3MFTA 5DPVA 4CTCA 4W4VA 3CJFA 4U7ZA 2WTVA 5CYIA 3H4JA 3UYSA 3VS2A 3EOCA 1MUOA 4F9AA 4GT4A 2OXDA 2ZDUA 4IB3A 4LRKA 2V22A 4AW0A 5BPYA 4BGQA 2I40A 2IN6A 4MBLA 5LVNA 4N4SA 2JDSA 3F3VA 4XH6A 2EXMA 3R83A 5HESA 4C3RA 1ZOHA 5AADA 3D83A 4CVAA 1Y8YA 5HE2A 5IA4A 2W05A 3MY5A 4F70A 3E8DA 5AP7A 3LCOA 3VRZA 3RHKA 4BFMA 5C8NA 4APCA 5JFXA 4GFGA 2R3RA 2VTIA 1WVXA 3W8QA 4L6QA 1ATPE 2P55A 4BTMA 3MVJA 4YMJA 3FL4A 3HRFA 2F7XE 2GHMA 4ANBA 2BDFA 3JVRA 2OJGA 2BRNA 4N0SA 1ZWSA 4XG8A 3DA6A 5E8YA 3JPVA 3MH0A 3R8UA 3LFCA 4ZOGA 5FDPA 5L8KA 4G6LA 4TNDA 4ANMA 4ARKA 3I0OA 5A4EA 2X0GA 1VEBA 3PE1A 3ZSGA 1ZZ2A 4IFCA 2PVJA 3W1FA 4IMYA 4U79A 2B52A 4DEIA 4PTCA 3OBGA 5FTQA 4ZEGA 4D55A 2HCKA 4USDA 4A9TA 3HECA 5KBRA 4JG8A 4XG4A 3ORPA 4L7FA 1CKPA 3IW8A 3EYGA 3ZS5A 4DG0E 5KMLA 2BZIB 3D7ZA 3RI1A 1E1VA 2O63A 4I21A 1GZKA 3LFBA 4I0TA 2X7FA 1O6KA 4RSSA 3U6IA 5G1XA 5TF9A 5L6OA 1YKRA 3M42A 2I1MA 3QHWA 3VBWA 4TKSA 4TYGA 2PUUA 4IB5A 5M4FA 2XBAA 4MAOA 2ITUA 3BGQA 4QMPA 4Z3VA 2C6OA 3C9WA 5J9YA 4TYHA 4RZWA 4Y85A 4J71A 1W7HA 3CBLA 4C4GA 4F1MA 4RC2A 4WG3A 4R1VA 5IA5A 5CT7A 5I3OA 5IDNA 4CLJA 5E8VA 1QL6A 2H96A 5ANDA 4D2PA 3R04A 4IANA 2XYUA 1XQZA 1K2PA 4Q2AA 3CCNA 4IX4A 2OJFE 4RPVA 3FQHA 5IA0A 3VJOA 3K5VA 1JSVA 2WPAA 4G31A 4XRLA 5C1QB 4FNXA 2BZJA 3E8EA 4FTJA 4DYMA 3EFKA 4L00A 3QBNA 5FP5A 2W5BA 3UIBA 3VUMA 4LOQA 4KBCA 4F0IA 4APPA 4UMUA 2VZ6A 4ZJIA 2J51A 4BGHA 1YDSE 1H28A 4AZSA 1JSTA 1U59A 3PPKA 2V7OA 4XG6A 1YHSA 4FTOA 4YZMA 4FBXA 2X6EA 2ITZA 4FTUA 5K4JA 4Q9ZA 3FQEA 5D9HA 1QPEA 3OMVA 2XNEA 3LCKA 4FIFA 1FGKA 1SVGA 2F7EE 3ZXTA 3Q6WA 4B9DA 5AAEA 5I9VA 1AGWA 3GU7A 4NKSA 5EDQA 2YEXA 4CRLA 2R7IA 3IQ7A 3PJ8A 3NCZA 4IWPA 3RGFA 4CYJA 2AC5A 4RGJA 2CGXA 3GC7A 4LFIA 2XNMA 4W8DA 5CU3A 3FMMA 3COIA 5CZHA 2VU3A 3P7BA 2ETRA 3ZTXA 3PPJA 2HW6A 4EQCA 2ZV2A 1KV1A 2CKEA 3QQKA 2EXCX 4B99A 5A14A 4HZSA 4IC8A 2W1HA 2XJ2A 2HK5A 2JKOA 3TJCA 5CANA 1WBNA 4IDVA 2UZWE 4Y73A 4U3ZA 2CN5A 4UWBA 3B8QA 2VGOA 5JFVA 2GCDA 3TWJA 4XOYA 4HNIA 3ZSHA 5AA8A 5AV3A 3RWPA 4P7EA 2OO8X 2X0QA 2GS6A 4RIXA 4UWCA 4D9TA 1Q61A 1CTPE 4RIWB 4BCMA 4DH3A 3KULB 2WFYA 2WMQA 5A6OA 5EH0A 4HPTE 4MXAA 1Q41A 2ZVAA 5K0KA 4XG2A 3AC5A 4EH8A 4JBQA 1Y91A 3BHVA 4CFNA 2C5NA 3SC1A 4YO4A 2ZB0A 3OF0A 3E3BX 4IZAA 2ITNA 5AMNA 3IG7A 3UG1A 3IKAA 3EYHA 1ZMWA 3QYWA 1OVEA 2ZM4A 3EHAA 5KMKA 2ZMDA 4FVPA 4I94A 3EQIA 3PRIA 3E5AA 4BDBA 2BKZA 1H25A 3ORXA 2OFUA 3FLNC 1PMNA 4ZTLA 1GZ8A 2WGJA 3GXLA 3OVVA 4FTAA 3GENA 3II5A 3RZBA 5T68A 3HV3A 1Q62A 2EVAA 5AX9A 4CFXA 3UZTA 1HCKA 4ANOA 5IKWA 2QLQA 4ACHA 3LE6A 4R3CA 3GU4A 3KRJA 2JLDA 4EI4A 2R0UA 2UZEA 5BMMA 3FXZA 3ZO2A 2CLXA 4C3PA 1GIJA 3DK6A 3NIEA 1GY3A 4D1XA 3KMUA 3C4CA 4YNOA 2RL5A 2W99B 4KS7A 1AD5A 3HV5A 3KXZA 4J52A 3EKKA 1ZOEA 2EB3A 3M11A 3SDJA 3PA4A 3U8WA 4AF3A 4C02A 2HAKA 1ZYJA 1YRPA 3RK9A 4FIJA 5D1JA 5LWNA 5HNBA 3FKOA 4GJ3A