4PPBA

Itk kinase domain with compound 28 (n-{1-[(1s)-3-(dimethylamino)-1-phenylpropyl]-1h-pyrazol-4-yl}-6-(1h-pyrazol-4-yl)-1h-indazole-3-carboxamide)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
264
structure length
239
Chain Sequence
SVIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAESG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Discovery and optimization of indazoles as potent and selective interleukin-2 inducible T cell kinase (ITK) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 239
sequence length 264
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ppbA00
1Q97A 3NUXA 1XH7A 4YLJA 2WIHA 3DA6A 3C1XA 3Q5ZA 4YNEA 2W1FA 4WUNA 3PPKA 4FTAA 5IU2A 5FM2A 2R3OA 4C58A 3W33A 4EL9A 4GK4A 4MNEA 4IXPA 4QTCA 5M56A 3QXOA 2JD5A 3PPZA 3HRCA 5H2UA 1P14A 3QCXA 4BICA 2XB7A 2RF9A 3I60A 5LCKA 4J1RA 4AGCA 1UNGA 3W2QA 4QMOA 2BRMA 4QTAA 4YBJA 5AV3A 4UZDA 3TIYA 2JDSA 2OZOA 5LQFA 1NY3A 5H8GA 5DHJA 2PMLX 4YJSA 4UX9A 5CF8A 3ZCLA 2OJJA 3PA3A 4GVAA 4XUFA 4DFZE 1ZY5A 4TWCA 3MSSA 3LQ5A 3VN9A 3OWJA 2WMRA 3THBA 5IDNA 5E1SA 4QTBA 4CYJA 4LOPA 4O0WA 4PQNA 4EOLA 4HGSA 2VWYA 5F95A 3V3VA 4B4LA 5TO8A 4EUUA 4FVPA 3M11A 4O38A 3MH1A 3ZEPA 2OG8A 3HX4A 2F2UA 2R3RA 3BBTB 3LXPA 3UZPA 2CJMA 3R9OA 4BZDA 3R71A 4YJUA 4MBJA 2XH5A 4TRLA 5AUVA 4MXZA 4B6LA 4MQ1A 4F9BA 3BZ3A 4H36A 3WF6A 1XH9A 3DK3A 4OLIA 4F08A 4ENXA 4UWCA 2OH4A 4A06A 2X0GA 2R3QA 1RJBA 1GZNA 3U9NA 4BCIA 2J9MA 3DBEA 3TKHA 2NP8A 1FMKA 3ZRKA 2IVTA 3KFAA 1RE8A 5LVPA 4H3BA 5FBOA 2XYUA 1LP4A 5KX8A 1M14A 2C6EA 4IFGA 4H3PA 4QMZA 3GFEA 5DMZA 2WO6A 4W4YA 2HXLA 4D4VA 4E3CA 2RG6A 4KKHA 3ENMA 5A6OA 4FF8A 3FLNC 4CT1A 4ACHA 3ZDUA 4BI0A 5L4QA 4YHFA 2YAAA 4RJ6A 2WOUA 2PWLA 3KEXA 4CFXA 5HLWA 2DUVA 3UP2A 3UYTA 3MGYA 4CNHA 5FQDC 2QHNA 4DEGA 4PTEA 1HCLA 5JKGA 3K3JA 5CQWA 4D1XA 3RK5A 4ACCA 3NYNA 2P3GX 4Y8DA 3QRJA 2IJMA 3FPMA 3PFQA 4E4NA 3R22A 3UG2A 3TCPA 4F63A 4AT3A 2A0CX 1PXPA 2W5BA 5EM5A 4PDSA 2W17A 4D2RA 4D2PA 2UVXA 4TNBA 3F5PA 1ZMVA 4BTMA 2V62A 2VTOA 4BDEA 2OFUA 5CEIA 3KF7A 1MRUA 4PRJA 2ZMCA 4ZTQA 3D83A 4L00A 4F09A 4K8AA 2UVYA 2XIZA 3LZBA 2HYYA 2C1BA 4JBQA 5HO7A 4AW2A 2XNPA 5HE3A 1OPJA 5FTQA 5L6WL 2R64A 1YHWA 2OF2A 1W84A 2Y0AA 3Q60A 2VTPA 4AFJA 3BEGA 4AA5A 5BPYA 4JBPA 4JDIA 3AT2A 1SVGA 2XJ1A 1SVHA 4FKIA 3KF4A 4E1ZA 4OTHA 4EH8A 2X8DA 5IUIA 5BNJA 3IW5A 2YEXA 2EXMA 2A1AB 3FV8A 5FXQA 3MIYA 5I4NA 1ZLTA 5F4NA 2J0KA 2QOQA 3PIZA 5DG5A 4YPDA 1OUKA 3PXFA 4PP9A 4LRKA 4DAWA 3ORXA 5CSXA 5KMIA 5HU9A 3C5UA 4K11A 4UYAA 2ZB1A 4RWLA 2OU7A 3A99A 4QRCA 4YJPA 3FJQE 3E8NA 4E4MA 4NCTC 5AM7A 3O50A 5AR7A 2UW4A 2XF0A 3NSZA 3COHA 5I0BA 3PE2A 1O6LA 1BLXA 4GK3A 5IPJA 1VEBA 3KCKA 4M13A 3IPHA 1WBWA 2ZDUA 4HYIA 4L3PA 4XG4A 4YLKA 3PUPA 1GY3A 4QP4A 4F99A 4BIBA 3EB0A 3LJ0A 2NRYA 4ZTNA 4FSUA 1OM1A 3ZLSA 3LFQA 3NEWA 5CU3A 5DVRA 4E7WA 3PY3A 3NR9A 4IDTA 4L42A 3UQCA 1R39A 4BWXA 5JRSA 3UOKA 1R1WA 4PMPA 4GS6A 3ORPA 1R0EA 3E3PA 5EYMA 2UZWE 4DC2A 4EOKA 4RZWA 4GMYA 3TNPC 1JKTA 5CS6A 4A07A 4RLKA 2X6DA 4FTTA 4O0YA 4ZXTA 3PSCA 3RNIA 4BIEA 2W1GA 4C37A 5F20A 3WIGA 1IASA 4MXCA 5HCZA 3D5VA 5HCXA 5AP3A 2OZAB 4NT4A 1Y6BA 3I79A 4AW1A 2F7XE 4L53A 3L8VA 3RPOA 5CWZA 5E8TA 1JQHA 3IW7A 5FRIA 3G9LX 3QRUA 4PDOA 4XG6A 5JK3A 5AP0A 4QT1A 2X6EA 3ENHA 3GCQA 2R3HA 4I24A 3WE4A 3QD3A 5LMAA 3ACKA 2E9PA 1O6YA 2BVAA 3PSDA 3LAUA 4HGLA 2WFYA 3QUPA 5KO1A 4E20A 4IC7A 5HG8A 5D10A 5A3XA 4D1ZA 3COMA 4D2WA 4OAUC 2GFCA 4I6QA 4KIKA 3MH2A 2VNYA 1WVYA 2XNMA 4D28A 1E1XA 4OBOA 2C1AA 3OVVA 5D12A 2IW9A 4YJTA 3UOHA 4BB4A 2I0YA 2VTMA 4FVRA 1UNHA 3DK7A 5CALA 4I20A 2ONLA 4FG9A 3CBLA 5E8VA 4GT4A 5L3AA 2HOGA 2XNEA 4ENYA 2QOKA 5KMJA 4MD8E 4ID7A 2IZTA 4I5HA 3NAXA 1AD5A 4HGTA 4X2GA 3LFBA 3TN8A 3OW3A 5GZ8A 5HZNA 1T45A 2J7TA 5CENA 2WPAA 4CZYB 5ANOA 3R28A 3MB6A 4MYGA 5JZJA 3QKMA 1PYEA 3QQLA 4XOYA 3T9IA 5F94A 3QHWA 4ZSJA 5AA9A 3VS2A 4BCFA 3KMUA 1F5QA 3EYHA 3IDCA 3Q4TA 3VHKA 4TYHB 3FXZA 4M14A 2G2FA 4OR5A 3SW7A 3VWAA 4FTUA 2ITTA 3NNVA 4BCHA 4S30A 1CKJA 4NK9A 4GG5A 4BYJA 3MVMA 5AIKA 3QQHA 4O6EA 3PG1A 2ZM3A 3TNHA 3ACJA 4UN0C 2QONA 2JIUA 3V5JA 2QURA 4AACA 1BL7A 5AAEA 4U8ZA 4C02A 2C3JA 4HNIA 2WTCA 4FIIA 2E2BA 2VZ6A 2WHBA 5AR8A 4FSMA 4FTOA 3PXYA 4GH2A 3ZLXA 2ZVAA 3GP0A 3QCSA 4XX9A 3FQSA 1LR4A 2FVDA 4ZLYA 5J8IA 2ZMDA 5AUWA 4DCEA 5M4FA 2OJGA 4IBMA 3F3WA 3PIXA 2PMIA 3KVWA 3LFFA 4CMUA 1G3NA 3QYWA 2IVUA 4EH2A 4OW8A 5ANGA 3FLYA 2XP2A 4MWHA 4C0TA 4PL4A 4R1VA 3QF9A 3Q9ZA 3SRVA 3AMBA 3H3CA 3OC1A 4DFLA 3HDMA 4A9SA 4X2KA 5L8JA 3NWWA 5HNBA 4A9UA 1XH6A 5IUHA 4RX9A 1RQQA 3CGOA 4X0MA 2WQOA 3PLSA 1OL6A 2Z2WA 2O65A 3R30A 4IZ7A 3D7TB 3ODZX 3LIJA 4UYNA 3BGPA 3VF9A 4KAOA 3PXKA 2XZSA 3VS3A 5E8UA 1OL7A 3S1HA 4D5KA 4K9YA 4YHJA 1V1KA 1FINA 3IO7A 5T6KA 3VUDA 5FEQA 2C5YA 5EHLA 2XKEA 5IEYA 4ACMA 4PNIA 1TQIA 3SAYA 2X9FA 5I5ZA 3KCFA 1PXLA 2J2IB 3Q9XA 3DAKA 4MNEB 1OUYA 3RPRA 2ITWA 5HG9A 3V5PA 4WOVA 4S34A 3LCSA 4W4WA 2BILB 4WRGA 4CKJA 2VU3A 3MA6A 4LL0A 3PXQA 3C0HA 2ZV9A 2BMCA 2HELA 3U4UA 5TT7A 3R7EA 2OJFE 3C4FA 4RWIA 1U5RA 1WFCA 3HMIA 4FG7A 3QX4A 2C3KA 4C7TA 3H9FA 1H0VA 2XK3A 3KC3A 4FKJA 4IANA 3A60A 1Z5MA 1OKWA 2YITA 4I5PA 2YERA 4IZYA 5AADA 5CAQA 5CAVA 1GIHA 4YJVA 5DA3A 4QP3A 2OXYA 3QQFA 4YNOA 4PUZA 3BLRA 2B53A 4FKVA 4FYNA 3P7BA 2WTKC 3QWJA 4M69A 4WBBB 3EQDA 2C68A 4PPCA 3FLSA 1Q4LA 3GCVA 3U9CA 2C0IA 4HZRA 2YJSA 4I41A 4L9IA 3W2CA 1ZZ2A 4L43A 3TUCA 2OFVA 2QVSE 4F9CA 5AEPA 3DJ6A 4KKEA 4HCVA 3MV5A 4IAAA 4C8BA 4HPTE 4RIYA 4ZY4A 3EMGA 3ALNA 2VRXA 4IB0A 4DG2E 4BN1A 2HAKA 3D15A 4O0XA 4YU2A 3EFJA 3MDYA 4MKCA 4F6SA 2UW3A 2YM4A 3Q9YA 2AYPA 2ZDTA 3IW6A 3OFMA 4D58A 4EBVA 5AP7A 4UMPA 4BCNA 3QXPA 2YWPA 3NS9A 3UIMA 4ANQA 3ZHPC 5FXRA 4HGEA 3LMGA 2Q0NA 4WG4A 4XOZA 2IZUA 3O17A 4M84A 1PXKA 4XHKB 2BRHA 3QZHA 1XR1A 3EQGA 2FSTX 2WTIA 4RIOA 2PE1A 5FM3A 4BHNA 2BALA 4HPUE 3HV7A 3UVPA 4RGJA 2WOTA 3FKOA 3QLFA 3LVPA 2WTKB 3C4ZA 3HL7A 3ZSHA 4A9TA 2VN9A 2WTWA 4AW0A 4IAIA 3V5TA 4FKOA 5AP2A 4EZ5A 4YZCA 1H1QA 2V5QA 4TWNA 3MW1A 5EM8A 4YSJA 5HD7A 3W18A 4RC4A 1ZYJA 4I0TA 4ANBA 4O1PA 3MFTA 4B8MA 3OP5A 2WMXA 4DGOA 5AA8A 1H28A 2QQ7A 4FSRA 3LE6A 2WMQA 4QP1A 1RDQE 4X7QA 4YHTA 1PMUA 4OTWA 5FDPA 3L8SA 4DFYA 2RFEA 4K33A 2H9VA 3HGKA 3JYAA 4M3QA 3QTSA 1YXUA 5J7HA 3MYGA 4ANLA 3W2OA 3EQFA 4RJ4A 2BRGA 4GT5A 1Q3DA 4UB7A 5EYKA 3FPQA 5HG5A 4IACA 4AN2A 2EB3A 2CPKE 4BWPA 2ITNA 3HNGA 4JAJA 4X6QC 2YAKA 5EOLA 3AG9A 4ZIMA 3IKAA 3POZA 4U9AA 4RC3A 2BFYA 4ZJVA 5DR9A 4XBRA 5IF1A 3G6GA 3NRMA 3NGAA 4CQGA 3W8LA 4MAOA 3SV0A 5L2SA 1GNGA 4E8AA 3G0FA 3WYXA 3MBLA 1PMVA 4IDVA 4MXXA 5JSMA 2QOOA 5LWNA 2J5EA 5AV2A 4TW9A 3KRRA 5EM6A 2WU6A 2O63A 3KRJA 4C4IA 5A6NA 5E7RA 3CEKA 2VTNA 3CJGA 3Q04A 4U97A 4A9YA 3BQCA 5EDRA 4IB5A 4FV3A 4U40A 5HNIX 3ZRLA 1H1SA 3OXTA 4FNYA 3R63A 4C4HA 5K0KA 5M57A 3BU3A 2B55A 4Q2AA 3LFNA 1SZMA 1QPDA 3ORTA 4FSYA 3UBDA 3TJCA 3VBQA 1W98A 1Q8WA 4E6DA 2LGCA 4QQTA 2R9SA 3DK6A 3PWDA 3IOPA 3MPMA 4I1ZA 1MQ4A 1W83A 5J95A 4CFUA 5IG1A 4FV5A 5M4UA 4BDCA 1H4LA 1ZMUA 3GCUA 3SOAA 4H1JA 5LJJA 4TYIA 5I9UA 4FI1A 1U4DA 3UG1A 5IUGA 2FUMA 4RIXA 1S9IA 2UZDA 4YZBA 3TZ9A 1ZZLA 2GCDA 4FUYA 3CXWA 4QP8A 3A7HA 2OJ9A 4IJ9A 3PZEA 4QP6A 5D41A 5DRDA 3KVXA 3LLTA 3NUNA 4ZY6A 4TWOA 2W5AA 2JDTA 3BV2A 3E87A 2PVHA 2P2HA 5BUJA 3DZOA 2FSMX 3JS2A 5ETAA 5KMLA 4BKYA 3OS3A 4TN6A 4CT2A 2WQNA 3FQEA 3MH3A 4UALA 4GFOA 4BRXA 4DGLC 5AMNA 1OMWA 1GOLA 4AGWA 3V6SA 3QTWA 3AD5A 3WI6A 4BDBA 4CFFA 4H1MA 4O1OA 3ZOSA 4WT6A 4JG6A 2UUEA 4KS8A 3LXNA 1OIUA 4P5ZA 3Q6UA 4G9CA 5T68A 5EW8A 4CV8A 4YZ9A 5DR2A 4MXOA 3A7GA 3DAJA 2H6DA 2UZNA 4ITIA 3SXFA 1W82A 2GHLA 1YI6A 3PWYA 3R7YA 4EOJA 2VWVA 4FODA 4FIJA 2ITUA 4AZTA 4HVSA 3H9RA 4RT7A 4PDPA 2FB8A 3LXLA 4AE6A 4APCA 1PYXA 2IZRA 4J8NA 4IX6A 1YHSA 2PZ5A 1GIJA 1Q24A 2BFXA 3QFVA 4GCJA 4TWPA 5C26A 4NH1A 3B8QA 2GHMA 5I3OA 1SMHA 4AZFA 2CMWA 4I6HA 1MQBA 4BDAA 2FSLX 2OIQA 4FKWA 4IJPA 4PMMA 5DFPA 3B2TA 4ZOGA 3QRIA 2Z8CA 2O2UA 1K9AA 2ZM1A 2JKMA 3UQGA 3D5XA 5JZNA 4ZLOA 4OT5A 4ERKA 1OIYA 4D2VA 2V7OA 3N51A 4GEOA 5FG8A 4G3CA 3QA0A 3RM6A 2YACA 3L9MA 4FZFB 4FKPA 3UGCA 5LVMA 1ZY4A 1JNKA 2C6IA 5BVWA 3A4PA 3RCJA 4WG5A 3BU6A 3FI2A 2UW7A 2QR8A 3IGGA 4O0SA 4XRJA 3ZMMA 3ZS5A 5E92A 2CGVA 4QMQA 1ZAOA 1H25A 3GGFA 5IH6A 5HO8A 2C5OA 4DHFA 1O6KA 3MPTA 4FK3A 4DG0E 4EK3A 4EORA 1M2PA 1H26A 3DU8A 3AT4A 3I4BA 1YWNA 3DV3A 3R02A 4IIRA 3WF5A 4YSMA 3Q32A 2XK7A 4BZOA 5HO6A 4AWIA 3U4WA 3DBFA 4IQ6A 3VUTA 2YISA 4YLLA 2XK9A 3CCNA 5IA5A 2B9FA 1YOLA 2PVFA 4BDGA 4QPSA 3C4CA 3H10A 4F7NA 2QU5A 3D94A 5EOBA 5JT2A 2XKCA 2R3PA 3IONA 3L9PA 4YZDA 4CFVA 4DEEA 2ITOA 2BTSA 4ZTRA 4IFCA 3EFLA 2WGJA 1ZOHA 1FGIA 2EXCX 1T46A 4RSSA 3M1SA 4DYMA 2VWUA 2QLQA 2O8YA 4FBXA 1H8FA 3LPBA 1GZ8A 5J5TA 3VS6A 3QD2B 2BAQA 2HW6A 3T9TA 3SKCA 1JSTA 2CDZA 4OTIA 4FZDB 3M42A 4Q5HA 2ESMA 4U42A 3R7VA 4BYIA 5B2MA 4O6LA 5HE1A 1H1RA 2VTHA 3N9XA 3NW5A 5ACKA 3W55A 4IVDA 2GSFA 3R6XA 5IMEA 1REJA 5CEMA 3BKBA 1J1CA 4R7IA 2JKKA 4K0YA 2JDOA 4QMTA 4S32A 5DBXA 4XCUA 2R3KA 5BVNA 4JL9A 3E63A 5CF5A 1P2AA 4FSQA 4BDKA 4RJ3A 3ETAA 1OVEA 3QC4A 4G17A 4J98A 4FIFA 3QWKA 2ZV7A 3PJ2A 4NIFA 4GRBA 4UMTA 2OBJA 4NFNA 2OF4A 4Y46A 5DEYA 3LFSA 2C3IB 4LOOA 3HMOA 5FP6A 4UV0A 5L2QA 5LARA 3IW4A 3A7JA 3MPAA 4EHVA 3WF7A 3EFKA 4UMQA 4L01A 3G0EA 3ZUUA 4FKLA 2UW5A 3PP0A 4P4CA 4TPTA 4U5JA 3W16A 3RGFA 4FGBA 2X2MA 5E91A 1R0PA 2W1EA 4YZNA 4DFNA 3K2LA 4Y95A 5HORA 1XWSA 2WMTA 4QOXA 3VBWA 3WYYA 4HW7A 4OTGA 5ITAA 3S00A 3LM0A 2R3NA 4C35A 1M17A 4UMUA 1QPCA 5EYDA 3I0OA 5F9EA 3C4EA 2ZYBA 2XNBA 2JDVA 1ZYDA 4I5MA 2W05A 4RFYA 2XYNA 3BEAA 4WNOA 2XIXA 4R3RA 4EH6A 1WBSA 4IWOA 4IX3A 1NVSA 2VTSA 2ACXA 1CM8A 4GU6A 3TUBA 4L68A 4AN9A 2W5HA 2JC6A 2JEDA 4FL2A 4GYGA 4IADA 3FMJA 4ZSLA 3AOXA 4PPAA 4IWQA 3LJ1A 3KXXA 4BBMA 1OL5A 5IEVA 4HVDA 5TR6A 4AT5A 2QHMA 1B6CB 4BHZA 2XCHA 1TVOA 3HVCA 4LQMA 2B52A 2XNOA 4RIYB 2JBOA 4IVBA 2HW7A 4YBKA 4EH4A 2XM8A 4BVUA 2DWBA 4UZHA 4IEBA 3RZFA 4I4EA 3GI3A 2UVZA 4B8LA 3FUPA 2VO7A 3BYSA 3P08A 4M12A 3VJOA 3OTVA 3UOLA 3CTHA 4U7ZA 2XJ2A 3BGQA 2AC3A 4RQKA 2YLEA 4FV0A 4RFZA 1WBOA 1UU9A 1WBTA 1UA2A 3H30A 1XH8A 1Y91A 5C8MA 2W7XA 5EKNA 3HMNA 5BVOA 2JFLA 2FO0A 3NIEA 4FSZA 4UMRA 3R1QA 4NKAA 2WB8A 3ZXTA 4BDIA 3PXZA 2OIDA 4QP9A 3VS5A 2XJ0A 5CT7A 5EYCA 3F6XA 3FMEA 1U5QA 3QGYA 4HYSA 4RZVA 3WZKA 2FSOX 3VC4A 1FVVA 3L1SA 4NUSA 1UV5A 3OXZA 3PVGA 3VW8A 2XRWA 1O9UA 3ZBXA 4AOTA 5HE2A 3KMWA 5FWKK 1BKXA 2OSCA 4I6FA 5CVFA 4CMOA 3OCGA 3KN6A 3FXXA 4Q9SA 1UVRA 3HMPA 4F1OA 3QD4A 3BU5A 4C62A 3FDNA 3BCEA 5HOAA 5J1VA 3AC3A 4J71A 5CNOA 3BHHA 2R3JA 3HRFA 5CSWA 5AUUA 2PVYA 2B9JA 4O0TA 5AWMA 4KSPA 5BUIA 5HTIA 4GIHA 2OO8X 4XLIA 4AQCA 4IM2A 1UWJA 4BTJA 5HIDA 4XV1A 4ASZA 3A61A 4CLJA 5JEBA 4M67A 3V04A 1Q41A 3BYVA 4E6CA 4PP7A 3UYSA 2X2LA 4JBOA 3WF8A 3RPVA 3PVBA 3KA0A 4AS0A 1JWHA 2XNGA 3EKNA 4EK4A 4BKJA 4DGMA 4EYMA 4CCUA 4F0IA 3DGKA 3F2NA 4JX3A 4QMMA 5C8KA 3F66A 5EG3A 3DLSA 1GZKA 4FMQA 2VX0A 4NKSA 5T3QA 2YCRA 3R00A 3R9NA 3WILA 5K5NA 3D5WA 3VBYA 3GU6A 3G33A 3KKVA 3RK7A 4JDKA 2W99B 4FR4A 4DGNA 4ALUA 2P33A 3F61A 2WMAA 4FKSA 2BHHA 4M15A 4DH7A 2Q0BA 3NW6A 5KMMA 1ERKA 2QNJA 3U87A 4DEBA 4IM3A 4Z7HA 3PPJA 4FTMA 3FI4A 2HY81 4QTDA 2Y7JA 5DGZA 1NA7A 3FZ1A 3O8UA 4DLIA 3S2PA 4IVCA 2O0UA 2VX1A 3GC8A 4JAIA 4MXYA 3WARA 1Z9XA 3SXRA 1BI8A 4KBCA 3R0TA 4U80A 3UZTA 2UZTA 4F1TA 2J0LA 4PY1A 4QPAA 2QOLA 4EEVA 3KXZA 4F6UA 1PMEA 4RIXB 4EC8A 4EYJA 4YJNA 3R8PA 5CI6A 2EUFB 4BBEA 2ITZA 4R5SA 3UC3A 2VWIA 2RIOA 4FUXA 4NJ3A 4JI9A 5AUYA 3UIBA 4QMSA 4BZNA 5L8KA 3S0OA 4KIOA 2UV2A 3S3IA 4C3PA 3MWUA 5IA3A 2V0DA 5JQ5A 2R3GA 3O96A 3CY3A 4X3JA 1FGKA 3GUBA 4DINA 5ICPA 2R3LA 4JVGA 1KV2A 4QYGA 5CEOA 2C5NA 3G5DA 3CKWA 3DFAA 2WNTA 5KHWA 3E93A 4WRSA 3TTJA 3DDQA 4DH5A 2Z7RA 1WAKA 5EW9A 3R1SA 4K77A 4AZEA 4E4LA 4G16A 4PX6A 5EDQA 3DXNA 4KSQA 3GOPA 2JKQA 3ZYAA 3EFWA 4FC0A 4N6YA 3T3UA 2BHEA 4AP7A 5AR3A 2V22A 4G3FA 3TG1A 4GJ3A 5C03A 2WKMA 2BPMA 4ZSAA 1B38A 5DPVA 3D14A 3JUHA 4GIIA 3W10A 4RFMA 4JQEA 3F9NA 1M7NA 3Q4UA 2X7OA 2PY3A 5BX0A 2BR1A 5JFSA 2E9VA 3K54A 3PJCA 1UU7A 3QUDA 3DKGA 2ZJWA 4QNYA 3PSBA 4H39A 3TNQB 2ETMA 2XVDA 3KXMA 4D0WA 2WELA 2VO0A 3IDBA 5A4QA 3WBLA 3I6UA 4ZJIA 4JT3A 3P7AA 1M52A 3EL7A 4D4YA 1OGUA 3BV3A 2WMVA 3B8RA 4TKSA 4NTTA 5F1ZA 4GSBA 1PXNA 3OOGA 4RWJA 5FD2A 4CEGA 4I22A 3FBVA 4D9UA 3V8SA 4XP2A 3TNIA 3E64A 5FBNC 3UOJA 3E92A 1XBBA 2PZPA 3FY2A 4QYFA 5DT3A 2RGPA 2NRUA 3ORIA 3EZRA 3VUIA 5IA0A 3DKOA 4PMSA 5HNGA 5HD4A 1MRYA 4U3YA 2BROA 2XIKA 2Z7SA 5CANA 3AD6A 2G1TA 3ZZEA 4I21A 4AT4A 5BYZA 4MXAA 2X9EA 3OZ6A 4OUCA 3PJ8A 2GU8A 4AE9A 3LJ2A 3OEFX 5DT0A 5HI2A 4RRVA 3W1FA 4DEHA 3FLWA 1MP8A 3COIA 3MS9A 4G6LA 4C36A 1CKIA 4OTDA 3QC9A 3OXIA 4NU1A 4EQMA 3AC4A 3ERKA 3IS5A 4DN5A 5LVLA 1J3HA 4UWYA 1QL6A 4ACGA 5LWMA 4JDHA 4YJOA 4IAFA 4PTGA 3BIZA 3GVUA 4BC6A 4BWKA 5J9ZA 4PPBA 1QCFA 2PTKA 3DOGA 2UW6A 5BUEA 2W06A 2ERZE 4IW0A 1YRPA 4LGHA 4YZMA 3TZ8A 4YR8A 1W0XC 2Y8OA 3BHVA 4LGDA 5ANJA 3TV6A 2KULA 4OAVB 3HEGA 3MA3A 5FTOA 4ZTMA 3TJDA 1ZXEA 1ZWSA 2PHKA 3A8WA 4FSWA 2YCSA 4EH3A 1PXJA 4M8TA 2YA9A 2OXDA 4R3CA 5CLPA 3RAWA 5CEKA 4XV3A 5C01A 3VQUA 4EONA 3TI1A 3DDPA 3C9WA 5LMKA 4G34A 4I92A 2BZKB 2CSNA 5CZIA 3WIKA 1K3AA 2C5XA 3ZONA 2X8EA 4RIWA 4CLIA 1Q8ZA 3CTJA 3VHEA 4D9TA 3O2MA 4XG2A 4E5BA 4E4XA 5I9VA 3P23A 3VO3A 4LL5A 3ULZA 3EYGA 3NUPA 5DNRA 4C2VA 1NVRA 5HX8A 3ORKA 5AR2A 4I94A 1OKYA 3FYJX 5ANDA 1H0WA 3FSFA 5EI8A 5KZ0A 4Z7GA 5BQ0A 3R7GA 3BLHA 2R0IA 4J97A 4J99A 2BDFA 4ASXA 3P7CA 4F4PA 4F7LA 4JLCA 2X39A 3KRXA 4KIQA 1VR2A 1ZARA 3R7UA 3RAHA 4NM5A 4U45A 3UP7A 3G2FA 4KNBA 2XBAA 2VTLA 4OBPA 3MFSA 2GNHA 3NLBA 1M2RA 4FNZA 1P5EA 2JIVA 3DZQA 4NIFB 4O27B 1JKSA 4FV6A 2CN5A 4QTEA 3QZIA 5J9YA 4LRJA 4RX8A 1VYWA 1YVJA 5CQUA 4B0GA 1Y57A 4ZP5A 2VX3A 4E5WA 4MCVA 3E62A 4IB3A 4FYOA 4AX8A 2ITVA 4TNDA 2BRNA 1LEWA 2VTQA 3FHIA 5AP1A 1UU8A 4ZAUA 3SHEA 2FA2A 2ETRA 3E5AA 3ORNA 3NCZA 3PE1A 4I5CA 1OPKA 4YGAA 5AIRA 5DT4A 3UJGA 4U79A 1XH4A 2Y4PA 1AQ1A 4WSYA 1H1PA 4XMOA 3WZDA 4XG9A 3V01A 5K4IA 3GNIB 4BI1A 4KKGA 4ZY5A 1XHAA 2XEZA 1FQ1B 2ZB0A 3EQBA 5IKWA 2OJIA 1KE9A 4EOPA 1DAWA 1U54A 3IDPA 1LEZA 4NZWB 3TZ7A 5CI7A 4L67A 2B7AA 3MVLA 3RKBA 3QQGA 5KBQA 3HA8A 3KRWA 3VQHA 4LRMA 2ZM4A 3W32A 4MQ2A 3GFWA 4D4SA 1DI9A 2CGUA 5G6VA 2VWXA 3OROA 4DGGA 1JVPP 5K5XA 1JPAA 2YLFA 4R6VA 4QMNA 4LGGA 4QMLA 3TL8A 3GC7A 2PZYA 4JIAA 4AGUA 3V8TA 2OW3A 5KBRA 4IMYA 3DAEA 4M66A 2GTMA 3E8EA 4ZTLA 4NWMA 1XO2B 4M7IA 2PL0A 2BIYA 4HOKA 1KSWA 2C6LA 3QTXA 1SNUA 4PNKA 2WQEA 4FT9A 1BUHA 4V04A 5ETFA 4YPSA 3ZLWA 2E9NA 4XG8A 4PL3A 2J5FA 3AD4A 2OKRA 4P5QA 3UVRA 2VO6A 5D7VA 5IA4A 3VUMA 5ACBC 5TKDA 5IA1A 2W1ZA 3R8MA 1SVEA 1V0OA 4NM7A 3D2KA 4M0ZA 3RWQA 1FVRA 2I6LA 4L45A 4ITHA 5M4IA 1MUOA 3DBDA 3EQRA 3NIZA 2BAKA 3RAKA 4X2JA 4ZZMA 5EH0A 5JRQA 1JSUA 1UWHA 3C13A 3LCOA 2A2AA 3W2RA 5K3YA 3QQUA 2VTTA 2YABA 3QKKA 4WNKA 4KD1A 2R0UA 2EWAA 3R8UA 3EL8A 3VBXA 4C59A 1Q3WA 5EHOA 3VIDA 4K18A 2YM7A 4ZSGA 3TKUA 2W4JA 3OW4A 3C51A 5HX6A 3MY1A 4WKQA 2CCHA 4ZSEA 2ITYA 1E1VA 3QBNA 3Q53A 1H27A 4FTLA 4MWIA 2E9OA 2WU7A 4CTBA 3U8WA 5BVKA 2R7IA 4II5A 2EU9A 3I7BA 4FOBA 3UE4A 4L44A 3FAAA 3QTUA 4AXAA 3F3ZA 3CE3A 4FKQA 1CKPA 4UWBA 2XK6A 4LOQA 4XNEA 4GJ2A 1PXOA 5C27A 4CD0A 5CZHA 4QO9A 5KCVA 3QRTA 3DFCB 4YC8A 3ODYX 3V5LA 2O64A 2XK4A 2IWIA 2C6OA 3NNUA 4G1WA 3ZLYA 3HV5A 4H58A 4HCUA 5E8SA 3LM5A 3HP2A 3SXSA 5EW3A 4DH8A 4TT7A 3BHYA 2OK1A 3ZC5A 3LW0A 3NYOA 4R7HA 3FZTA 3DJ5A 4L8MA 4WG3A 3RNYA 3OT8A 2ZV8A 2KTYA 5L8LA 2ZAZA 3KXHA 4V01A 3OG7A 1K2PA 2H34A 4S33A 5I9ZA 2X2KA 3P4KA 4KA3A 4KS7A 5E8WA 4B99A 2UZEA 4UY9A 5CXZA 4WBOA 4ITJA 3PVUA 2UZUE 3PTGA 3WZEA 5AUZA 4WD5A 1REKA 1OB3A 5ANIA 4Q9ZA 3C4XA 2GNIA 4LM5A 4X3FA 3R83A 5EHYA 5HVJA 4G9RA 4ZTSA 4MBLA 3NYVA 4USEA 2XMYA 4IB1A 1BMKA 1JAMA 2ITQA 5EI6A 3OCSA 3VRYA 4CSVA 3AC2A 3NCGA 3QGWA 4DLJA 4F0FA 3EQPA 5LOHA 3UPZA 2DS1A 2HENA 3F3UA 2ONLC 4K2RA 4P90A 1PXIA 3ORLA 4U43A 3KGAA 3DLZA 2SRCA 4ZZOA 4IX5A 5CEQA 3R7OA 4DBNA 3IW8A 2VGOA 1DM2A 1TQMA 1YKRA 2QU6A 4GG7A 4LUDA 3ZU7A 1U46A 4BI2A 4MTAA 3AMYA 5HQ0A 2J0JA 4F70A 1YXTA 1WZYA 2CLXA 3OBJA 3CLYA 1DI8A 3R1NA 2EVAA 3MVJA 3P0MA 1JKKA 2F9GA 4JRVA 1ZRZA 2W1CA 3PVWA 3FKLA 4V0GA 1OKVA 3CPBA 3RZBA 3T3VA 4CKRA 3LCTA 4BFMA 1Q8TA 3FMNA 4LG4A 5HLPA 4EH9A 4MF1A 1OIRA 3TIZA 5IA2A 5M51A 2R4BA 1VJYA 4OTPA 3LFDA 2RFNA 5I9YA 2R2PA 3PJ3A 3GU4A 4X6RA 2HCKA 3FKNA 1XBCA 3I81A 3VJNA 3IK3A 3PRIA 4I23A 4U6RA 3GU5A 1SNXA 2C6DA 4FV8A 2AUHA 3BHUA 3F7WA 4KIKB 4NTSA 3EQHA 3OMVA 3A2CA 2YIRA 4Q5EA 4QD6A 4BDFA 5JMSA 3RJCA 5A4EA 1XKKA 2GHGA 2CCIA 3ZO2A 5DI1A 2X7FA 1HOWA 4WO5A 4FNWA 1ZYCA 4U44A 2H96A 3ZH8A 5K0XA 2HK5A 5E90A 5A4CA 5KMNA 4AN3A 4KRCA 3IGOA 2B9HA 3GU7A 3IECA 2I1MA 3QZGA 5FGKA 4ANSA 1TQPA 2BAJA 3II5A 5CVHA 3FMMA 5TOZA 1WCCA 4TYEA 4IAKA 3V8WA 1FOTA 3LOKA 5CSVA 5IISA 3EWHA 5AJQA 4XBUA 5D9HA 3I1AA 5LMKC 3C7QA 4FG8A 4APPA 3H0YA 1PXMA 3AC1A 4A4XA 5CASA 1KOAA 5JH6A 3MFUA 3A62A 3ZZWA 2WAJA 2QD9A 3OD6X 4F7JA 3FMLA 5JGBA 3SOCA 5HU3A 4F64A 3FQHA 4FTJA 4KB8A 1YXSA 4XG3A 4EOOA 2PVRA 2PK9A 4RWKA 2ETKA 5HIBA 5M53A 4IX4A 4IZAA 4FKRA 4BGGA 4C34A 5CX9A 2Z7LA 3O0GA 3OWKA 4JXFA 2XA4A 3OUKA 2W1HA 3I5NA 3OT3A 2GS6A 3QYZA 3K3IA 1YQJA 4JJRA 5AP5A 4YUQA 1CSNA 5AAFA 2J0IA 2A19B 3WF9A 2C30A 4OTQA 2CKEA 2NPQA 3DQXA 3VUHA 3VW6A 1HCKA 4ANOA 4CQEA 1GJOA 2QOFA 3PA5A 2GFSA 3FMHA 3KXGA 1OKZA 2VNWA 4TYGA 3MTFA 4X2NA 2PMNX 3UO5A 5FP5A 3SRVB 4AW5A 3I6WA 3L9LA 1H08A 2VUWA 4GUBA 3R2YA 2W0JA 4RJ7A 3EH9A 3PIYA 3C0IA 2VWBA 4FTRA 4PWNA 4JR3A 3WZJA 5EFQA 3ZFXA 4HVIA 3ZEWA 2WMWA 4J7BA 1X8BA 4RIWB 2RG5A 2X81A 4WIHA 3NUSA 1WBPA 2PZRA 3E8DA 4XG7A 1UU3A 2QKRA 3I5ZA 5IMXA 1IR3A 3CTQA 3Q96A 1Y8GA 3R8LA 3MB7A 3O7LB 5DOSA 4YC3A 3UODA 4CFMA 4W4VA 5HE0A 1E9HA 3EN5A 3NUYA 2J51A 4HCTA 4HYHA 4DTKA 3GOKA 3GCPA 4LMNA 3DB8A 4CV9A 3HLLA 4YURA 1A06A 3UDBA 4BCJA 1UNLA 5AX3A 2BUJA 3OEZA 5HIEA 4NJDA 2GPHA 5LXMA 4USDA 2FYSA 3E8CA 1WVXA 2J4ZA 4TYJA 3FMDA 4EBWA 3KQ7A 4P2KA 4EK6A 1FVTA 2C6TA 3F3VA 5C8NA 3BE2A 2C69A 4ASEA 4EC9A 1APME 2GNLA 3CP9A 4CYIA 1PHKA 5A4TA 2B4SB 3V5QA 5E1EA 4AFEA 5BVDA 1AGWA 3ROCA 4RBLA 4FT3A 4Z16A 5JFXA 4N6ZA 4ACDA 4XRLA 5LVNA 3RMFA 4AG8A 3OY1A 5HCYA 5D7AA 1IG1A 2W4KA 4XH6A 2OGVA 5BMSA 2BDJA 4I0RA 3R9HA 4M69B 4DEAA 1V0PA 2W4OA 1OL1A 4QMPA 4TY1A 4ANMA 5HGIA 3Q52A 4S2ZA 1Q5KA 4GV1A 2Y9QA 3FYKX 3F3TA 4RMZA 3T8OA 4IHPA 4QP7A 1P4FA 3LCKA 3BQRA 3MN3A 4C2WA 5CAPA 1ZYLA 2YM5A 4ZS0A 4XV9A 3SA0A 4YTHA 3CS9A 5HVKA 1U54B 2PVMA 3ROYA 3VVHA 2EXEA 3GQLA 3EQCA 4EZ7A 4AAAA 4MEDA 4G6OA 2OICA 3UIXA 3KULA 4F7SA 2QI8A 3GENA 4KABA 2XCKA 3NNWA 3TEIA 2BKZA 1IRKA 1YWRA 5AR5A 2YM3A 3OWLA 4MD9E 4A7CA 2HWPA 4YO4A 4Z9LA 5C9CA 4BDDA 4O2ZA 3TACA 3FE3A 2Y6OA 3BBWA 4L7SA 4FVQA 3TV4A 4AZVA 1XH5A 4QPMA 1Q61A 2QODA 4QMWA 3DBQA 4Y5HA 3A7FA 3ZM4A 4FIHA 5AP6A 4EUTA 3TWJA 3QQKA 3OTUA 3HV4A 1H1WA 4O0VA 4RVLA 3BRBA 4EHEA 2WTVA 3TTIA 3Q6WA 3EZVA 5AP4A 3E88A 5EK7A 3RWPA 2R3MA 4QMVA 4OBQA 2JAMA 3FMKA 4A9RA 4DH3A 4IZ5A 4QQ5A 3MVHA 3GBZA 1PKDA 1V0BA 2YHVA 4D1SA 1OI9A 4EOSA 2YIYA 4P7EA 2JITA 4U0IA 1OIQA 1GIIA 2I0EA 2BTRA 3ULIA 1OPLA 3GEQA 3D2IA 4K6ZA 4C38A 3BYOA 5HBHA 3D0EA 5HVYA 3RCDA 4FV1A 2IN6A 4F9AA 4N70A 3CQUA 3R8ZA 3EKKA 5BVFA 4O0RA 3VBVA 3QTZA 4RJ8A 4JIKA 3DKCA 4U3ZA 4HVHA 4X3FC 1QMZA 4D2SA 5M55A 3V5WA 3ET7A 2X4ZA 4NM0A 4FSTA 5JQ8A 5M4CA 2JIIA 2WEVA 2LAVA 2REIA 3O8PA 1LUFA 4EH7A 4EJNA 1JKLA 3ELJA 5J7BA 2QOCA 4YP8A 4Z3VA 2F2CB 5G1XA 3UMXA 3BGZA 4AA0A 4G3DA 1NXKA 4M0YA 3R8VA 4D55A 2W96B 2G15A 2JFMA 4EQCA 5CAOA 4ERWA 4EHZA 3EN7A 5GZ9A 1YXXA 2HY0A 1YDTE 1BL6A 3OCBA 3KK9A 3UIUA 1PY5A 1LPUA 3QRKA 1GZOA 2HZ0A 4Y73A 3VUGA 1ZOEA 5GZAA 3AC5A 3LXKA 4FNXA 4FT5A 4XJ0A 1P4OA 5GJDA 4D4RA 2H8HA 3IG7A 3MY5A 4F65A 3SVVA 3VS4A 2UW9A 3CKXA 2YN8A 2C4GA 3R2BA 4XP0A 1ZYSA 1Y6AA 4OT6A 5L6OA 4XEYA 3OUNB 5K9IA 2DQ7X 4E5AX 1DS5A 5HTBA 3C0GA 4I6BA 4LI5A 5CYIA 5HLNA 4QQJA 2GQGA 2VWZA 4J96A 2VGPA 1VYZA 2WIPA 2R7BA 3A8XA 1JSVA 4EHGA 2C47A 5CF6A 2BIKB 3O71A 4FKUA 5LMBA 2Y6MA 5J9LA 4X3FB 3NYXA 3QALE 4XV2A 2IZSA 4CFWA 3QQJA 3EHAA 5HEZA 4C61A 3FXWA 4RVKA 4YJQA 3AGMA 4IE9A 2E9UA 4BCKA 1KWPA 3JPVA 2XK8A 1H07A 3W2PA 4RVMA 3GXLA 4FK6A 2XM9A 4AZWA 5CVGA 2PZIA 1M2QA 4LV8A 2PVKA 2X1NA 4NEUA 4AF3A 3CIKA 1ZOGA 2YM6A 4UEUA 4W8EA 3ZXZA 3NW7A 4AUAA 3D5UA 3EN9A 4ZK5A 1IEPA 5KHXA 2VWWA 3CQWA 5J1WA 3AMAA 3ZC6A 1UKHA 2JBPA 3LCDA 4V0GB 5J79A 4ZJJA 2F49A 3HUBA 3TUDA 1ATPE 1YOMA 4EI4A 2F57A 3LFAA 5EDPA 4F9WA 4ZTHA 5EM7A 3VNTA 3DJ7A 3KU2A 3K5VA 4RA4A 5C1QB 2J0MB 2OI4X 4ZEGA 2PE2A 4FZAB 4O0UA 4A4LA 4ARKA 2JGZA 2B54A 3ZUTA 3FL5A 2BZJA 4L3JA 4FX3A 2P4IA 2W1DA 3FLQA 4YC6A 3H0ZA 4S31A 1PJKA 2QG5A 4FIEA 4FTCA 3DS6A 2AC5A 1GAGA 4K1BA 1CMKE 4CXAA 2PMOX 4ZLZA 5GNKA 4QYHA 3VAPA 2Y4IC 2BRBA 3F5UA 3LFCA 4XYFA 4B7TA 5HICA 4C4GA 3FLZA 4AZSA 4C4FA 3BLQA 4IAZA 5FDXA 3VS0A 4E73A 5FLFA 3EN4A 5KMKA 2C6KA 3FZOA 3RAIA 5CF4A 3D4QA 4Y83A 4D5HA 4AOIA 3QAME 4TZRA 5JFWA 4L52A 3D7ZA 4JQ7A 4QYEA 5BVEA 3Q3BA 4EK5A 4OTRA 3UTOA 5ANKA 4G5PA 3H4JA 2DYLA 2F7EE 3PRFA 4IC8A 5KE0A 3CGFA 4NFMA 1QPEA 1OZ1A 3F82A 1H24A 2GNGA 2YDIA 2YFXA 3RPSA 5CSPA 1J91A 4MVFA 4L3LA 4FV2A 3RINA 4MF0A 5L6PA 1W8CA 2UZVA 4JBVA 3I7CA 3D9VA 5B2LA 3LFEA 2YCFA 2YDKA 3HZTA 3QU0A 3PP1A 3F69A 4J95A 2A4LA 4FEQA 1YI4A 4WHZA 4EKKA 4N4SA 3AGLA 3LQ8A 2ZV2A 3NUUA 3KRLA 3ANRA 3CC6A 2R3FA 3HV3A 4E6AA 3JXWA 1A9UA 3NX8A 1OITA 2Y4IB 2B1PA 5FXSA 3RVGA 4FTQA 3E7VA 5I9WA 3S95A 2VV9A 4I4FA 3DY7A 3R9DA 3I0QA 4LUEA 4AGDA 2IW8A 3TXOA 2G9XA 2UW0A 3RHKA 3UNKA 3CY2A 1S9JA 4ONAA 4JRNA 4V05A 2CGXA 3MI9A 4FSNA 5DH3A 4W9WA 4CZUA 2WEIA 1OL2A 3H9OA 5AM6A 3R7IA 5H8BA 3BX5A 3UMWA 5HBJA 1IA8A 3AC8A 3R73A 4X2FA 4WNPA 2UZLA 3QHRA 3ZRMA 3FY0A 5DLSA 5CT0A 4HNFA 4XLVA 2WMSA 3EIDA 5A46A 2HWOA 2W9ZB 3DBCA 4U81A 2VTAA 3ZFMA 4DEIA 4F6WA 2QCSA 2VO3A 1NVQA 3IOKA 4M68A 2C5VA 3QCQA 4PL5A 3WE8A 2ITPA 4G3GA 3ANQA 3R21A 4YTIA 4BCOA 2GDOA 3BELA 1CDKA 4TTHB 1Q99A 4I3ZA 3DQWA 4QMXA 3CQEA 3QKLA 4CKIA 3GB2A 2QOBA 1PW2A 2RKUA 2Z60A 4KWPA 5B0XA 5IEXA 3TNWA 4WUAA 4IVAA 5HG7A 3V6RA 2RFDA 3BYMA 2R5TA 4GT3A 4GVJA 3TT0A 4CMTA 2PVJA 4EQUA 4J53A 5JFVA 3M2WA 3O8TA 4ASDA 4RC2A 5IZFA 3KN5A 3MY0A 4DITA 2VD5A 3ITZA 2XRUA 2I40A 2IO6A 5AAGA 1SM2A 4KRDA 4YTFA 3EQIA 5L2TA 3ZO3A 2A27A 2O5KA 3QD0A 4R1YA 4NW6A 3R1YA 4JG8A 3ZTXA 4O91A 3UPXA 5D11A 1JBPE 3Q2MA 5CU4A 3ZBFA 5DWRA 2VTRA 5CXHA 3PY1A 3AT3A 1URCA 4O96A 2JAVA 4C33A 3PXRA 2C0OA 4E26A 3P9JA 3OOMA 3FWQA 4CVAA 3SD0A 2YCQA 4R8QA 1PMNA 3CD3A 2WTJA 2QOIA 3FSKA 3G6HA 3JY9A 2XBJA 3DT1A 3QTRA 4MX9A 4RPVA 5H8EA 4BGHA 1Y8YA 2J50A 3DB6A 4UXLA 5H9BA 3TZMA 3PZHA 4JOAA 3FHRA 4EH5A 4D2TA 3GC0A 5AV0A 3L8PA 4EOQA 3SX9A 4FIGA 3RALA 3VULA 3KULB 4DH1A 2F4JA 3HKOA 4IH8A 4FL1A 4C3RA 2I0VA 2I0HA 3ZO4A 4R5YA 1KE7A 2RSVA 4OTFA 5DEWA 1H01A 2HZ4A 5J5SA 1MRVA 1TKIA 3CR0A 1W7HA 4UXQA 3FC2A 3REPA 2GMXA 3ZSGA 2XKDA 4LYNA 1B39A 2P0CA 2X8IA 3G51A 4DFXE 4YJRA 2XS0A 3B2WA 2XIYA 2GNJA 3Q4ZA 4FT7A 3IQ7A 4JDJA 3RI1A 1YW2A 3FL4A 4QQCA 3COKA 2EB2A 2Z7QA 4QYYA 3HA6A 3W8QA 4AA4A 3UQFA 2CHLA 1WMKA 4WNMA 3RTPA 4BTFA 1ZMWA 3VS7A 3OBGA 5CU6A 1XJDA 2OXXA 3BYUA 4MK0A 4CCBA 1DAYA 3BHTA 3E3BX 4FV4A 4TL0A 4USFA 4G31A 3TV7A 4N0SA 3F2AA 3MIAA 5TF9A 4AOJA 5LCJA 4MNFA 5M44A 2PUUA 3F88A 3PY0A 1M7QA 1Q62A 1YI3A 4MHAA 5DN3A 5DE2A 3QL8A 2IVVA 1URWA 5GJGA 4AU8A 5A54A 5CAUA 1QPJA 2FGIA 2YIXA 3KL8A 4H3QA 4MH7A 3DTCA 4J52A 2YM8A 3UC4A 4C57A 3UO6A 2CN8A 1KOBA 2JDRA 3P78A 1Q8UA 3VS1A 2OWBA 3ORMA 5DR6A 3SDJA 3U51A 1YWVA 5HKMA 3F7ZA 5E8XA 3HV6A 4G2FA 2JLDA 1F0QA 1WBVA 1XQZA 3QX2A 4U41A 3KB7A 3U6HA 1WBNA 1KE8A 4PV0A 4RX7A 5DIAA 4ANNA 3RBWA 3MJ1A 4NW5A 5AV4A 5HTCA 3CD8A 3CPCA 2UZOA 3S4QA 2PVLA 2QO7A 5H3QA 3DTWA 3EJ1A 4EKLA 2J6MA 2GTNA 4W8DA 2QC6A 5BYYA 5JGAA 2QO9A 4BTKA 5JGDA 4YTCA 5LVOA 4ZZNA 5A9UA 2YIWA 3DNEA 2YJRA 4KIPA 2WMBA 5D1JA 3W2SA 5TE0A 4MBIA 4FTIA 3QA8A 3RM7A 4EWQA 5HESA 2X4FA 4CZTA 1F3MC 4GFGA 3JY0A 5ETIA 3SLSA 3SW4A 4EK8A 3KY2A 3VRZA 3VUKA 3HMMA 3BE9A 4JS8A 4JX7A 5CNNA 5AR4A 3C50A 3L9NA 1CTPE 4QMUA 4LFIA 2RFSA 3NPCA 3O51A 2PSQA 2HXQA 3G9NA 5B2KA 2WMUA 3HRBA 4E6QA 2PVNA 3UNJA 3POOA 4R3PA 1JOWB 5E8YA 3HYHA 4O22A 1OECA 4WA9A 4A4OA 4CRLA 1U59A 2BDWA 1Q8YA 3DPKA 2B9IA 3BI6A 2XIRA 2ZOQA 4IWDA 4M97A 2F7ZE 3GT8A 5AUTA 4BGQA 4FTKA 3HP5A 4RJ5A 4FKTA 3RHXA 5E8ZA 4X21A 4WSQA 2GNFA 2W1IA 3A4OX 5CU2A 3UVQA 3G90X 4F1MA 4FICA 1STCE 2PE0A 2UZBA 4W9XA 3ALOA 3PJ1A 4JQ8A 3VBTA 3HUCA 2C3LA 3L8XA 3P79A 2WTDA 3UO4A 4C4EA 4L46A 4NSTA 4DG3E 5L2WA 1R3CA 4ALVA 2WD1A 2QO2A 4E93A 3HDNA 3OWPA 5IH5A 5AUXA 1G5SA 5CSHA 4HJOA 2BZIB 1R78A 4RQVA 4DEDA 3NAYA 3DKFA 5EKOA 2W9FB 4UBAA 3MTLA 3EN6A 3OCTA 2R3IA 2V7AA 3OF0A 2OZAA 4O21A 4O2PA 3JVRA 3WZUA 4EOMA 4BBFA 3AQVA 3GU8A 3RK9A 3PG3A 2XEYA 2VAGA 1FPUA 2NO3A 3DCVA 4Y5QA 5ETCA 1PKGA 3R01A 2P55A 1I09A 2IVSA 4GU9A 1RW8A 3R04A 4NCTA 5ANEA 3NNXA 4CFNA 2HZNA 1WVWA 2VTJA 3GCSA 4FV7A 5CEPA 4PMTA 3VF8A 4NM3A 3NDMA 2V55A 4L7FA 5KUPA 2J90A 4JNWA 4PTCA 5GHVA 4KINA 5HBEA 4J8MA 4B9DA 4Z55A 1L3RE 3P5KA 2QKWB 1YXVA 5FEDA 4HZSA 3ZO1A 5HHWA 3ZDIA 4FZ7A 4PF4A 2X7GA 3P1AA 1VZOA 4XP3A 5FEEA 2HIWA 3A7IA 3F5XA 3FZPA 5KKRC 3QZFA 4HVGA 4EWHA 2QOHA 3C4WA 3DNDA 4FV9A 5AV1A 4EOIA 3UNZA 2RL5A 4LV5A 2ITXA 3KK8A 2BZHB 3Q4CA 2IW6A 4G6NA 5A4LA 3FZSA 4FA2A 2VTIA 4GW8A 3OHTA 2FH9A 3HECA 4C4JA 2XNNA 4LMUA 1Z57A 4KBKA 4IM0A 2OIBA 5KNJA 4FZ6A 3BWFA 4Y72A 1J1BA 4Y85A 4CTCA 3ORZA 4GUEA 3BWJA 3JVSA 5CY3A 1BYGA 3O7LD 4C3FA 4BCMA 2CGWA 5AX9A 2BCJA 4ALWA 1YOJA 5GJFA 5I9XA 5BMMA 3RPYA 4I93A 1KE6A 3ZSIA 3NZ0A 1FMOE 3MFRA 4CRSA 4BF2A 2OH0E 3MH0A 1H00A 4RVTA 3V51A 3KMMA 1BX6A 2YZAA 4FOCA 3U6IA 2P2IA 1JLUE 1UKIA 4GYIA 4TYHA 2CLQA 4GK2A 3EOCA 4JG7A 2GS7A 4BCGA 3SC1A 3F5GA 3O23A 4HYUA 3FZRA 3ZFYA 3BPRA 4GL9A 4BL1A 2C0TA 2HZIA 2WZJA 4G3EA 4RLLA 4XS2A 3QCYA 4D0XA 2XKFA 3P86A 3PYYA 4RG0A 5CU0A 3GQIA 5KKRB 1PF8A 3WOWA 3CJFA 1SYKA 5KMOA 3OY3A 2ERKA 4QMYA 4FKGA 3PA4A 4G5JA 5A14A 2JKOA 3GC9A 2WQBA 4TXCA 4W4XA 2YDJA 5I3RA 5DRBA 4QP2A 1YHVA 4KBAA 5JN2A 5EI2A 5IH4A 3MJ2A 5IDPA 1EH4A 4FTNA 3RP9A 4F9YA 5L2IA 3U6JA 4IWPA 1KE5A 4GFMA 5B7VA 2QLUA 4IAYA 2WQMA 3ZUVA 4BKZA 1KV1A 4JR7A 3KXNA 4RA5A 1I44A 1YDSE 2G2HA 2UW8A 3K5UA 5KZIA 3TKIA 4BIDA 4BDJA 4QNAA 1YDRE 4BDHA 4YMJA 2WXVA 3E7OA 3Q5IA 2C6MA 3QLGA 3QTIA 3FI3A 3FC1X 5J87A 3D7TA 2G2IA 3LHJA 3QTQA 4FT0A 4EZ3A 2G01A 4RX5A 4OGRA 5K4JA 4YO6A 3AXWA 1XBAA 3QUEA 4FL3A 4I0SA 4MD7E 1BI7A 5CTPA 2YIQA 3Q9WA 3SQQA 4BCQA 4L6QA 4BCPA 4F0GA 2O3PA 2QR7A 2GS2A 2XUUA
chains in the Genus database with same CATH superfamily
1Q97A 3NUXA 1XH7A 4YLJA 2WIHA 3DA6A 3C1XA 3Q5ZA 4YNEA 2W1FA 4WUNA 3PPKA 4FTAA 5IU2A 5FM2A 2R3OA 4C58A 3W33A 4EL9A 4GK4A 4MNEA 4IXPA 4QTCA 5M56A 3QXOA 2JD5A 3PPZA 3HRCA 5H2UA 1P14A 3QCXA 4BICA 2XB7A 2RF9A 3I60A 5LCKA 4J1RA 4AGCA 1UNGA 3W2QA 4QMOA 2BRMA 4QTAA 4YBJA 5AV3A 2X0PA 4UZDA 3TIYA 2JDSA 2OZOA 5LQFA 1NY3A 5H8GA 5DHJA 2PMLX 4YJSA 4UX9A 5CF8A 3ZCLA 2OJJA 3PA3A 4GVAA 4XUFA 4DFZE 1ZY5A 4TWCA 3MSSA 3LQ5A 3VN9A 3OWJA 2WMRA 3THBA 5IDNA 5E1SA 4QTBA 4CYJA 4LOPA 4O0WA 4PQNA 4EOLA 4HGSA 2VWYA 5F95A 3V3VA 4B4LA 5TO8A 4EUUA 4FVPA 3M11A 4O38A 3MH1A 3ZEPA 2OG8A 3HX4A 2F2UA 2R3RA 3BBTB 3LXPA 3UZPA 2CJMA 3R9OA 4BZDA 3R71A 4YJUA 4MBJA 2XH5A 4TRLA 5AUVA 4MXZA 4B6LA 4MQ1A 4F9BA 3BZ3A 4H36A 3WF6A 1XH9A 3DK3A 4OLIA 4F08A 4ENXA 4UWCA 2OH4A 4A06A 2X0GA 2R3QA 1RJBA 1GZNA 3U9NA 4BCIA 2J9MA 3DBEA 3TKHA 2NP8A 1FMKA 3ZRKA 2IVTA 3KFAA 1RE8A 5LVPA 4H3BA 5FBOA 2XYUA 1LP4A 5KX8A 1M14A 2C6EA 4IFGA 4H3PA 4QMZA 3GFEA 5DMZA 2WO6A 4W4YA 2HXLA 4D4VA 4E3CA 2RG6A 4KKHA 3ENMA 5A6OA 4FF8A 3FLNC 4CT1A 4ACHA 3ZDUA 4BI0A 5L4QA 4YHFA 2YAAA 4RJ6A 2WOUA 2PWLA 3KEXA 4CFXA 5HLWA 2DUVA 3UP2A 3UYTA 3MGYA 4CNHA 5FQDC 2QHNA 4DEGA 4PTEA 1HCLA 5JKGA 3K3JA 5CQWA 4D1XA 3RK5A 4ACCA 3NYNA 2P3GX 4Y8DA 3QRJA 2IJMA 3FPMA 3PFQA 4E4NA 3R22A 3UG2A 3TCPA 4F63A 4AT3A 2A0CX 1PXPA 2W5BA 5EM5A 4PDSA 2W17A 4D2RA 4D2PA 2UVXA 4TNBA 3F5PA 1ZMVA 4BTMA 2V62A 2VTOA 4BDEA 2OFUA 5CEIA 3KF7A 1MRUA 4PRJA 2ZMCA 4ZTQA 3D83A 4L00A 4F09A 4K8AA 2UVYA 2XIZA 3LZBA 2HYYA 2C1BA 4JBQA 5HO7A 4AW2A 2XNPA 5HE3A 1OPJA 5FTQA 5L6WL 2R64A 1YHWA 2OF2A 1W84A 2Y0AA 3Q60A 2VTPA 4AFJA 3BEGA 4AA5A 5BPYA 4JBPA 4JDIA 3AT2A 1SVGA 2XJ1A 1SVHA 4FKIA 3KF4A 4E1ZA 4OTHA 4EH8A 2X8DA 5IUIA 5BNJA 3IW5A 2YEXA 2EXMA 2A1AB 3FV8A 5FXQA 3MIYA 5I4NA 1ZLTA 5F4NA 2J0KA 2QOQA 3PIZA 5DG5A 4YPDA 1OUKA 3PXFA 4PP9A 4LRKA 4DAWA 1W2DA 3ORXA 5CSXA 5KMIA 5HU9A 3C5UA 4K11A 4UYAA 2ZB1A 4RWLA 2OU7A 3A99A 4QRCA 4YJPA 3FJQE 3E8NA 4E4MA 4NCTC 5AM7A 3O50A 5AR7A 2UW4A 2XF0A 3NSZA 3COHA 5I0BA 3PE2A 1O6LA 1BLXA 4GK3A 5IPJA 1VEBA 3KCKA 4M13A 3IPHA 1WBWA 2ZDUA 4HYIA 4L3PA 4XG4A 4YLKA 3PUPA 1GY3A 4QP4A 4F99A 4BIBA 3EB0A 3LJ0A 2NRYA 4ZTNA 4FSUA 1OM1A 3ZLSA 3LFQA 3NEWA 5CU3A 5DVRA 4E7WA 3PY3A 3NR9A 4IDTA 4L42A 3UQCA 1R39A 4BWXA 5JRSA 3UOKA 1R1WA 4PMPA 4GS6A 3ORPA 1R0EA 3E3PA 5EYMA 2UZWE 4DC2A 4EOKA 4RZWA 4GMYA 3TNPC 1JKTA 5CS6A 4A07A 4RLKA 2X6DA 4FTTA 4O0YA 4ZXTA 3PSCA 3RNIA 4BIEA 2W1GA 4C37A 5F20A 3WIGA 1IASA 4MXCA 5HCZA 3D5VA 5HCXA 5AP3A 2OZAB 4NT4A 1Y6BA 3I79A 4AW1A 2F7XE 4L53A 3L8VA 3RPOA 5CWZA 5E8TA 1JQHA 3IW7A 5FRIA 3G9LX 3QRUA 4PDOA 4XG6A 5JK3A 5AP0A 4QT1A 2X6EA 3ENHA 3GCQA 2R3HA 4I24A 3WE4A 3QD3A 5LMAA 3ACKA 2E9PA 1O6YA 2BVAA 3PSDA 3LAUA 4HGLA 2WFYA 3QUPA 5KO1A 4E20A 4IC7A 5HG8A 5D10A 5A3XA 4D1ZA 3COMA 4D2WA 4OAUC 2GFCA 4I6QA 4KIKA 3MH2A 2VNYA 1WVYA 2XNMA 4D28A 1E1XA 4OBOA 2C1AA 3OVVA 5D12A 2IW9A 4YJTA 3UOHA 4BB4A 2I0YA 2VTMA 4FVRA 1UNHA 3DK7A 5CALA 4I20A 2ONLA 4FG9A 3CBLA 5E8VA 4GT4A 5L3AA 2HOGA 2XNEA 4ENYA 2QOKA 5KMJA 4MD8E 4ID7A 2IZTA 4I5HA 3NAXA 1AD5A 4HGTA 4X2GA 3LFBA 3TN8A 3OW3A 5GZ8A 5HZNA 1T45A 2J7TA 5CENA 2WPAA 4CZYB 5ANOA 3R28A 3MB6A 4MYGA 5JZJA 3QKMA 1PYEA 3QQLA 4XOYA 3T9IA 5F94A 3QHWA 4ZSJA 5AA9A 3VS2A 4BCFA 3KMUA 1F5QA 3EYHA 3IDCA 3Q4TA 3VHKA 4TYHB 3FXZA 4M14A 2G2FA 4OR5A 3SW7A 3VWAA 4FTUA 2ITTA 3NNVA 4BCHA 4S30A 1CKJA 4NK9A 4GG5A 4BYJA 3MVMA 5AIKA 3QQHA 4O6EA 3PG1A 2ZM3A 3TNHA 3ACJA 4UN0C 2QONA 2JIUA 3V5JA 2QURA 4AACA 1BL7A 5AAEA 4U8ZA 4C02A 2C3JA 4HNIA 2WTCA 4FIIA 2E2BA 2VZ6A 2WHBA 5AR8A 4FSMA 4FTOA 3PXYA 4GH2A 3ZLXA 2ZVAA 3GP0A 3QCSA 4XX9A 3FQSA 1LR4A 2FVDA 4ZLYA 5J8IA 2ZMDA 5AUWA 4DCEA 5M4FA 2OJGA 4IBMA 3F3WA 3PIXA 2PMIA 3KVWA 3LFFA 4CMUA 1G3NA 3QYWA 2IVUA 4EH2A 4OW8A 5ANGA 3FLYA 2XP2A 4MWHA 4C0TA 4PL4A 4R1VA 3QF9A 3Q9ZA 3SRVA 3AMBA 3H3CA 3OC1A 4DFLA 3HDMA 4A9SA 4X2KA 5L8JA 3NWWA 5HNBA 4A9UA 1XH6A 5IUHA 4RX9A 1RQQA 3CGOA 4X0MA 2WQOA 3PLSA 1OL6A 2Z2WA 2O65A 3R30A 4IZ7A 3D7TB 3ODZX 3LIJA 4UYNA 3BGPA 3VF9A 4KAOA 3PXKA 2XZSA 3VS3A 5E8UA 1OL7A 3S1HA 4D5KA 4K9YA 4YHJA 1V1KA 1FINA 3IO7A 5T6KA 3VUDA 5FEQA 2C5YA 5EHLA 2XKEA 5IEYA 4ACMA 4PNIA 1TQIA 3SAYA 2X9FA 5I5ZA 3KCFA 1PXLA 2J2IB 3Q9XA 3DAKA 4MNEB 1OUYA 3RPRA 2ITWA 5HG9A 3V5PA 4WOVA 4S34A 3LCSA 4W4WA 2BILB 4WRGA 4CKJA 2VU3A 3MA6A 4LL0A 3PXQA 3C0HA 2ZV9A 2BMCA 2HELA 3U4UA 5TT7A 3R7EA 2OJFE 3C4FA 4RWIA 1U5RA 1WFCA 3HMIA 4FG7A 3QX4A 2C3KA 4C7TA 3H9FA 1H0VA 2XK3A 3KC3A 4FKJA 4IANA 3A60A 1Z5MA 1OKWA 2YITA 4I5PA 2YERA 4IZYA 5AADA 5CAQA 5CAVA 1GIHA 4YJVA 5DA3A 4QP3A 2OXYA 3QQFA 4YNOA 4PUZA 3BLRA 2B53A 4FKVA 4FYNA 3P7BA 2WTKC 3QWJA 4M69A 4WBBB 3EQDA 2C68A 4PPCA 3FLSA 1Q4LA 3GCVA 3U9CA 2C0IA 2IF8A 4HZRA 2YJSA 4I41A 4L9IA 3W2CA 1ZZ2A 4L43A 3TUCA 2OFVA 2QVSE 4F9CA 5AEPA 3DJ6A 4KKEA 4HCVA 3MV5A 4IAAA 4C8BA 4HPTE 4RIYA 4ZY4A 3EMGA 3ALNA 2VRXA 4IB0A 4DG2E 4BN1A 2HAKA 3D15A 4O0XA 4YU2A 3EFJA 3MDYA 4MKCA 4F6SA 2UW3A 2YM4A 3Q9YA 2AYPA 2ZDTA 3IW6A 3OFMA 4D58A 4EBVA 5AP7A 4UMPA 4BCNA 3QXPA 2YWPA 3NS9A 3UIMA 4ANQA 3ZHPC 5FXRA 4HGEA 3LMGA 2Q0NA 4WG4A 4XOZA 2IZUA 3O17A 4M84A 1PXKA 4XHKB 2BRHA 3QZHA 1XR1A 3EQGA 2FSTX 2WTIA 4RIOA 2PE1A 5FM3A 4BHNA 2BALA 4HPUE 3HV7A 3UVPA 4RGJA 2WOTA 3FKOA 3QLFA 3LVPA 2WTKB 3C4ZA 3HL7A 3ZSHA 4A9TA 2VN9A 2WTWA 4AW0A 4IAIA 3V5TA 4FKOA 5AP2A 4EZ5A 4YZCA 1H1QA 2V5QA 4TWNA 3MW1A 5EM8A 4YSJA 5HD7A 3W18A 4RC4A 1ZYJA 4I0TA 4ANBA 4O1PA 3MFTA 4B8MA 3OP5A 2WMXA 4DGOA 5AA8A 1H28A 2QQ7A 4FSRA 3LE6A 2WMQA 4QP1A 1RDQE 4X7QA 4YHTA 1PMUA 4OTWA 5FDPA 3L8SA 4DFYA 2RFEA 4K33A 2H9VA 3HGKA 3JYAA 4M3QA 3QTSA 1YXUA 5J7HA 3MYGA 4ANLA 3W2OA 3EQFA 4RJ4A 2BRGA 4GT5A 1Q3DA 4UB7A 5EYKA 3FPQA 5HG5A 4IACA 4AN2A 2EB3A 2CPKE 4BWPA 2ITNA 3HNGA 4JAJA 4X6QC 2YAKA 5EOLA 3AG9A 4ZIMA 3IKAA 3POZA 4U9AA 4RC3A 2BFYA 4ZJVA 5DR9A 4XBRA 5IF1A 3G6GA 3NRMA 3NGAA 4CQGA 3W8LA 4MAOA 3SV0A 5L2SA 1GNGA 4E8AA 3G0FA 3WYXA 3MBLA 1PMVA 4IDVA 4MXXA 5JSMA 2QOOA 5LWNA 2J5EA 5AV2A 4TW9A 3KRRA 5EM6A 2WU6A 2O63A 3KRJA 4C4IA 5A6NA 5E7RA 3CEKA 2VTNA 3CJGA 3Q04A 4U97A 4A9YA 3BQCA 5EDRA 4IB5A 4FV3A 4U40A 5HNIX 3ZRLA 1H1SA 3OXTA 4FNYA 3R63A 4C4HA 5K0KA 5M57A 3BU3A 2B55A 4Q2AA 3LFNA 1SZMA 1QPDA 3ORTA 4FSYA 3UBDA 3TJCA 3VBQA 1W98A 1Q8WA 4E6DA 2LGCA 4QQTA 2R9SA 3DK6A 3PWDA 3IOPA 3MPMA 4I1ZA 1MQ4A 1W83A 5J95A 4CFUA 5IG1A 4FV5A 5M4UA 4BDCA 1H4LA 1ZMUA 3GCUA 3SOAA 4H1JA 5LJJA 4TYIA 5I9UA 4FI1A 1U4DA 3UG1A 5IUGA 2FUMA 4RIXA 1S9IA 2UZDA 4YZBA 3TZ9A 1ZZLA 2GCDA 4FUYA 3CXWA 4QP8A 3A7HA 2OJ9A 4IJ9A 3PZEA 4QP6A 5D41A 5DRDA 3KVXA 3LLTA 3NUNA 4ZY6A 4TWOA 2W5AA 2JDTA 3BV2A 3E87A 2PVHA 2P2HA 5BUJA 3DZOA 2FSMX 3JS2A 5ETAA 5KMLA 4BKYA 3OS3A 4TN6A 4CT2A 2WQNA 3FQEA 3MH3A 4UALA 4GFOA 4BRXA 4DGLC 5AMNA 1OMWA 1GOLA 4AGWA 3V6SA 3QTWA 3AD5A 3WI6A 4BDBA 4CFFA 4H1MA 4O1OA 3ZOSA 4WT6A 4JG6A 2UUEA 4KS8A 3LXNA 1OIUA 4P5ZA 3Q6UA 4G9CA 5T68A 5EW8A 4CV8A 4YZ9A 5DR2A 4MXOA 3A7GA 3DAJA 2H6DA 2UZNA 4ITIA 3SXFA 1W82A 2GHLA 1YI6A 3PWYA 3R7YA 4EOJA 2VWVA 4FODA 4FIJA 2ITUA 4AZTA 4HVSA 3H9RA 4RT7A 4PDPA 2FB8A 3LXLA 4AE6A 4APCA 1PYXA 2IZRA 4J8NA 4IX6A 1YHSA 2PZ5A 1GIJA 1Q24A 2BFXA 3QFVA 4GCJA 4TWPA 5C26A 4NH1A 3B8QA 2GHMA 5I3OA 1SMHA 4AZFA 2CMWA 4I6HA 1MQBA 4BDAA 2FSLX 2OIQA 4FKWA 4IJPA 4PMMA 5DFPA 3B2TA 4ZOGA 3QRIA 2Z8CA 2O2UA 1K9AA 2ZM1A 2JKMA 3UQGA 3D5XA 5JZNA 4ZLOA 4OT5A 4ERKA 1OIYA 4D2VA 2V7OA 3N51A 4GEOA 5FG8A 4G3CA 3QA0A 3RM6A 2YACA 3L9MA 4FZFB 4FKPA 3UGCA 5LVMA 1ZY4A 1JNKA 2C6IA 5BVWA 3A4PA 3RCJA 4WG5A 3BU6A 3FI2A 2UW7A 2QR8A 3IGGA 4O0SA 4XRJA 3ZMMA 3ZS5A 5E92A 2CGVA 4QMQA 1ZAOA 1H25A 3GGFA 5IH6A 5HO8A 2C5OA 4DHFA 1O6KA 3MPTA 4FK3A 4DG0E 4EK3A 4EORA 1M2PA 1H26A 3DU8A 3AT4A 3I4BA 1YWNA 3DV3A 3R02A 4IIRA 3WF5A 4YSMA 3Q32A 2XK7A 4BZOA 5HO6A 4AWIA 3U4WA 3DBFA 4IQ6A 3VUTA 2YISA 4YLLA 2XK9A 3CCNA 5IA5A 2B9FA 1YOLA 2PVFA 4BDGA 4QPSA 3C4CA 3H10A 4F7NA 2QU5A 3D94A 5EOBA 5JT2A 2XKCA 2R3PA 3IONA 3L9PA 4YZDA 4CFVA 4DEEA 2ITOA 2BTSA 4ZTRA 4IFCA 3EFLA 2WGJA 1ZOHA 1FGIA 2EXCX 1T46A 4RSSA 3M1SA 4DYMA 2VWUA 2QLQA 2O8YA 4FBXA 1H8FA 3LPBA 1GZ8A 5J5TA 3VS6A 3QD2B 2BAQA 2HW6A 3T9TA 3SKCA 1JSTA 2CDZA 4OTIA 4FZDB 3M42A 4Q5HA 2ESMA 4U42A 3R7VA 4BYIA 5B2MA 4O6LA 5HE1A 1H1RA 2VTHA 3N9XA 3NW5A 5ACKA 3W55A 4IVDA 2GSFA 3R6XA 5IMEA 1REJA 5CEMA 3BKBA 1J1CA 4R7IA 2JKKA 4K0YA 2JDOA 4QMTA 4S32A 5DBXA 4XCUA 2R3KA 5BVNA 4JL9A 3E63A 5CF5A 1P2AA 4FSQA 4BDKA 4RJ3A 3ETAA 1OVEA 3QC4A 4G17A 4J98A 4FIFA 3QWKA 2ZV7A 3PJ2A 4NIFA 4GRBA 4UMTA 2OBJA 4NFNA 2OF4A 4Y46A 5DEYA 3LFSA 2C3IB 4LOOA 3HMOA 5FP6A 4UV0A 5L2QA 5LARA 3IW4A 3A7JA 3MPAA 4EHVA 3WF7A 3EFKA 4UMQA 4L01A 3G0EA 3ZUUA 4FKLA 2UW5A 3PP0A 4P4CA 4TPTA 4U5JA 3W16A 3RGFA 4FGBA 2X2MA 5E91A 1R0PA 2W1EA 4YZNA 4DFNA 3K2LA 4Y95A 5HORA 1XWSA 2WMTA 4QOXA 3VBWA 3WYYA 4HW7A 4OTGA 5ITAA 3S00A 3LM0A 2R3NA 4C35A 1M17A 4UMUA 1QPCA 5EYDA 3I0OA 5F9EA 3C4EA 2ZYBA 2XNBA 2JDVA 1ZYDA 4I5MA 2W05A 4RFYA 2XYNA 3BEAA 4WNOA 2XIXA 4R3RA 4EH6A 1WBSA 4IWOA 4IX3A 1NVSA 2VTSA 2ACXA 1CM8A 4GU6A 3TUBA 4L68A 4AN9A 2W5HA 2JC6A 2JEDA 4FL2A 4GYGA 4IADA 3FMJA 4ZSLA 3AOXA 4PPAA 4IWQA 3LJ1A 3KXXA 4BBMA 1OL5A 5IEVA 4HVDA 5TR6A 4AT5A 2QHMA 1B6CB 4BHZA 2XCHA 1TVOA 3HVCA 4LQMA 2B52A 2XNOA 4RIYB 2JBOA 4IVBA 2HW7A 4YBKA 4EH4A 2XM8A 4BVUA 2DWBA 4UZHA 4IEBA 3RZFA 4I4EA 3GI3A 2UVZA 4B8LA 3FUPA 2VO7A 3BYSA 3P08A 4M12A 3VJOA 3OTVA 3UOLA 3CTHA 4U7ZA 2XJ2A 3BGQA 2AC3A 4RQKA 2YLEA 4FV0A 4RFZA 1WBOA 1UU9A 1WBTA 1UA2A 3H30A 1XH8A 1Y91A 5C8MA 2W7XA 5EKNA 3HMNA 5BVOA 2JFLA 2FO0A 3NIEA 4FSZA 4UMRA 3R1QA 4NKAA 2WB8A 3ZXTA 4BDIA 3PXZA 2OIDA 4QP9A 3VS5A 2XJ0A 5CT7A 5EYCA 3F6XA 3FMEA 1U5QA 3QGYA 4HYSA 4RZVA 3WZKA 2FSOX 3VC4A 1FVVA 3L1SA 4NUSA 1UV5A 3OXZA 3PVGA 3VW8A 2XRWA 1O9UA 3ZBXA 4AOTA 5HE2A 3KMWA 5FWKK 1BKXA 2OSCA 4I6FA 5CVFA 4CMOA 3OCGA 3KN6A 3FXXA 4Q9SA 1UVRA 3HMPA 4F1OA 3QD4A 3BU5A 4C62A 3FDNA 3BCEA 5HOAA 5J1VA 3AC3A 4J71A 5CNOA 3BHHA 2R3JA 3HRFA 5CSWA 5AUUA 2PVYA 2B9JA 4O0TA 5AWMA 4KSPA 5BUIA 5HTIA 4GIHA 2OO8X 4XLIA 4AQCA 4IM2A 1UWJA 4BTJA 5HIDA 4XV1A 4ASZA 3A61A 4CLJA 5JEBA 4M67A 3V04A 1Q41A 3BYVA 4E6CA 4PP7A 3UYSA 2X2LA 4JBOA 3WF8A 3RPVA 3PVBA 3KA0A 4AS0A 1JWHA 2XNGA 3EKNA 4EK4A 4BKJA 4DGMA 4EYMA 4CCUA 4F0IA 3DGKA 3F2NA 4JX3A 4QMMA 5C8KA 3F66A 5EG3A 3DLSA 1GZKA 4FMQA 2VX0A 4NKSA 5T3QA 2YCRA 3R00A 3R9NA 3WILA 5K5NA 3D5WA 3VBYA 3GU6A 3G33A 3KKVA 3RK7A 4JDKA 2W99B 4FR4A 4DGNA 4ALUA 2P33A 3F61A 2WMAA 4FKSA 2BHHA 4M15A 4DH7A 2Q0BA 3NW6A 5KMMA 1ERKA 2QNJA 3U87A 4DEBA 4IM3A 4Z7HA 3PPJA 4FTMA 3FI4A 2HY81 4QTDA 2Y7JA 5DGZA 1NA7A 3FZ1A 3O8UA 4DLIA 3S2PA 4IVCA 2O0UA 2VX1A 3GC8A 4JAIA 4MXYA 3WARA 1Z9XA 3SXRA 1BI8A 4KBCA 3R0TA 4U80A 3UZTA 2UZTA 4F1TA 2J0LA 4PY1A 4QPAA 2QOLA 4EEVA 3KXZA 4F6UA 1PMEA 4RIXB 4EC8A 4EYJA 4YJNA 3R8PA 5CI6A 2EUFB 4BBEA 2ITZA 4R5SA 3UC3A 2VWIA 2RIOA 4FUXA 4NJ3A 4JI9A 5AUYA 3UIBA 4QMSA 4BZNA 5L8KA 3S0OA 4KIOA 2UV2A 3S3IA 4C3PA 3MWUA 5IA3A 2V0DA 5JQ5A 2R3GA 3O96A 3CY3A 4X3JA 1FGKA 3GUBA 4DINA 5ICPA 2R3LA 4JVGA 1KV2A 4QYGA 5CEOA 2C5NA 3G5DA 3CKWA 3DFAA 2WNTA 5KHWA 3E93A 4WRSA 2AQXA 3TTJA 3DDQA 1W2FA 4DH5A 2Z7RA 1WAKA 5EW9A 3R1SA 4K77A 4AZEA 4E4LA 4G16A 4PX6A 5EDQA 3DXNA 4KSQA 3GOPA 2JKQA 3ZYAA 3EFWA 4FC0A 4N6YA 3T3UA 2BHEA 4AP7A 5AR3A 2V22A 4G3FA 3TG1A 4GJ3A 5C03A 2WKMA 2BPMA 4ZSAA 1B38A 5DPVA 3D14A 3JUHA 4GIIA 3W10A 4RFMA 4JQEA 3F9NA 1M7NA 3Q4UA 2X7OA 2PY3A 5BX0A 2BR1A 5JFSA 2E9VA 3K54A 3PJCA 1UU7A 3QUDA 3DKGA 2ZJWA 4QNYA 3PSBA 4H39A 3TNQB 2ETMA 2XVDA 3KXMA 4D0WA 2WELA 2VO0A 3IDBA 5A4QA 3WBLA 3I6UA 4ZJIA 4JT3A 3P7AA 1M52A 3EL7A 4D4YA 1OGUA 3BV3A 2WMVA 3B8RA 4TKSA 4NTTA 5F1ZA 4GSBA 1PXNA 3OOGA 4RWJA 5FD2A 4CEGA 4I22A 3FBVA 4D9UA 3V8SA 4XP2A 3TNIA 3E64A 5FBNC 3UOJA 3E92A 1XBBA 2PZPA 3FY2A 4QYFA 5DT3A 2RGPA 2NRUA 3ORIA 3EZRA 3VUIA 5IA0A 3DKOA 4PMSA 2A98A 5HNGA 5HD4A 1MRYA 4U3YA 2BROA 2XIKA 2Z7SA 5CANA 3AD6A 2G1TA 3ZZEA 4I21A 4AT4A 5BYZA 4MXAA 2X9EA 3OZ6A 4OUCA 3PJ8A 2GU8A 4AE9A 3LJ2A 3OEFX 5DT0A 5HI2A 4RRVA 3W1FA 4DEHA 3FLWA 1MP8A 3COIA 3MS9A 4G6LA 4C36A 1CKIA 4OTDA 3QC9A 3OXIA 4NU1A 4EQMA 3AC4A 3ERKA 3IS5A 4DN5A 5LVLA 1J3HA 4UWYA 1QL6A 4ACGA 5LWMA 4JDHA 4YJOA 4IAFA 4PTGA 3BIZA 3GVUA 4BC6A 4BWKA 5J9ZA 4PPBA 1QCFA 2PTKA 3DOGA 2UW6A 5BUEA 2W06A 2ERZE 4IW0A 1YRPA 4LGHA 4YZMA 3TZ8A 4YR8A 1W0XC 2Y8OA 3BHVA 4LGDA 5ANJA 3TV6A 2KULA 4OAVB 3HEGA 3MA3A 5FTOA 4ZTMA 3TJDA 1ZXEA 1ZWSA 2PHKA 3A8WA 4FSWA 2YCSA 4EH3A 1PXJA 4M8TA 2YA9A 2OXDA 4R3CA 5CLPA 3RAWA 5CEKA 4XV3A 5C01A 3VQUA 4EONA 3TI1A 3DDPA 3C9WA 5LMKA 4G34A 4I92A 2BZKB 2CSNA 5CZIA 3WIKA 1K3AA 2C5XA 3ZONA 2X8EA 4RIWA 4CLIA 1Q8ZA 3CTJA 3VHEA 4D9TA 3O2MA 4XG2A 4E5BA 4E4XA 5I9VA 3P23A 3VO3A 4LL5A 3ULZA 3EYGA 3NUPA 5DNRA 4C2VA 1NVRA 5HX8A 3ORKA 5AR2A 4I94A 1OKYA 3FYJX 5ANDA 1H0WA 3FSFA 5EI8A 5KZ0A 4Z7GA 5BQ0A 3R7GA 3BLHA 2R0IA 4J97A 4J99A 2BDFA 4ASXA 3P7CA 4F4PA 4F7LA 4JLCA 2X39A 3KRXA 4KIQA 1VR2A 1ZARA 3R7UA 3RAHA 4NM5A 4U45A 3UP7A 3G2FA 4KNBA 2XBAA 2VTLA 4OBPA 3MFSA 2GNHA 3NLBA 1M2RA 4FNZA 1P5EA 2JIVA 3DZQA 4NIFB 4O27B 1JKSA 4FV6A 2CN5A 4QTEA 3QZIA 5J9YA 4LRJA 4RX8A 1VYWA 1YVJA 5CQUA 4B0GA 1Y57A 4ZP5A 2VX3A 4E5WA 4MCVA 3E62A 4IB3A 4FYOA 4AX8A 2ITVA 4TNDA 2BRNA 1LEWA 2VTQA 3FHIA 5AP1A 1UU8A 4ZAUA 3SHEA 2FA2A 2ETRA 3E5AA 3ORNA 3NCZA 3PE1A 4I5CA 1OPKA 4YGAA 5AIRA 5DT4A 3UJGA 4U79A 1XH4A 2Y4PA 1AQ1A 4WSYA 1H1PA 4XMOA 3WZDA 4XG9A 3V01A 5K4IA 3GNIB 4BI1A 4KKGA 4ZY5A 1XHAA 2XEZA 1FQ1B 2ZB0A 3EQBA 5IKWA 2OJIA 1KE9A 4EOPA 1DAWA 1U54A 3IDPA 1LEZA 4NZWB 3TZ7A 5CI7A 4L67A 2B7AA 3MVLA 3RKBA 3QQGA 5KBQA 3HA8A 3KRWA 3VQHA 4LRMA 2ZM4A 3W32A 4MQ2A 3GFWA 4D4SA 1DI9A 2CGUA 5G6VA 2VWXA 3OROA 4DGGA 1JVPP 5K5XA 1JPAA 2YLFA 4R6VA 4QMNA 4LGGA 4QMLA 3TL8A 3GC7A 2PZYA 4JIAA 4AGUA 3V8TA 2OW3A 5KBRA 4IMYA 3DAEA 4M66A 2GTMA 3E8EA 4ZTLA 4NWMA 1XO2B 4M7IA 2PL0A 2BIYA 4HOKA 1KSWA 2C6LA 3QTXA 1SNUA 4PNKA 2WQEA 4FT9A 1BUHA 4V04A 5ETFA 4YPSA 3ZLWA 2E9NA 4XG8A 4PL3A 2J5FA 3AD4A 2OKRA 4P5QA 3UVRA 2VO6A 5D7VA 5IA4A 3VUMA 5ACBC 5TKDA 5IA1A 2W1ZA 3R8MA 1SVEA 1V0OA 4NM7A 3D2KA 4M0ZA 3RWQA 1FVRA 2I6LA 4L45A 4ITHA 5M4IA 1MUOA 3DBDA 3EQRA 3NIZA 2BAKA 3RAKA 4X2JA 4ZZMA 5EH0A 5JRQA 1JSUA 1UWHA 3C13A 3LCOA 2A2AA 3W2RA 5K3YA 3QQUA 2VTTA 2YABA 3QKKA 4WNKA 4KD1A 2R0UA 2EWAA 3R8UA 3EL8A 3VBXA 4C59A 1Q3WA 5EHOA 3VIDA 4K18A 2YM7A 4ZSGA 3TKUA 2W4JA 3OW4A 3C51A 5HX6A 3MY1A 4WKQA 2CCHA 4ZSEA 2ITYA 1E1VA 3QBNA 3Q53A 1H27A 4FTLA 4MWIA 2E9OA 2WU7A 4CTBA 3U8WA 5BVKA 2R7IA 4II5A 2EU9A 3I7BA 4FOBA 3UE4A 4L44A 3FAAA 3QTUA 4AXAA 3F3ZA 3CE3A 4FKQA 1CKPA 4UWBA 2XK6A 4LOQA 4XNEA 4GJ2A 1PXOA 5C27A 4CD0A 5CZHA 4QO9A 5KCVA 3QRTA 3DFCB 4YC8A 3ODYX 3V5LA 2O64A 2XK4A 2IWIA 2C6OA 3NNUA 4G1WA 3ZLYA 3HV5A 4H58A 4HCUA 5E8SA 3LM5A 3HP2A 3SXSA 5EW3A 4DH8A 4TT7A 3BHYA 2OK1A 3ZC5A 3LW0A 3NYOA 4R7HA 3FZTA 3DJ5A 4L8MA 4WG3A 3RNYA 3OT8A 2ZV8A 2KTYA 5L8LA 2ZAZA 3KXHA 4V01A 3OG7A 1K2PA 2H34A 4S33A 5I9ZA 2X2KA 3P4KA 4KA3A 4KS7A 5E8WA 4B99A 2UZEA 4UY9A 5CXZA 4WBOA 4ITJA 3PVUA 2UZUE 3PTGA 3WZEA 5AUZA 4WD5A 1REKA 1OB3A 5ANIA 4Q9ZA 3C4XA 2GNIA 4LM5A 4X3FA 3R83A 5EHYA 5HVJA 4G9RA 4ZTSA 4MBLA 3NYVA 4USEA 2XMYA 4IB1A