4PPBA

Itk kinase domain with compound 28 (n-{1-[(1s)-3-(dimethylamino)-1-phenylpropyl]-1h-pyrazol-4-yl}-6-(1h-pyrazol-4-yl)-1h-indazole-3-carboxamide)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
264
structure length
239
Chain Sequence
SVIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDLAARNCLVGENQVIKVSDFGPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAESG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Discovery and optimization of indazoles as potent and selective interleukin-2 inducible T cell kinase (ITK) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 67
structure length 239
sequence length 264
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ppbA00
5J5SA 3GOKA 1PKGA 5HICA 5HNIX 1QPJA 3LAUA 4IX3A 4D4SA 2A19B 2PY3A 4Z3VA 3GI3A 4MNEB 4RIOA 4C2VA 4CYJA 2ZB1A 4EKKA 5JGBA 1PMVA 2X0GA 3CJFA 3RVGA 5FDPA 4BTKA 5KMIA 3MH3A 3PJ3A 4QP8A 3IW7A 3L8SA 4UV0A 4EONA 2YDKA 5G6VA 2QHNA 2OH0E 3EYGA 1KOAA 4NWMA 2IWIA 4AACA 3PIYA 4D0XA 5BMSA 3EKNA 2C3LA 2PE1A 3C0GA 1B39A 3I5ZA 4BKZA 1H28A 4OAVB 3ZFMA 4RMZA 3KVXA 2C68A 4UN0C 1A06A 5DNRA 4D2WA 3PJ2A 3FZ1A 3R7IA 1UU3A 2GS6A 2X4FA 2QOQA 3WZJA 2X1NA 5AR2A 3REPA 4DTKA 2P0CA 3E7OA 4UX9A 2J0LA 3KULB 1CMKE 2ZOQA 4I5CA 3PG3A 1YOLA 3AC1A 3QCQA 3HYHA 4RIYB 4II5A 4BN1A 3QYWA 3NZ0A 3O2MA 5AUXA 4QMOA 3KK8A 3CPBA 4BBEA 1WVYA 2QHMA 4RWKA 1M7QA 3QTXA 3AGLA 2A2AA 4FL3A 4FSNA 3QYZA 4J7BA 4HCTA 4BDIA 2ZDTA 3VUDA 2PSQA 2HIWA 3CEKA 3P1AA 4FYNA 5HVYA 3W33A 4DEBA 1OL1A 4JBPA 4EZ7A 3D5UA 1CKPA 1UKIA 4FL2A 3VHEA 4N6ZA 4YTIA 3F9NA 2ITQA 3MW1A 2QKWB 4AE9A 1FMKA 4EYMA 3E93A 3E63A 2A27A 5HD7A 3GCVA 1TQPA 4GFMA 4TL0A 4YGAA 1Z5MA 4FT3A 5I9VA 3P5KA 4W4XA 3CP9A 2G1TA 3UOJA 5LOHA 2JKKA 4KABA 5FDXA 3OY3A 3EFLA 3EQHA 4RC2A 1XHAA 2NRUA 3CJGA 4A9UA 4JX3A 4FT9A 2WTIA 2YAKA 4F7NA 5KBQA 5EFQA 3RK9A 3UQFA 4YC6A 5L6PA 5E90A 4V0GB 3AT4A 3ZC6A 2X7OA 5KX8A 2OIQA 2YIQA 3FHRA 5AV4A 2ITOA 3GCQA 2XMYA 4RVLA 4TYHB 2ETMA 5HCZA 4W9WA 4G16A 4AQCA 3TTIA 4NKSA 3SXSA 5I3OA 3NNUA 3FXXA 4K18A 4GFGA 2XBJA 3TV7A 4FUXA 4YZCA 3TZ9A 3BI6A 2F2UA 3UOLA 4C61A 5HHWA 3D7TA 4EK3A 2PL0A 4NTSA 3TCPA 2R5TA 4NCTC 4O6LA 4BZDA 5KCVA 3NUPA 3PZEA 2QLQA 3HGKA 3R7EA 2PZYA 5GZ8A 4AT5A 2J50A 3EHAA 3MIYA 4MAOA 3W1FA 1ZOHA 4GV1A 4N4SA 3JY9A 1YXUA 5AADA 5IMEA 2OJ9A 3PVWA 4IZYA 1GZOA 3MVLA 3VW6A 4EH8A 3F88A 2W1DA 4QMQA 3LCKA 2X2MA 5GNKA 4PV0A 1XO2B 2OH4A 2P55A 3E88A 1ZLTA 3Q5IA 4XBUA 2W1IA 3EQBA 3F3ZA 5DE2A 3F3UA 4YMJA 3EWHA 5CSPA 1WBPA 4KIQA 5CF5A 4EH5A 4F1TA 1SNUA 3FZOA 3W32A 4YJOA 1LEWA 2Y0AA 3Q4UA 5AIRA 2DWBA 4AAAA 2IJMA 3FC1X 3F7WA 2YM6A 3ORXA 4PX6A 4HVSA 3KC3A 1XBCA 3FV8A 4DCEA 4FZ6A 4GIHA 3QCYA 3QALE 3Q60A 4G3GA 1ZWSA 4K33A 3OOMA 4L9IA 4CZTA 3NYXA 4YJNA 3W10A 4UYNA 4EHEA 5D1JA 1P4OA 4A9SA 2CDZA 2WQMA 3VS1A 5KBRA 3AMAA 3QQFA 2UW5A 3F3WA 2UVYA 1M14A 2OK1A 4DYMA 2XP2A 2W17A 3BHHA 4Z16A 3PSDA 4XRLA 3F5GA 5EKOA 4ZTMA 4E5BA 1UWJA 2FSTX 3FMHA 4FG7A 4FKIA 3UTOA 3ZO4A 5JMSA 5L3AA 4OTPA 4L53A 1PMUA 1WZYA 4DG0E 4XLVA 2WMTA 2WEIA 3D15A 4OTHA 2BROA 4IM0A 1BI8A 1KSWA 4JI9A 4BDBA 3RHXA 2WKMA 4C2WA 4FZ7A 4IMYA 2WU6A 4B8LA 2WMWA 4D1SA 4D1ZA 2ETKA 3HX4A 3T3VA 3PXYA 3ORTA 1H1RA 4EZ3A 3CQWA 3OXZA 1XH6A 2VTQA 4TW9A 3BV3A 5AUZA 2XBAA 3L9NA 4L67A 3FMLA 1R78A 2Y6MA 4NM7A 3Q6WA 4L00A 4R5SA 4U79A 4F7JA 3DTWA 5AP2A 2Y4IC 2XK8A 1YQJA 4LV5A 4A9TA 1YDSE 2WTCA 2XNPA 4HPUE 4BWKA 2Q0BA 5K4JA 2OG8A 3FY0A 2UZVA 1OKWA 1OPLA 3SAYA 2YDIA 4WBBB 3IQ7A 4BWPA 2XK7A 3P4KA 1KE8A 2YACA 3B2WA 4AWIA 4EK4A 1HOWA 3UZTA 4YUQA 5J1WA 1DI9A 2I6LA 4DHFA 5AUYA 4YJRA 3R9HA 1YHVA 4AGDA 4ZTHA 4FNYA 2X81A 2FVDA 1IRKA 1UNLA 3M2WA 4LM5A 2B9HA 1X8BA 3QQJA 4FNXA 4GK2A 5GZ9A 3RI1A 4L43A 3TL8A 5JQ8A 3QZGA 5HLWA 2OI4X 4WA9A 2AC3A 3PVGA 2PVNA 3QGYA 3SLSA 4FKWA 1MRUA 4CTCA 3ELJA 5IMXA 2UZOA 4PL3A 2VWWA 4B0GA 4AA4A 2PMIA 3TZ7A 4CYIA 4AZFA 2J4ZA 3P23A 4F64A 5C8NA 4IB1A 1IA8A 3MB6A 4D5KA 2AUHA 4ASDA 4XX9A 4BCGA 2Z7QA 1SVEA 4FSTA 5C8KA 1BYGA 2VTTA 3BIZA 4IJ9A 3E3PA 2ZVAA 1SNXA 2ZDUA 3BBWA 3FBVA 3QUPA 3IDBA 3QX2A 4PDPA 3U87A 5CAUA 3ALOA 2R3GA 3OMVA 4LRJA 4FKUA 1B6CB 3SX9A 2E9UA 4F99A 1SZMA 5DA3A 3HL7A 3FQSA 4EC9A 4JRNA 1UU9A 2VX0A 3NUYA 3AD5A 4W9XA 3GB2A 3HMPA 4QPMA 3VQUA 3MI9A 5TT7A 4TWCA 3FMJA 3FPMA 4HGLA 2WQOA 4O21A 3TACA 2BAQA 3O96A 4TN6A 1UWHA 4XV9A 4QP9A 3WILA 1S9JA 3G0FA 4LMUA 1YW2A 3OWPA 4XG3A 3COKA 2PE2A 4P5ZA 5JK3A 1PYXA 3BELA 4C4HA 3P86A 3O71A 4ALWA 4PPAA 5K4IA 4BKYA 4MXOA 4PMTA 4KIKA 4AZWA 5HG8A 4BHZA 2Z7RA 4TTHB 3E5AA 4I94A 4WG4A 5CU2A 5CAQA 4O1PA 4FUYA 4X2JA 2VU3A 2PVFA 4ITHA 4X3FC 3KRLA 3R7GA 5AUVA 4FV5A 1GJOA 3FLSA 4BTFA 1QPEA 4FOCA 3PA5A 3UE4A 1JKLA 4H1MA 4RVTA 4ARKA 1YOMA 3F5PA 4BYIA 4L44A 2I0EA 5ANDA 2IVTA 4QNYA 2HAKA 3BEGA 4GT4A 5EI2A 4JT3A 2NRYA 3DJ5A 2WU7A 5JGAA 1PMNA 5A6NA 3AD6A 3G9NA 3MA6A 4IB0A 3GU4A 3WYYA 4EH6A 4NFMA 5DMZA 4Y8DA 3MY1A 4GG7A 3T9TA 3VHKA 3V8SA 2PZPA 4R7IA 5KE0A 2ITTA 4FA2A 2W05A 3CIKA 2ZM4A 3VF9A 4H3PA 4AOTA 3CBLA 2WHBA 3ZEWA 1Q41A 1OI9A 2VNYA 2XCHA 4JDKA 4WNKA 4CKJA 2P2IA 4AGUA 3BGZA 3P08A 4HNIA 3E3BX 4RWIA 4KWPA 1LUFA 3A99A 3BWJA 2R3NA 2QVSE 1KWPA 4LV8A 2UZWE 4CZUA 5EM6A 3LE6A 3BWFA 2XYNA 5F94A 3I79A 3ZC5A 5D7AA 4I24A 2OJGA 2ITUA 2SRCA 1XH8A 4I93A 3MFTA 4XRJA 5TO8A 1EH4A 1YHSA 3IW8A 4G5PA 4MWIA 5HE2A 3O0GA 3QTZA 4O96A 1YVJA 5AV2A 4KKHA 4X2NA 5BVOA 4BRXA 3RJCA 2WMBA 3HDNA 3QD3A 5HNBA 3VUKA 2R3KA 3PY0A 4RPVA 3TIYA 3PIXA 3DNDA 4ZJIA 1G3NA 4USEA 4FSYA 1KV2A 1VJYA 1U5RA 1P4FA 2GTMA 3B2TA 4RC3A 4IDTA 4DGLC 4O2ZA 4QTDA 5GJDA 4IJPA 4F6WA 4CFVA 3FZRA 3FZTA 2QURA 3R02A 2OZAA 3QX4A 4PDOA 3IW6A 5E8VA 4LOPA 2Z7SA 4ZEGA 3VRYA 3W16A 4YTFA 5K5XA 3FLZA 4KS8A 3DKFA 3R22A 4B7TA 3LIJA 5HTIA 5ACKA 4BCHA 4PNKA 3KRRA 4WRSA 3DJ6A 4K6ZA 5LWNA 1BI7A 4S30A 4ZZMA 3R7VA 1GY3A 2YAAA 5EM8A 3NPCA 3ZO2A 4N0SA 4D4YA 3JUHA 3KEXA 4A06A 4GT5A 2J0MB 3AC2A 2JC6A 4ZTRA 4Q5EA 4EH9A 4UZHA 2BMCA 4I6BA 4DEAA 3VJNA 3DOGA 3ETAA 2X9FA 4RFMA 4P2KA 2PVMA 4MD9E 4F0FA 2WNTA 2UVZA 2X6EA 3C5UA 3Q9XA 4IZ7A 4RWJA 2J0KA 4X7QA 5IDNA 1PXOA 2VGOA 4CTBA 1OZ1A 3VUTA 2JIUA 5L2SA 3W8LA 5KZIA 3U6HA 2UV2A 3OWLA 1OITA 3GNIB 4L45A 1NVRA 2XKEA 2HZ4A 4JBVA 1LPUA 2CMWA 5M57A 2CGVA 2V22A 3NYOA 3Q32A 4G6LA 4XBRA 3ZUUA 3MWUA 1PXLA 5TE0A 2YCSA 5AEPA 2A4LA 4QP3A 1ZOEA 4HGTA 1IASA 1PXJA 5CWZA 3RMFA 3D2IA 4YLJA 2E9NA 2UZTA 4GG5A 5HO8A 4IWQA 4KKGA 4G3CA 1JSTA 3DXNA 2C69A 4ENYA 1M52A 4KRCA 4JL9A 2UW7A 3UC4A 3IECA 2QODA 4FIFA 2HY0A 5HNGA 5IKWA 4ZTSA 2OF2A 5EOBA 4I4FA 2UZBA 4PRJA 4P7EA 1VEBA 3ZZWA 4AS0A 1J3HA 1JKTA 3BHUA 1O6YA 1OVEA 4FK3A 2UVXA 5CF8A 5A4CA 3MFRA 2FSMX 3MYGA 5HLPA 3NS9A 3TKHA 2HZNA 2W1FA 2WTVA 3TI1A 2W1GA 1O9UA 3S1HA 3N9XA 4CVAA 3BBTB 3TN8A 4IEBA 2OZOA 2OICA 4QP4A 3C50A 3QZFA 4HYSA 5DOSA 2J9MA 4IACA 4D2RA 4CKRA 5IA2A 4BWXA 3I7CA 3TUBA 3ZRLA 4I92A 1PYEA 5AV0A 3PXKA 5DLSA 4BCKA 3AG9A 1Y57A 3Q52A 5AP7A 3ZDIA 4LFIA 3FKNA 5JFXA 2FH9A 4FVRA 4E7WA 5IEXA 1H00A 4QP6A 3A8XA 2IN6A 2X9EA 3FKLA 4ZK5A 3WF6A 2H9VA 2WMUA 3P7CA 3R7YA 2BAKA 3TIZA 4ALUA 3HRFA 3QTSA 4CD0A 4QQCA 5HBEA 2VAGA 3MTLA 3QC4A 5E8SA 1KE7A 2V5QA 2OBJA 4NJ3A 3SOCA 2HXQA 5AR3A 3MH0A 3NCZA 4J8NA 3JY0A 2BCJA 5EOLA 4BGHA 3RGFA 4QQTA 2PHKA 4FNZA 5EDRA 2ZJWA 4APPA 4E3CA 4EI4A 4PY1A 3WIKA 3LFBA 3DKOA 1MRVA 5HG7A 3EQFA 3CXWA 2QOCA 2W5BA 3IPHA 2B54A 3JVSA 3ANRA 5HIBA 3LCTA 4C7TA 5M44A 3RM6A 3VS4A 4IC8A 3RAIA 3R8VA 3MGYA 1E1VA 4EOQA 4EQUA 4LL0A 5FEEA 3RALA 4NH1A 5C9CA 5DT3A 3RWQA 2W7XA 4IX5A 3PJCA 4QTCA 4BHNA 1FPUA 4BI0A 4QTEA 3RK7A 3NIEA 1DAYA 3MVJA 3KN6A 5L6OA 4M67A 4F0IA 4HGEA 4YJQA 3R8PA 3R2YA 3NX8A 2QOOA 3G33A 1MUOA 3OW4A 2O8YA 4MCVA 5DR2A 3GU6A 3HUCA 2I0VA 4G3FA 3H4JA 3NR9A 4FZFB 5BVDA 2X7GA 2B55A 5DT0A 1H1PA 4BDAA 4I0RA 4XYFA 3ORKA 4NM3A 3CS9A 4NW6A 5B7VA 3AT2A 3NRMA 3KF4A 3BYVA 3DBDA 3EN7A 4FL1A 4G3DA 4RX7A 2J6MA 5HQ0A 3WF8A 4RX5A 2O64A 4I0TA 3DZQA 4OTFA 5DN3A 5D11A 1OM1A 3RPOA 5DRDA 4E26A 4C59A 2H96A 5A9UA 5F4NA 5AP5A 4AZSA 2BZIB 4KSQA 4UMPA 4FTOA 1R0EA 2B1PA 2B4SB 2RFEA 3Q4TA 2WIHA 3EYHA 2NO3A 3ORPA 4AW2A 2Y8OA 4M66A 3NGAA 4OTIA 4GJ3A 4IAZA 4R5YA 4MNFA 4KSPA 1YXTA 2P3GX 2XRUA 4JG8A 3K3JA 1F0QA 3HRCA 3CKXA 2IO6A 4MX9A 3LJ2A 4Z7GA 4S2ZA 2PE0A 3E8NA 4BIEA 4Y83A 3ZH8A 1H26A 3PY3A 5LCKA 1ZMUA 5J7BA 3UPZA 4QMVA 3GBZA 2G15A 4E8AA 3A7GA 3QRJA 2XNEA 5JT2A 4QP7A 4U5JA 1WVXA 4BI2A 4GIIA 4UZDA 3FZSA 5DFPA 3MPTA 2WMRA 4ZZNA 4J71A 3CD8A 3ULIA 3D94A 1GZKA 3FSKA 3QZHA 4G17A 2C6TA 2VWUA 2UW3A 1ZXEA 4K0YA 4D1XA 2VWBA 3R9NA 4IW0A 3F66A 3BZ3A 3BYSA 3IS5A 1O6KA 2QU6A 4OLIA 3QU0A 4QPSA 3BLHA 3DLSA 1OL6A 2VTPA 3H0YA 3R28A 3MH2A 4HYUA 4K9YA 4XCUA 4Q5HA 5EDPA 2YDJA 1OIYA 3FMDA 3JS2A 2FO0A 3TNIA 5IH6A 3OD6X 1VR2A 4GUEA 3UVPA 3QCSA 1BL7A 3PVBA 3W2SA 5CVHA 3G6GA 1NVQA 3QD0A 2F49A 4UYAA 4H58A 5EHLA 4AX8A 3PA3A 4ANBA 4M3QA 2V62A 4CKIA 3QQUA 2VX3A 3GU8A 2C5XA 3IGGA 3LFAA 4O38A 3OF0A 4DC2A 2XJ0A 2BZKB 4RQKA 4M12A 4WNOA 4Y5QA 3GGFA 4YC3A 4F6UA 3DK6A 3SXRA 4EUTA 2EB3A 3O8PA 4Y95A 3BU5A 1R39A 3HZTA 4QMLA 4G1WA 3VIDA 2JGZA 3WZDA 3SVVA 4BC6A 1ZOGA 2WD1A 4KAOA 4WT6A 3MN3A 4K2RA 2VN9A 4EQCA 5J9ZA 2ESMA 2G2HA 2VWIA 2H8HA 3LXLA 5AAEA 1YDRE 4OT5A 4ACDA 1YXVA 2PVYA 3G9LX 3BU6A 3DA6A 3F3VA 5AV3A 3ZUVA 3H30A 5B2LA 2UZLA 3TKUA 4IWPA 5JZJA 2C5YA 4NK9A 1JOWB 4LOOA 3DLZA 4CMUA 4C0TA 3ERKA 2XB7A 3OROA 4QRCA 4ALVA 4EBVA 3MSSA 4CMOA 2GNGA 3P9JA 2RFSA 2IVUA 3ZRMA 1H08A 3UDBA 2GHGA 5JFWA 4F7SA 4CCUA 3VBTA 3R2BA 3R01A 4CEGA 3HMNA 4KRDA 2WTJA 5KHWA 4OTDA 3PXZA 2BUJA 4FV4A 4L7SA 4FGBA 4BDCA 4RZVA 5A54A 3DAKA 3VBYA 2ITYA 3KXHA 3UIXA 2PVHA 4DH7A 1V0BA 1U59A 3KRWA 3QQHA 4LUDA 3D2KA 4WOVA 4XOYA 1ZYCA 3TV6A 2G9XA 4BL1A 5FXSA 4YBJA 1W84A 1YHWA 4I22A 4F63A 1NXKA 3UODA 4HVGA 1U54B 5CSWA 4WO5A 3SRVB 5IH4A 1OL7A 2XEYA 2J7TA 4FV9A 2BRGA 4XG6A 3OT8A 2RF9A 2QC6A 4U0IA 4NKAA 4CCBA 1XQZA 5L4QA 3DK7A 4I3ZA 4QMUA 5EHOA 1SM2A 2JDOA 3NNXA 3VULA 4V05A 3LFEA 3FY2A 3W55A 5EKNA 4QYEA 3NW5A 2VO7A 1Y6AA 5A4EA 4IE9A 5LJJA 3QTQA 5HZNA 2OJJA 3LXPA 2UZUE 4QMSA 5CY3A 3WZKA 4ZSLA 5HLNA 5AM7A 5IA0A 4DH8A 2O63A 3DBFA 1NVSA 2R3HA 5JFVA 4J96A 5ANKA 2YIWA 3QTIA 3GC9A 5DR6A 3UMXA 4AE6A 3W2CA 3PE2A 1H24A 4M0YA 3EN5A 3LQ5A 3FLWA 1AD5A 3COIA 1Q97A 1SMHA 4EUUA 4IX4A 3U4WA 4FR4A 3NUSA 4F65A 4N70A 2XK9A 4QNAA 3FLNC 2LAVA 3ULZA 3O8TA 2W4OA 2XJ2A 2NPQA 4TYGA 4OR5A 4YZBA 3V5QA 1BLXA 3SDJA 4JQEA 4XS2A 1Y8GA 2VWZA 2UW8A 5IPJA 4XG7A 5FEQA 4ZSJA 4RJ7A 4AA5A 1OL2A 4BZOA 1G5SA 2WQBA 1PXMA 2UZEA 3E8EA 2HZ0A 4BDDA 2P4IA 3AC4A 3I6WA 5AUTA 4EHZA 4JG6A 4FTJA 2FSOX 2E9OA 4ZAUA 5H8EA 3G0EA 2CKEA 3IO7A 2J0IA 4YZMA 5L2WA 1ZRZA 2B9IA 3EZVA 4RIWB 1PKDA 4WRGA 2ZAZA 4BBFA 4I0SA 2CCIA 4RJ3A 5I9UA 4L52A 5E1EA 5ANOA 2ZMCA 4UWCA 3ITZA 1JKKA 2UW6A 2YJRA 3VN9A 3TUCA 3ZSIA 5AMNA 2OWBA 3R1QA 3S00A 3OCSA 4JLCA 4P5QA 4RA5A 4I6FA 5EG3A 2J5FA 3QKKA 1P2AA 4QMYA 4A4XA 5I5ZA 4GFOA 2V55A 3FWQA 4QMWA 4U43A 4ACMA 3QXPA 4E4MA 1NY3A 3FC2A 5HG5A 3FI4A 3DK3A 2WFYA 5IUIA 4TT7A 3BYOA 3PTGA 3QRTA 3DCVA 5A46A 4RLKA 5FXQA 4FSQA 1VYZA 4I23A 4KB8A 4L68A 4D2TA 5HORA 1JLUE 2B7AA 1XH9A 4UBAA 2JBPA 3D5WA 3DNEA 3CLYA 4OTWA 1DS5A 1OGUA 3IDPA 4GVAA 5BVNA 1FVRA 5CYIA 3KXMA 4G9CA 5AM6A 4JNWA 3GCPA 2H6DA 2RG6A 3PSCA 3WARA 3M11A 2CHLA 3PWDA 3QCXA 2J51A 3F6XA 3GCSA 3O7LB 3WF9A 5HX8A 2YM3A 3W18A 5JZNA 3JYAA 2HZIA 2PZRA 2W1HA 1UNHA 5CT7A 4EORA 4JIKA 5HIDA 2GNFA 3OC1A 3Q9ZA 2OIBA 4QMPA 4OW8A 1UU8A 4XLIA 5AWMA 5KMNA 3KL8A 4QP1A 4QPAA 3EN6A 5ANEA 1QPDA 3V8WA 5DBXA 3QLFA 3RAHA 2GS7A 4Q9ZA 3NCGA 4PTGA 5J8IA 2ONLC 3QRUA 4M8TA 1YXSA 3CC6A 5AX3A 5FRIA 1XH4A 4Y5HA 1TQMA 3LFNA 3OS3A 5DT4A 3S95A 5BQ0A 4JBQA 4UWBA 3OY1A 2O3PA 4BYJA 4UXLA 3ZSHA 1UU7A 3U6IA 3GVUA 3OWKA 3MY5A 3T8OA 4G6OA 5FM2A 1XJDA 3O17A 5AP6A 4L3JA 2QLUA 3I0QA 4IX6A 5IH5A 4D58A 5HI2A 2VTIA 3LM5A 4YTCA 3EH9A 3CQEA 3HV4A 1GOLA 1PXKA 4NM0A 4YHJA 1ZYDA 2Y6OA 4X3JA 4X3FA 2R9SA 4BDHA 2BR1A 1FINA 1I09A 4FTAA 3F2NA 2JKQA 4IANA 4W8EA 5BYYA 3U6JA 3B8RA 1ZYLA 2R4BA 4H3BA 4O0TA 2PVLA 4H36A 5LVNA 3NEWA 3KVWA 3A7HA 1H27A 2GNIA 4YLKA 2FUMA 4U41A 3PE1A 4DLIA 3VBWA 3BYUA 2R3RA 4U3ZA 5A14A 2QU5A 2VWVA 5JFSA 3FMNA 1JPAA 4EOMA 3MJ2A 3EQPA 3AMYA 4RC4A 1CM8A 4U3YA 4QQJA 2W1EA 1WBSA 4IWOA 5BUEA 3ZMMA 5HU3A 4IXPA 4M69B 3ZM4A 5CSHA 5AJQA 4FG8A 4MQ2A 3IG7A 3R00A 4P4CA 3DFAA 5M4FA 1WBTA 1UV5A 3PSBA 3A62A 4FTCA 3UYTA 3GU7A 3DB6A 2ITNA 4IDVA 4R3CA 5FLFA 4ZY4A 1H0VA 5DWRA 3MS9A 2FYSA 3MY0A 5IA1A 4QMXA 5AX9A 2IW6A 4PTCA 4CFMA 2FA2A 2QOLA 5AR7A 2JIIA 1OIUA 1FVTA 4L42A 3ZBFA 4ACGA 4MBIA 3GCUA 2W0JA 2YCFA 2XM9A 5T68A 4DH1A 1H4LA 2WXVA 3HDMA 5CQUA 3PA4A 1JAMA 2JFLA 2R3OA 3GT8A 3VW8A 4EQMA 4FNWA 1OKYA 3C7QA 4NTTA 4AFJA 3EFKA 3VNTA 2C5NA 4EK6A 4J99A 3F2AA 2JKOA 3ZU7A 3RP9A 3Q4ZA 4FKRA 1J1BA 3L8PA 4MQ1A 5CX9A 2WMAA 3H9FA 3HLLA 3UG2A 4RIXB 2GHLA 2R3MA 5CAVA 3OP5A 5CEMA 4WHZA 5JGDA 2GU8A 4I4EA 3RPVA 4EH7A 2HXLA 2W4JA 4WG5A 2QKRA 4YZ9A 4CLIA 1JNKA 1ZZLA 4ZSAA 4MK0A 4RLLA 4M7IA 3POOA 2BZJA 4BTJA 4DAWA 3SOAA 2CGUA 1Q5KA 4MXAA 3L1SA 3C9WA 3PPZA 4L3LA 4DN5A 3O8UA 2XIKA 2O65A 2F57A 2W9ZB 2F7ZE 1W8CA 3QWKA 2HELA 4FIIA 4H3QA 4F0GA 3U8WA 5J95A 5CNNA 1URCA 1OUYA 4CFUA 5FG8A 3PP0A 4RX9A 4V01A 3ZXTA 3ZO3A 3FE3A 3KRXA 2RGPA 3NAYA 5E8XA 3NNVA 3KMUA 5D10A 4RBLA 4X2KA 3ZOSA 2XYUA 3QFVA 3QTRA 4RA4A 3QA8A 1RDQE 3TJCA 3TWJA 3V5WA 4IAAA 5LARA 4GK3A 2KULA 4NIFA 4E73A 1DM2A 3H10A 3NYVA 4TYEA 4GRBA 5H8GA 3G6HA 4YPDA 4O91A 1H25A 4C4FA 1M7NA 3EL7A 4MF1A 3I60A 1UNGA 2YISA 3BHYA 3PFQA 4MNEA 5CU6A 4C35A 2HWPA 2XIRA 2OU7A 4OUCA 2J0JA 5LMKC 4PQNA 4L01A 4RZWA 5EM7A 2RL5A 3QRKA 5BX0A 2X39A 2WB8A 2YM5A 3ZXZA 2YIYA 3WZUA 3CTJA 1XWSA 3LQ8A 3DTCA 4FSMA 3RCDA 5M4IA 3COHA 4FI1A 3L9PA 5TKDA 3GEQA 3SC1A 3KKVA 5TR6A 4BI1A 4E6DA 1J1CA 4LUEA 5EYMA 4J97A 4AW0A 3KULA 3N51A 4FZAB 2WO6A 4WUNA 2PVJA 1L3RE 2C4GA 2EXMA 4K11A 4UEUA 3UC3A 2WMVA 3VAPA 4FODA 1FOTA 3CR0A 1STCE 4YPSA 3DT1A 2QONA 3OXTA 4RIYA 4WKQA 5ANJA 1OL5A 2JBOA 4HZRA 3QAME 3CCNA 3AMBA 4J95A 4XNEA 2CGXA 3UQGA 3V01A 2IVVA 4IB3A 3VS5A 5E8YA 3D5VA 1KE9A 5L8LA 2GCDA 1XBBA 3Q9WA 5FEDA 4HVIA 1M2QA 2BIKB 4R3RA 4XP0A 3R73A 4BCJA 4FKGA 2RKUA 2X7FA 3G51A 3GQIA 4FTNA 4FC0A 4J53A 4YO4A 4OBPA 2FGIA 4EL9A 3KY2A 2BRHA 2BKZA 1PXIA 4L8MA 3ZRKA 4ZJJA 2PZ5A 3MJ1A 3DBQA 4CLJA 5LMBA 3AT3A 1XR1A 5FWKK 1PW2A 3A7JA 2R0UA 4FSUA 4Y72A 4MYGA 3VUHA 4C3RA 3II5A 4BGQA 1BUHA 4FKPA 4JVGA 3KMWA 2G2FA 3PY1A 2GSFA 5BVKA 4EEVA 4HVDA 3KCKA 4PL4A 3CPCA 4I20A 4IB5A 4LQMA 4YR8A 5KMLA 3Q2MA 2CSNA 5F20A 3SW4A 4HZSA 1YWVA 3FUPA 2KTYA 4V0GA 4DBNA 2BIYA 4MD8E 3DDQA 4MXCA 4TYHA 4YJTA 3ENMA 3E7VA 3OUNB 2VO3A 2JKMA 3I7BA 5L2TA 2VV9A 5C26A 4KIPA 4DGNA 5EW3A 3D7TB 3TZMA 4ZSGA 5LVMA 2O2UA 3F3TA 4FV1A 4O6EA 5AR5A 1OPJA 4F7LA 4U44A 3QQLA 5KKRC 2B9FA 4N6YA 2HK5A 1B38A 3UO4A 5J9LA 1OKZA 4IQ6A 4BBMA 1KE5A 5CEIA 4FTUA 3OFMA 2BZHB 3V04A 5LWMA 1OECA 3GP0A 4O0UA 3R7OA 3MTFA 3TV4A 2DQ7X 3C4FA 5I9XA 2YN8A 4BCIA 3U4UA 4U42A 2HWOA 4M84A 3BU3A 2IW9A 4LL5A 3TUDA 3ORLA 1K9AA 3BLRA 1LR4A 4APCA 3L8VA 1PXPA 2XK3A 3CE3A 4C36A 5C01A 3ZLWA 4O0XA 3TZ8A 4DG2E 3HMMA 4D5HA 1YI4A 3QKLA 4LRMA 4ID7A 5DG5A 3FYKX 3V6RA 3KQ7A 3O50A 5B0XA 3ZSGA 1FVVA 4GS6A 3ZLYA 4F70A 3ZBXA 3QBNA 3ZS5A 5FTOA 2BRMA 2OFVA 3VS7A 4C3PA 1Q99A 2WOUA 4IVDA 3BLQA 4Q9SA 2BTRA 5CEOA 2R3JA 5HX6A 1APME 3BGPA 3ZZEA 2C0OA 3JXWA 1Y91A 1YXXA 3LMGA 3PP1A 4XV1A 4PWNA 4XMOA 4C62A 4C37A 2GPHA 2VO0A 3C4WA 3K5UA 4E4LA 3LCDA 4R3PA 2BDWA 3ACJA 5E1SA 5ACBC 3UNJA 4LGGA 3Q96A 4GYIA 2WQEA 1XH5A 3ODYX 4Y73A 1W83A 5ETFA 4EOPA 2ERZE 4F9AA 4FT5A 3H9RA 4DEGA 1JBPE 3OVVA 1YDTE 1GIHA 2JDSA 4NJDA 3WYXA 4BKJA 4MKCA 1RE8A 1QCFA 1RW8A 4FTKA 4R6VA 1H1QA 2F4JA 2QNJA 2XNOA 4JAIA 4F08A 4M68A 2EVAA 3RAKA 3Q04A 3PPJA 1ZMVA 5HE3A 2WTWA 3DKGA 1Q4LA 4ASXA 3QHWA 4DGOA 4S31A 5GHVA 3VS6A 3PVUA 1W7HA 4FMQA 4TZRA 4OTRA 2R3IA 5CEKA 3D0EA 4R1VA 3E8CA 4BDEA 2Z2WA 4RT7A 3ZONA 4FOBA 2C3IB 2QCSA 3ZFXA 1Z57A 4TKSA 3I1AA 2PUUA 4C3FA 5ANIA 5CEQA 3VUIA 2Z8CA 1PF8A 5DVRA 4EH3A 5A3XA 4H1JA 4WSYA 1ZYSA 1WBOA 4NW5A 5D12A 4YSMA 5C8MA 3PJ8A 3TNWA 4U9AA 3FI2A 3FKOA 2X8IA 2OFUA 4J98A 2VRXA 4AZTA 5AA8A 4WNMA 2WEVA 4UMUA 3F69A 5KMMA 2B53A 2XK4A 3OW3A 3U9CA 3MFUA 4HOKA 3KK9A 3MPMA 2VX1A 4QQ5A 5KUPA 2YIRA 3VF8A 4AGCA 3AC8A 4TWOA 4BFMA 2VTNA 4GYGA 3WE8A 3SA0A 4YBKA 5HKMA 2HENA 2QQ7A 4O0WA 2XNBA 5I9WA 2YABA 3EFJA 1W0XC 5L8KA 3OTVA 4XHKB 4QO9A 5AAGA 1IEPA 4EOLA 5CEPA 3PXFA 4QTBA 2VUWA 3K3IA 4EHVA 2I1MA 2F2CB 2BILB 2Y9QA 3I81A 2C6IA 3R71A 5CTPA 4BDGA 3FPQA 5K5NA 3C0IA 4O0YA 1CDKA 1Q8ZA 5BVFA 5IA3A 4B4LA 2C6DA 2HY81 2ZV7A 2X4ZA 3P7BA 4JAJA 3FXZA 4F4PA 4PP9A 4ACCA 3D9VA 4FF8A 2XIXA 3SW7A 4JS8A 2QOFA 4D55A 2EXCX 5KMOA 2HW6A 4YHTA 2YEXA 3BX5A 2GFCA 4I5HA 3UG1A 3NAXA 4ONAA 3LFDA 3Q6UA 4O0RA 4OTGA 3HMOA 1MRYA 4LG4A 3CGFA 3VBXA 3LJ1A 3ORZA 5B2MA 4FG9A 3A2CA 4TYIA 5L2QA 3NLBA 3MH1A 4ERKA 3QLGA 4USFA 5J9YA 4NEUA 2BDFA 1OUKA 4BCNA 2C6KA 5CASA 3ZTXA 2JDTA 3L9MA 3OBJA 1Y6BA 3DJ7A 3I4BA 3ZLXA 3VWAA 4JDJA 3IW4A 3ENHA 3R6XA 2CGWA 2ZB0A 5BUJA 3HKOA 2IZSA 3M42A 2JD5A 4J1RA 3R8LA 2C6EA 3GUBA 4I5MA 4M14A 3HECA 3QTWA 4KIKB 4QYHA 3OT3A 4CQGA 3HP5A 3LHJA 3Q53A 4FKVA 5HO6A 3ZO1A 1LEZA 3KXXA 5HD4A 4MXZA 5AR8A 3W8QA 4S34A 1ATPE 2BAJA 4WSQA 3UVRA 3VUGA 5TF9A 1T45A 4Q2AA 3HA6A 1Q3WA 4QD6A 5EDQA 1YWRA 2E9VA 4RFYA 1UVRA 3AGMA 4FBXA 4RJ4A 4YJSA 2C30A 2YCRA 2G2IA 5BYZA 2P2HA 4IVBA 3EFWA 4U6RA 4BCOA 2Y4PA 2WELA 3QXOA 3QL8A 1FQ1B 1KV1A 3FMKA 5BNJA 5DR9A 3LPBA 2GDOA 4GU9A 1YI6A 2ZV2A 4X0MA 3LCOA 2R7IA 3IW5A 4IAIA 4O27B 4RVKA 3R9DA 2RFNA 3VS3A 4C02A 3TNPC 5LVLA 1TVOA 4A7CA 4U45A 1Y8YA 2VGPA 4OTQA 4DFLA 5E8UA 3D14A 4RJ6A 1CKIA 2WOTA 4OBOA 3UOHA 5LVPA 2XM8A 1VZOA 1QL6A 3QZIA 3HUBA 4UB7A 4ZY5A 3TNHA 2XIYA 1U46A 5AP0A 3HEGA 3UQCA 5ETAA 2WTDA 3S3IA 4C33A 4S32A 2HCKA 4FV6A 3I5NA 2ZMDA 2QD9A 4LMNA 5CS6A 4BDJA 4EOKA 2C6MA 2GS2A 4IFCA 3BV2A 4LOQA 3V8TA 4USDA 2XVDA 1R0PA 3Q9YA 3GU5A 4JQ7A 1ZYJA 3DGKA 5IG1A 4HPTE 3KXGA 2QOKA 3VVHA 3COMA 3MVHA 4NCTA 2OF4A 2JDVA 3VUMA 4X2GA 5KKRB 5CU0A 4ZOGA 4EK8A 1PJKA 4O0SA 3NUXA 3OXIA 4CXAA 3IKAA 3LM0A 4AW1A 2CJMA 5B2KA 2CN5A 3PXRA 4XH6A 5J87A 4B8MA 4D4VA 4B9DA 2OIDA 5J1VA 4FV7A 5H3QA 2F9GA 5CT0A 4BICA 3QTUA 3DAEA 4IIRA 2I40A 4U97A 5HOAA 3WF5A 3KCFA 3AC5A 3EN4A 3QKMA 4CSVA 5HU9A 4RVMA 3TEIA 3DPKA 3O7LD 4QTAA 5CVFA 4FVQA 3DS6A 2OZAB 3ORIA 4U8ZA 4WD5A 1YI3A 3WZEA 4BB4A 1VYWA 3RPYA 3PIZA 2X2KA 5IA5A 2FSLX 4GVJA 4I5PA 3MV5A 5JEBA 3E87A 4FTIA 5M56A 5AP3A 3E8DA 4R8QA 1FGKA 2JLDA 1V0PA 4X6QC 4NZWB 1Q8UA 2GMXA 3MDYA 4UMTA 1E9HA 3AD4A 4LYNA 3V3VA 3MB7A 4NM5A 3SQQA 3KN5A 2OXXA 5IUHA 1TQIA 3A7FA 3P7AA 4BCFA 4E5WA 2PWLA 4E5AX 4AZEA 5KMJA 5HBJA 3H3CA 3MA3A 3PRIA 3FQEA 3NIZA 2WTKB 3KB7A 3SD0A 3P0MA 5C27A 4DITA 3I6UA 1SVHA 2X2LA 3PXQA 5FD2A 5IEVA 3M1SA 2VTAA 5LCJA 4K8AA 5E8WA 1S9IA 4HYHA 4EWQA 3SKCA 2YLFA 2XIZA 2XJ1A 3QD4A 4R1YA 3UJGA 4AU8A 1GIIA 4MTAA 4RSSA 3POZA 4L46A 4UWYA 5EI8A 3RM7A 3TXOA 4AT3A 1RJBA 2C5OA 3K5VA 3ORMA 3PJ1A 4CNHA 2EU9A 4MVFA 3H9OA 4LGHA 4BIDA 4OAUC 4EOOA 2GNLA 3U9NA 3D83A 3LXKA 4EKLA 4I41A 3LLTA 4ZTQA 3R8UA 2OXDA 4FTQA 2XKFA 3DBCA 1CSNA 2C5VA 3F5UA 5KHXA 4G3EA 1F3MC 4H39A 3EQRA 4A9YA 5FQDC 4FIHA 3HRBA 1GZNA 4I1ZA 1AQ1A 3QF9A 2XNGA 5JN2A 1YKRA 5DI1A 2C0IA 3WF7A 3EJ1A 5HVKA 3UIMA 2C6LA 3PZHA 5KO1A 3EZRA 1HCKA 2ONLA 4X6RA 2W4KA 4QMTA 4YHFA 2ZM3A 4DFXE 5CALA 3EMGA 4FICA 3V6SA 4W4VA 3A60A 3ODZX 2XKDA 4UALA 4CFFA 4D28A 2WPAA 4OGRA 4EYJA 1XH7A 3V5PA 1YRPA 4YLLA 4YJVA 2OJFE 3HV3A 3ZCLA 1SYKA 2YLEA 4I6HA 4HGSA 4KBKA 2CPKE 4Z55A 1Q62A 4FK6A 2R64A 2HOGA 2ITVA 3BE9A 3FL5A 3SXFA 3RCJA 5DHJA 1W98A 4AA0A 2OSCA 2QOHA 4XG2A 1H8FA 3BHTA 2QR7A 5FGKA 5JRQA 4FSRA 5CSXA 1WVWA 1J91A 3V51A 4C4IA 2Z60A 4AGWA 2X8EA 2ZV9A 3OCBA 5CU3A 5J5TA 3GENA 2JAVA 2JAMA 3KF7A 2GQGA 4YJPA 5L2IA 4ZTLA 2YM4A 3CTQA 2Y7JA 5TOZA 3P78A 4AG8A 3GXLA 4FV0A 5HE1A 1I44A 4EH2A 4ZLZA 4BIBA 5CU4A 4C8BA 3RAWA 3LOKA 2OJIA 3BHVA 4C58A 3O23A 2GHMA 3R83A 5KMKA 2XKCA 2DS1A 3VC4A 4AUAA 2C0TA 1ZZ2A 5HTCA 2ITXA 3V5LA 2C1AA 3ALNA 3R04A 1Q8TA 2J2IB 3A61A 4IZAA 2UUEA 3UO5A 4M0ZA 3ZDUA 2E2BA 2ITZA 3BE2A 5JH6A 4FIEA 1E1XA 4BCPA 4DH3A 5A4LA 3NDMA 5IF1A 4HCUA 2VWXA 2O5KA 3W2PA 3I0OA 3UBDA 3AOXA 4ZS0A 5M51A 4FTLA 3GFWA 4WG3A 2OKRA 4Y85A 4BGGA 4AOJA 3NW6A 2VTLA 5CXZA 2QOIA 2UW9A 4JG7A 4BCQA 2WMXA 3HV7A 1NA7A 3PPKA 5I4NA 5GJFA 1ZY5A 1DAWA 2GNHA 3W2QA 4YU2A 1UA2A 1BX6A 2YM7A 5EW9A 3VS0A 5IDPA 2P33A 3IONA 2GFSA 2GNJA 3LFQA 4JBOA 4PUZA 4A9RA 2W96B 3NUNA 4QYGA 2HYYA 5CXHA 5AUWA 5L8JA 3ROCA 5FBOA 4DFZE 2YM8A 3IOKA 4L7FA 1K3AA 3DQXA 4DGGA 4ASZA 1KE6A 2VWYA 3LFSA 2W1ZA 1WBWA 3Q4CA 1CTPE 4GK4A 4UY9A 4TWPA 1XBAA 3BRBA 4YZNA 4MEDA 2ERKA 2AC5A 3KRJA 3F82A 4JRVA 2WGJA 4XV3A 3LVPA 5HBHA 2UW0A 4ZLYA 3TTJA 4MF0A 2QR8A 3EB0A 3R1SA 4U40A 3LCSA 5I9ZA 3CY2A 3RNYA 3OCGA 3W2OA 2F7EE 5DH3A 3UOKA 2XNNA 4MBJA 5HGIA 5T6KA 4YNEA 4YSJA 3FHIA 1WBNA 3ORNA 1K2PA 4G5JA 3FLYA 4LRKA 1JKSA 3R30A 4B99A 3ZUTA 1Q3DA 3ZYAA 3WI6A 4IH8A 4JR3A 4ANSA 4EK5A 4IVAA 3C0HA 5DRBA 2WMSA 1P14A 2Q0NA 3DY7A 3P79A 3QGWA 2CLXA 3FQHA 4ITJA 3RKBA 5I3RA 3PYYA 1TKIA 2A0CX 2VTJA 3ZEPA 2VO6A 4I6QA 2AYPA 3R63A 2BHHA 3UMWA 2JITA 5HESA 3D5XA 5CZHA 5H8BA 3T9IA 5CVGA 1IR3A 4KNBA 5AIKA 4JJRA 3E64A 5AR4A 1M2RA 4XEYA 3C4XA 3UGCA 3BEAA 5HIEA 1XKKA 3ANQA 4JIAA 1U5QA 4M97A 3FZPA 3TG1A 4A4LA 3DFCB 4FTTA 3DAJA 1SVGA 3HMIA 1MQBA 4DEDA 5LMKA 2CLQA 4XG8A 3VS2A 4CRSA 5IZFA 2R3LA 2X8DA 5AAFA 5H9BA 3RZBA 5BPYA 3IGOA 4YP8A 4DINA 1JQHA 4AN3A 4FIGA 1U4DA 2LGCA 3UIUA 4S33A 1Q24A 4XG9A 5FM3A 4FIJA 4E1ZA 4W4YA 4F1MA 5KZ0A 3HNGA 3JPVA 4HVHA 5ETCA 4W4WA 2VTHA 4F6SA 2YHVA 5D7VA 1RQQA 2BALA 3WIGA 4CT1A 4EWHA 5CAOA 3GFEA 3LW0A 4GL9A 3QC9A 2W1CA 2W5AA 4UMQA 5AP1A 2DYLA 3C4ZA 4PMMA 4M13A 2C47A 1ZARA 2RSVA 3DKCA 2W5HA 3EQCA 3OG7A 4GUBA 4IAFA 1OB3A 1OPKA 2VTRA 1W82A 2VTOA 1MQ4A 2C3JA 4TWNA 4PPCA 2QG5A 4QMNA 4G9RA 1PMEA 2EB2A 4AF3A 5JSMA 3IDCA 3NW7A 4PNIA 3ZLSA 4IHPA 5F1ZA 3WOWA 4CFXA 4F9YA 3SHEA 3R9OA 3Q3BA 3LFFA 1R1WA 3FSFA 4B6LA 4HW7A 3QRIA 2ITPA 4GW8A 4IAKA 4DLJA 3GC7A 5ITAA 5HE0A 1JWHA 2W06A 4O0VA 2IZRA 2UZNA 3VO3A 5M4UA 1WAKA 1ZY4A 4CV8A 3LFCA 4ASEA 4KA3A 3WE4A 1PHKA 4G34A 4JDIA 5DGZA 1CKJA 4KINA 2BPMA 5EYKA 4ENXA 4FTRA 5A4TA 2OW3A 4L3PA 1M17A 2R0IA 4CMTA 4UMRA 5CAPA 5K9IA 3CKWA 2IZUA 2QO2A 3OEFX 4YJUA 3R7UA 5K0XA 2ETRA 2R3PA 4F9CA 3R1NA 3UIBA 2H34A 2JIVA 4RQVA 3K2LA 1ZAOA 5ETIA 4BZNA 4P90A 4ANOA 5H2UA 4AW5A 3E92A 4FYOA 2E9PA 2QI8A 3DU8A 4FV8A 3PLSA 4A07A 2PMLX 4D0WA 2PMNX 4KKEA 2XNMA 5L6WL 1JSUA 5BUIA 4TXCA 2ITWA 3PUPA 4RX8A 4V04A 4M15A 4D9TA 2UW4A 3NNWA 1QPCA 1T46A 2PTKA 3A4PA 3MPAA 1URWA 4MWHA 4WNPA 5EI6A 4DEIA 5CZIA 4AOIA 5AA9A 3RINA 3U51A 4FVPA 4F09A 3IOPA 5M53A 3NWWA 1A9UA 5CI6A 3CY3A 2R2PA 2XF0A 3MBLA 5FP5A 4FT0A 4JR7A 2IVSA 1U54A 4EC8A 4MXYA 3A8WA 3A4OX 4O22A 3RWPA 3SRVA 2EUFB 2YCQA 4AN2A 2V0DA 4U81A 3V5JA 4AFEA 1H1SA 3A7IA 4BVUA 4IM3A 4GCJA 4FKQA 4QMZA 4TRLA 1JSVA 4XG4A 1V0OA 4ZXTA 3EOCA 3RZFA 1GZ8A 4NU1A 3R8MA 3EQGA 2BRNA 4W8DA 5ANGA 4D2PA 3FLQA 3MIAA 3W2RA 4CFNA 5E7RA 4ERWA 3PWYA 4XJ0A 2IW8A 2RFDA 2WQNA 3FYJX 3KFAA 4U7ZA 2WZJA 3NSZA 3ZFYA 3KXNA 4TNBA 4OT6A 5G1XA 4C38A 4C4EA 4E4XA 5K0KA 4PTEA 2F7XE 3G90X 3SV0A 4XV2A 3DDPA 5JQ5A 4EOSA 5IU2A 3BQCA 5IISA 4FKLA 3VQHA 2EWAA 3LZBA 4DH5A 4IZ5A 2J5EA 5DIAA 1WMKA 3BKBA 3BQRA 3BYMA 5IEYA 4EJNA 5FBNC 3EIDA 4IVCA 4PL5A 4EZ5A 1R3CA 2YITA 1PXNA 4J52A 5CI7A 3QQKA 3EL8A 2I0HA 3UZPA 3Q5ZA 1Q8YA 4A4OA 4EHGA 2VNWA 3TJDA 5EYDA 3LXNA 4CZYB 4CRLA 3OBGA 5AUUA 4MHAA 2JDRA 2DUVA 4FV3A 1BMKA 4IC7A 4FX3A 4LGDA 4ZY6A 3CQUA 5CQWA 2XZSA 2BRBA 4I21A 1Q8WA 4PF4A 4O2PA 2QO7A 5T3QA 4G2FA 3HVCA 3F5XA 4TPTA 4AP7A 2HW7A 4RIWA 4PP7A 5LXMA 2Y4IB 3EQDA 4OBQA 4IM2A 5E91A 5LMAA 1IG1A 1REKA 4KBCA 5HO7A 4RFZA 4X2FA 1YWNA 3OTUA 5J79A 3RK5A 3BCEA 3BPRA 2PMOX 3FXWA 2JFMA 3UNZA 3THBA 3RBWA 5I0BA 4Z9LA 2V7AA 3C4EA 2RIOA 2FB8A 2V7OA 1AGWA 2C3KA 1GAGA 2W9FB 2A1AB 3E62A 2XH5A 1UKHA 4LI5A 3ACKA 4TYJA 3L9LA 2ZV8A 5CF6A 1H07A 1OKVA 3DBEA 4IBMA 3K54A 2B52A 1F5QA 2ZYBA 3KXZA 2OGVA 2WMQA 2WTKC 3EQIA 4C4JA 5HCYA 5EHYA 4IFGA 4DFYA 5M4CA 1YOJA 3FL4A 3L8XA 2YZAA 3OOGA 3TNQB 4DEEA 4E4NA 4XP2A 3OWJA 5ICPA 4F9WA 5EM5A 4E6AA 2REIA 4YC8A 3GC8A 1OMWA 4AT4A 3VBVA 3G2FA 2Z7LA 2QO9A 4R7HA 4YO6A 3C1XA 2YWPA 4NUSA 3DB8A 4KBAA 4EOJA 3AC3A 3DZOA 3ROYA 3O51A 3BGQA 3NYNA 4AXAA 1OIRA 2GTNA 1V1KA 2YJSA 3EN9A 3F61A 3DQWA 1OIQA 3JVRA 1KOBA 5GJGA 5BVEA 4ZSEA 3R0TA 1ERKA 5LVOA 5D9HA 2G01A 4PMPA 3RNIA 2OXYA 1PY5A 1WFCA 3RHKA 4FSWA 3QWJA 4YNOA 3T3UA 2VTMA 3UPXA 4HYIA 3QHRA 4D2SA 3ZHPC 4G31A 4DGMA 4ZJVA 5F9EA 1JVPP 4ZIMA 2CCHA 4MH7A 5GZAA 4IWDA 1WBVA 3RPRA 3TT0A 4WBOA 4HCVA 4CT2A 4QT1A 5IUGA 5C1QB 2XUUA 5FTQA 4BF2A 4JQ8A 1M2PA 4CFWA 4ZP5A 4G6NA 2XEZA 4D9UA 4C34A 3UO6A 5J7HA 4QP2A 2I0YA 4NSTA 4QMMA 1HCLA 4FKJA 3KMMA 5EH0A 4FKTA 4MBLA 2R7BA 4CQEA 5DPVA 5DEWA 5K3YA 4PMSA 2XK6A 2YIXA 3LJ0A 3FAAA 4RGJA 2BHEA 2R3QA 2PZIA 2C1BA 1ZMWA 4X3FB 4KIOA 4D2VA 5LQFA 2BVAA 3HP2A 3IK3A 4RWLA 5CANA 1MP8A 3UNKA 3VRZA 4UXQA 1QMZA 4E93A 4ZLOA 4GU6A 1O6LA 4JDHA 5E92A 5M55A 3UP7A 4FT7A 4JOAA 5BVWA 4Y46A 4QYYA 4PDSA 2YERA 4O1OA 4QOXA 2C6OA 3GC0A 4QYFA 3H0ZA 3R8ZA 2WAJA 3HV6A 5EYCA 1H01A 1FMOE 2BFYA 3FDNA 3OEZA 4K77A 4C4GA 1GNGA 3CTHA 3GOPA 3QA0A 3C4CA 2VZ6A 4FKSA 4GMYA 5I9YA 1H1WA 4ANQA 4EBWA 5AP4A 5EK7A 4Z7HA 1BKXA 1Z9XA 2PK9A 4JX7A 5DEYA 4TNDA 5BMMA 4ZTNA 3GQLA 4FEQA 4BDKA 3OZ6A 2B9JA 2YA9A 4XP3A 4ZZOA 5JKGA 3AXWA 2PVRA 4GEOA 4M69A 4ANNA 4IADA 3QQGA 4F1OA 4ANLA 5CNOA 4RJ5A 1Q61A 4X21A 3EKKA 1FGIA 3WBLA 4ITIA 4DG3E 4XOZA 3QUDA 2BDJA 2XA4A 4WUAA 4E20A 5FP6A 4FZDB 3RPSA 3RTPA 2ACXA 1GIJA 5HTBA 3R21A 2RG5A 3AQVA 4FSZA 5EW8A 4WIHA 2XS0A 4FTMA 5JRSA 4ACHA 4PPBA 3C13A 5CLPA 5FXRA 3KU2A 4K1BA 4L6QA 4BTMA 2WIPA 3QD2B 3UYSA 3VBQA 4EOIA 2UZDA 4YTHA 2R3FA 4YZDA 3PG1A 3OCTA 4BCMA 2XCKA 5CSVA 2J90A 3MFSA 3OHTA 4FKOA 4MD7E 5CF4A 3QUEA 2IZTA 4GJ2A 2NP8A 3CGOA 3MVMA 4KS7A 4XUFA 5E8ZA 4IAYA 4RJ8A 5CENA 4YURA 4EH4A 3UP2A 4F9BA 4E6QA 4KD1A 3C51A 1DI8A 4AN9A 3DV3A 4JXFA 4MXXA 5C03A 4BDFA 5HVJA 3F7ZA 3S0OA 3HA8A 4GT3A 4GH2A 4RIXA 4E6CA 3FMMA 5HEZA 4NFNA 1BL6A 5E8TA 3R1YA 2PVKA 4C57A 3B8QA 1LP4A 1WCCA 2BFXA 3ET7A 3TKIA 3D4QA 2JEDA 2OO8X 3CD3A 4RG0A 4RRVA 3UVQA 4AZVA 3D7ZA 4DFNA 4TY1A 4CV9A 2W99B 4NT4A 5HG9A 4D4RA 2XRWA 5A6OA 2X6DA 3FJQE 4HJOA 3FI3A 4J8MA 4DEHA 4U80A 1H0WA 2VTSA 2VD5A 2QOBA 2ZM1A 4GSBA 3FMEA 2YFXA 2EXEA 2O0UA 3KGAA 1REJA 5IA4A 3G5DA 2CN8A 4FV2A 1P5EA 5D41A 5F95A 3V5TA 5A4QA 5AV1A 3HV5A 3NUUA 3OUKA 3PRFA 4HNFA 5HCXA 2BTSA 3S4QA 3VJOA 4ANMA 3S2PA 4NIFB 3KA0A 5KNJA
chains in the Genus database with same CATH superfamily
5J5SA 3GOKA 1PKGA 5HICA 5HNIX 1QPJA 3LAUA 4IX3A 4D4SA 2A19B 2PY3A 4Z3VA 3GI3A 4MNEB 4RIOA 4C2VA 4CYJA 2ZB1A 4EKKA 5JGBA 1PMVA 2X0GA 3CJFA 3RVGA 5FDPA 4BTKA 5KMIA 3MH3A 3PJ3A 4QP8A 3IW7A 3L8SA 4UV0A 4EONA 2YDKA 5G6VA 2QHNA 2OH0E 3EYGA 1KOAA 4NWMA 2IWIA 4AACA 3PIYA 4D0XA 5BMSA 3EKNA 2C3LA 2PE1A 3C0GA 1B39A 3I5ZA 4BKZA 1H28A 4OAVB 3ZFMA 4RMZA 3KVXA 2C68A 4UN0C 1A06A 5DNRA 4D2WA 3PJ2A 3FZ1A 3R7IA 1UU3A 2GS6A 2X4FA 2QOQA 3WZJA 2X1NA 5AR2A 3REPA 4DTKA 2P0CA 3E7OA 4UX9A 2J0LA 3KULB 1CMKE 2ZOQA 4I5CA 3PG3A 1YOLA 3AC1A 3QCQA 3HYHA 4RIYB 4II5A 4BN1A 3QYWA 3NZ0A 3O2MA 5AUXA 4QMOA 3KK8A 3CPBA 4BBEA 1WVYA 2QHMA 4RWKA 1M7QA 3QTXA 3AGLA 2A2AA 4FL3A 4FSNA 3QYZA 4J7BA 4HCTA 4BDIA 2ZDTA 3VUDA 2PSQA 2HIWA 3CEKA 3P1AA 4FYNA 5HVYA 3W33A 4DEBA 1OL1A 4JBPA 4EZ7A 3D5UA 1CKPA 1UKIA 4FL2A 3VHEA 4N6ZA 4YTIA 3F9NA 2ITQA 3MW1A 2QKWB 4AE9A 1FMKA 4EYMA 3E93A 3E63A 2A27A 1TZDA 5HD7A 3GCVA 1TQPA 4GFMA 4TL0A 4YGAA 1Z5MA 4FT3A 5I9VA 3P5KA 4W4XA 3CP9A 2G1TA 3UOJA 5LOHA 2JKKA 4KABA 5FDXA 3OY3A 3EFLA 3EQHA 4RC2A 1XHAA 2NRUA 3CJGA 4A9UA 4JX3A 4FT9A 2WTIA 2YAKA 4F7NA 5KBQA 5EFQA 3RK9A 3UQFA 4YC6A 5L6PA 5E90A 4V0GB 3AT4A 3ZC6A 2X7OA 5KX8A 2OIQA 2YIQA 3FHRA 5AV4A 2ITOA 3GCQA 2XMYA 4RVLA 4TYHB 2ETMA 5HCZA 4W9WA 4G16A 4AQCA 3TTIA 4NKSA 3SXSA 5I3OA 3NNUA 3FXXA 4K18A 4GFGA 2XBJA 3TV7A 4FUXA 4YZCA 3TZ9A 3BI6A 2F2UA 3UOLA 4C61A 5HHWA 3D7TA 4EK3A 2PL0A 4NTSA 3TCPA 2R5TA 4NCTC 4O6LA 4BZDA 5KCVA 3NUPA 3PZEA 2QLQA 3HGKA 3R7EA 2PZYA 5GZ8A 4AT5A 2J50A 3EHAA 3MIYA 4MAOA 3W1FA 1ZOHA 4GV1A 4N4SA 3JY9A 1YXUA 5AADA 5IMEA 2OJ9A 3PVWA 4IZYA 1GZOA 3MVLA 3VW6A 4EH8A 3F88A 2W1DA 4QMQA 3LCKA 2X2MA 5GNKA 4PV0A 1XO2B 2OH4A 2P55A 3E88A 1ZLTA 3Q5IA 4XBUA 2W1IA 3EQBA 3F3ZA 5DE2A 3F3UA 4YMJA 3EWHA 5CSPA 1WBPA 4KIQA 5CF5A 4EH5A 4F1TA 1SNUA 3FZOA 3W32A 4YJOA 1LEWA 2Y0AA 3Q4UA 5AIRA 2DWBA 4AAAA 2IJMA 3FC1X 3F7WA 2YM6A 3ORXA 4PX6A 4HVSA 3KC3A 1XBCA 3FV8A 4DCEA 4FZ6A 4GIHA 3QCYA 3QALE 3Q60A 4G3GA 1ZWSA 4K33A 3OOMA 4L9IA 4CZTA 3NYXA 4YJNA 3W10A 4UYNA 4EHEA 5D1JA 1P4OA 4A9SA 2CDZA 2WQMA 3VS1A 5KBRA 3AMAA 3QQFA 2UW5A 3F3WA 2UVYA 1M14A 2OK1A 4DYMA 2XP2A 2W17A 3BHHA 4Z16A 3PSDA 4XRLA 3F5GA 5EKOA 4ZTMA 4E5BA 1UWJA 2FSTX 3FMHA 4FG7A 4FKIA 3UTOA 3ZO4A 5JMSA 5L3AA 4OTPA 4L53A 1PMUA 1WZYA 4DG0E 4XLVA 2WMTA 2WEIA 3D15A 4OTHA 2BROA 4IM0A 1BI8A 1KSWA 4JI9A 4BDBA 3RHXA 2WKMA 4C2WA 4FZ7A 4IMYA 2WU6A 4B8LA 2WMWA 4D1SA 4D1ZA 2ETKA 3HX4A 3T3VA 3PXYA 3ORTA 1H1RA 4EZ3A 3CQWA 3OXZA 1XH6A 2VTQA 4TW9A 3BV3A 5AUZA 2XBAA 3L9NA 4L67A 3FMLA 1R78A 2Y6MA 4NM7A 3Q6WA 4L00A 4R5SA 4U79A 4F7JA 3DTWA 5AP2A 2Y4IC 2XK8A 1YQJA 4LV5A 4A9TA 1YDSE 2WTCA 2XNPA 4HPUE 4BWKA 2Q0BA 5K4JA 2OG8A 3FY0A 2UZVA 1OKWA 1OPLA 3SAYA 2YDIA 4WBBB 3IQ7A 4BWPA 2XK7A 3P4KA 1KE8A 2YACA 3B2WA 4AWIA 4EK4A 1HOWA 3UZTA 4YUQA 5J1WA 1DI9A 2I6LA 4DHFA 5AUYA 4YJRA 3R9HA 1YHVA 4AGDA 4ZTHA 4FNYA 2X81A 2FVDA 1IRKA 1UNLA 3M2WA 4LM5A 2B9HA 1X8BA 3QQJA 4FNXA 4GK2A 5GZ9A 3RI1A 4L43A 3TL8A 5JQ8A 3QZGA 5HLWA 2OI4X 4WA9A 2AC3A 3PVGA 2PVNA 3QGYA 3SLSA 4FKWA 1MRUA 4CTCA 3ELJA 5IMXA 2UZOA 4PL3A 2VWWA 4B0GA 4AA4A 2PMIA 3TZ7A 4CYIA 4AZFA 2J4ZA 3P23A 4F64A 5C8NA 4IB1A 1IA8A 3MB6A 4D5KA 2AUHA 4ASDA 4XX9A 4BCGA 2Z7QA 1SVEA 4FSTA 5C8KA 1BYGA 2VTTA 3BIZA 4IJ9A 3E3PA 2ZVAA 1SNXA 2ZDUA 3BBWA 3FBVA 3QUPA 3IDBA 3QX2A 4PDPA 3U87A 5CAUA 3ALOA 2R3GA 3OMVA 4LRJA 4FKUA 1B6CB 3SX9A 2E9UA 4F99A 1SZMA 5DA3A 3HL7A 3FQSA 4EC9A 4JRNA 1UU9A 2VX0A 3NUYA 3AD5A 4W9XA 3GB2A 3HMPA 4QPMA 3VQUA 3MI9A 5TT7A 4TWCA 3FMJA 3FPMA 4HGLA 2WQOA 4O21A 3TACA 2BAQA 3O96A 4TN6A 1UWHA 4XV9A 4QP9A 3WILA 1S9JA 3G0FA 4LMUA 1YW2A 3OWPA 4XG3A 3COKA 2PE2A 4P5ZA 5JK3A 1PYXA 3BELA 4C4HA 3P86A 3O71A 4ALWA 4PPAA 5K4IA 4BKYA 4MXOA 4O4EA 4PMTA 4KIKA 4AZWA 5HG8A 4BHZA 2Z7RA 4TTHB 3E5AA 4I94A 4WG4A 5CU2A 5CAQA 4O1PA 4FUYA 4X2JA 2VU3A 2PVFA 4ITHA 4X3FC 3KRLA 3R7GA 5AUVA 4FV5A 1GJOA 3FLSA 4BTFA 1QPEA 4FOCA 3PA5A 3UE4A 1JKLA 4H1MA 4RVTA 4ARKA 1YOMA 3F5PA 4BYIA 4L44A 2I0EA 5ANDA 2IVTA 4QNYA 2HAKA 3BEGA 4GT4A 5EI2A 4JT3A 2NRYA 3DJ5A 2WU7A 5JGAA 1PMNA 5A6NA 3AD6A 3G9NA 3MA6A 4IB0A 3GU4A 3WYYA 4EH6A 4NFMA 5DMZA 4Y8DA 3MY1A 4GG7A 3T9TA 3VHKA 3V8SA 2PZPA 4R7IA 5KE0A 2ITTA 4FA2A 2W05A 3CIKA 2ZM4A 3VF9A 4H3PA 4AOTA 3CBLA 2WHBA 3ZEWA 1Q41A 1OI9A 2VNYA 2XCHA 4JDKA 4WNKA 4CKJA 2P2IA 4AGUA 3BGZA 3P08A 4HNIA 3E3BX 4RWIA 4KWPA 1LUFA 3A99A 3BWJA 2R3NA 2QVSE 1KWPA 4LV8A 2UZWE 4CZUA 5EM6A 3LE6A 3BWFA 2XYNA 5F94A 3I79A 3ZC5A 5D7AA 4I24A 2OJGA 2ITUA 2SRCA 1XH8A 4I93A 3MFTA 4XRJA 5TO8A 1EH4A 1YHSA 3IW8A 4G5PA 4MWIA 5HE2A 3O0GA 3QTZA 4O96A 1YVJA 5AV2A 4KKHA 4X2NA 5BVOA 4BRXA 3RJCA 2WMBA 3HDNA 3QD3A 5HNBA 3VUKA 2R3KA 3PY0A 4RPVA 3TIYA 2IEWA 3DNDA 3PIXA 4ZJIA 1G3NA 4USEA 4FSYA 1KV2A 1VJYA 1U5RA 1P4FA 2GTMA 3B2TA 4RC3A 4IDTA 4DGLC 4O2ZA 4QTDA 5GJDA 4IJPA 4F6WA 4CFVA 3FZRA 3FZTA 2QURA 3R02A 2OZAA 3QX4A 4PDOA 3IW6A 5E8VA 4LOPA 2Z7SA 4ZEGA 3VRYA 3W16A 4YTFA 5K5XA 3FLZA 4KS8A 3DKFA 3R22A 4B7TA 3LIJA 5HTIA 5ACKA 4BCHA 4PNKA 3KRRA 4WRSA 3DJ6A 4K6ZA 5LWNA 1BI7A 4S30A 4ZZMA 3R7VA 1GY3A 2YAAA 5EM8A 3NPCA 3ZO2A 4N0SA 4D4YA 3JUHA 3KEXA 1W2CA 4GT5A 4A06A 2J0MB 3AC2A 2JC6A 4ZTRA 4Q5EA 4EH9A 4UZHA 2BMCA 4I6BA 4DEAA 3VJNA 3DOGA 3ETAA 2X9FA 4RFMA 4P2KA 2PVMA 4MD9E 4F0FA 2WNTA 2UVZA 2X6EA 3C5UA 3Q9XA 4IZ7A 4RWJA 2J0KA 4X7QA 5IDNA 1PXOA 2VGOA 4CTBA 1OZ1A 3VUTA 2JIUA 5L2SA 3W8LA 5KZIA 3U6HA 2UV2A 3OWLA 1OITA 3GNIB 4L45A 1NVRA 2XKEA 2HZ4A 4JBVA 1LPUA 2CMWA 5M57A 2CGVA 2V22A 3NYOA 3Q32A 4G6LA 4XBRA 3ZUUA 3MWUA 1PXLA 5TE0A 2YCSA 5AEPA 2A4LA 4QP3A 1ZOEA 4HGTA 1IASA 1PXJA 5CWZA 3RMFA 3D2IA 4YLJA 2E9NA 2UZTA 4GG5A 5HO8A 4IWQA 4KKGA 4G3CA 1JSTA 3DXNA 2C69A 4ENYA 1M52A 4KRCA 4JL9A 2UW7A 3UC4A 3IECA 2QODA 4FIFA 2HY0A 5HNGA 5IKWA 4ZTSA 2OF2A 5EOBA 4I4FA 2UZBA 4PRJA 4P7EA 1VEBA 3ZZWA 4AS0A 1J3HA 1JKTA 3BHUA 1O6YA 1OVEA 4FK3A 2UVXA 5CF8A 5A4CA 3MFRA 2FSMX 3MYGA 5HLPA 3NS9A 3TKHA 2HZNA 2W1FA 2WTVA 3TI1A 2W1GA 1O9UA 3S1HA 3N9XA 4CVAA 3BBTB 3TN8A 4IEBA 2OZOA 2OICA 4QP4A 3C50A 3QZFA 4HYSA 5DOSA 2J9MA 4IACA 4D2RA 4CKRA 5IA2A 4BWXA 3I7CA 3TUBA 3ZRLA 4I92A 1PYEA 5AV0A 3PXKA 5DLSA 4BCKA 3AG9A 1Y57A 3Q52A 5AP7A 3ZDIA 4LFIA 3FKNA 5JFXA 2FH9A 4FVRA 4E7WA 5IEXA 1H00A 4QP6A 3A8XA 2IN6A 2X9EA 3FKLA 4ZK5A 3WF6A 2H9VA 2WMUA 3P7CA 3R7YA 2BAKA 3TIZA 4ALUA 3HRFA 3QTSA 4CD0A 4QQCA 5HBEA 2VAGA 3MTLA 3QC4A 5E8SA 1KE7A 2V5QA 2OBJA 4NJ3A 3SOCA 2HXQA 5AR3A 3MH0A 3NCZA 4J8NA 3JY0A 2BCJA 5EOLA 4BGHA 3RGFA 4QQTA 2PHKA 4FNZA 5EDRA 2ZJWA 4APPA 4E3CA 4EI4A 4PY1A 3WIKA 3LFBA 3DKOA 1MRVA 5HG7A 3EQFA 3CXWA 2QOCA 2W5BA 3IPHA 2B54A 3JVSA 3ANRA 5HIBA 3LCTA 4C7TA 5M44A 3RM6A 3VS4A 4IC8A 3RAIA 3R8VA 3MGYA 1E1VA 4EOQA 4EQUA 4LL0A 5FEEA 3RALA 4NH1A 5C9CA 5DT3A 3RWQA 2W7XA 4IX5A 3PJCA 4QTCA 4BHNA 1FPUA 4BI0A 4QTEA 3RK7A 3NIEA 1DAYA 3MVJA 3KN6A 5L6OA 4M67A 4F0IA 4HGEA 4YJQA 3R8PA 3R2YA 3NX8A 2QOOA 3G33A 1MUOA 3OW4A 2O8YA 4MCVA 5DR2A 3GU6A 3HUCA 2I0VA 4G3FA 3H4JA 3NR9A 4FZFB 5BVDA 2X7GA 2B55A 5DT0A 1H1PA 4BDAA 4I0RA 4XYFA 3ORKA 4NM3A 3CS9A 4NW6A 5B7VA 3AT2A 3NRMA 3KF4A 3BYVA 3DBDA 3EN7A 4FL1A 4G3DA 4RX7A 2J6MA 5HQ0A 3WF8A 4RX5A 2O64A 4I0TA 3DZQA 4OTFA 5DN3A 5D11A 1OM1A 3RPOA 5DRDA 4E26A 4C59A 2H96A 5A9UA 5F4NA 5AP5A 4AZSA 2BZIB 4KSQA 4UMPA 4FTOA 1R0EA 2B1PA 2B4SB 2RFEA 3Q4TA 2WIHA 3EYHA 2NO3A 3ORPA 4AW2A 2Y8OA 4M66A 3NGAA 4OTIA 4GJ3A 4IAZA 4R5YA 4MNFA 4KSPA 1YXTA 2P3GX 2XRUA 4JG8A 3K3JA 1F0QA 3HRCA 3CKXA 2IO6A 4MX9A 3LJ2A 4Z7GA 4S2ZA 2PE0A 3E8NA 4BIEA 4Y83A 3ZH8A 1H26A 3PY3A 5LCKA 1ZMUA 5J7BA 3UPZA 4QMVA 3GBZA 2G15A 4E8AA 3A7GA 3QRJA 2XNEA 5JT2A 4QP7A 4U5JA 1WVXA 4BI2A 4GIIA 4UZDA 3FZSA 5DFPA 3MPTA 2WMRA 4ZZNA 4J71A 3CD8A 3ULIA 3D94A 1GZKA 3FSKA 3QZHA 4G17A 2C6TA 2VWUA 2UW3A 1ZXEA 4K0YA 4D1XA 2VWBA 3R9NA 4IW0A 3F66A 3BZ3A 3BYSA 3IS5A 1O6KA 2QU6A 4OLIA 3QU0A 4QPSA 3BLHA 3DLSA 1OL6A 2VTPA 3H0YA 3R28A 3MH2A 4HYUA 4K9YA 4XCUA 4Q5HA 5EDPA 2YDJA 1OIYA 3FMDA 3JS2A 2FO0A 3TNIA 5IH6A 3OD6X 1VR2A 4GUEA 3UVPA 3QCSA 1BL7A 3PVBA 3W2SA 5CVHA 3G6GA 1NVQA 3QD0A 2F49A 4UYAA 4H58A 5EHLA 4AX8A 3PA3A 4ANBA 4M3QA 2V62A 4CKIA 3QQUA 2VX3A 3GU8A 2C5XA 3IGGA 3LFAA 4O38A 3OF0A 4DC2A 2XJ0A 2BZKB 4RQKA 4M12A 4WNOA 4Y5QA 3GGFA 4YC3A 4F6UA 3DK6A 3SXRA 4EUTA 2EB3A 3O8PA 4Y95A 3BU5A 1R39A 3HZTA 4QMLA 4G1WA 3VIDA 2JGZA 3WZDA 3SVVA 4BC6A 1ZOGA 2WD1A 4KAOA 4WT6A 3MN3A 4K2RA 2VN9A 4EQCA 5J9ZA 2ESMA 2G2HA 2VWIA 2H8HA 3LXLA 5AAEA 1YDRE 4OT5A 4ACDA 1YXVA 2PVYA 3G9LX 3BU6A 3DA6A 3F3VA 5AV3A 3ZUVA 3H30A 5B2LA 2UZLA 3TKUA 4IWPA 5JZJA 2C5YA 4NK9A 1JOWB 4LOOA 3DLZA 4CMUA 4C0TA 3ERKA 2XB7A 3OROA 4QRCA 4ALVA 4EBVA 3MSSA 4CMOA 2GNGA 3P9JA 2RFSA 2IVUA 2X0PA 3ZRMA 1H08A 3UDBA 2GHGA 5JFWA 4F7SA 4CCUA 3VBTA 3R2BA 3R01A 4CEGA 3HMNA 4KRDA 2WTJA 5KHWA 4OTDA 3PXZA 2BUJA 4FV4A 4L7SA 4FGBA 4BDCA 4RZVA 5A54A 3DAKA 3VBYA 2ITYA 3KXHA 3UIXA 2PVHA 4DH7A 1V0BA 1U59A 3KRWA 3QQHA 4LUDA 3D2KA 4WOVA 4XOYA 1ZYCA 3TV6A 2G9XA 4BL1A 5FXSA 4YBJA 1W84A 4O4BB 1YHWA 4I22A 4F63A 1NXKA 3UODA 4HVGA 1U54B 5CSWA 4WO5A 3SRVB 5IH4A 1OL7A 2XEYA 2J7TA 4FV9A 2BRGA 4XG6A 3OT8A 2RF9A 2QC6A 4U0IA 4NKAA 4CCBA 1XQZA 5L4QA 3DK7A 4I3ZA 4QMUA 5EHOA 1SM2A 2JDOA 3NNXA 3VULA 4V05A 3LFEA 3FY2A 3W55A 5EKNA 4QYEA 3NW5A 2VO7A 1Y6AA 5A4EA 4IE9A 5LJJA 3QTQA 5HZNA 2OJJA 3LXPA 2UZUE 4QMSA 5CY3A 3WZKA 4ZSLA 5HLNA 5AM7A 5IA0A 4DH8A 2O63A 3DBFA 1NVSA 2R3HA 5JFVA 4J96A 5ANKA 2YIWA 3QTIA 3GC9A 5DR6A 3UMXA 4AE6A 3W2CA 3PE2A 1H24A 4M0YA 3EN5A 3LQ5A 3FLWA 1AD5A 3COIA 1Q97A 1SMHA 4EUUA 4IX4A 3U4WA 4FR4A 3NUSA 4F65A 4N70A 2XK9A 4QNAA 3FLNC 2LAVA 3ULZA 3O8TA 2W4OA 2XJ2A 2NPQA 4TYGA 4OR5A 4YZBA 3V5QA 1BLXA 3SDJA 4JQEA 4XS2A 1Y8GA 2VWZA 2UW8A 5IPJA 4XG7A 5FEQA 4ZSJA 4RJ7A 4AA5A 1OL2A 4BZOA 1G5SA 2WQBA 1PXMA 2UZEA 3E8EA 2HZ0A 4BDDA 2P4IA 3AC4A 3I6WA 5AUTA 4EHZA 4JG6A 4FTJA 2FSOX 2E9OA 4ZAUA 5H8EA 3G0EA 2CKEA 3IO7A 2J0IA 4YZMA 5L2WA 1ZRZA 2B9IA 3EZVA 4RIWB 1PKDA 4WRGA 2ZAZA 4BBFA 4I0SA 2CCIA 4RJ3A 5I9UA 4L52A 5E1EA 5ANOA 2ZMCA 4UWCA 3ITZA 1JKKA 2UW6A 2YJRA 3VN9A 3TUCA 3ZSIA 5AMNA 2OWBA 3R1QA 3S00A 3OCSA 4JLCA 4P5QA 4RA5A 4I6FA 5EG3A 2J5FA 3QKKA 1P2AA 4QMYA 4A4XA 5I5ZA 4GFOA 2V55A 3FWQA 4QMWA 4U43A 4ACMA 3QXPA 4E4MA 1NY3A 3FC2A 5HG5A 3FI4A 3DK3A 2WFYA 5IUIA 4TT7A 3BYOA 3PTGA 3QRTA 3DCVA 5A46A 4RLKA 5FXQA 4FSQA 1VYZA 4I23A 4KB8A 4L68A 4D2TA 5HORA 1JLUE 2B7AA 1XH9A 4UBAA 2JBPA 3D5WA 3DNEA 3CLYA 4OTWA 1DS5A 1OGUA 3IDPA 4GVAA 5BVNA 1FVRA 5CYIA 3KXMA 4G9CA 5AM6A 4JNWA 3GCPA 2H6DA 2RG6A 3PSCA 3WARA 3M11A 2CHLA 3PWDA 3QCXA 2J51A 3F6XA 3GCSA 3O7LB 3WF9A 5HX8A 2YM3A 3W18A 5JZNA 3JYAA 2HZIA 2PZRA 2W1HA 1UNHA 5CT7A 4EORA 4JIKA 5HIDA 2GNFA 3OC1A 3Q9ZA 2OIBA 4QMPA 4OW8A 1UU8A 4XLIA 5AWMA 5KMNA 3KL8A 4QP1A 4QPAA 3EN6A 5ANEA 1QPDA 3V8WA 5DBXA 3QLFA 3RAHA 2GS7A 4Q9ZA 3NCGA 4PTGA 5J8IA 2ONLC 3QRUA 4M8TA 1YXSA 3CC6A 5AX3A 5FRIA 1XH4A 4Y5HA 1TQMA 3LFNA 3OS3A 5DT4A 3S95A 5BQ0A 4JBQA 4UWBA 3OY1A 2O3PA 4BYJA 4UXLA 3ZSHA 1UU7A 3U6IA 3GVUA 3OWKA 3MY5A 3T8OA 4G6OA 5FM2A 1XJDA 3O17A 5AP6A 4L3JA 2QLUA 3I0QA 4IX6A 5IH5A 4D58A 5HI2A 2VTIA 3LM5A 4YTCA 3EH9A 3CQEA 3HV4A 1GOLA 1PXKA 4NM0A 4YHJA 1ZYDA 2Y6OA 4X3JA 4X3FA 2R9SA 4BDHA 2BR1A 1FINA 1I09A 4FTAA 3F2NA 2JKQA 4IANA 4W8EA 5BYYA 3U6JA 3B8RA 1ZYLA 2R4BA 4H3BA 4O0TA 2PVLA 4H36A 5LVNA 3NEWA 3KVWA 3A7HA 1H27A 2GNIA 4YLKA 2FUMA 4U41A 3PE1A 4DLIA 3VBWA 3BYUA 2R3RA 4U3ZA 5A14A 2QU5A 2VWVA 5JFSA 3FMNA 1JPAA 4EOMA 3MJ2A 3EQPA 3AMYA 4RC4A 1CM8A 4U3YA 4QQJA 1W2DA 2W1EA 1WBSA 4IWOA 5BUEA 3ZMMA 5HU3A 4IXPA 4M69B 3ZM4A 5CSHA 5AJQA 4FG8A 4MQ2A 3IG7A 3R00A 4P4CA 3DFAA 5M4FA 1WBTA 1UV5A 3PSBA 3A62A 4FTCA 3UYTA 3GU7A 3DB6A 2ITNA 4IDVA 4R3CA 5FLFA 4ZY4A 1H0VA 5DWRA 3MS9A 2FYSA 3MY0A 5IA1A 4QMXA 5AX9A 2IW6A 4PTCA 4CFMA 2FA2A 2QOLA 5AR7A 2JIIA 1OIUA 1FVTA 4L42A 3ZBFA 4ACGA 4MBIA 3GCUA 2W0JA 2YCFA 2XM9A 5T68A 4DH1A 1H4LA 2WXVA 3HDMA 5CQUA 3PA4A 1JAMA 2JFLA 2R3OA 3GT8A 3VW8A 4EQMA 4FNWA 1OKYA 3C7QA 4NTTA 4AFJA 3EFKA 3VNTA 2C5NA 4EK6A 4J99A 3F2AA 2JKOA 3ZU7A 3RP9A 3Q4ZA 4FKRA 1J1BA 3L8PA 4MQ1A 5CX9A 2WMAA 3H9FA 3HLLA 2AQXA 3UG2A 4RIXB 2GHLA 2R3MA 5CAVA 3OP5A 5CEMA 4WHZA 5JGDA 2GU8A 4I4EA 3RPVA 4EH7A 2HXLA 2W4JA 4WG5A 2QKRA 4YZ9A 4CLIA 1JNKA 1ZZLA 4ZSAA 4MK0A 4RLLA 4M7IA 3POOA 2BZJA 4BTJA 4DAWA 3SOAA 2CGUA 1Q5KA 4MXAA 3L1SA 3C9WA 3PPZA 4L3LA 4DN5A 3O8UA 2XIKA 2O65A 2F57A 2W9ZB 2F7ZE 1W8CA 3QWKA 2HELA 4FIIA 4H3QA 4F0GA 3U8WA 5J95A 5CNNA 1URCA 1OUYA 4CFUA 5FG8A 3PP0A 4RX9A 4O4DA 4V01A 3ZXTA 3ZO3A 3FE3A 3KRXA 2RGPA 3NAYA 5E8XA 3NNVA 3KMUA 5D10A 4RBLA 4X2KA 3ZOSA 2XYUA 3QFVA 3QTRA 4RA4A 3QA8A 1RDQE 3TJCA 3TWJA 3V5WA 4IAAA 5LARA 4GK3A 2KULA 4NIFA 4E73A 1DM2A 3H10A 3NYVA 4TYEA 4GRBA 5H8GA 3G6HA 4YPDA 4O91A 1H25A 4C4FA 1M7NA 3EL7A 4MF1A 3I60A 1UNGA 2YISA 3BHYA 3PFQA 4MNEA 5CU6A 4C35A 2HWPA 2XIRA 2OU7A 4OUCA 2J0JA 5LMKC 4PQNA 4L01A 4RZWA 5EM7A 2RL5A 3QRKA 5BX0A 2X39A 2WB8A 2YM5A 3ZXZA 2YIYA 3WZUA 3CTJA 1XWSA 3LQ8A 3DTCA 4FSMA 3RCDA 5M4IA 3COHA 4FI1A 3L9PA 5TKDA 3GEQA 3SC1A 3KKVA 5TR6A 4BI1A 4E6DA 1J1CA 4LUEA 5EYMA 4J97A 4AW0A 3KULA 3N51A 4FZAB 2WO6A 4WUNA 2PVJA 1L3RE 2C4GA 2EXMA 4K11A 4UEUA 3UC3A 2WMVA 3VAPA 4FODA 1FOTA 3CR0A 1STCE 4YPSA 3DT1A 2QONA 3OXTA 4RIYA 4WKQA 5ANJA 1OL5A 2JBOA 4HZRA 3QAME 3CCNA 3AMBA 4J95A 4XNEA 2CGXA 3UQGA 3V01A 2IVVA 4IB3A 3VS5A 5E8YA 3D5VA 1KE9A 5L8LA 2GCDA 1XBBA 3Q9WA 5FEDA 4HVIA 1M2QA 2BIKB 4R3RA 4XP0A 3R73A 4BCJA 4FKGA 2RKUA 2X7FA 3G51A 3GQIA 4FTNA 4FC0A 4J53A 4YO4A 4OBPA 2FGIA 4EL9A 3KY2A 2BRHA 2BKZA 1PXIA 4L8MA 3ZRKA 4FRFA 4ZJJA 2PZ5A 3MJ1A 3DBQA 4CLJA 5LMBA 3AT3A 1XR1A 5FWKK 1PW2A 3A7JA 2R0UA 4FSUA 4Y72A 4MYGA 3VUHA 4C3RA 3II5A 4BGQA 1BUHA 4FKPA 4JVGA 3KMWA 2G2FA 3PY1A 2GSFA 5BVKA 4EEVA 4HVDA 3KCKA 4PL4A 3CPCA 4I20A 4IB5A 4LQMA 4YR8A 5KMLA 3Q2MA 2CSNA 5F20A 3SW4A 4HZSA 1YWVA 3FUPA 2KTYA 4V0GA 4DBNA 2BIYA 4MD8E 3DDQA 4MXCA 4TYHA 4YJTA 3ENMA 3E7VA 3OUNB 4O4CA 2VO3A 2JKMA 3I7BA 5L2TA 2VV9A 5C26A 4KIPA 4DGNA 5EW3A 3D7TB 3TZMA 4ZSGA 5LVMA 2O2UA 3F3TA 4FV1A 4O6EA 5AR5A 1OPJA 4F7LA 4U44A 3QQLA 5KKRC 2B9FA 4N6YA 2HK5A 1B38A 3UO4A 5J9LA 1OKZA 4IQ6A 4BBMA 1KE5A 5CEIA 4FTUA 3OFMA 2BZHB 3V04A 5LWMA 1OECA 3GP0A 4O0UA 3R7OA 3MTFA 3TV4A 2DQ7X 3C4FA 5I9XA 2YN8A 4BCIA 3U4UA 4U42A 2HWOA 4M84A 3BU3A 2IW9A 4LL5A 3TUDA 3ORLA 1K9AA 3BLRA 1LR4A 4APCA 3L8VA 1PXPA 2XK3A 3CE3A 4C36A 5C01A 3ZLWA 4O0XA 3TZ8A 4DG2E 3HMMA 4D5HA 1YI4A 3QKLA 4LRMA 4ID7A 5DG5A 3FYKX 3V6RA 3KQ7A 3O50A 5B0XA 3ZSGA 1FVVA 4GS6A 3ZLYA 4F70A 3ZBXA 3QBNA 3ZS5A 5FTOA 2BRMA 2OFVA 3VS7A 4C3PA 1Q99A 2WOUA 4IVDA 3BLQA 4Q9SA 2BTRA 5CEOA 2R3JA 5HX6A 1APME 3BGPA 3ZZEA 2C0OA 3JXWA 1Y91A 1YXXA 2A98A 3LMGA 3PP1A 4XV1A 4PWNA 4XMOA 4C62A 4C37A 2GPHA 2VO0A 3C4WA 3K5UA 4E4LA 3LCDA 4R3PA 2BDWA 3ACJA 5E1SA 5ACBC 3UNJA 4LGGA 3Q96A 4GYIA 2WQEA 1XH5A 3ODYX 4Y73A 1W83A 5ETFA 4EOPA 2ERZE 4F9AA 4FT5A 3H9RA 4DEGA 1JBPE 3OVVA 1YDTE 1GIHA 2JDSA 4NJDA 3WYXA 4BKJA 4MKCA 1RE8A 1QCFA 1RW8A 4FTKA 4R6VA 1H1QA 2F4JA 2QNJA 2XNOA 4JAIA 4F08A 4M68A 2EVAA 3RAKA 3Q04A 3PPJA 1ZMVA 5HE3A 2WTWA 3DKGA 1Q4LA 4ASXA 3QHWA 4DGOA 4S31A 5GHVA 3VS6A 3PVUA 1W7HA 4FMQA 4TZRA 4OTRA