3L8PA

Crystal structure of cytoplasmic kinase domain of tie2 complexed with inhibitor cep11207
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
308
structure length
292
Chain Sequence
TIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Angiopoietin-1 receptor
publication title Crystal structure of cytoplasmic kinase domain of Tie2 complexed with inhibitor CEP11207
rcsb
source organism Homo sapiens
total genus 89
structure length 292
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3l8pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3l8pA01
3MYGA 3EN5A 1MRYA 5GJGA 3S2PA 4C37A 5HCXA 3TV4A 2OW3A 3V5QA 4AA4A 5M44A 3UNKA 2XCHA 2JEDA 5CS6A 4FV5A 1F0QA 4MD9E 2QOQA 4TXCA 5DHJA 2R3KA 5KZIA 5JZJA 2HZNA 4O7TA 5DBXA 3MA3A 5TE0A 5LVLA 1Q8ZA 4AWIA 3BEGA 3E87A 5DVRA 5HD4A 4FKSA 2NNWB 3PWYA 3PJ2A 3FZ1A 2YM5A 5KMOA 4DT8A 4L53A 5HO8A 4BC6A 1OUYA 4GIIA 2A2AA 2QOLA 4EWHA 5K4IA 3EQBA 1UNHA 2PE0A 3PVUA 3ZH8A 4R78A 3ZXZA 4AF3A 1YVJA 2WIHA 4KWPA 2OKRA 4Y8DA 3PRIA 2PVHA 5CI6A 3QWJA 5L8JA 4FYNA 3BLQA 3IONA 3TUCA 5K3YA 2JITA 4A4LA 4O6EA 3SX9A 2R0UA 1OKZA 5HTBA 4BCFA 3SAYA 3JS2A 5AAGA 2A0CX 2GQGA 3I1AA 4IDTA 4L7SA 3RK5A 3ULZA 3QLGA 4PP7A 4RA4A 4C0TA 2XM9A 3VS1A 5CQUA 2CKOA 2QR7A 2OWBA 3VVHA 4NUSA 1YXUA 4RVLA 4ALWA 3Q04A 4MH7A 4XG7A 4ACDA 4Z3VA 5C9CA 4I4FA 2DS1A 4RIWA 2QG5A 2B9HA 1JQHA 5I9WA 1ZAOA 2REIA 3EZRA 3MB7A 4IJPA 2GHGA 4TKSA 5K4JA 2Z02A 4O7RA 3FSKA 4TWPA 4UWCA 4FT5A 5E8YA 4GT3A 3OY3A 2R7BA 3V01A 4TY1A 4CLJA 2XK7A 2OFUA 3I60A 1JWHA 4S2ZA 4TWOA 4M69A 3BYUA 3NX8A 4CYJA 4CG9A 4TN6A 4XG4A 4IH8A 5EI6A 3G0FA 4DN5A 4ZIMA 4MQ1A 3Q6UA 1KOAA 4EUTA 4QYEA 5AR7A 5GJFA 3A4OX 4QMTA 4MWIA 3TZ8A 3P7AA 3IW6A 3OEFX 5F94A 4ZLOA 3RHKA 3WYXA 2QURA 2BTSA 2Z8CA 3DLSA 3FHIA 3LFAA 3RI1A 4CKJA 3R00A 3OOMA 1Q24A 1FGKA 2NRYA 4I0SA 4E4LA 3MS9A 2QHMA 3FMJA 3BLRA 4KB8A 5FXSA 4WT6A 3CQWA 2OJ9A 2QOFA 3R71A 2GTNA 1JKLA 3PY3A 3TIZA 3RM7A 2WOTA 2GQSA 5E8SA 3QTQA 2Y7JA 5CLPA 4AW1A 4TYEA 2RSVA 3LM5A 2W5HA 2X9FA 5FRIA 4FT9A 1CKJA 4TPTA 3I5ZA 1OIQA 3W33A 2NO3A 2WMXA 3ZYAA 5LQFA 3PA4A 4FSMA 5M51A 5KKRB 5H8BA 2YCFA 4CEGA 3L1SA 4I21A 4YZBA 2XKDA 5AUVA 4UYAA 4HOKA 2UZWE 4FTTA 3V8TA 4AZFA 1WBSA 3DQWA 1FMKA 3DQXA 2B7AA 1H4LA 4NT4A 4BCHA 5J5TA 3VBXA 3R6XA 3JR1A 3LCTA 2C6KA 5AM7A 4E6DA 2W4OA 3K2LA 4KKEA 2OF2A 1IEPA 2EUFB 4JBQA 1O6YA 2B55A 2VTJA 3KU2A 4FKLA 3Q53A 3SKCA 3HUCA 4HVIA 3SV0A 4EZ5A 4QYGA 4FC0A 4ZZNA 1ZYSA 2C5XA 4Q2AA 3W18A 1UWJA 4TTHB 5FLFA 3AT3A 2XNOA 2B4SB 5M08A 1P4OA 5D11A 2BALA 2ZM1A 2Y9QA 5IUGA 4DH1A 2BZJA 2IWIA 3ORNA 3R8LA 4BTMA 4F08A 1KUTA 5AX3A 2XCKA 3LVPA 3BHYA 3IKAA 4V05A 3TV7A 3MH1A 5HNBA 5DG5A 1GZ8A 4M13A 2PWLA 3RCDA 1PXLA 3A2CA 2YIQA 4IZYA 4CRSA 4PL5A 4BGGA 1URCA 4IZAA 3Q9XA 4KKGA 4P5ZA 4DEIA 2JIIA 2JDSA 3DB8A 1ZMWA 3OWJA 4FNXA 5CU3A 3FZOA 2QNJA 3KF7A 3VJNA 4FTLA 4DEHA 4F09A 2HYYA 4MQ2A 4O27B 4IEBA 4KBAA 2FSTX 4YJNA 1OKWA 5DRBA 3IW5A 2I40A 2PZPA 2PVMA 5E91A 4X2NA 2F7ZE 2QCSA 5D12A 2YLEA 1U5RA 4RRVA 2XKCA 2IW6A 5A4QA 3BWFA 4L3JA 4ACCA 3TN8A 1J1BA 2W1GA 2BHEA 4JLCA 3PWDA 2UW3A 1LEZA 4JS8A 5TR6A 4P90A 5CAVA 1QMZA 4JRNA 5CAQA 3P23A 4I23A 3DNDA 4FTNA 2R3FA 3PXYA 3UDBA 3CSVA 2QKRA 2UW6A 5LVMA 1JKSA 2YM7A 3LXLA 2BRNA 3M2WA 3OHTA 4FV0A 4W8EA 2F57A 2NRUA 3KEXA 4LG4A 2HZ4A 4X6RA 5LXMA 4FV2A 4DFXE 4QQJA 3FBVA 3RPVA 1KOBA 2A1AB 4G5JA 5AP7A 5CVHA 5AV0A 4HVGA 2VN9A 4FTRA 1BYGA 4C02A 5L6PA 4ZLYA 1JBPE 3A7JA 4O7YA 2ITZA 5HG9A 4IAIA 4DGLC 5CU6A 1FOTA 4D4RA 4UN0C 2Y4IB 3K5VA 3R22A 4ZTSA 4PTEA 4NFMA 1H24A 3R63A 4KUJA 4H58A 4L01A 2G1TA 5A9UA 4KIOA 5B0XA 3V5PA 2Q0NA 4IVDA 4OUCA 3ATTA 4QOXA 4EH8A 4FOBA 5AIRA 3P9JA 1M2QA 2PVRA 5CTPA 5K5XA 4FZFB 2C30A 1YHSA 3TI1A 3TWJA 1REJA 3VUMA 3WE4A 2ETMA 3L9PA 1PKDA 2W4JA 1FVVA 3ACKA 1JKKA 2QONA 5C8MA 4AOTA 1URWA 4ZZOA 4OT5A 3EN6A 4AW2A 4FL3A 5BYYA 3ID6C 3RPOA 2ZM4A 2R2PA 2YCSA 4JG6A 4E1ZA 5BMSA 4MYGA 4GVJA 4BWXA 3ZRLA 3VRYA 3FMHA 3MY1A 1M14A 5CEKA 1ZXEA 3NUXA 4G2FA 4QRCA 4XP3A 3VC4A 3U54A 2C6TA 3G6HA 1ZYCA 1RW8A 1B38A 3PXZA 3QLFA 3FMLA 4WSYA 4FEQA 3CPCA 2VV9A 4NW6A 5CU2A 3UZPA 1U5QA 4BKYA 4IZ5A 2FYSA 5C1QB 1PMNA 4ZP5A 3BHUA 2C5OA 3E63A 3MVMA 3BHHA 3EMGA 1Q5KA 3GU8A 1H01A 3QALE 3QTSA 4EHGA 4E5WA 4J71A 3N4VA 2YERA 5KMMA 2JD5A 3R1NA 5I9XA 1PXIA 1YI6A 3BV3A 4RMZA 3KN6A 4D4YA 4IB0A 4L52A 3SDJA 3VUGA 2X8EA 3S3IA 2QOHA 2PUUA 2R3QA 1AD5A 2VWVA 2VX0A 3PLSA 3CKXA 2I7QA 5CY3A 3R9OA 5DN3A 3PP0A 4ZLZA 4KD1A 4I4EA 3DTWA 2R3PA 3GUBA 2X1NA 3EIDA 3QAME 2GQRA 5CASA 3SHEA 2C47A 3WBLA 3A62A 4J97A 4PX6A 1W7HA 4F7NA 4ALUA 4EOKA 5CEPA 1P2AA 1ZWSA 5L2WA 3DGKA 5AP2A 2CLXA 4EJNA 4JX7A 5JFWA 5EKOA 4F65A 4IVAA 3K5UA 4ZJJA 1R0PA 4EI4A 4DLIA 3ZBXA 1SVEA 3EKKA 3PTGA 3RGFA 4E26A 1PXMA 3TUDA 3ALNA 1PXJA 1V0BA 3N9XA 3ZM9A 5C26A 2RL5A 4XYFA 5IQCA 5JFVA 1ZOHA 5J5SA 4HNIA 4J8MA 3P5KA 4KRDA 5E90A 3RBWA 4IM3A 4CG8A 3R8VA 3ZC5A 2QODA 1T46A 1PKGA 4YJUA 1J7LA 3F2AA 4H3BA 2EVAA 1R39A 4FKGA 4XBUA 3OCSA 1V1KA 4BIDA 1HOWA 1YW2A 2WQNA 5A4EA 5FD2A 2W1EA 3GU4A 5FQDC 1YI3A 2H8HA 2IVTA 4GW8A 3FZRA 5LCKA 3WIGA 2EWAA 5F9EA 3IECA 3GVUA 2ITNA 1MP8A 2BIYA 1R3CA 5T6KA 3BGQA 4GU6A 2X7FA 4TYGA 3SA0A 3U6HA 3TUBA 4O0SA 2PMOX 4FTKA 4NIFB 4E5AX 2BRMA 2J90A 2XMYA 4GEOA 4O0WA 4TWNA 3UP7A 1GIIA 2O2UA 4PDPA 2WD1A 3NR9A 4BN1A 2A27A 2W7XA 3ZSHA 4E7WA 1P4FA 1K2PA 1U59A 2OZAA 4QTCA 4XJ0A 4FL1A 3F82A 4G34A 3LFNA 4AOIA 4Q9ZA 2C6IA 3WZEA 2BAJA 4LMUA 2BAKA 4N0SA 3ZHPC 4NU1A 4E3CA 4XH6A 4D0WA 2VAGA 2JKKA 2XKEA 2A4LA 2ITWA 3PSDA 3BX5A 4ZTHA 3DCVA 2OJIA 3RCJA 1TQIA 2OU7A 3E5AA 2XRWA 3GU7A 3AQVA 2W5AA 3GEQA 2PVFA 4PMMA 1PHKA 4N6YA 4NSTA 4XV9A 2PL0A 4U3ZA 5DT0A 4EOSA 2YWPA 4Q5EA 3CD3A 3NW5A 5HZNA 4I5HA 4MNEA 3K3JA 3VHEA 4CMUA 4DGNA 5HVKA 3LJ2A 2BCJA 2WMQA 3HA8A 4BDJA 4PMSA 2HZ0A 3TJDA 4BBMA 3ANQA 4H05A 2JIVA 2WMWA 1JSUA 3WOWA 4CRLA 4EEVA 3BEAA 1U54A 3GCUA 3E8CA 3R1QA 3EH9A 2BFXA 5JQ8A 4II5A 2PU8A 4YZ9A 1OGUA 3G51A 3TACA 5DR2A 5LMKC 4HYIA 3HDNA 4AX8A 5JH6A 3V04A 2P2IA 3LM0A 3NCGA 3DJ7A 5I0BA 4XLVA 3EB0A 2JKQA 1SZMA 2PZ5A 2XEZA 1OKVA 2PE2A 3AD6A 3HMNA 5AMNA 4DFYA 5ITAA 5JZNA 3DNEA 3QKMA 2RKUA 3F66A 3MW1A 4H3PA 4HGEA 5AV1A 4BL1A 1M7QA 5AUXA 4FBXA 4BIEA 1K9AA 4D1SA 3RNIA 2XIKA 5D10A 3VIDA 4O2ZA 3OUNB 5FG8A 4RC2A 2JIUA 3MIAA 5T68A 4GCJA 2B9JA 3RVGA 2E9UA 2ZVAA 5AFVA 3MH3A 4DFNA 3FL5A 5L2IA 4GK4A 1H27A 2OH0E 3A7IA 3QCYA 5CF8A 4UEUA 4D5KA 2WPAA 4GYGA 5EOBA 4EBWA 3IG7A 3Q2JA 2HY0A 4L7FA 3FQHA 3A60A 5JN2A 4J95A 5IA2A 3HP2A 4FTMA 2HY81 3TIYA 4NKAA 4UMTA 3NMUF 1NT2A 1YHVA 4FV3A 2YZAA 3GNIB 3QZGA 4EQMA 1IA9A 1CM8A 1YXVA 2PZIA 4G6LA 4CXAA 4E6CA 5HO7A 2VO0A 4TWCA 5EG3A 5D9HA 4FKQA 3Q5ZA 5JGDA 4NM3A 5IH6A 5M4FA 5M4UA 3MFRA 2IZRA 2Z7RA 4K33A 2B54A 3FUPA 1XO2B 4YTIA 2ITYA 4CFUA 5C8NA 2HZIA 4GUEA 4FIGA 4RJ7A 4FF8A 2ZOQA 4YJVA 3RPSA 5L3AA 4DTKA 4RIYB 3R7EA 4D5HA 2ZV8A 4FTIA 4WD5A 3ROCA 1Z5MA 4C3FA 4HZSA 4TYHA 3H9OA 4QP1A 4ORKA 4RT7A 3IO7A 1NVQA 2X6EA 3PJ1A 4WHZA 4XOZA 3LFBA 4ANQA 1KE9A 1Q97A 3D15A 3FMEA 3DOGA 3I6UA 5CT7A 4DEEA 4BGQA 2HENA 3R7GA 3CR0A 4LRKA 1I09A 3D5VA 4RSSA 3MPMA 3VS2A 2C3JA 3CJGA 2W1HA 3CXWA 3FEGA 4IE9A 3D94A 3AOXA 3LCOA 5AR3A 2VTLA 5HVYA 2WEIA 3A8WA 3BQRA 4NTTA 3ORIA 4JDIA 4MBLA 4ENXA 2G2IA 2IPXA 3ZDIA 2Z60A 4MEDA 4X2FA 2RFDA 1E9HA 3ZLXA 4ERWA 4RG0A 4QP4A 1O9UA 3VBYA 4IAFA 1I44A 3D7ZA 1P14A 3CBLA 3MN3A 2IZUA 4EH7A 2HW7A 4CCBA 4KA3A 4ZK5A 3PPZA 3II5A 3OWPA 4N57A 3HV3A 3ZDUA 5E7RA 2WTWA 3QKLA 4FTOA 4HGSA 2C69A 4BVUA 2QOBA 3GB2A 2FO0A 5IQGA 4C61A 2HK5A 5CF4A 4E5BA 4AN9A 3GQLA 4FG8A 3ZOSA 1MRUA 5KBQA 3CY3A 3FKLA 4AGCA 2QOOA 1DS5A 3DDPA 3PRFA 3F88A 4O86A 2BZKB 2JAMA 5ETCA 2O0UA 5HESA 4F6SA 3LQ3A 3AMYA 5IA0A 1LR4A 4J98A 4LMNA 5B2MA 3L8PA 3ERKA 2WELA 3OUKA 4GK3A 4H1MA 3GCVA 4EC9A 2X6DA 1YDRE 2WGJA 4G9CA 2C5VA 4R1VA 4HNFA 4E4XA 3NPCA 4KSPA 4QMMA 3OF0A 4C7TA 4RLLA 2B0QA 1U46A 2OICA 3HDMA 3PG3A 3SC1A 4EHEA 2KTYA 2J6MA 2VTMA 2X9EA 3F5PA 3R1SA 4WBOA 2OZOA 2ITUA 1ZARA 3QRTA 5D1JA 3UOLA 3Q2MA 4I6HA 4F7JA 4G5PA 2XNMA 2AUHA 2P4IA 2WNTA 2WTCA 3EN9A 2V0DA 3MA6A 3R9NA 4C4EA 4YUQA 3ENMA 4ACMA 1HCLA 3HNGA 4U40A 5FEEA 4BBFA 2F2CB 1XH7A 2QOCA 3D7TB 3REPA 2UW0A 4L3LA 3VAPA 1KE8A 3PUPA 4XMOA 4G3FA 3LHJA 4GJ2A 4GV1A 2GNHA 2QD9A 3BPRA 4C58A 1CMKE 2WAJA 3VJOA 4F9BA 5M07A 2PMLX 2PZYA 3E93A 2C6DA 3EOCA 4KIPA 5TOZA 3C0IA 5KHWA 3KY2A 5CNOA 3QC4A 4D0XA 4F70A 4M67A 3R7UA 3SLSA 3OW3A 3EFJA 3WILA 1H28A 3QGYA 4U3YA 3JVRA 3C4EA 4RX5A 3WF7A 3BYSA 3I81A 4QMQA 5HICA 3HV4A 4IM2A 4ZXTA 3MWUA 4BCGA 3FMNA 4O81A 4HCUA 4JG7A 4DEDA 2QHNA 2WZJA 4MVFA 3D0EA 3LZBA 5IEYA 1Y6AA 3Q32A 2GNGA 4O7SA 3KGAA 2BVAA 3R01A 4U41A 3PZHA 4OAUC 3NUAA 1V0PA 3H0ZA 2CMWA 5DI1A 1RJBA 2VNYA 4FODA 4ZOGA 3F7WA 4YSMA 5IISA 4CFFA 5IA3A 4YJSA 2VTNA 2W17A 2ONLA 4IM0A 5FXQA 4AQCA 3O50A 3WARA 4F6UA 3O8PA 1WVWA 2BTRA 4L8MA 3VHKA 5H9BA 4HVDA 3UO6A 4DHFA 2VO6A 2UV2A 5EHOA 4DC2A 4F1MA 5IU2A 5FDPA 2BAQA 1REKA 2KULA 5IQAA 4AU8A 2J7TA 2G2HA 3PP1A 1VEBA 2P55A 1JNKA 4MD8E 5DT4A 1UU8A 5BNJA 4I41A 1ZYDA 4GIHA 4U97A 1QPEA 4I94A 4ZY5A 3NSZA 4TYJA 3QWKA 1IRKA 3ORMA 5EHYA 1QCFA 4EWQA 5AR5A 4CTCA 2YAKA 3LFDA 4KKHA 4DCEA 4W4WA 4G3GA 2PULA 2UW5A 1KE6A 4L9IA 5EK7A 4EH6A 4ID7A 4JRVA 4QPSA 3TT0A 2GFSA 4EYMA 1UVRA 4BI0A 3QZHA 5HNIX 2A19B 3BGZA 5J8IA 1SNXA 4ZTQA 3TKHA 2BRGA 2EB2A 4M15A 3M42A 5HE2A 2E9PA 4HPUE 3G9LX 4QMPA 4Z9LA 4EK8A 3R1YA 4F1TA 3Q6WA 3PXRA 3AXWA 5KE0A 5HIEA 4UV0A 4FT7A 4LQMA 5IMXA 3NZ0A 4F6WA 2G2FA 4ITIA 4IC7A 2GS6A 5EW3A 4A9UA 2W1IA 4C34A 4K18A 4E93A 2R0IA 2PHKA 5BYZA 1PW2A 4I5CA 4IVCA 3T9TA 3WF6A 3DZQA 5J7BA 1Q41A 4H1JA 1W98A 2EXMA 2XIXA 3BV2A 3PE2A 4K6ZA 4MXCA 5ANGA 4O0UA 3CGOA 2YABA 3V5JA 3QRJA 3R8PA 3G0EA 4QMNA 3GENA 4IAYA 2ZMDA 5DA3A 5H3QA 5E4HA 1BL6A 1KV2A 3TNHA 2X8DA 5AP5A 1JSVA 3ZO2A 2PY3A 4RQVA 3O0GA 4MF1A 2YZLA 5ETFA 1QPDA 3ZRKA 3OXIA 1YOLA 3D83A 3Q60A 1WBTA 4BCMA 3O51A 4S31A 3V5LA 5GIPE 4WIHA 1Q61A 3WF9A 3AMBA 4GVAA 1QPJA 2Y4PA 4BHNA 3CIKA 2QC6A 4YLKA 4E6AA 3UNZA 4BIBA 1W83A 4EK5A 5M57A 3UZRA 4DBXA 5AUZA 1G8SA 2HXQA 4RFZA 5CZIA 3SOCA 2GS7A 5J79A 3EQIA 3FJQE 3I5NA 3ZSGA 1ZMVA 5A4CA 3KRWA 2CGUA 4Q5HA 5CSXA 4XV1A 2J2IB 2DUVA 4BI1A 2YIXA 5HQ0A 2VO3A 4XNEA 4F0GA 3PVGA 5GIOE 1NXKA 4ZSJA 5E92A 3KRRA 2YEXA 2PVLA 4U5JA 4D2VA 2P33A 3KRJA 3NWWA 5HX6A 3W2CA 2BR1A 2X4ZA 1ZYJA 3FE3A 3ODYX 4B9DA 4UXQA 2PZRA 3MJ2A 2B9IA 2F49A 3FI2A 3ZO4A 4PTGA 4B6LA 4FSRA 4KBCA 3DZOA 4K8AA 4BI2A 3FI3A 2W96B 4Z7HA 4X3FA 5M55A 4E4NA 3F6XA 4GH2A 3V5TA 3C9WA 3MVHA 4E8AA 3BGPA 3VS0A 5A54A 3UO5A 3QQFA 3ZONA 2CKEA 2OIQA 3R9HA 3CEKA 5AAFA 4YO6A 2VTIA 4D9UA 5BQ0A 3WI6A 1M52A 2ZV7A 4YJQA 3NUSA 2Z7LA 3LQ8A 3RINA 3NNWA 5AP6A 3F2RA 4PPAA 2WMUA 3IW8A 3ENHA 3NUPA 4MXYA 3KXMA 4FTUA 2X2LA 4EK6A 3LMGA 1FMOE 4Y5HA 3FLYA 2BZHB 3QD2B 4RJ8A 5EDQA 1FVRA 2PUPA 3F3WA 2VWXA 3LIJA 4HYHA 3QZIA 3FY0A 4RX9A 3FHRA 4CYIA 4L68A 1ERKA 4AAAA 4QPAA 3VUHA 5BPYA 2CKPA 1Q4LA 4FL2A 4QP2A 4C4IA 3VUDA 4DH7A 3EKNA 4WNPA 4RGJA 2XYNA 2XZSA 4AOJA 4B8LA 4DBNA 4A4XA 2OI4X 4GFOA 1J1CA 4WNMA 4C8BA 2PVJA 5BUJA 3L8SA 3PG1A 1ZYLA 2R3LA 2O3PA 3JXWA 3R04A 4IACA 4U43A 3NAYA 4IHPA 4ZTLA 3R8MA 1OECA 2R3RA 5HX8A 1PRYA 4XRLA 4DFZE 2R64A 1GZKA 4DG3E 1J7UA 2ITTA 3ZZWA 5AUUA 3V8SA 5DT3A 5JGBA 3C13A 3PPJA 3QQHA 4V0GB 3TTJA 3OCBA 4YMJA 2JFMA 3VRZA 2X39A 3VF8A 4G3DA 2CJMA 4PF4A 3O71A 3OFMA 2DYLA 4E73A 1XH6A 5DLSA 4QTBA 2PMIA 1YOJA 3L8VA 5KMJA 4D2RA 3POOA 4FSTA 1YXXA 1DI8A 4EH4A 2PE1A 2VTSA 2J5FA 4WA9A 2WMSA 4HYSA 4IWQA 2X2KA 4V04A 4XV3A 3KK8A 2VX1A 3SXFA 4BDGA 2OJGA 4FEWA 3PSCA 4OBPA 5CZHA 3F5GA 5C8KA 4CT1A 2WHBA 2R9SA 3QRIA 4I0RA 4FEXA 4GT5A 4GFGA 2WTKC 2E9VA 3GCSA 4D2TA 4BDEA 2O8YA 1H25A 3H30A 4WUAA 5A3XA 4M97A 3DAKA 4FIIA 4EZ7A 4JDHA 3OW4A 4CZTA 4G31A 2YM6A 2BDFA 3T3VA 1OMWA 4MD7E 4MXAA 4QP3A 4K2RA 3QCSA 4JQ7A 4RWIA 4B4LA 3EL8A 4MF0A 4EOPA 2ZM3A 4UMQA 3RWQA 4AGDA 3U87A 4DGOA 5B2LA 4ASXA 4ANLA 4KIKA 1CTPE 5A6NA 3V6SA 3O8UA 2GHMA 5AUYA 3FLSA 5L8KA 2Q0BA 2YLFA 5HIDA 1SNUA 3A8XA 3VN9A 5AP1A 4Y46A 4O7WA 3RALA 4FNWA 4CLIA 1GJOA 2V62A 2RFEA 4I93A 3QHRA 2OIBA 2R3NA 4FEVA 3A7FA 5HE3A 3C4XA 1ZY4A 2CHLA 3DXNA 3IGOA 4IDVA 5DR9A 5EI8A 4DYMA 3G6GA 2X8IA 3V6RA 2CCHA 4EOIA 4G16A 5JEBA 5JK3A 1A9UA 4RWKA 4ZSAA 5IA1A 3P08A 4LV5A 4QMLA 4DH3A 4YO4A 4DF3A 2J0MB 5IH4A 2ITXA 4FT3A 3CS9A 4OBQA 4I20A 3D4QA 4KBKA 4ANNA 3FKNA 2UZUE 1GNGA 2HELA 3ZRMA 2IN6A 2J5EA 2ZV2A 4D9TA 4AZSA 1WAKA 1JLUE 3HYHA 4KAOA 4M0ZA 3HV7A 3T8OA 3U6IA 1YOMA 1Y91A 3GOKA 1R0EA 3L8XA 2VZ6A 4MKCA 4MK0A 3R8UA 3UVQA 2Q83A 4R8QA 5BVFA 3P4KA 1UKHA 3NGAA 3PVWA 3Q9YA 3DBFA 4EOOA 1H0VA 4KRCA 3QA8A 5LVNA 5AP0A 2VTPA 3E8NA 4YPDA 3U4WA 3D14A 3HRFA 3I0QA 4PPCA 5E9EA 2CPKE 4MX9A 2V7OA 4IQ6A 3MY5A 4IAAA 1G8AA 4FKTA 5AR8A 1WVXA 1UWHA 4JX3A 3DBCA 5ANDA 3I79A 3NDMA 3EWHA 4Y72A 4EOQA 3EQCA 4P4CA 3KRLA 2GDOA 4O7ZA 2W1CA 1SM2A 1M2PA 1BI7A 4FKPA 2XBJA 4C38A 4C4FA 1FINA 3OP5A 4S34A 4C3RA 4A9YA 4DTBA 3FC1X 4FK3A 3R28A 5G6VA 3MB6A 1X8BA 3U8WA 2BUJA 3QUEA 3RMFA 2BIKB 3MSSA 3A4PA 4YBKA 4FV6A 2WMTA 5GZ9A 5CX9A 4U44A 4BWPA 3BYVA 5EHLA 4ZSGA 4F7LA 5T3QA 4W8DA 4ZZMA 3C7QA 3TCPA 2GCDA 3KXHA 3A61A 3U6JA 2W9FB 4GG5A 3SVVA 4DITA 4S33A 2OO8X 2W99B 3IS5A 3EJ1A 1Q8YA 2ZAZA 3R2YA 4Z16A 2VWYA 2X2MA 3HLLA 3DBEA 2YCQA 3AC3A 4BCKA 4BZDA 5M06A 2OZAB 2WFYA 2WQMA 4FV1A 1JVPP 3VF9A 2QR8A 3GC0A 4RVTA 2YM4A 1F5QA 1QL6A 2XIRA 3P7CA 4QQ5A 5HEZA 4CFXA 3UTOA 5J95A 4V01A 4UMUA 5LMBA 3DJ6A 3LXPA 1WBNA 3F7ZA 5CAUA 5CAOA 3CY2A 4D2SA 4Z55A 4E6QA 5EQYA 4FKIA 4H39A 3HMPA 3OCGA 1T45A 2UZDA 1JPAA 4RJ3A 1J7IA 4QP6A 3OTVA 1VYWA 4FSZA 4G6NA 1NVRA 3E64A 4MNEB 2AC3A 4WBBB 3THBA 2BKKA 4I5PA 3TDWA 2IG7A 4BTFA 2ERKA 4O7LA 5IG1A 1M7NA 2ONLC 3QXOA 5JFXA 2YITA 2I0EA 4QD6A 2HWOA 1U54B 4DEGA 2YIYA 4E20A 2GPHA 2JKOA 3D5XA 4J96A 2VUWA 5L6WL 3COKA 4RZVA 3B2WA 3DKFA 3NS9A 2EXCX 4IJ9A 4IFCA 1A06A 4K1BA 3UIBA 2P3GX 3RZFA 3ZUTA 5GNKA 4YR8A 3SW4A 3QTXA 4J52A 3P86A 3S0OA 3ROYA 1G3NA 2IW8A 3MBLA 4O7VA 3D5UA 3RAIA 3VS4A 3D5WA 3NUUA 5C4LA 3IQ7A 3ZO3A 4D2PA 3T9IA 5LVPA 4L46A 4MBIA 4CFVA 4AW5A 1IG1A 4LV8A 3EQDA 4FNYA 2ETRA 3FAAA 1S9IA 4UWBA 4NCTA 4E4MA 3Q96A 2PVKA 4IB5A 4BTJA 2PUIA 5A4LA 3KMWA 4IIRA 4C2VA 3LMIA 1CSNA 2XUUA 3R9RA 5HO6A 5BUIA 4R7BA 1OL6A 2PMNX 3B8RA 3NIEA 2WMBA 4WKQA 5C4KA 4QQCA 2VWWA 4FG9A 5ACBC 2YN8A 4LGGA 3AC4A 3KCFA 2QO2A 3PIXA 3QQGA 4O1OA 4XUFA 4ZS0A 5FGKA 5CEOA 2P0CA 3GC9A 4JXFA 4Y5QA 2UW4A 5C03A 4LL5A 3F3TA 1WFCA 4FKWA 4ZSLA 5L8LA 5HKMA 3R02A 2QLQA 2R3MA 3H3CA 3KVWA 3LFEA 3OEZA 4L44A 4MWHA 4QMZA 5DE2A 4F0FA 1ZLTA 2VWBA 5J1WA 1H00A 1KSWA 2IVSA 4DINA 4DCAA 5E8VA 1R78A 4GYIA 4UBAA 4BR3A 2NPQA 3O96A 1DAYA 4H3QA 1DI9A 4FK6A 4XBRA 4HYUA 2I0VA 3RHXA 4B0GA 3HRBA 3C51A 3DXPA 4TNDA 4DT9A 2BPMA 1UNLA 4HCTA 3DXQA 3I7BA 5EYCA 5HVJA 3VBWA 4D1XA 2WMRA 1PJKA 3LCSA 4IX4A 3ZTXA 3V8WA 1Y8YA 5GZAA 2VWIA 1TQPA 5LCJA 3HUBA 2WTKB 4CZYB 1Z9XA 2XF0A 3SG8A 3HA6A 4UYNA 5IZFA 2UZLA 3C4ZA 4FSYA 3LFSA 4DH8A 2V55A 3G90X 5E8ZA 4W4XA 3CQUA 3PIZA 3EQHA 3OXZA 5CSWA 3QXPA 3NCZA 4RBLA 3LKMA 5CEIA 1ND4A 2O5KA 5JGAA 4BDHA 3MGYA 4O6LA 1UNGA 2BHHA 4KSQA 3W2PA 4BBEA 4EOLA 5L2TA 4ZMFA 1KV1A 2RF9A 5I3RA 5HTCA 3QQLA 3N51A 3DFCB 1BKXA 2QOIA 3GQIA 4R1YA 4DGMA 3NW6A 1IAJA 4J7BA 2UZBA 3PA5A 2PYWA 4IWOA 4IMYA 4R77A 3UG2A 4RX8A 4XRJA 4CV8A 4I22A 1YQJA 4Y95A 3GOPA 5CU0A 1BLXA 5I9YA 1RQQA 5HI2A 3EN7A 4O96A 4RWLA 5J87A 3KQ7A 4YU2A 5CYIA 4KABA 1BX6A 2J0KA 1PMUA 3HV6A 4UB7A 4GK2A 2VD5A 4CSVA 1OL7A 4NIFA 5IA4A 1PF8A 5FM3A 4O7NA 1KE7A 3EYHA 4EK3A 4PNKA 4AACA 3COHA 2C0IA 2QKWB 2G01A 4EZ3A 5ANKA 2OSCA 3I4BA 1R1WA 4FKJA 3RAWA 3TXOA 1Q8UA 4MXZA 4AG8A 2YWVA 2JLDA 2ZV9A 3MTFA 3OTUA 3PZEA 3UMWA 4PY1A 4BDDA 1XH9A 4U6RA 4DEAA 4G3EA 3F61A 3FWQA 1J91A 4AN2A 1JOWB 1Y6BA 2WIPA 4JNWA 4YC8A 5HG8A 4OTQA 4CMOA 5KUPA 1FBNA 3L9MA 4BDCA 3DBQA 3TV6A 3PXKA 3RNYA 4IZ7A 3LFFA 5E8UA 3RPRA 3SRVA 3ZC6A 1GY3A 4MHAA 3DK7A 3VW6A 2E9OA 3BU3A 2GNJA 4RX7A 2CNQA 4YPSA 4ITHA 3GCPA 4QYFA 1O6LA 2OXYA 4I3ZA 2J0IA 3CQEA 5CALA 4H36A 4OTPA 2IW9A 4BYJA 5ETAA 4EHZA 4RC4A 4EOJA 3DBDA 3HAMA 1UU3A 5HCYA 1SVGA 4KINA 4R5YA 1WBVA 4JOAA 5I9ZA 1E1XA 4RWJA 5BVOA 2QLUA 4AP7A 4R5SA 4P2KA 3CTJA 4A07A 4GKIA 3UQCA 4USDA 3VUIA 2UZOA 5HE1A 5HLPA 1H1SA 3VULA 2W5BA 2XM8A 1DAWA 4LYNA 3GFEA 3F3ZA 3GP0A 5TKDA 1W82A 3QX2A 4FZ7A 3M11A 2V5QA 4FIEA 3NYXA 2W4KA 3W2RA 1OPLA 5IQDA 3O8TA 2JKMA 4C2WA 2VRXA 3ZMMA 4FGBA 3BBWA 3DKOA 4A9SA 4OR5A 3EQGA 1GAGA 3GU5A 3R21A 3LCKA 3EQRA 4HCVA 5CU4A 3OC1A 2C4GA 2EB3A 3B8QA 5AM6A 2IO6A 2YIRA 4L45A 3UVRA 3KULB 4ANSA 1JKTA 3BYOA 2W05A 2YJRA 3HP5A 2XRUA 2WB8A 4QMVA 4RIXA 3CTQA 3UOKA 3W55A 2OBJA 5LVOA 4EQUA 3NNXA 3QF9A 5CF6A 2VWZA 5A46A 4OAVB 1YKRA 3AD5A 2BDJA 2C0OA 2WTVA 4JQ8A 5FP5A 4FSQA 4AN3A 1UU7A 1TKIA 2NP8A 3EYGA 2ZJWA 1GIHA 4NWMA 2ZYBA 4PNIA 4N70A 3RTPA 2YA9A 3BU6A 3IDPA 4NZWB 4UX9A 4X3JA 4M84A 2B1PA 3HGKA 1NA7A 3W32A 3TDVA 2XNBA 2XKFA 3W8LA 3FI8A 2JBPA 3DK3A 3L9NA 4HJOA 3ZU7A 3UC3A 3G9NA 5HLNA 2WTIA 4DA5A 5FBNC 3BE9A 4EH5A 4RIYA 2X7GA 1OPJA 2CDZA 3ORLA 1CKPA 1IASA 2R3HA 4ACGA 5KHXA 4DE4A 2FSOX 3NVKI 5ETIA 5IEXA 5AA9A 3ETAA 3R9DA 3FMKA 4CFWA 3R2BA 2QVSE 2XIZA 1TVOA 3VWAA 4CKRA 3HVCA 4N6ZA 4MAOA 4JR3A 2JAVA 4QP9A 1FGIA 3VUTA 1IA8A 2X4FA 3GT8A 4ZS4A 4PDSA 4JQEA 3KXZA 1OL2A 2BRBA 2WEVA 2QO9A 3OT8A 4P7EA 4GU9A 5HGIA 4XS2A 3BELA 3ALOA 3IGGA 3UVPA 4B8MA 3DU8A 3SXRA 1APME 2XJ1A 2VU3A 4FV4A 2ZDUA 5HD7A 3EFKA 4M66A 4I92A 5EDRA 2GS2A 2XJ2A 3DPKA 4U81A 4LUDA 4QO9A 5GHVA 2JDRA 3GC8A 2ERZE 3BBTB 2I0YA 2AC5A 3FYKX 4OTHA 3QCXA 4KS8A 2YACA 1H1QA 4NM7A 3MY0A 4AW0A 4C35A 2CGVA 4D4VA 2QU6A 2YJSA 3ZSIA 2C0TA 2O63A 3IW7A 3FXZA 4D58A 3KXNA 4C4JA 2WKMA 4O83A 4EHVA 5L2QA 2VTHA 3LLTA 1XBCA 5FP6A 1S9JA 2XNEA 3MFUA 4XV2A 4CFMA 3VQUA 5EFQA 5EDPA 4FVPA 2JGZA 5F20A 5IA5A 2WXVA 5LOHA 2X7OA 3CPBA 4F7SA 4F63A 4FIJA 4BFMA 4FTQA 2GHLA 2QU5A 3A99A 3LFQA 4AA0A 3CGFA 5J1VA 3AT2A 3W1FA 4G9RA 3TKIA 5KMKA 1PXKA 3ZZEA 3P78A 5EYMA 2P2HA 3Q4CA 3R7VA 2CKQA 5IQHA 4ANBA 2H9VA 3P0MA 3QGWA 4JAIA 4JJRA 5CNNA 2GFCA 4YC6A 3ZLWA 4AE6A 1GZOA 4JBVA 2CN5A 3S95A 4F0IA 2OGVA 4MCVA 3HV5A 1OL5A 3E7VA 5I9UA 3UE4A 4BCNA 5HBEA 4AGWA 4GRBA 4QMOA 5C01A 5JMSA 4TZRA 4FUXA 5FEQA 1CKIA 3WIKA 3TM0A 5JFSA 5DEYA 2UW7A 3KMMA 5K0KA 3O2MA 3KRXA 4NW5A 4PUZA 2OF4A 4WG3A 3LAUA 3SOAA 4YHTA 4FV8A 2VTRA 3DY7A 1H0WA 5FWKK 5BVWA 2YM8A 4GT4A 1OVEA 2VTTA 4OTDA 4DG2E 5IQFA 4QMYA 3V3VA 5M53A 5HNGA 4BCPA 1PYEA 4R6VA 3DLZA 4G3CA 4RIWB 1B6CB 1P5EA 2CLQA 4CD0A 3HMIA 5AUWA 2RGPA 3D7TA 3OG7A 3OD6X 3AGMA 4F1OA 4LOOA 2FSLX 3BQCA 1BL7A 3BLHA 4M69B 4PRJA 4XG9A 5GINE 3KL8A 3QQUA 4IAZA 4OLIA 3ANRA 3ZEWA 3KFAA 4LGDA 3P1AA 3F3UA 3WZJA 3ZUUA 1H1WA 2OG8A 4BDKA 3ODZX 1VYZA 2B53A 1XKKA 1CDKA 3LFCA 3GCQA 3ZFMA 1WBPA 4IWDA 3F2NA 3S4QA 4LGHA 1H8FA 3KKVA 4C57A 5JQ5A 3OWLA 1M17A 3KCKA 3QZFA 4L67A 4UMPA 3VNTA 5EKNA 1B39A 5DRDA 3OVVA 3UNJA 3ZLSA 2QOKA 4WNOA 4RPVA 4P5QA 4APCA 3HMOA 4FICA 4IB1A 5I3OA 2IJMA 3R83A 1PY5A 1YWNA 2ITPA 3UYTA 3JVSA 4QMXA 3R8ZA 4B7TA 2HW6A 4C36A 4J8NA 4QMSA 2VTQA 3UIXA 1XQZA 1OL1A 3Q4UA 4QT1A 4RIOA 5F4NA 4YNOA 4EBVA 3HAVA 4LUEA 5HBHA 3FPMA 2HWPA 3ZS5A 3DAJA 4X2GA 3MFTA 2WU6A 4FZDB 4RJ6A 2GMXA 5E1SA 4JI9A 3CLYA 4BB4A 1F3MC 4BCQA 2R4BA 4W9XA 4NL0A 2C3IB 5TF9A 4AS0A 3QYZA 3FKOA 4NCTC 4U0IA 3UJGA 1OIUA 5IUIA 5I9VA 4EH2A 3GI3A 4DFBA 3VQHA 3E8DA 5LMKA 2CNUA 5AADA 4ZTNA 3QRUA 2XYUA 4PV0A 4ARKA 5BVNA 3O17A 3UIMA 2Y6OA 1PXNA 2H96A 5FUTA 2FGIA 3ET7A 5AR4A 3R7OA 4DGGA 2JFLA 3LOKA 5IQIA 3K54A 3UQGA 3CE3A 2WMVA 1ZZLA 3BE2A 4W9WA 2O65A 4C3PA 1G5SA 2XVDA 3PE1A 5AV2A 3RPYA 2F9GA 4LOQA 2FVDA 4OGRA 5AEPA 5AV3A 2PVNA 2HCKA 3C5UA 4NH1A 5DIAA 1AQ1A 4CMTA 3Q5IA 4O0RA 4L43A 3S1HA 2UZEA 3IW4A 4U45A 3MIYA 3PYYA 3LW0A 4PMTA 3KXGA 4YZCA 3FMDA 4FV7A 3TL8A 4NFNA 1BMKA 4FR4A 4MTAA 2UW8A 3CTHA 5LJJA 3TNPC 5I5ZA 4CQEA 1Q99A 1OITA 1RDQE 1WVYA 4UWYA 4FKOA 4RFMA 2IVUA 3DK6A 4FTAA 4JG8A 3MPTA 4AE9A 3MTLA 3QFVA 4EJ7A 4QMUA 1RE8A 2FSMX 5CSPA 2WOUA 5AWMA 2UZNA 4Z7GA 3G5DA 4OTGA 4WSQA 3TZMA 5EQPA 5TO8A 4AUAA 5K5NA 4KIKB 3SQQA 3ZM4A 5HTIA 3OT3A 5EM7A 3JY9A 3QTRA 2I1MA 4D55A 5DYJA 3AC2A 5CQWA 5CXZA 2R3JA 5M56A 4C59A 2QQ7A 3PJCA 4FZ6A 4JL9A 2XH5A 3GBZA 5DOSA 3IDBA 4I1ZA 3VS3A 3DFAA 2OIDA 4YBJA 3ZFXA 4U42A 4APPA 4X2KA 3BIZA 5H8EA 3HEGA 4I6FA 4M8TA 3A7GA 3NNVA 3FSFA 5DEWA 3F69A 4F9CA 4AZVA 3FLZA 2PPQA 3TNQB 3C4FA 4JR7A 3RAKA 1IAHA 1V0OA 1KE5A 4N4SA 4MXOA 2XB7A 2UUEA 2W1DA 5KMLA 2AYPA 1Y8GA 4L3PA 4R7IA 2JC6A 1LPUA 3N4TA 5EQEA 4X6QC 4J53A 4FE2A 3DKCA 1MQBA 3VO3A 4YZMA 3OBGA 1JSTA 3WZUA 1FPUA 3WZDA 4FA2A 2W0JA 4NJDA 3U51A 3C1XA 5KBRA 5BUEA 3SW7A 5DWRA 1YXSA 3GXLA 3FLQA 3AC1A 1PXPA 5LWNA 4FUYA 4GMYA 3ZFYA 1PYXA 2C6MA 4WO5A 4LI5A 2ZDTA 2XS0A 2RFNA 3IOKA 3QA0A 3VBTA 2O64A 5CSVA 2RG5A 5A4TA 3FPQA 2G15A 4C4GA 3BU5A 4XLIA 3P7BA 4Y85A 4BZOA 3UOJA 1YRPA 1XJDA 4CGAA 2BFYA 3AD4A 2XIYA 4G1WA 1XH8A 4OBOA 2YFXA 4PP9A 4YJOA 1OM1A 4O1PA 5K0XA 4I5MA 5H8GA 4RVKA 1NW1A 4JBPA 5JT2A 4DEBA 3OZ6A 1Q3WA 3EQFA 4FG7A 4F99A 3E8EA 2J50A 1NY3A 2FUMA 2R7IA 5CSHA 4AT3A 3TTIA 3DAEA 2IZTA 3UGCA 5M4CA 4TNBA 4IX3A 3ZO1A 4AA5A 5EYDA 4USEA 3PLAE 4W4YA 4A9TA 4BCOA 2VTAA 4XHKB 2R3GA 3MJ1A 3BWJA 4IWPA 3PY0A 3KC3A 3KF4A 5ACKA 4GUBA 3B2TA 4GL9A 4RJ5A 3KMUA 3QD0A 3UMXA 4GFMA 5B7VA 3CD8A 4O91A 4UZDA 3M1SA 3VUKA 4YTHA 3WE8A 4L00A 2XNPA 2LGCA 4BCIA 3SGCA 2FH9A 3PY1A 5AR2A 5AUTA 2JDTA 2H6DA 4GJ3A 5BYLA 1OPKA 5LWMA 1WZYA 2C3LA 1FQ1B 3NYNA 3H0YA 3W2QA 3GFWA 4DG0E 5A14A 2C1AA 4U80A 2I6LA 4DFLA 4V0GA 2VO7A 5HOAA 4C4HA 4PL4A 4FTCA 4CKIA 5AJQA 2BKZA 3RK7A 4BYIA 2F4JA 2XA4A 5HU9A 4U9AA 3ZBFA 2RIOA 5HIBA 3AC5A 3OWKA 5JKGA 3CCNA 4CT2A 4EKLA 2OJFE 4FIFA 4EKKA 3O23A 1W84A 4IC8A 4YLJA 5BX0A 4JVGA 2QI8A 5ICPA 1K3AA 1SYKA 2UZVA 2XK9A 4X2JA 2ESMA 4QTEA 2F2UA 3WF5A 4YZNA 5FM2A 5JSMA 3FC2A 4I6BA 3OY1A 1GOLA 5ANIA 2Y0AA 4NYEA 3R30A 4QPMA 2WU7A 1YWRA 3SXSA 4X0MA 3QUDA 5F95A 3LJ0A 3A7HA 2VX3A 5IPJA 1BUHA 1XWSA 4LOPA 3JYAA 3NNUA 2WQBA 3HL7A 4M7IA 5DNRA 5AP3A 2FB8A 5LMAA 4AT4A 4BCJA 5FTQA 4PMPA 3IDCA 4ITJA 2J9MA 5E8TA 4XG3A 3UPXA 5E8XA 4EL9A 1QPCA 4NK9A 4U8ZA 3RAHA 2VGPA 4ZY4A 4ZAUA 4ASZA 4LRJA 5CANA 3ORKA 1XBAA 2J0LA 4IADA 4AZWA 3NVMB 1NVSA 1ZOEA 4FI1A 3WZKA 3AT4A 2XK3A 3KXXA 4G17A 4D2WA 4YC3A 1HCKA 2ETKA 4CNHA 1OUKA 2C68A 5KMIA 4HVSA 3E88A 2OLCA 5CVGA 2LAVA 2OK1A 1H26A 1Q8WA 5IQEA 2XK4A 3F3VA 3I7CA 2V22A 3F5UA 1IR3A 1FVTA 4I0TA 3ORTA 4Y73A 3TJCA 4BDIA 5IEVA 3G15A 4UXLA 2H34A 3I0OA 3PXQA 4O22A 2XNNA 2VNWA 3SG9A 4AZTA 3W8QA 4BKZA 4BICA 4LM5A 3NUNA 2J4ZA 3Q4ZA 4S30A 3C5IA 1UKIA 4R3CA 3OBJA 4A7CA 5AA8A 4FVQA 3UG1A 5J7HA 1ZY5A 4RC3A 1OB3A 1Q8TA 4O0XA 1Y57A 3BI6A 1KWPA 3KB7A 3DB6A 3T3UA 3QCQA 1H1PA 1UU9A 1GIJA 3FLWA 5HORA 4YTFA 2ZMCA 2WO6A 4QNYA 1LEWA 4JDJA 2C6LA 2C1BA 5HG7A 4FIHA 4KIQA 3TG1A 2JBOA 3DJ5A 4C33A 2GTMA 4XOYA 3ULIA 4JIKA 4PL3A 3QX4A 4RLKA 3FZSA 4NEUA 4YJPA 2BZIB 4QMWA 1XR1A 3OMVA 4CZUA 3V5WA 3PDTA 4JBOA 4BY9E 5AAEA 3G2FA 5F1ZA 3COIA 3TZ9A 3C0HA 3LXNA 4X21A 4GKHA 4W4VA 5CXHA 2ZB0A 3EQPA 1WCCA 5CT0A 5EM8A 5BVEA 4D1ZA 2YIWA 4M14A 3VBQA 1AGWA 4WRGA 4WRSA 4DFUA 3AC8A 3OXTA 3L9LA 2CNVA 1XHAA 3UYSA 1ZOGA 1STCE 4JDKA 2Y6MA 3ACJA 4PTCA 3NUYA 3EFWA 3JY0A 5FDXA 3QQKA 3MVJA 4IXPA 3LQ5A 4PQNA 4XG6A 1GZNA 4QP7A 4FSWA 4ERKA 3CJFA 3Q52A 4Q9SA 4WG5A 4BTKA 3WYYA 3KREA 4IB3A 4WG4A 5CEQA 4EYJA 4CVAA 3KVXA 5HG5A 5KMNA 3VS5A 2CGWA 2XK8A 3BCEA 5J9LA 3FYJX 4FX3A 4U7ZA 3NYOA 4ZEGA 2C3KA 1WBWA 3QL8A 2WTDA 5KZ0A 5TT7A 1Q62A 4HW7A 4FSUA 4RQKA 4ZTRA 2DQ7X 2Y8OA 3DKGA 3LCDA 3LXKA 3P79A 3Q9WA 4WOVA 4AZEA 3PFQA 4O84A 3HMMA 2YCRA 3IOPA 3PSBA 4NM0A 2ITVA 4BDFA 4DH5A 2GNFA 1XH5A 2WQOA 2E9NA 4OW8A 4YHFA 4A06A 4XG2A 3NAXA 3QKKA 1YXTA 3ATSA 4JAJA 5CENA 3U9CA 3V51A 4F9WA 3E7OA 1Q3DA 4S32A 4O2PA 3TZ7A 1H07A 4O21A 4TYHB 4WUNA 2R5TA 2XP2A 5EOLA 4A9RA 5IF1A 3FZTA 3RJCA 4ANOA 2PSQA 3OS3A 4IBMA 2WQEA 5DH3A 2ITOA 2RG6A 4BGHA 3SRVB 1WMKA 3LLAA 5EI2A 4IW0A 4GSBA 5J9ZA 4FT0A 2W06A 3MV5A 2UZTA 4F9AA 3H10A 2G9XA 1XH4A 5A6OA 1U4DA 2VGOA 2W1ZA 5KO1A 3PXFA 4QTAA 3FQEA 4QYHA 3U9NA 4RJ4A 3DS6A 2BMCA 3FLNC 4BRXA 3N4UA 5KNJA 4UALA 3DTCA 3PJ3A 3FI4A 5D7VA 1YDTE 5CAPA 5HBJA 4R7HA 3QTWA 1YI4A 5K9IA 3AMAA 3H4JA 4ZJVA 3FMMA 3R0TA 4NM5A 3RWPA 1YDSE 4DLJA 3K3IA 4NJ3A 4TYIA 2C5NA 5E1EA 4YTCA 2OXDA 3U55A 4FKVA 2GNIA 4FYOA 4EQCA 2R3OA 3KN5A 4FKUA 4BZNA 4FNZA 2CGXA 5CEMA 1PMEA 4YJRA 5LARA 5FXRA 4OTFA 5EYKA 2C5YA 4X3FC 4FTJA 3TEIA 2B9FA 5B2KA 4RA5A 5AIKA 2HAKA 3COMA 4OTIA 1OZ1A 3NEWA 1LP4A 3QTUA 4EORA 3ZLYA 4FMQA 3IK3A 3ZCLA 3H9RA 1A48A 1VJYA 4B99A 4AGUA 1MQ4A 3W2SA 5D41A 1W0XC 5I4NA 3UP2A 3UOHA 4FGRA 2PTKA 3POZA 1ZZ2A 3NIZA 4HPTE 4RIXB 4J1RA 3VS6A 5L4QA 3ZXTA 4CCUA 4IANA 3QC9A 5JRSA 4O82A 2B52A 3D2IA 3HKOA 4A4OA 4I24A 3R7YA 2HOGA 3WF8A 4FEUA 5C27A 4PWNA 4IAKA 4BHZA 4BDBA 2QG7A 3EZVA 3C50A 4R3RA 5FTOA 3BKBA 4JT3A 3EN4A 4EOMA 3BZ3A 3F9NA 4M12A 4IX6A 2IZSA 1OBGA 3PA3A 4BF2A 2UVYA 3QU0A 4FKRA 2IVVA 3FV8A 2PK9A 2X81A 3AGLA 2OJJA 5GJDA 2BROA 3CP9A 4YLLA 3MDYA 5HCZA 4AT5A 4EH9A 4UZHA 3BYMA 5HLWA 3GC7A 2GNLA 3E3BX 3D2KA 2C6EA 4O0TA 4YHJA 3MI9A 4YP8A 3DA6A 4XG8A 5CF5A 5AP4A 3QRKA 2YDJA 2CSNA 4UMRA 2I0HA 2XEYA 4MBJA 4K0YA 5IKWA 3U4UA 2W9ZB 5D7AA 3W2OA 4EC8A 3VS7A 3BHVA 3E62A 5EW8A 3ZEPA 3FY2A 4OTWA 4U79A 2YDIA 5E8WA 1OIRA 2BDWA 4TRLA 3D9VA 3DT1A 2F7EE 4AXAA 4YZDA 4GS6A 5DMZA 3VW8A 4L6QA 4O0VA 4ANMA 3PJ8A 2WTJA 1L8TA 5ANOA 2J51A 3Q3BA 3FQSA 4FZAB 4XP0A 5IDNA 5IQBA 4DTAA 3DDQA 5ANJA 3MPAA 4ZMEA 4O38A 4RVMA 1ATPE 3JPVA 1OIYA 2R3IA 4XEYA 3R7IA 1PXOA 1UA2A 2DWBA 4L42A 4RZWA 3GGFA 3O7LD 5J9YA 2ZB1A 3UO4A 4DAWA 5GZ8A 4K77A 1SVHA 4G6OA 4EK4A 1Z57A 2SRCA 3QD4A 4LL0A 5CWZA 2CCIA 5IDPA 4XP2A 3TKUA 2ITQA 3HX4A 3BHTA 4USFA 4HGTA 3ELJA 4YGAA 4EH3A 1ZMUA 5DFPA 5DGZA 5FTGA 5L2SA 2UVXA 2C6OA 2W1FA 2XBAA 3C0GA 2X0GA 4HGLA 3SD0A 3LJ1A 3ZUVA 4F4PA 3JUHA 4HVHA 2EXEA 5EM6A 4YSJA 4ZSEA 1O6KA 5IH5A 1E1VA 3UC4A 2UVZA 5FEDA 2HIWA 4F64A 3E92A 3QBNA 5G1XA 1DM2A 2J0JA 4YURA 3MESA 3RKBA 1LUFA 2YISA 3DV3A 3PPKA 3UBDA 4ASDA 5HHWA 5H2UA 4OTRA 4ASEA 5CI7A 1J3HA 1EH4A 3NYVA 3QYWA 4LRMA 4KNBA 5KX8A 1SMHA 2Z2WA 2HXLA 3NW7A 1H08A 2V7AA 1YHWA 1M2RA 5IMEA 4AFEA 4M0YA 4F9YA 1YWVA 3G33A 3RK9A 3ORZA 5DR6A 2RFSA 2PVYA 3CC6A 3GU6A 4CTBA 3Q4TA 1JAMA 3EL7A 3H9FA 3UIUA 1OKYA 3FL4A 3OROA 4J99A 3MH2A 4GG7A 4O0YA 4MXXA 3W16A 5KKRC 2VTOA 4FV9A 5L6OA 2OH4A 4BDAA 4ENYA 1TQMA 4C62A 3FXXA 1PMVA 3LPBA 4WNKA 5EW9A 1WBOA 2BRHA 2F7XE 3ORXA 4CQGA 2ACXA 3Q9ZA 5JRQA 1XBBA 4HZRA 3IPHA 4XCUA 4FOCA 4ACHA 5HE0A 4EONA 4TT7A 3AG9A 4QNAA 3QHWA 4RFYA 4FSNA 3CKWA 4OT6A 3W10A 3C4WA 1OBDA 2EU9A 4M68A 4R3PA 4TL0A 5EM5A 2YHVA 1UV5A 3C4CA 3MH0A 4IFGA 3QQJA 4TW9A 5DPVA 5M4IA 2JDOA 3F5XA 4EUUA 5M09A 2GSFA 3UODA 4Y83A 3OCTA 4YNEA 3KULA 2GU8A 3FZPA 4PPBA 2E2BA 3HRCA 5IUHA 5BVKA 4IVBA 1L3RE 4I6QA 3HECA 4D4SA 5AV4A 4AFJA 1MUOA 3RP9A 3R73A 2XNGA 3FXWA 1VR2A 2BILB 3OOGA 2OFVA 3KK9A 4ZY6A 4FVRA 4XX9A 4ZTMA 1BI8A 2XJ0A 5BMMA 3LE6A 3S00A 4UY9A 4KS7A 4ONAA 1VZOA 3KA0A 2CN8A 4X7QA 3RM6A 4NTSA 4BKJA 2Z7QA 3PIYA 5AX9A 3MFSA 3TNIA 4LFIA 3NLBA 4K9YA 4ZJIA 4YJTA 4M3QA 3MVLA 3EHAA 5KCVA 3FDNA 2QO7A 2UW9A 2VWUA 3LMHA 3BRBA 4JIAA 3QUPA 4PDYA 3QTZA 2Z7SA 4NKSA 3ORPA 3VBVA 3NRMA 1H1RA 2WMAA 4CFNA 2YAAA 2JDVA 3TNWA 5CVFA 5ANEA 1OI9A 2YDKA 2XK6A 4QP8A 3E3PA 2YM3A 4QYYA 2OXXA 4IX5A 4PDOA 4K11A 4X3FB 3RZBA 1ZRZA 3ITZA 5FBOA 3PVBA 3UZTA 3EFLA 2PUNA 3HZTA 3O7LB 3I6WA 3QD3A 4ALVA 2Y4IC 4D28A 5BVDA 5EH0A 4QQTA 5HU3A 1MRVA 4MNFA 1W8CA 3UQFA 4QTDA 4CV9A 2FA2A 3QTIA 4BWKA 3UPZA
chains in the Genus database with same CATH superfamily
3MYGA 3EN5A 1MRYA 5GJGA 3S2PA 4C37A 5HCXA 3TV4A 2OW3A 3V5QA 4AA4A 5M44A 3UNKA 2XCHA 2JEDA 5CS6A 4FV5A 1F0QA 4MD9E 2QOQA 4TXCA 5DHJA 2R3KA 5KZIA 5JZJA 2HZNA 4O7TA 5DBXA 3MA3A 5TE0A 5LVLA 1Q8ZA 4AWIA 3BEGA 3E87A 5DVRA 5HD4A 4FKSA 5BV3A 2NNWB 3PWYA 3PJ2A 3FZ1A 2YM5A 5KMOA 4DT8A 4L53A 5HO8A 4BC6A 1OUYA 4GIIA 2A2AA 2QOLA 4EWHA 5K4IA 2X0QA 3EQBA 1UNHA 2PE0A 3PVUA 3ZH8A 4R78A 3ZXZA 4AF3A 1YVJA 2WIHA 4KWPA 2OKRA 4Y8DA 3PRIA 2PVHA 5CI6A 3QWJA 5L8JA 4FYNA 3BLQA 3IONA 3TUCA 5K3YA 2JITA 4A4LA 4O6EA 3SX9A 2R0UA 1OKZA 5HTBA 4BCFA 3SAYA 3JS2A 5AAGA 2A0CX 2GQGA 3I1AA 4IDTA 4L7SA 3RK5A 3ULZA 3QLGA 4PP7A 4RA4A 4C0TA 2XM9A 3VS1A 5CQUA 2CKOA 2QR7A 2OWBA 3VVHA 4NUSA 1YXUA 4RVLA 4ALWA 3Q04A 4MH7A 4XG7A 4ACDA 4Z3VA 5C9CA 4I4FA 2DS1A 4RIWA 2QG5A 2B9HA 1JQHA 5I9WA 1ZAOA 2REIA 3EZRA 3MB7A 4IJPA 2GHGA 4TKSA 5K4JA 2Z02A 4O7RA 3FSKA 4TWPA 4UWCA 4FT5A 5E8YA 4GT3A 3OY3A 2R7BA 3V01A 4TY1A 4CLJA 2XK7A 2OFUA 3I60A 1JWHA 4S2ZA 4TWOA 4M69A 3BYUA 3NX8A 4CYJA 4CG9A 4TN6A 4XG4A 4IH8A 5EI6A 3G0FA 4DN5A 4ZIMA 4MQ1A 3Q6UA 1KOAA 4EUTA 4QYEA 5AR7A 5GJFA 1XMMA 3A4OX 4QMTA 4MWIA 3TZ8A 3P7AA 3IW6A 3OEFX 5F94A 4ZLOA 3RHKA 3WYXA 2QURA 2BTSA 2Z8CA 3DLSA 3FHIA 3LFAA 3RI1A 4CKJA 3R00A 3OOMA 1Q24A 1FGKA 2NRYA 4I0SA 4E4LA 3MS9A 2QHMA 3FMJA 3BLRA 4KB8A 5FXSA 4WT6A 3CQWA 2OJ9A 2QOFA 3W0NA 3R71A 2GTNA 1JKLA 3PY3A 3TIZA 3RM7A 2WOTA 2GQSA 5E8SA 3QTQA 4DHZA 2Y7JA 5CLPA 4AW1A 4TYEA 2RSVA 3LM5A 2W5HA 2X9FA 5FRIA 4FT9A 1CKJA 4TPTA 3I5ZA 1OIQA 3W33A 2NO3A 2WMXA 3ZYAA 5LQFA 3PA4A 4FSMA 5M51A 5KKRB 5H8BA 2YCFA 4CEGA 1TFFA 4QDEA 3L1SA 4I21A 4YZBA 2XKDA 5AUVA 4UYAA 4HOKA 2UZWE 4FTTA 3V8TA 2AEGA 4AZFA 1WBSA 3DQWA 1FMKA 3DQXA 2B7AA 1H4LA 4NT4A 4BCHA 5J5TA 3VBXA 3R6XA 3JR1A 3LCTA 2C6KA 5AM7A 4E6DA 2W4OA 3K2LA 4KKEA 2OF2A 1IEPA 2EUFB 4JBQA 3VONA 1O6YA 2B55A 2VTJA 3KU2A 4FKLA 3Q53A 3SKCA 3HUCA 4HVIA 3SV0A 4EZ5A 4QYGA 4FC0A 4ZZNA 1ZYSA 2C5XA 4Q2AA 3W18A 1UWJA 4TTHB 5FLFA 3AT3A 2XNOA 2B4SB 5M08A 1P4OA 5D11A 4FJVA 2BALA 2ZM1A 2Y9QA 5IUGA 4DH1A 2BZJA 2IWIA 3ORNA 3R8LA 4BTMA 4F08A 1KUTA 5AX3A 2XCKA 3LVPA 3BHYA 3IKAA 4V05A 3TV7A 3MH1A 5HNBA 5DG5A 1GZ8A 4M13A 2PWLA 3RCDA 1PXLA 3A2CA 2YIQA 4IZYA 4CRSA 4PL5A 4BGGA 1URCA 4IZAA 3Q9XA 4KKGA 4P5ZA 4DEIA 2JIIA 2JDSA 3DB8A 1ZMWA 3OWJA 4FNXA 5CU3A 3FZOA 2QNJA 3KF7A 3VJNA 4FTLA 4DEHA 4F09A 4BJJB 2HYYA 4MQ2A 4O27B 4IEBA 4KBAA 2FSTX 4YJNA 1OKWA 5DRBA 3IW5A 4I6LA 2I40A 2PZPA 2PVMA 5E91A 4X2NA 2F7ZE 2QCSA 5D12A 2YLEA 1U5RA 4RRVA 2XKCA 2IW6A 5A4QA 3BWFA 4L3JA 4ACCA 3TN8A 1J1BA 2W1GA 2BHEA 4JLCA 3PWDA 2UW3A 1LEZA 4JS8A 5TR6A 4P90A 5CAVA 1QMZA 4JRNA 5CAQA 3P23A 4I23A 3DNDA 4FTNA 2R3FA 3PXYA 3UDBA 3CSVA 2QKRA 2UW6A 5LVMA 1JKSA 2YM7A 3LXLA 2BRNA 3M2WA 3OHTA 4FV0A 4W8EA 2F57A 2NRUA 3KEXA 4LG4A 2HZ4A 4X6RA 5LXMA 4FV2A 4DFXE 4QQJA 3FBVA 3RPVA 1KOBA 2A1AB 4G5JA 5AP7A 5CVHA 5AV0A 4HVGA 2VN9A 4FTRA 1BYGA 4C02A 5L6PA 4ZLYA 1JBPE 3A7JA 4O7YA 2ITZA 5HG9A 4IAIA 4DGLC 5CU6A 1FOTA 4D4RA 4UN0C 2Y4IB 3K5VA 3R22A 4ZTSA 4PTEA 4NFMA 1H24A 3R63A 4KUJA 4H58A 4L01A 2G1TA 5A9UA 4KIOA 5B0XA 3V5PA 2Q0NA 4IVDA 4OUCA 3ATTA 4QOXA 4EH8A 4FOBA 5AIRA 3P9JA 1M2QA 2PVRA 5CTPA 5K5XA 4FZFB 2C30A 1YHSA 3TI1A 3TWJA 1REJA 3VUMA 3WE4A 2ETMA 3L9PA 1PKDA 2W4JA 3ACKA 1FVVA 1JKKA 2QONA 5C8MA 4AOTA 1URWA 4ZZOA 4OT5A 3EN6A 4AW2A 4FL3A 5BYYA 3ID6C 3RPOA 2ZM4A 2R2PA 2YCSA 4JG6A 4E1ZA 5BMSA 4MYGA 4GVJA 4BWXA 3ZRLA 3VRYA 3FMHA 3MY1A 1M14A 5CEKA 1ZXEA 1G8KA 3NUXA 4G2FA 4QRCA 4XP3A 3VC4A 3U54A 2C6TA 3G6HA 1ZYCA 1RW8A 1B38A 3PXZA 3QLFA 3FMLA 4WSYA 4FEQA 3CPCA 2VV9A 4NW6A 5CU2A 3UZPA 1U5QA 4BKYA 4IZ5A 2FYSA 5C1QB 3AKJA 1PMNA 4ZP5A 3BHUA 2C5OA 3E63A 3MVMA 3BHHA 3EMGA 1Q5KA 3GU8A 1H01A 3QALE 3QTSA 4EHGA 4E5WA 4J71A 3N4VA 2YERA 5KMMA 2JD5A 3R1NA 5I9XA 1PXIA 1YI6A 3BV3A 4RMZA 3KN6A 4D4YA 4IB0A 4L52A 3SDJA 3VUGA 2X8EA 3S3IA 2QOHA 2PUUA 2R3QA 1AD5A 2VWVA 2VX0A 3PLSA 3CKXA 2I7QA 5CY3A 3R9OA 5DN3A 3PP0A 4ZLZA 4KD1A 4I4EA 3DTWA 2R3PA 3GUBA 2X1NA 3EIDA 3QAME 2GQRA 5CASA 3SHEA 2C47A 3WBLA 3A62A 4J97A 4PX6A 1W7HA 4F7NA 4ALUA 4EOKA 3UDTA 5CEPA 1P2AA 1ZWSA 5L2WA 3DGKA 5AP2A 2CLXA 4EJNA 4JX7A 5JFWA 5EKOA 4F65A 4IVAA 3K5UA 4ZJJA 1R0PA 4EI4A 4DLIA 3ZBXA 1SVEA 3EKKA 3PTGA 3RGFA 4E26A 1PXMA 3TUDA 3ALNA 1PXJA 1V0BA 3N9XA 3ZM9A 5C26A 2RL5A 4XYFA 5IQCA 5JFVA 1ZOHA 5J5SA 4HNIA 4J8MA 3P5KA 4KRDA 5E90A 3RBWA 4IM3A 4CG8A 3R8VA 3ZC5A 2QODA 1T46A 1PKGA 4YJUA 1J7LA 3F2AA 4H3BA 2EVAA 1R39A 4FKGA 3UDSA 4XBUA 3OCSA 1V1KA 4BIDA 1HOWA 1YW2A 2WQNA 5A4EA 5FD2A 2W1EA 3GU4A 5FQDC 1YI3A 2H8HA 2IVTA 4GW8A 3FZRA 5LCKA 3WIGA 2EWAA 5F9EA 3IECA 3GVUA 2ITNA 1MP8A 2BIYA 1R3CA 5T6KA 3BGQA 4GU6A 2X7FA 4TYGA 3SA0A 3U6HA 3TUBA 4O0SA 2PMOX 4FTKA 4NIFB 4E5AX 2BRMA 2J90A 2XMYA 4GEOA 4O0WA 4O4CA 4TWNA 3UP7A 1GIIA 2O2UA 4PDPA 2WD1A 3NR9A 4BN1A 2A27A 2W7XA 3ZSHA 4E7WA 1P4FA 1K2PA 1U59A 2OZAA 4QTCA 4XJ0A 4FL1A 3F82A 4G34A 3LFNA 4AOIA 4Q9ZA 2C6IA 3WZEA 2BAJA 4LMUA 2BAKA 4N0SA 3ZHPC 4NU1A 4E3CA 4XH6A 4D0WA 2VAGA 2JKKA 2XKEA 2A4LA 2ITWA 3PSDA 3BX5A 4ZTHA 3DCVA 2OJIA 3RCJA 1TQIA 2OU7A 3E5AA 2XRWA 3GU7A 3AQVA 2W5AA 3GEQA 1G8JA 2PVFA 4PMMA 1PHKA 4N6YA 4NSTA 4XV9A 2PL0A 4U3ZA 5DT0A 4EOSA 2YWPA 4Q5EA 3CD3A 3NW5A 5HZNA 4I5HA 4MNEA 3K3JA 3VHEA 4CMUA 4DGNA 5HVKA 3LJ2A 4QDVA 2BCJA 2WMQA 3HA8A 4BDJA 4PMSA 2HZ0A 3TJDA 4BBMA 3ANQA 4H05A 2JIVA 2WMWA 1JSUA 3WOWA 4CRLA 4EEVA 3BEAA 1U54A 3GCUA 3E8CA 3R1QA 3EH9A 2BFXA 5JQ8A 4II5A 2PU8A 4YZ9A 2AQXA 1OGUA 3G51A 3TACA 5DR2A 5LMKC 4HYIA 3HDNA 4AX8A 5JH6A 3V04A 2P2IA 3LM0A 3NCGA 3DJ7A 5I0BA 4XLVA 3EB0A 2JKQA 1SZMA 2PZ5A 3W0MA 2XEZA 1OKVA 2PE2A 3AD6A 3HMNA 5AMNA 4DFYA 5ITAA 5JZNA 3DNEA 3QKMA 2RKUA 3F66A 3MW1A 4H3PA 4HGEA 5AV1A 4BL1A 1M7QA 5AUXA 4FBXA 4BIEA 1ST4A 1K9AA 4D1SA 3RNIA 2XIKA 5D10A 3VIDA 4O2ZA 3OUNB 5FG8A 4RC2A 2JIUA 3MIAA 5T68A 4GCJA 2B9JA 3RVGA 2E9UA 2ZVAA 5AFVA 3MH3A 4DFNA 3FL5A 5L2IA 4GK4A 1H27A 2OH0E 3A7IA 3QCYA 5CF8A 4UEUA 4D5KA 2WPAA 4GYGA 5EOBA 4EBWA 3IG7A 3Q2JA 2HY0A 4L7FA 3FQHA 3A60A 5JN2A 4J95A 5IA2A 3HP2A 4FTMA 2HY81 3TIYA 4NKAA 4UMTA 3NMUF 1NT2A 1YHVA 4FV3A 2YZAA 3GNIB 3QZGA 4EQMA 1IA9A 1CM8A 1YXVA 2PZIA 4DDIA 4G6LA 4CXAA 4E6CA 5HO7A 2VO0A 4TWCA 5EG3A 5D9HA 4FKQA 3Q5ZA 5JGDA 4NM3A 5IH6A 5M4FA 5M4UA 3MFRA 2IZRA 3BL7A 2Z7RA 4K33A 2B54A 3FUPA 1XO2B 4YTIA 2ITYA 4CFUA 5C8NA 2HZIA 4GUEA 4FIGA 4RJ7A 4FF8A 2ZOQA 4YJVA 3RPSA 5L3AA 4DTKA 4RIYB 3R7EA 4D5HA 2ZV8A 4FTIA 4WD5A 3ROCA 1Z5MA 4C3FA 4HZSA 4TYHA 3H9OA 4QP1A 4ORKA 4RT7A 3IO7A 1NVQA 2X6EA 3PJ1A 4WHZA 4XOZA 3LFBA 4ANQA 1KE9A 1Q97A 3D15A 3FMEA 3DOGA 3I6UA 5CT7A 4DEEA 4BGQA 2HENA 3R7GA 3CR0A 4LRKA 1I09A 3D5VA 4RSSA 3MPMA 3VS2A 2C3JA 3CJGA 2XAOA 2W1HA 3CXWA 3FEGA 4IE9A 3D94A 3AOXA 3LCOA 5AR3A 2VTLA 5HVYA 2WEIA 3A8WA 3BQRA 4NTTA 3BL9A 3ORIA 4JDIA 4MBLA 4ENXA 2G2IA 2IPXA 3ZDIA 2Z60A 4MEDA 4X2FA 2RFDA 1E9HA 3ZLXA 4ERWA 4RG0A 4QP4A 1O9UA 3VBYA 4IAFA 1I44A 3D7ZA 1P14A 3CBLA 3MN3A 2IZUA 4EH7A 2HW7A 4CCBA 4KA3A 4ZK5A 3PPZA 3II5A 3OWPA 4N57A 3HV3A 3ZDUA 5E7RA 2WTWA 3QKLA 4FTOA 4HGSA 2C69A 4BVUA 2QOBA 3GB2A 2FO0A 5IQGA 4C61A 2HK5A 5CF4A 4E5BA 4AN9A 3GQLA 4FG8A 3ZOSA 1MRUA 5KBQA 3CY3A 3FKLA 4AGCA 2QOOA 1DS5A 3DDPA 3PRFA 4QEBA 3F88A 4O86A 2BZKB 2JAMA 5ETCA 2O0UA 5HESA 4F6SA 3LQ3A 3AMYA 5IA0A 1LR4A 4J98A 4LMNA 5B2MA 3L8PA 3ERKA 2WELA 3OUKA 4GK3A 4H1MA 3GCVA 4EC9A 2X6DA 1YDRE 2WGJA 4G9CA 2C5VA 4R1VA 4DHJA 4HNFA 4E4XA 3NPCA 4KSPA 4QMMA 3OF0A 4C7TA 4RLLA 2B0QA 1U46A 2OICA 3HDMA 3PG3A 3SC1A 4EHEA 2KTYA 2J6MA 2VTMA 2X9EA 3F5PA 3R1SA 4WBOA 2OZOA 2ITUA 1ZARA 3QRTA 5D1JA 3UOLA 3Q2MA 4I6HA 4F7JA 4G5PA 2XNMA 2AUHA 2P4IA 2WNTA 2WTCA 3EN9A 2V0DA 3MA6A 3R9NA 4C4EA 4YUQA 3ENMA 4ACMA 1HCLA 3HNGA 4U40A 5FEEA 4BBFA 2F2CB 1XH7A 2QOCA 3D7TB 3REPA 2UW0A 4L3LA 3VAPA 1KE8A 3PUPA 4XMOA 4G3FA 3LHJA 4GJ2A 4GV1A 2GNHA 2QD9A 3BPRA 4C58A 1CMKE 2WAJA 3VJOA 4F9BA 5M07A 2PMLX 2PZYA 3E93A 2C6DA 3EOCA 4KIPA 5TOZA 3C0IA 5KHWA 3KY2A 5CNOA 3QC4A 4D0XA 4F70A 4M67A 3R7UA 3SLSA 3OW3A 3EFJA 3WILA 1H28A 3QGYA 4U3YA 3JVRA 3C4EA 4RX5A 3WF7A 3BYSA 3I81A 4QMQA 5HICA 3HV4A 4IM2A 4ZXTA 3MWUA 4BCGA 3FMNA 4O81A 4HCUA 4JG7A 4DEDA 2QHNA 2WZJA 4MVFA 3D0EA 3LZBA 5IEYA 1Y6AA 3Q32A 2GNGA 4O7SA 3KGAA 2BVAA 3R01A 4U41A 3PZHA 4OAUC 3NUAA 1V0PA 3H0ZA 2CMWA 5DI1A 1RJBA 2VNYA 4FODA 4ZOGA 3F7WA 4YSMA 5IISA 4CFFA 5IA3A 4YJSA 2VTNA 2W17A 2ONLA 4IM0A 5FXQA 4AQCA 3O50A 3WARA 4F6UA 3O8PA 1WVWA 2BTRA 4L8MA 3VHKA 5H9BA 4HVDA 3UO6A 4DHFA 2VO6A 2UV2A 5EHOA 4DC2A 4F1MA 5IU2A 5FDPA 2BAQA 1REKA 2KULA 5IQAA 4AU8A 2J7TA 2G2HA 3PP1A 1VEBA 2P55A 1JNKA 4MD8E 5DT4A 1UU8A 5BNJA 4I41A 1ZYDA 4GIHA 4U97A 1QPEA 4I94A 4ZY5A 3NSZA 4TYJA 3QWKA 1IRKA 3ORMA 5EHYA 1QCFA 4EWQA 5AR5A 4CTCA 2YAKA 3LFDA 4KKHA 4DCEA 4W4WA 4G3GA 2PULA 2UW5A 1KE6A 4L9IA 5EK7A 4EH6A 4ID7A 4JRVA 4QPSA 3TT0A 2GFSA 4EYMA 1UVRA 4BI0A 3QZHA 5HNIX 2A19B 3BGZA 5J8IA 1SNXA 4ZTQA 3TKHA 2BRGA 2EB2A 4M15A 3M42A 5HE2A 2E9PA 4HPUE 3G9LX 4QMPA 4Z9LA 4EK8A 2XAMA 3R1YA 4F1TA 3Q6WA 3PXRA 3AXWA 5KE0A 5HIEA 4UV0A 4FT7A 4LQMA 5IMXA 3NZ0A 4F6WA 2G2FA 4ITIA 4IC7A 2GS6A 5EW3A 4A9UA 2W1IA 4C34A 4K18A 4E93A 3PFYA 2R0IA 2PHKA 5BYZA 1PW2A 4I5CA 4IVCA 3T9TA 3WF6A 3DZQA 5J7BA 1Q41A 4H1JA 1W98A 2EXMA 2XIXA 3BV2A 3PE2A 4K6ZA 4MXCA 5ANGA 4O0UA 3CGOA 2YABA 3V5JA 3QRJA 3R8PA 3G0EA 4QMNA 3GENA 4IAYA 2ZMDA 5DA3A 5H3QA 5E4HA 4MUQA 1BL6A 1KV2A 3TNHA 2X8DA 5AP5A 1JSVA 3ZO2A 2PY3A 4RQVA 3O0GA 4MF1A 2YZLA 5ETFA 1QPDA 3ZRKA 3OXIA 1YOLA 3D83A 3Q60A 1WBTA 4BCMA 3O51A 4S31A 3V5LA 5GIPE 4WIHA 1Q61A 3WF9A 3AMBA 4GVAA 1QPJA 2Y4PA 4BHNA 3CIKA 2QC6A 4YLKA 4E6AA 3UNZA 4BIBA 1W83A 4EK5A 5M57A 3UZRA 4DBXA 5AUZA 1G8SA 2HXQA 4RFZA 5CZIA 3SOCA 2GS7A 5J79A 3EQIA 3FJQE 3I5NA 3ZSGA 1ZMVA 5A4CA 3KRWA 2CGUA 4Q5HA 5CSXA 4XV1A 2J2IB 2DUVA 4BI1A 2YIXA 5HQ0A 2VO3A 4XNEA 4F0GA 3PVGA 5GIOE 1NXKA 4ZSJA 5E92A 3KRRA 2YEXA 2PVLA 4U5JA 4D2VA 2P33A 3KRJA 3NWWA 5HX6A 3W2CA 2BR1A 2X4ZA 1ZYJA 3FE3A 3ODYX 4B9DA 4UXQA 2PZRA 3MJ2A 2B9IA 2F49A 3FI2A 3ZO4A 4PTGA 4B6LA 4FSRA 4KBCA 3DZOA 4K8AA 2ZFYA 4BI2A 3FI3A 2W96B 4Z7HA 4X3FA 5M55A 4E4NA 3F6XA 4GH2A 2XARA 3V5TA 3C9WA 3MVHA 4E8AA 3BGPA 3VS0A 5A54A 3UO5A 3QQFA 3ZONA 2CKEA 2OIQA 3R9HA 3CEKA 5AAFA 4YO6A 2VTIA 4D9UA 5BQ0A 3WI6A 1M52A 2ZV7A 2IEWA 4YJQA 3NUSA 2Z7LA 3LQ8A 3RINA 3NNWA 5AP6A 3F2RA 4PPAA 2WMUA 3IW8A 3ENHA 3NUPA 4MXYA 3KXMA 4FTUA 2X2LA 4EK6A 3LMGA 1FMOE 4Y5HA 3FLYA 2BZHB 3QD2B 4RJ8A 5EDQA 1FVRA 2PUPA 3F3WA 2VWXA 3LIJA 4HYHA 3QZIA 3FY0A 4RX9A 3FHRA 4CYIA 4L68A 1ERKA 4AAAA 4QPAA 3VUHA 5BPYA 1W2DA 1Q4LA 4FL2A 4QP2A 2CKPA 4C4IA 3VUDA 4DH7A 3EKNA 4WNPA 4RGJA 2XYNA 2XZSA 4AOJA 4B8LA 4DBNA 4A4XA 2OI4X 4GFOA 1J1CA 4WNMA 4C8BA 2PVJA 5BUJA 3L8SA 3PG1A 1ZYLA 2R3LA 2O3PA 3JXWA 3R04A 4IACA 4U43A 3NAYA 4IHPA 4ZTLA 3R8MA 1OECA 2R3RA 5HX8A 1PRYA 4XRLA 4DFZE 2R64A 4AQKA 1GZKA 4DG3E 1J7UA 2ITTA 3ZZWA 5AUUA 3V8SA 5DT3A 5JGBA 3C13A 3PPJA 3QQHA 4V0GB 3TTJA 3OCBA 4YMJA 2JFMA 3VRZA 2X39A 3VF8A 4G3DA 2CJMA 4PF4A 3O71A 3OFMA 2DYLA 4E73A 1XH6A 5DLSA 4QTBA 2PMIA 1YOJA 3L8VA 5KMJA 4D2RA 3POOA 4FSTA 1YXXA 1DI8A 4EH4A 2PE1A 2VTSA 2J5FA 4WA9A 2WMSA 4HYSA 4IWQA 2X2KA 4V04A 4XV3A 3KK8A 2VX1A 3SXFA 4BDGA 2OJGA 4FEWA 3PSCA 4OBPA 5CZHA 3F5GA 5C8KA 4CT1A 2WHBA 2R9SA 3QRIA 4I0RA 4FEXA 4GT5A 4GFGA 2WTKC 2E9VA 3GCSA 4D2TA 4BDEA 2O8YA 1H25A 3H30A 4WUAA 5A3XA 4M97A 3DAKA 4FIIA 4EZ7A 4JDHA 3OW4A 4CZTA 4G31A 2YM6A 2BDFA 3T3VA 1OMWA 4MD7E 4MXAA 4QP3A 4K2RA 3QCSA 4JQ7A 4RWIA 4B4LA 3EL8A 4MF0A 4EOPA 2ZM3A 4UMQA 3RWQA 4AGDA 3U87A 4DGOA 5B2LA 4ASXA 4ANLA 3PUFC 4KIKA 1CTPE 5A6NA 3V6SA 3O8UA 2GHMA 5AUYA 3FLSA 5L8KA 2Q0BA 2YLFA 5HIDA 1SNUA 3A8XA 3VN9A 5AP1A 4Y46A 4O7WA 3RALA 4FNWA 4CLIA 1GJOA 2V62A 2RFEA 4I93A 3QHRA 2OIBA 4AAYA 2R3NA 4FEVA 3A7FA 5HE3A 3C4XA 1ZY4A 2CHLA 3DXNA 3IGOA 2X0PA 4IDVA 5DR9A 5EI8A 4DYMA 3G6GA 2X8IA 3V6RA 2CCHA 4EOIA 4G16A 5JEBA 5JK3A 1A9UA 4RWKA 4ZSAA 5IA1A 3P08A 4LV5A 4QMLA 4DH3A 4YO4A 4DF3A 2J0MB 5IH4A 2ITXA 4FT3A 3CS9A 4OBQA 4I20A 3D4QA 4KBKA 4ANNA 3FKNA 2UZUE 1GNGA 1W2FA 2HELA 3ZRMA 2IN6A 2J5EA 2ZV2A 4D9TA 4AZSA 1WAKA 1JLUE 3HYHA 4KAOA 4M0ZA 3HV7A 3T8OA 3U6IA 1YOMA 1Y91A 3GOKA 1R0EA 3L8XA 2VZ6A 4MKCA 4MK0A 3R8UA 3UVQA 2Q83A 4R8QA 5BVFA 3P4KA 1UKHA 3NGAA 3PVWA 3Q9YA 3DBFA 4EOOA 1H0VA 4KRCA 3QA8A 5LVNA 5AP0A 2VTPA 3E8NA 4YPDA 3U4WA 3D14A 3HRFA 3I0QA 4PPCA 5E9EA 2CPKE 4MX9A 2V7OA 4IQ6A 3MY5A 4IAAA 1G8AA 4FKTA 5AR8A 1WVXA 1UWHA 4JX3A 3DBCA 5ANDA 3I79A 3NDMA 3EWHA 4Y72A 4EOQA 3EQCA 4P4CA 3KRLA 2GDOA 4O7ZA 2W1CA 1SM2A 1M2PA 1BI7A 4FKPA 2XBJA 4C38A 4C4FA 1FINA 3OP5A 4S34A 4C3RA 4A9YA 4DTBA 3FC1X 4FK3A 3R28A 5G6VA 3MB6A 1X8BA 3P5JC 3U8WA 2BUJA 3QUEA 3RMFA 2BIKB 3MSSA 3A4PA 4YBKA 4FV6A 2WMTA 5GZ9A 5CX9A 4U44A 4BWPA 3BYVA 5EHLA 4ZSGA 4F7LA 5T3QA 4W8DA 4ZZMA 3C7QA 3TCPA 2GCDA 3KXHA 3A61A 3U6JA 2W9FB 4GG5A 3SVVA 4DITA 4S33A 2OO8X 2W99B 3IS5A 3EJ1A 1Q8YA 2ZAZA 3R2YA 4Z16A 2VWYA 2X2MA 3HLLA 3DBEA 2YCQA 3AC3A 4BCKA 4BZDA 5M06A 2OZAB 2WFYA 2WQMA 4FV1A 1JVPP 3VF9A 2QR8A 3GC0A 4RVTA 2YM4A 1F5QA 1QL6A 2XIRA 3P7CA 4QQ5A 5HEZA 4CFXA 3UTOA 5J95A 4V01A 4UMUA 5LMBA 3DJ6A 3LXPA 1WBNA 3F7ZA 5CAUA 5CAOA 3CY2A 4D2SA 4Z55A 4E6QA 5EQYA 4FKIA 4H39A 3HMPA 3OCGA 1T45A 2UZDA 1JPAA 4RJ3A 1J7IA 4LDTA 4QP6A 3OTVA 1VYWA 4FSZA 4G6NA 1NVRA 3E64A 4MNEB 2AC3A 4WBBB 3THBA 2BKKA 4I5PA 3TDWA 2IG7A 4BTFA 2ERKA 4O7LA 5IG1A 1M7NA 2ONLC 3QXOA 5JFXA 2YITA 2I0EA 4QD6A 2HWOA 1U54B 4DEGA 2YIYA 4E20A 2GPHA 2JKOA 3D5XA 4J96A 2VUWA 5L6WL 3COKA 4RZVA 3B2WA 3DKFA 3NS9A 2EXCX 4IJ9A 4IFCA 1A06A 4K1BA 3G15A 3UIBA 2P3GX 3RZFA 3ZUTA 5GNKA 4YR8A 3SW4A 3QTXA 4J52A 3P86A 3S0OA 3ROYA 1G3NA 2IW8A 3MBLA 4O7VA 3D5UA 3RAIA 3VS4A 3D5WA 3NUUA 5C4LA 3IQ7A 3ZO3A 4D2PA 3T9IA 5LVPA 4L46A 4MBIA 4CFVA 4AW5A 1IG1A 4LV8A 3EQDA 4FNYA 2ETRA 3FAAA 1S9IA 4UWBA 4NCTA 4E4MA 3Q96A 2PVKA 4IB5A 4BTJA 2PUIA 5A4LA 3KMWA 4IIRA 4C2VA 3LMIA 1CSNA 2XUUA 3R9RA 5HO6A 5BUIA 4R7BA 1OL6A 2PMNX 3B8RA 3NIEA 2WMBA 4WKQA 5C4KA 4QQCA 2VWWA 4FG9A 5ACBC 2YN8A 4LGGA 3AC4A 3KCFA 2QO2A 3PIXA 3QQGA 4O1OA 4XUFA 4ZS0A 5FGKA 5CEOA 2P0CA 3GC9A 4JXFA 4Y5Q