3L8PA

Crystal structure of cytoplasmic kinase domain of tie2 complexed with inhibitor cep11207
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
308
structure length
292
Chain Sequence
TIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Angiopoietin-1 receptor
publication title Crystal structure of cytoplasmic kinase domain of Tie2 complexed with inhibitor CEP11207
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 292
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3l8pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3l8pA01
3G33A 3DKCA 5AR2A 5FUTA 5IPJA 1SNUA 2BIYA 4GFOA 3JUHA 3SA0A 4C59A 3E3PA 4RJ5A 4USDA 4BCFA 1X8BA 4KAOA 5IQDA 4BDFA 4KINA 3MW1A 5DEWA 3DZQA 4ZMEA 2Z7SA 2C68A 3OXZA 3UIBA 3UTOA 4ZJJA 3QQFA 3FL5A 2HY81 3UQCA 4A9RA 4DG2E 1E1XA 5D1JA 4XUFA 5LCJA 5HCYA 3U4UA 4EH9A 2IVVA 4FIGA 3LM0A 4M3QA 1IRKA 4HVIA 4B4LA 4I22A 4K9YA 3DJ7A 4RX7A 4LMNA 3R71A 4TYHA 4MXOA 4CKRA 4IHPA 1SYKA 5IG1A 1PXLA 2EXEA 3BYSA 2CJMA 3EOCA 5DG5A 3NS9A 4KIOA 3KXXA 2JFMA 4JIKA 4C36A 4GG5A 2OZAA 4I92A 5CEMA 5HQ0A 1WCCA 3F7WA 4GVAA 4P7EA 4XLIA 1ZZLA 3JY0A 3BLQA 3MVMA 3L9NA 4GW8A 2OBJA 4K1BA 4M69B 4XS2A 5AV1A 3A7IA 5C8KA 2OI4X 3ZXZA 3ZOSA 3OUKA 2HZ4A 3KRWA 4YJNA 2C69A 2VTJA 4GK3A 3VF8A 3LXLA 3GCQA 4K2RA 3TZMA 4XYFA 4G5PA 1ZMVA 3VUMA 2QG7A 1JKTA 3NNUA 4N4SA 5DA3A 2ZDUA 4OTGA 4JS8A 5E8YA 5KHXA 5DIAA 2OZOA 4RFZA 1RE8A 5J5TA 1UU9A 4MF0A 3TIZA 3MPTA 4IACA 3RPRA 3QCSA 1DI8A 2PUNA 2PVRA 5KKRB 3A8WA 3QTRA 2WMVA 2J0MB 4FL2A 2AC3A 5D7AA 1V0OA 4C3RA 4GKIA 3VUKA 5M06A 3ELJA 4NU1A 5HLNA 1Q3WA 2UZDA 1TVOA 3I6WA 4IC7A 4W4XA 3O7LD 3D94A 3GU5A 3QCQA 4UX9A 3JR1A 3COHA 4P2KA 4D1SA 2VTNA 3C0GA 3QBNA 4DH7A 5C4LA 1RW8A 2UW0A 3BE2A 4U79A 4TT7A 1K9AA 2QOQA 4FTTA 4D58A 4A7CA 4QYHA 5EHOA 3R63A 3WF8A 2VD5A 3DJ5A 4RJ7A 2YABA 1J7UA 1JKLA 5JRQA 1HCKA 1H24A 5CXHA 3IOKA 1NXKA 4YURA 4DFXE 2OJJA 2NRUA 2BPMA 1URCA 3F82A 4MHAA 3BGZA 3UNJA 3ZSHA 3LVPA 2WAJA 4QOXA 1R1WA 3BV2A 4ZZOA 2YEXA 3TEIA 4AUAA 3MDYA 3D7TA 1WFCA 4A9YA 2WPAA 4L43A 3R8VA 3QQJA 4IMYA 4YZ9A 2EXCX 3UIMA 5C4KA 4EQMA 4RJ6A 5EI8A 3CLYA 2BVAA 4FT0A 4J98A 4EC8A 2WIHA 2VO7A 4J99A 2WTJA 3FLWA 3PSCA 1Q8UA 5TE0A 4MX9A 4QMQA 4Y5QA 2JBPA 2EB2A 4O22A 4MD9E 2OJ9A 5ETFA 3OY1A 4R8QA 4QMPA 3FI8A 3TDWA 3O8TA 1OZ1A 3E7VA 3KF7A 2HWPA 3H30A 4J7BA 3EN7A 3OWJA 3F3UA 3FMLA 2C6EA 2E9NA 5JGAA 2PMOX 2GNFA 3OC1A 3KXZA 2ITTA 4I0SA 5FP5A 4BN1A 3R6XA 3W8QA 3UZRA 3QQLA 3BBTB 1W7HA 5CNOA 3R30A 4RC2A 5DOSA 3R9OA 4X3FB 2R64A 1G8SA 2ZV9A 2ITNA 3MH2A 3RPVA 4W4WA 3RBWA 1U46A 4FTAA 3MB7A 4TNBA 2X39A 1IEPA 4I5PA 4XV3A 2HXLA 4MKCA 4ZJIA 5AUXA 2PUPA 4ZZNA 1Q3DA 4FG8A 3IW7A 4U6RA 4XBUA 3BU3A 4NM5A 5JFXA 3ERKA 3VUTA 1A9UA 5TKDA 4ZS4A 4O6EA 2NRYA 1PYXA 2YCQA 4Z9LA 4HNIA 1Y8GA 4UZHA 5KX8A 2GNGA 2PWLA 5AUYA 4NYEA 3QTUA 1JVPP 3BWJA 4RLLA 3ZC6A 1DS5A 4RBLA 4F70A 3HMPA 5CU3A 5L2TA 2FSTX 1CTPE 5KMLA 2UZVA 3OW3A 2YJRA 3UGCA 3QZIA 5L6OA 3Q53A 2RFDA 4I23A 2R3KA 3UYTA 2IW8A 5CENA 4S33A 1EH4A 2WMTA 4PUZA 4E20A 3NUPA 2BCJA 3CQEA 3TV4A 2CKPA 2QO9A 4ALVA 4E5BA 5HTIA 3MPAA 4FKJA 2YM8A 2UZLA 3IPHA 5C9CA 5HU3A 4QYFA 5JGBA 2IWIA 3LXKA 2IVUA 2KULA 1PXMA 3DT1A 4XHKB 3KCKA 2W5AA 3GNIB 4DGNA 3OHTA 3OD6X 5EDRA 3GC7A 4TTHB 3N4UA 2W06A 4JL9A 5IQEA 2ZOQA 2JIIA 4R77A 2C30A 1SVHA 1PF8A 3EQDA 5HI2A 5HNBA 4QRCA 5H3QA 5IQFA 2W1ZA 2PZ5A 4IX5A 3ZUVA 4ASZA 3WZUA 3S1HA 3E8EA 4ZY4A 4NH1A 1YVJA 4XX9A 3DKOA 3KQ7A 1H00A 5TT7A 4DGLC 4WG4A 2CNQA 5AX9A 2QODA 4FV2A 1YI3A 1MRVA 1GIIA 4M68A 4GH2A 3LLAA 3U9CA 1W82A 4R7BA 2O2UA 3L9LA 5DFPA 5M56A 2YERA 5AMNA 4UWCA 2PVFA 2VTRA 4Z7HA 3R8UA 5GIOE 4L53A 2XA4A 3ZC5A 1FMOE 1H01A 2JDTA 4WBOA 5HLWA 4WNPA 4DH3A 2XRWA 3GVUA 3PIYA 3NVKI 5LOHA 5J1VA 3FAAA 2A27A 2Z8CA 4WUAA 3HL7A 4EOJA 3CR0A 1UVRA 2VO0A 2XM9A 3BYVA 4E73A 4NCTA 3FHIA 3MPMA 5HG5A 3RK5A 3VBVA 4F6SA 3I81A 4TN6A 3G0EA 4GIIA 2CSNA 4FSWA 4O7LA 1U5RA 3DCVA 4FEWA 5BVOA 4YGAA 4RG0A 2WHBA 4AT4A 4HCVA 2XIYA 4IM2A 5I9UA 3R0TA 4FSQA 4QQTA 3FC1X 2YIQA 3ZUTA 2OWBA 4BKYA 4F7JA 2OJIA 1SMHA 4IDVA 4LM5A 4FEXA 1GY3A 3BIZA 4X2KA 2CKOA 4KSQA 3Q5ZA 2WELA 4X6RA 3PVBA 2RIOA 2OW3A 4AZVA 3NYNA 3WZDA 3MI9A 4NWMA 2PPQA 3FZRA 5FRIA 4G6LA 3RAHA 3HX4A 1ATPE 4XV1A 4KBKA 2PYWA 5AEPA 4LG4A 4JR7A 2B53A 4Q2AA 4RA4A 3RCDA 3R9RA 2JKOA 5AUUA 4KKEA 4HJOA 3VJOA 4FR4A 3OT8A 2UZBA 5AR5A 5EYKA 1FMKA 3ITZA 3RNYA 2HIWA 4I5HA 4QNYA 4UZDA 3UO6A 4XG7A 2UZTA 2V62A 4C57A 3HMOA 3LJ1A 2LAVA 5K4IA 4O0SA 4IE9A 4H3PA 3ACJA 3QD3A 4AACA 4D4SA 5EM7A 4FGBA 3FXXA 4WHZA 4BBMA 1PMNA 5DR2A 3FLNC 4F7NA 2YN8A 3DU8A 3ZZWA 3MFTA 2CCIA 3QHRA 5EOLA 4F6UA 4OTPA 4CKIA 1PXOA 1OUKA 4C3PA 3DXPA 1QMZA 1YOMA 4V04A 3VAPA 4L8MA 2IZTA 2WTVA 3NNVA 5HICA 3ORMA 2R3HA 2YIYA 1BLXA 4QPMA 5J95A 1STCE 3D83A 4ANQA 2R3GA 5HE2A 3LJ2A 5HVYA 3R8LA 4BF2A 2GQSA 2CGVA 3L9PA 5IQHA 4ZK5A 2OSCA 1UWHA 3V6RA 3I0OA 3R22A 3RZBA 2CLQA 2PVHA 4R7IA 3QCYA 5GZ9A 3UPXA 5J1WA 3DS6A 2HOGA 2OIQA 3S4QA 1WVYA 2C4GA 4KWPA 2W0JA 3ENMA 2J50A 5D41A 4AAAA 4CV8A 4CZTA 3C9WA 4L7FA 1O6KA 5HEZA 3FEGA 4ZAUA 3IKAA 3F2AA 4G17A 2QURA 1MRYA 3QKMA 4E6CA 4D55A 4EYJA 3FLZA 4YP8A 3RWPA 4BWKA 3A7GA 2P2IA 2VV9A 2V55A 4JQ7A 2JEDA 4PRJA 3V8WA 5BQ0A 1Q61A 2ESMA 5IISA 4RZWA 1U54A 5I4NA 2WEIA 2HAKA 2XEZA 4KRDA 3P79A 3THBA 3S0OA 3TG1A 1PXJA 4FOCA 4JX3A 4ERWA 3PJ3A 2E9UA 3FKOA 1UNHA 3BEAA 3EHAA 4G16A 4MWHA 4U44A 4YTCA 4FEVA 4FKWA 4ZTRA 2YCFA 3V8TA 5LVPA 2VWBA 4EOKA 2W7XA 1DAYA 2X2KA 3GENA 3OVVA 4IFCA 3F61A 3T8OA 4AGWA 3QTXA 2F7EE 4RIYA 1UA2A 2X9FA 3AT4A 2C6MA 2JAMA 4H3BA 5FM2A 5CU4A 2Y8OA 5BVEA 4D0XA 4FEUA 3RPOA 2FVDA 2YWPA 4YLLA 3SAYA 4CSVA 4KNBA 3OCGA 4CFVA 2QVSE 5ANKA 3LE6A 3RINA 3VS0A 2W5HA 3L8VA 4O0RA 4GUEA 4LL5A 2CN5A 5CLPA 2JLDA 3H9RA 4BCPA 4AT5A 3P0MA 3ORTA 4U3YA 4CMUA 4F6WA 1Z9XA 3ATSA 2BROA 5CY3A 1NY3A 4ZTLA 4JDIA 2QLUA 3MGYA 2QQ7A 4IWPA 3UMWA 5FXQA 3HZTA 1YOJA 3ZU7A 3FMJA 4E8AA 3IW8A 3EN5A 5EQEA 3WIGA 5A4CA 4H39A 4WG3A 2PUUA 5LMBA 4D5KA 1OKVA 2OIBA 2R3NA 1AD5A 4F63A 1Q8YA 4EBWA 5L3AA 1ZYLA 2UZWE 2VX3A 3OROA 1F5QA 4ASXA 4BCJA 4BTMA 4ZSAA 2H9VA 4AE9A 4YPDA 3POOA 4IZYA 5AV4A 1R0EA 4QP9A 1J3HA 4C38A 1VYZA 5JMSA 3HYHA 4BDHA 4EKLA 4ACCA 2GHGA 3AGLA 5DT0A 3UBDA 3UVPA 2BFXA 5DT4A 2WTDA 3P1AA 3WE4A 4FNXA 2X4ZA 3MSSA 2ITYA 5JK3A 2R3QA 3POZA 5E1SA 4PF4A 5C01A 5HX6A 4AZWA 2BR1A 4EH4A 1FGIA 3DKGA 1W83A 4O0TA 4U42A 3WF6A 2J90A 4BCNA 3OW4A 3PXKA 4LV8A 3V5PA 4LGGA 4JQEA 4RFYA 2YWVA 3FZSA 2IVTA 5CASA 5EI6A 5C8NA 1FPUA 3HMNA 2WTCA 1DAWA 2VWIA 3B8RA 3KK8A 3IGOA 3OTVA 5HE0A 4CMOA 5CF8A 5KMOA 2VGPA 2OK1A 3LFDA 3TXOA 3R1SA 4BL1A 1ZYCA 4U40A 5AIKA 5IQBA 4F1MA 4H58A 4J8MA 2F7ZE 3NLBA 1OL5A 1OL2A 2HZNA 5IQIA 1KWPA 4FTLA 2GTNA 5LMAA 4L00A 4BBEA 3PTGA 4GK2A 4ACMA 4IM0A 5DE2A 4FYOA 5J87A 2PTKA 4RSSA 1OKYA 2ETMA 4O7YA 3UG1A 4EUUA 1GZOA 5I5ZA 1J7LA 4OTIA 5KMMA 5CSHA 3HMIA 1PKGA 3GQIA 1JLUE 2W1HA 4Y85A 2VAGA 5HESA 4WD5A 4LQMA 3ACKA 3C51A 4EK4A 5DNRA 5K0XA 4XV9A 2JC6A 4CV9A 4FVQA 2WQOA 2ERZE 4FNZA 2BZKB 2R3OA 4QT1A 1IAJA 3NMUF 3A4PA 3U54A 2J9MA 5L4QA 3AD4A 4P90A 5M4FA 4TZRA 4BGQA 2YDKA 3MFRA 3MN3A 3GU4A 4MXAA 3A62A 4CMTA 4DTBA 3MH3A 4BIEA 3WARA 4PDPA 4LOOA 3D7ZA 4RX5A 5CAUA 1GIJA 2PVJA 2Y9QA 4G3EA 5HD4A 4C7TA 5HO8A 4NJ3A 3MS9A 2VWVA 4HYSA 4PV0A 2XJ0A 5CNNA 3CGOA 4AA5A 5IA3A 3I60A 2EU9A 4EL9A 5HE1A 3KXGA 1JKKA 5HD7A 1JBPE 1LR4A 4CXAA 4GT3A 3F69A 4L3JA 4IX4A 3QQUA 3Q3BA 5DI1A 3CY2A 2QI8A 3NYXA 2W1EA 3FHRA 3MH1A 3O96A 4H1MA 4IVBA 3PXZA 5DRBA 3ORNA 4K18A 3GU8A 3MA6A 4GYGA 4IWDA 5LWNA 4I41A 2B7AA 2H8HA 3OTUA 4TYIA 2XVDA 5CEOA 4GL9A 3DBDA 1ZLTA 3KFAA 1YI6A 2C6KA 4QYGA 3RM6A 4J1RA 3LCDA 4YNOA 4Y5HA 4XP3A 4QMLA 4EWQA 2QG5A 1XH7A 4OUCA 4W4VA 2W1IA 3QXPA 1U4DA 3CKWA 3E92A 4JG8A 1Q62A 4QTDA 5AR8A 1OIUA 4BCIA 1WBPA 2ITWA 5AA9A 3V6SA 4MNEB 4Q5EA 3HGKA 4H36A 3SRVA 5KMIA 4BVUA 3DNEA 3GEQA 4V0GB 1W8CA 1VJYA 3TN8A 5C26A 4EOOA 5BVFA 1GZNA 4A9TA 2C0TA 4D4VA 3F66A 4EHZA 4NM7A 4RQVA 3TJCA 5CSXA 4AOTA 5HVKA 5HTBA 2R2PA 3AC4A 3QTQA 3HP2A 4IB3A 3VBXA 2KTYA 4BZNA 4DEGA 4YC3A 4MF1A 4YBKA 3FLQA 4FKUA 3V04A 4U8ZA 2ZJWA 4RFMA 3ODYX 5AR4A 3IQ7A 4IXPA 3V5QA 1YHSA 2V5QA 2Y6MA 3DAEA 2QU6A 3HRBA 1M7NA 3R00A 4X0MA 1Y57A 2UZEA 4QP6A 1GIHA 2GCDA 5GHVA 2GU8A 3ANQA 3LCOA 4A4XA 4HYUA 3FY0A 4AP7A 4JAIA 4UWBA 2GMXA 3IGGA 3O17A 5CEKA 5CAOA 1OGUA 4E93A 4QYEA 4AT3A 4BDJA 3AC2A 1Q8WA 4HGLA 2V0DA 5M44A 4MK0A 2VTPA 3AC3A 4QQJA 3LCSA 4B8LA 5TOZA 3CTHA 4DF3A 4ITHA 4J96A 2C5YA 2CCHA 5CVGA 4FKRA 4HZSA 1PW2A 3FI4A 4GEOA 3VC4A 1UU7A 4M7IA 3TI1A 3S95A 4ENYA 4UN0C 2PE0A 3VUIA 3ROYA 2J7TA 3BX5A 4RWIA 4RWLA 4QTCA 3BHYA 4FTUA 4IEBA 1J1CA 4FSMA 3HUBA 2X9EA 3QX4A 4RT7A 3E7OA 3HA6A 4O7NA 3GBZA 4HGSA 5EK7A 3ZBXA 2RFNA 3CS9A 4O0XA 2GFSA 4MBLA 4R5SA 2B52A 2I40A 3WILA 3HP5A 3KY2A 4TKSA 2BRNA 3PXYA 4D4RA 3QHWA 2QHNA 5FQDC 4DITA 4LMUA 4NCTC 3GGFA 4MBJA 5CF4A 3JS2A 4I6FA 3ZDIA 4DFNA 5J5SA 2XBAA 3WF9A 5EDQA 1T45A 4R3RA 3Q52A 2WQNA 3Q96A 5B2MA 5KCVA 1ZZ2A 5IDNA 3ALNA 4ASDA 4O1PA 2UVYA 4PPAA 3BU6A 3PDTA 3NWWA 3R73A 5ACBC 2GS7A 1BUHA 3QGYA 4D0WA 5BX0A 1YQJA 1WMKA 5FM3A 2VU3A 3SXSA 4GUBA 2QOFA 4BB4A 5ANGA 3EZRA 5L6WL 3FMKA 4CQEA 4DN5A 4TWPA 5K5NA 4PMSA 3GC9A 3NIZA 3ATTA 3GUBA 4KABA 3GU6A 5HOAA 4EK8A 3OG7A 3II5A 2WOTA 4X2NA 3KEXA 3W1FA 5E8TA 3I5NA 3IW5A 5HBHA 4D5HA 5L6PA 2CDZA 3TNWA 2PMIA 2HZ0A 4YR8A 2B9HA 4UB7A 5FEDA 2YFXA 2XZSA 3WF7A 3G90X 2R3RA 2VTOA 4ENXA 3FUPA 3HEGA 4V01A 3DLZA 4YZCA 1CM8A 5H2UA 3UVQA 4GS6A 2OG8A 3PVUA 4BZDA 2OLCA 4EZ5A 1K3AA 4ANMA 2IW6A 4IQ6A 4G2FA 4O1OA 2WEVA 2GNLA 3KULB 5E8ZA 2V22A 3CD8A 4O0UA 1ZAOA 5A9UA 2P2HA 3EQGA 3QZHA 5KBRA 5E8UA 3ZO1A 4DC2A 3SG9A 3MESA 4EK3A 2GNIA 5AX3A 3UQFA 4YTIA 3DPKA 4X6QC 3DQXA 3OF0A 1Q4LA 2W17A 2WMRA 3BYMA 1MQ4A 4FTRA 4JDJA 3RAWA 3UOKA 5CZIA 5LMKA 3CPBA 5IA4A 2PK9A 3H0YA 4EK6A 5AAEA 5I9ZA 1IA9A 2EB3A 5JQ8A 3OEFX 3TTIA 3NZ0A 1CKIA 4MXXA 4AW1A 2WQMA 3A7FA 2G2HA 2X2MA 4QQCA 1TQIA 4L7SA 3L8PA 3PJ8A 2C6DA 4WRSA 2CKQA 4IANA 2UW7A 4ZY5A 4II5A 2RF9A 3QALE 5A6OA 3ZCLA 3IO7A 4K8AA 3PG1A 4FKQA 5CVHA 5GJFA 4C33A 1OI9A 1LUFA 5EW8A 3W2OA 4ARKA 1LP4A 4IW0A 3WF5A 3WOWA 4CRLA 4W8DA 1KE5A 1OIRA 3G0FA 4ZTQA 2CHLA 4DFBA 3R02A 3HV6A 4I1ZA 5CXZA 1FQ1B 4R1YA 4LUEA 5IMEA 3LFNA 1V0BA 1XH4A 3AGMA 4IAIA 4NM0A 3O50A 3UIXA 1IG1A 1YWRA 2BIKB 5ICPA 3R21A 1KE7A 3TUCA 3DFAA 2C3KA 3BQRA 4KRCA 3QRJA 3QD0A 5KNJA 4BKJA 4FTJA 5JFWA 4TNDA 4OAVB 3AXWA 5BPYA 5CZHA 3FMDA 3NGAA 1AGWA 3FI2A 2C0OA 3COMA 4X7QA 4BC6A 5M07A 5CVFA 5EQPA 2YIRA 1YXTA 4QPAA 2RFEA 1MQBA 4EH5A 4WOVA 1W98A 5CI6A 3WYYA 3Q5IA 1PYEA 3BHUA 3HV7A 4WBBB 3CQWA 4YC6A 4BGGA 4FKLA 3R1NA 2REIA 4YHTA 4GFMA 5AP1A 3D4QA 3R9HA 2R4BA 5DRDA 3MB6A 4M0YA 3VBWA 3UJGA 3KA0A 4GT5A 1F3MC 3NW5A 2CNVA 1MP8A 4B99A 4CYIA 3C4CA 4S34A 3FY2A 4QMMA 4DEIA 4BICA 1GZ8A 4K0YA 1BL7A 3NNWA 3RPYA 5M57A 2Q0NA 2F7XE 5DR9A 4U45A 4BDCA 3CE3A 3E64A 3AMYA 2WMQA 4GJ2A 1Q41A 3UYSA 2F9GA 5T6KA 4PL3A 3SC1A 4C62A 4BYIA 1Q97A 4OTQA 5BVKA 4KUJA 4FTCA 2BRMA 3CBLA 4P5QA 2ETRA 1FOTA 3QX2A 2WB8A 1WBTA 4AA4A 3RHXA 5KHWA 5LXMA 3BKBA 3ZLWA 3G6HA 1OECA 3Q2JA 5IH4A 3DB6A 4EH7A 5DGZA 4RZVA 5HLPA 1UKHA 4ZLZA 4NKAA 4FSTA 4U3ZA 2X0GA 4YTHA 3BU5A 4QQ5A 2OJGA 4DFZE 3UOHA 3SG8A 3O7LB 4DBXA 3A8XA 2HK5A 4KSPA 5HORA 3O71A 2ZYBA 5FXRA 2XIZA 1GZKA 1I09A 3GC8A 3I7CA 4E4XA 4FKOA 4YTFA 4U80A 5A4EA 2I0YA 5EKNA 2R3MA 2WMWA 3LFCA 4L67A 1H25A 2PL0A 1QL6A 5E90A 4ANBA 3TZ9A 3MJ1A 1CKPA 2SRCA 2PULA 4GVJA 5I9WA 3DOGA 4YJPA 5JRSA 3LCKA 3K3IA 3KN6A 2X7FA 3ZS5A 2FUMA 3C0HA 4BI2A 4FE2A 3RGFA 4PL5A 3TZ8A 2XS0A 2PMNX 4ITIA 4KA3A 3U87A 4EH2A 4KIKB 3FSKA 4FZAB 4FTOA 2YAAA 1RJBA 3PXFA 2XKCA 3A61A 4HGEA 4XMOA 1SM2A 2OH4A 4ANSA 1OKZA 1OVEA 4FIEA 5LJJA 2YJSA 3VHEA 2QONA 2OO8X 2PVYA 5EQYA 2P0CA 4GT4A 3NUNA 4PPCA 4L68A 3SQQA 4DTKA 4JLCA 4YJSA 4A4LA 5AFVA 4ZSJA 2QD9A 2JFLA 3I7BA 3GI3A 4M14A 4XV2A 4UMUA 2BTSA 2I0EA 4OW8A 3OUNB 2I0VA 3VS7A 4USFA 4DCAA 3IG7A 3JY9A 5AP0A 1ZRZA 2PSQA 2AUHA 4LOPA 4O38A 2ZM3A 3KMMA 4RJ3A 4C35A 3EYGA 4RVTA 4UXLA 4AS0A 3K3JA 4FEQA 4HVGA 4EUTA 4PPBA 5I3RA 3C50A 2BDJA 2Z7QA 3TZ7A 4CFFA 3U9NA 4TYHB 5DVRA 2G2IA 4YZNA 3TV6A 5E8VA 4KIQA 2Z7LA 4BIDA 4X3JA 5CAQA 3SGCA 2JIUA 2OZAB 3ZEPA 4RIWA 3ZFYA 4DH1A 1R0PA 4PTEA 4D1ZA 1PXNA 2GNHA 2XUUA 4CCUA 1OL6A 4FIHA 4APCA 1M14A 3CCNA 3NUYA 2X7GA 4NZWB 4YSJA 2PZYA 4FKVA 4UY9A 1L8TA 4EZ7A 4LOQA 2R3LA 2DUVA 3AC5A 3C4WA 4FF8A 4W8EA 1RDQE 2HW6A 2VGOA 4M97A 3TNPC 2HENA 3PPJA 5TF9A 1H27A 2O3PA 3LPBA 1H0VA 3EN9A 5BVNA 4CG8A 5CT0A 1H8FA 1JSUA 4MAOA 1REKA 4L3PA 1GAGA 3CKXA 3FLYA 2BHHA 3QKLA 1Y6BA 3R04A 1WVXA 2W1DA 3KCFA 4Y83A 3ZM9A 2YISA 3FLSA 4MQ2A 5CEIA 5D9HA 4FNYA 4YZBA 4UMTA 5J9LA 4DTAA 5A6NA 5DR6A 4NIFA 1ZYDA 2ITQA 4F08A 5HTCA 4EOLA 2VTMA 3FV8A 4JNWA 1VR2A 3ZLSA 4IC8A 4AZEA 3OWPA 4BCQA 4I24A 3FYKX 1V0PA 1YXSA 5CX9A 1QCFA 2WMBA 2Y0AA 3A7HA 3KKVA 4GU6A 2XKFA 4O84A 4QP1A 2YCRA 3D0EA 3DY7A 1M52A 4CFXA 2J0KA 1Q5KA 2P4IA 1YOLA 3BHTA 3UOLA 2ITUA 3T9IA 3JVSA 4C4GA 2R3PA 2PZPA 4O2PA 2UVZA 4UV0A 4FKPA 5DPVA 5K3YA 3V8SA 1KE8A 3T3UA 1VZOA 1XR1A 4TWCA 4CZUA 4QP4A 1WAKA 1A06A 3U55A 2C3JA 1BYGA 4G3DA 3D7TB 3G9LX 2FA2A 3ALOA 3IDPA 1JOWB 2E2BA 3OS3A 4DGGA 3T9TA 3P86A 1WBOA 1M7QA 3QD2B 1XKKA 3F7ZA 4QMVA 2XCHA 4D28A 4GYIA 3W2SA 3W32A 4MNFA 3EQRA 4NTTA 5FP6A 1BI7A 4K33A 4DH5A 3MJ2A 1UV5A 3FZTA 2CN8A 2YDIA 2GHMA 2OH0E 2PVMA 1XH9A 4W9WA 3NUXA 5DEYA 3R8PA 4IAAA 5CAVA 4FIFA 3DBFA 1V1KA 2H6DA 4FV7A 5DH3A 4M12A 2ZB1A 3DBCA 2GSFA 2QOCA 3NCZA 3VBTA 4EWHA 2GDOA 2VZ6A 2UZNA 2DQ7X 4G34A 4L01A 3IDCA 5ANOA 3FPQA 2BDWA 5JGDA 1NVSA 5CYIA 3BWFA 1OIQA 4G5JA 2WFYA 3FXWA 4U5JA 5DYJA 2WQEA 3G2FA 3A7JA 4DEAA 2ITVA 4Z16A 3ZBFA 2BDFA 4D2RA 4ZTHA 3O8PA 4DLJA 4NFNA 4IB1A 4RWJA 3VUHA 4UXQA 1PMVA 4CLJA 2PVNA 4YJUA 2QOKA 3MBLA 3NSZA 3L9MA 4FX3A 3EFKA 4JX7A 4C58A 1PXIA 4D2SA 1Q8TA 5HIEA 1XBBA 3PY3A 4IZ5A 4DYMA 3G9NA 4FK3A 3ULIA 5JH6A 3VN9A 4WNOA 4YLJA 1YXXA 2VX1A 4DAWA 4E4LA 3VS2A 3PVGA 5E8WA 4BI0A 2PUIA 5IF1A 1J7IA 3BI6A 3IW6A 2YDJA 4RWKA 4MVFA 3BGPA 4BDEA 5FBNC 3QAME 3GXLA 4CNHA 3QF9A 4OTRA 4ZY6A 1GOLA 1UU3A 3C5UA 1O6YA 4I5CA 2BRHA 3S2PA 2XRUA 2C6LA 3Q9YA 4LRMA 3ZLXA 2B0QA 1O9UA 5IQCA 3BHVA 4UMPA 3D5VA 3ZONA 3UZTA 3AMAA 3GCUA 5JN2A 3ORIA 3R7IA 3R7YA 4E7WA 3OFMA 3I4BA 3PY0A 2Y7JA 3F3ZA 2ZV8A 5H9BA 3PJ2A 3DXNA 5AUVA 3ORLA 4CKJA 5GJDA 4ZSGA 4R5YA 5EW3A 2DWBA 2J5FA 4X2GA 4PNIA 4A9UA 2OJFE 4FK6A 3U6IA 3GP0A 3W2CA 2VTAA 3Q4ZA 4FG9A 4G3FA 2PZRA 3GB2A 4NM3A 5H8EA 4DG0E 4EHVA 5HBEA 4XEYA 3VW8A 4BDDA 1FVTA 3B8QA 3FMMA 1KOAA 1NW1A 1Z57A 1QPEA 2VWUA 3E8NA 4I93A 4JG7A 4J8NA 5D10A 5L2QA 3VQUA 3NUSA 4Y8DA 2VTSA 1R39A 2G9XA 4WT6A 1YDRE 2YM7A 4ANOA 2G15A 2P33A 4XJ0A 5BUJA 4N70A 1BMKA 3QTZA 4JVGA 2PE1A 3VVHA 5IMXA 5LMKC 4PMTA 5M51A 4EORA 1H1RA 2ZVAA 1P14A 4ZEGA 4DEEA 1ZYJA 4DFUA 1XHAA 2W99B 1QPJA 4XG2A 3KXHA 5IUIA 2QR8A 1OL7A 4XH6A 2W96B 2WU6A 5ANJA 1OPLA 3QTIA 3L8XA 4ZSEA 5EYCA 4MEDA 5IH5A 4BDAA 3EZVA 5D7VA 4NJDA 2PU8A 2XYNA 3QTWA 2ZB0A 3QRKA 3TNQB 2E9VA 3EQHA 1PMUA 4O0YA 4FZFB 4K11A 1APME 2WTWA 3IS5A 3QA0A 4UMQA 4LL0A 4KBAA 3PG3A 5FG8A 5T3QA 2G01A 4QMUA 2HELA 4RIXA 1JKSA 4ZIMA 4YU2A 5GIPE 3KL8A 2X6EA 3BGQA 2ITZA 3I5ZA 2UV2A 4PL4A 4F0IA 3RAIA 5A14A 3ZXTA 4YO4A 2RG5A 3LQ5A 4DEDA 3QUEA 4TXCA 5CAPA 4AZSA 5B7VA 5L8LA 5LVNA 3QKKA 4AXAA 4EOMA 4HW7A 2R0IA 4EOQA 4AWIA 3E8DA 3E87A 2J51A 1XH5A 4QTAA 4QYYA 3NDMA 4AE6A 2J2IB 3SLSA 1S9JA 2YIWA 5AM6A 4DEHA 3EFLA 4TY1A 5KBQA 1GJOA 4ID7A 4MQ1A 5CTPA 3RMFA 2B55A 3MTFA 3TUDA 4I3ZA 4FMQA 2R9SA 3VRYA 4DH8A 4W9XA 4ZMFA 4UALA 4NT4A 5AWMA 5BUEA 4R78A 2C6TA 3PPKA 3DLSA 1UU8A 3VO3A 4KBCA 3W18A 3C4XA 4S30A 4IVCA 4AOJA 4BR3A 4J52A 2CGWA 4JAJA 2QHMA 2O63A 1IAHA 5J7HA 4AU8A 3DAKA 3HRFA 3TNHA 2OICA 2CLXA 4IAFA 1XH6A 5HNGA 1URWA 4CFNA 1YXVA 2HYYA 3ZRLA 3D9VA 3E62A 4UMRA 5E1EA 5HBJA 3T3VA 3R1QA 5IKWA 1OIYA 4ZTMA 3CXWA 4GJ3A 3QC4A 4OTHA 2XK9A 3EL8A 5IEYA 3TKIA 3KVXA 5F20A 4KB8A 3DDPA 3DDQA 3UVRA 4A9SA 5IUGA 4NTSA 1G8AA 5A4LA 4L44A 5BUIA 5CU0A 3AC8A 3BYOA 2X1NA 5C03A 4AFJA 3V01A 3QRTA 4B7TA 1DM2A 1F0QA 4AG8A 3UO5A 3VF9A 3QC9A 4ZJVA 4BDIA 3NUAA 4GMYA 5IA5A 5DWRA 2XM8A 4E4NA 2QOOA 1OITA 1VYWA 4EHEA 3QZFA 5GNKA 4DA5A 5CS6A 1M17A 1TQMA 3EIDA 3NPCA 3BEGA 2FO0A 4CZYB 3L1SA 1XBCA 2EUFB 4FBXA 3H0ZA 4FV0A 4NEUA 5CF6A 2UW6A 5AP7A 5A54A 2QC6A 4E6QA 3LOKA 3AMBA 1PKDA 2BTRA 2E9OA 3FMHA 2ZV2A 4B9DA 4BGHA 4CG9A 4N6ZA 3LLTA 4FV1A 2B9IA 1KOBA 3P9JA 3R2YA 4DHFA 3FZOA 4KKGA 4BCKA 4EOIA 4I6HA 3LQ3A 2XJ2A 3MY0A 2VUWA 2BMCA 4ANNA 3EFWA 4C2WA 3MY1A 5CI7A 3OXTA 4ZZMA 4E26A 1U54B 2X7OA 3QCXA 4LYNA 4H05A 3GOPA 2Z2WA 4NL0A 4G3CA 4QPSA 3D2IA 1GNGA 4YC8A 3ID6C 4JQ8A 4YLKA 3E3BX 1BX6A 3HVCA 3UE4A 3KRJA 3MIAA 3PWYA 4IJ9A 3R8MA 4O96A 1YXUA 2VWYA 3C4FA 4XRLA 2W1FA 3HDNA 3VW6A 2QO2A 4ZLOA 4IWOA 5D11A 3RALA 4D2VA 4F9YA 3RZFA 3OCSA 2CNUA 3VIDA 2IJMA 4UBAA 4FODA 4RPVA 4U97A 3O2MA 5T68A 1KSWA 4TRLA 3FQHA 4EOPA 4RIYB 4FTKA 2I6LA 4QP8A 3WIKA 1I44A 4FVRA 3R2BA 4YUQA 2IO6A 2XEYA 4AZTA 5JT2A 5K0KA 4AW2A 3ZZEA 3Q6WA 3NCGA 4IAZA 4BZOA 2PHKA 3QWKA 2YM3A 5C8MA 1SZMA 3EQIA 3F2NA 3O23A 3BHHA 2O65A 4OT6A 4WO5A 2C6OA 3ORZA 3EQPA 4M69A 4Z55A 3RNIA 2XNMA 2YM4A 4G9CA 2R3FA 3LFFA 3OBGA 2J5EA 4PDSA 5F95A 3L8SA 3Q4UA 3UODA 4DGMA 4HVHA 2WOUA 4MD7E 5E9EA 2A19B 3ORPA 5JFVA 3NYOA 4FSZA 4BCGA 5ACKA 4PMPA 5B0XA 4CTCA 4FIJA 4IBMA 3VUGA 1KV1A 1SVGA 1YDTE 3NAYA 3G5DA 4IDTA 3UIUA 4GRBA 1ERKA 3U51A 3KXNA 3V5LA 3WBLA 4C8BA 3VJNA 1P5EA 3LXNA 4JI9A 3SV0A 4EQUA 1REJA 3EQFA 3VNTA 2JDSA 3TV7A 3LMIA 3EQCA 5CWZA 4O86A 3H3CA 3EB0A 3P7AA 3UO4A 5M4UA 3D2KA 2A1AB 4BCHA 5L8KA 4ONAA 5A4QA 3LZBA 4E3CA 3SVVA 3ZTXA 3U6JA 2Y4IC 3MYGA 4AQCA 3PRFA 3QA8A 1ZXEA 4EK5A 3VS3A 3FQEA 1KE9A 4B8MA 4DCEA 3QTSA 2IG7A 5M4IA 3SXFA 3LFEA 2C1AA 3CEKA 5ANEA 2ITOA 1U59A 3VBQA 3PIXA 4NKSA 2ETKA 4EH6A 3NUUA 2JDRA 4AZFA 4JBOA 2XBJA 1LEWA 3OOMA 4O7ZA 2X2LA 3HRCA 3CIKA 2WIPA 2JKQA 2GNJA 3PY1A 3VQHA 5KMKA 3F5XA 2IZRA 4OBQA 4N57A 3P7CA 4UEUA 3QYZA 4BRXA 5E4HA 3KMWA 3QRUA 2UW8A 3BBWA 4BBFA 4XNEA 3LCTA 5ANIA 4E5AX 2CMWA 2ONLA 2C5XA 1FVRA 3NNXA 1CDKA 5L8JA 3VS5A 5IA1A 3KC3A 2BZJA 2C3LA 3LHJA 4IAYA 3V5TA 3A60A 2X8DA 2NO3A 4E6DA 3VS1A 5TR6A 4C3FA 1JSVA 2NP8A 1T46A 4O7VA 4OTWA 3OWKA 5IQAA 2QO7A 3DTWA 2AC5A 3EJ1A 4LGHA 3Q60A 4FV3A 4OBPA 4Q5HA 4U81A 5IA2A 4O7TA 4RIOA 3RTPA 2C5NA 5IA0A 2F49A 5DBXA 4HYHA 4O7SA 3NEWA 4JRNA 2B9JA 4J95A 4BCMA 3PVWA 1OM1A 2UW3A 4IFGA 1FGKA 4YSMA 3AG9A 2UUEA 5FWKK 2VTLA 5AV0A 3VS4A 5JEBA 5DLSA 3KK9A 1MRUA 3NIEA 5ITAA 5IU2A 4APPA 1Y91A 2YLFA 2QR7A 4BY9E 4Q9ZA 3HLLA 2VTHA 4QO9A 3U8WA 3WZKA 3Q2MA 3QGWA 5CQWA 5HU9A 5IUHA 4WUNA 2WXVA 2YCSA 2HCKA 3H10A 5EKOA 5HG8A 3QLGA 2ZV7A 2OF2A 4WIHA 4X3FA 5AV2A 3W33A 2QOIA 3H9OA 1R3CA 3QRIA 5IEXA 3RCJA 3HKOA 1NT2A 4O2ZA 3PLAE 4DFLA 1OBDA 2X8IA 1S9IA 5IZFA 2BRBA 2OU7A 4FV9A 3GCPA 4HOKA 4P5ZA 5EYMA 1CSNA 3LQ8A 3P23A 4P4CA 4QMOA 4CD0A 2YIXA 2RL5A 2XNOA 4AF3A 3TKHA 5C1QB 2B1PA 4FV4A 3MWUA 4HZRA 5G1XA 4M67A 4YZMA 4FOBA 3V51A 2NNWB 4FTIA 3UG2A 4JJRA 4QP2A 2E9PA 2ZDTA 4FUXA 2R7BA 1TQPA 2UW4A 2XB7A 3EWHA 4C4IA 2JIVA 3PA4A 2WU7A 5F1ZA 4MCVA 3SW7A 2C47A 5M55A 1FBNA 3FC2A 4O21A 2GFCA 4M13A 1OMWA 3QWJA 4DT8A 5FD2A 4FZ7A 2QOBA 2RSVA 2RG6A 3PIZA 4FV5A 2JKMA 2W9ZB 3HUCA 3S00A 2FH9A 2C1BA 3C4EA 3V3VA 4U7ZA 4FL1A 4Z7GA 4M8TA 3SRVB 4ZTSA 3RI1A 3MH0A 1ZOHA 3IECA 3R8ZA 4CT2A 3TTJA 4E4MA 1K2PA 4D1XA 3PA5A 4Y72A 3SXRA 3DTCA 2VX0A 3F88A 3FXZA 4CFUA 5E8SA 4F09A 5LCKA 1ZARA 4I0TA 2Y6OA 4XG9A 3ZO2A 1AQ1A 3FKLA 4AGDA 1H1QA 3QQGA 5JSMA 2XF0A 4U43A 4PDYA 3Q9ZA 3G6GA 3DQWA 2ZM1A 3QYWA 5J8IA 4AGUA 4CLIA 4DGOA 4HVSA 5KE0A 5K9IA 2FSOX 2WD1A 3F5UA 4ALUA 4GKHA 4W4YA 2C0IA 1B6CB 5ANDA 3ANRA 3B2TA 5DT3A 5L2IA 4ZP5A 5HKMA 3HMMA 4GG7A 4D2PA 2ACXA 3M11A 3K5VA 1ZMUA 3CY3A 4FSRA 3AD5A 4F9CA 4TW9A 4NFMA 4PMMA 5CU6A 3ORKA 4EH3A 4MWIA 3SD0A 2OXDA 4I20A 3P7BA 4FSYA 4IAKA 5A46A 3PZEA 2Y4PA 3TUBA 2BKKA 4DFYA 2QKRA 4KD1A 3TACA 4FNWA 1PXPA 2PVLA 3ROCA 1P2AA 3LMHA 3I79A 4JDKA 1JAMA 2BAJA 2YZAA 5CSPA 4JBPA 1XBAA 2XKDA 3WZEA 5BMMA 1B39A 1UKIA 1JSTA 2WGJA 3E5AA 3FPMA 2BALA 3O51A 3IW4A 3MFUA 2YAKA 4F0FA 3ZRMA 4HNFA 2FYSA 4ZXTA 4RVLA 4ASEA 4BTKA 3RKBA 2QCSA 5EW9A 4BWXA 4FUYA 3SKCA 4ERKA 1PMEA 3SDJA 5BVDA 2FSLX 4HVDA 4TPTA 3C4ZA 3LM5A 4RRVA 3FE3A 5DN3A 2IPXA 2UZOA 4R3CA 3DJ6A 3KMUA 3PSDA 3FL4A 3PJ1A 1OKWA 4NW5A 4RMZA 5AP4A 2OKRA 2JITA 1BKXA 2UVXA 2A4LA 4EOSA 4DEBA 3VWAA 3R7UA 3VRZA 3W55A 5G6VA 5BMSA 5F9EA 3CSVA 2GS2A 1WBNA 3QFVA 1CMKE 4B0GA 2VNYA 4F1OA 1YRPA 4BCOA 3D5UA 2C5OA 3REPA 4F4PA 4EJ7A 3PYYA 2OIDA 2FSMX 3HNGA 3JXWA 4QMXA 2XK3A 2BAQA 2B9FA 3A2CA 5DHJA 3COIA 5I9YA 3ETAA 4MYGA 2WMSA 4JR3A 4AGCA 3DBQA 4TWOA 4B6LA 3R7GA 3BRBA 4GIHA 1YI4A 2NPQA 1LPUA 5HHWA 4Z3VA 3GFEA 2XYUA 2V7AA 4BWPA 4E1ZA 4WKQA 1A48A 1HCLA 5LWMA 1UNLA 2ZAZA 2EXMA 3ENHA 4Y73A 3MVHA 1WZYA 3N4VA 2W4JA 3IONA 3DFCB 4F0GA 5EOBA 1W0XC 3VS6A 2PVKA 2XIXA 3AD6A 3CD3A 2IZSA 4BDGA 2XKEA 3EN4A 4QTBA 3W10A 1M2RA 4F1TA 3OCTA 5HE3A 4F99A 2DS1A 2R3JA 4YJQA 4O7RA 4FVPA 4PP7A 1Q8ZA 1ZYSA 5ETIA 4GV1A 3P78A 5EHYA 5AAFA 2YLEA 5HO6A 3S3IA 1UWJA 1JPAA 3CGFA 3HDMA 4OTFA 2YZLA 2B54A 3UPZA 4DLIA 3GCSA 4ITJA 5F94A 1NVRA 3IDBA 4IB5A 5EM8A 5ETAA 1M2PA 5GZ8A 3UNKA 2X4FA 3EN6A 5EDPA 4F64A 4C4JA 3UOJA 1JQHA 3GT8A 3MIYA 2J4ZA 2B4SB 3F3WA 1FVVA 2YA9A 4FC0A 2W1GA 3ODZX 4L42A 5HG9A 3RVGA 5LVMA 4UYAA 3RK9A 5KUPA 4QMSA 1Z5MA 2WTKC 3TKUA 3AOXA 3QL8A 4F7LA 4YJTA 4S32A 1WVWA 4KS7A 4IADA 4F9BA 1PHKA 3COKA 2IW9A 4MXYA 4LGDA 4CRSA 3D5WA 4CTBA 4QTEA 3UP2A 4D2WA 3BQCA 3DGKA 3KVWA 3BYUA 4XG6A 5DMZA 3DK3A 3ZMMA 3OCBA 1WBVA 2QLQA 2QOHA 5ETCA 4I5MA 4IJPA 4RQKA 1ND4A 4U0IA 3NR9A 4C4EA 5A4TA 4RJ8A 5E92A 3TIYA 3VBYA 2JKKA 3EKNA 4RA5A 5HIBA 5J9YA 3TWJA 2XK6A 2VRXA 4U41A 5CT7A 3NW6A 3Q9XA 4I0RA 2O0UA 1HOWA 3PLSA 3FMEA 4KS8A 4EC9A 2JAVA 1DI9A 4IZAA 2YM6A 4CCBA 3FWQA 4KIPA 3NRMA 2JBOA 3DZOA 3DB8A 3HV4A 4Y95A 3TT0A 3D14A 3H9FA 3WZJA 2WQBA 5FTQA 2BZIB 4YJRA 3GQLA 4J97A 1XWSA 1YW2A 2O8YA 3MFSA 3AC1A 3C0IA 3CJFA 3N9XA 3O0GA 5BYZA 1PRYA 3KB7A 4R6VA 2XK4A 4PWNA 5D12A 4FT3A 3PE2A 1RQQA 3GCVA 1R78A 2CKEA 3VULA 3ZHPC 2PY3A 4RVMA 5IDPA 4IVAA 4XP0A 4JXFA 5HNIX 1G3NA 2IN6A 3PWDA 3K5UA 2XNPA 2Z60A 1BI8A 3MA3A 3PUPA 3QQKA 3OT3A 4HYIA 4E5WA 4UWYA 4S2ZA 5AAGA 3E88A 1Q99A 2YITA 3G51A 4UYNA 3NYVA 1PJKA 4C2VA 2JD5A 3OMVA 4NUSA 2ZMCA 4I4EA 3N51A 4RX9A 4ANLA 3CJGA 3OOGA 4C4FA 2VO6A 2JDOA 4YJOA 4FIIA 4FT9A 3R01A 3BZ3A 5KKRC 3V5JA 4A07A 3PP0A 3W2RA 1YWVA 5L2WA 5J79A 4OAUC 3FYJX 4XRJA 3DA6A 4GCJA 5IQGA 1OPKA 2LGCA 4IIRA 5FDXA 5AA8A 5J9ZA 2WKMA 3MY5A 2GQRA 4FT7A 4K77A 4PNKA 2BHEA 4XLVA 2VWXA 4C61A 3ORXA 5M4CA 2GHLA 5B2LA 2RGPA 3P5KA 4RC4A 5FEEA 3F6XA 5BVWA 3PZHA 4R1VA 5K4JA 5GINE 4WNMA 3BV3A 4DINA 1L3RE 3QUPA 4FT5A 4IZ7A 3C7QA 3EL7A 3OZ6A 3Q4TA 4MD8E 4GFGA 5HCXA 2C5VA 2Q0BA 4JBVA 4OGRA 4FKIA 4YMJA 1ZMWA 4C02A 4DBNA 3O8UA 3P4KA 3TM0A 5HCZA 4PDOA 2ONLC 4BHZA 4WG5A 5EHLA 5AUTA 4PY1A 3FI3A 3LKMA 2BAKA 4M0ZA 4O91A 3U4WA 2YACA 3VHKA 1XJDA 3M2WA 4EH8A 3Q04A 4IB0A 3KRRA 4C37A 2BUJA 3R83A 1ZY4A 4D9TA 4EYMA 2XIKA 3BE9A 4QP3A 5J7BA 3EYHA 3ZFMA 4JIAA 4K6ZA 4XCUA 4A06A 4M84A 1IR3A 3DV3A 3LFAA 3LW0A 3Q9WA 5FBOA 4D4YA 3RJCA 4IX6A 4DE4A 4N6YA 4TWNA 4RX8A 5AJQA 3R7EA 4QD6A 3FZPA 2PZIA 4C0TA 4F9WA 4PP9A 4FL3A 3P08A 4WRGA 2OFVA 2OXYA 3LFSA 3UNZA 1IA8A 2R5TA 4CYJA 4AOIA 3KN5A 2CGUA 2XNNA 2RKUA 4QMNA 3D15A 3JPVA 1VEBA 4NK9A 5IEVA 5CU2A 5EH0A 5AP3A 2W4OA 4PTCA 4X3FC 4EJNA 4RIWB 2JGZA 3RK7A 4I94A 4O0WA 4YHFA 3HAVA 4FGRA 3F3TA 4XP2A 5CANA 4L3LA 4FI1A 2VN9A 5HX8A 3UC3A 3ZDUA 3BCEA 4U9AA 3PJCA 3E8CA 4MH7A 3MVJA 2O5KA 4FKGA 5FXSA 1XO2B 2OXXA 4ZSLA 3TJDA 4MXCA 5HZNA 2Y4IB 5TO8A 3MVLA 4CVAA 4MNEA 3DKFA 4IVDA 4RLKA 5H8GA 4I6QA 4N0SA 4OT5A 3OBJA 4CGAA 4L46A 4AW0A 4V0GA 4F7SA 1W84A 3GOKA 3U6HA 4FTQA 4DG3E 4HCTA 5AR3A 1FINA 2WZJA 4JBQA 4AN9A 5FDPA 2EVAA 5AIRA 3CC6A 4QP7A 4WSQA 3RHKA 2W5BA 4GU9A 3F2RA 4C34A 2VTQA 3VUDA 4CT1A 4NIFB 3F9NA 5I9XA 5HO7A 5E7RA 4O81A 1Y6AA 4ACDA 4HPTE 2G2FA 4OLIA 2XIRA 3RP9A 3OXIA 4RGJA 3OEZA 4MBIA 4MTAA 4EHGA 2HXQA 5CEPA 5JFSA 4FG7A 5EFQA 3WYXA 3RWQA 4GK4A 4BTJA 2HZIA 5LQFA 4V05A 5CF5A 2GTMA 4D2TA 5H8BA 4TYJA 5E8XA 2GPHA 4YNEA 1ZY5A 2F2UA 5EI2A 4RJ4A 3QZGA 2FB8A 2V7OA 5M09A 4R7HA 3CP9A 3ZLYA 4FKSA 3PXRA 3W2PA 2ITXA 2UZUE 4BFMA 4C4HA 1QPCA 2YM5A 4G9RA 2WMUA 5CSWA 5EM6A 4KKHA 3CTQA 3KRLA 4FSNA 1H07A 3PA3A 4EI4A 4R3PA 1U5QA 2XMYA 5B2KA 3R1YA 5AADA 3LMGA 3IK3A 3LIJA 2XP2A 2R0UA 5EG3A 2X6DA 3ZSIA 3LAUA 2W9FB 5F4NA 1ZOGA 4M66A 3FZ1A 2HW7A 2WMAA 1TKIA 4L45A 4USEA 2OFUA 4EKKA 3G15A 2EWAA 4J71A 2IVSA 3UQGA 3H4JA 3GFWA 3B2WA 3QUDA 2J6MA 3GC0A 2CPKE 1H4LA 1UNGA 2XK7A 3SOCA 3BLHA 1YHWA 2I0HA 5EYDA 5LVOA 4ACGA 3Q32A 3HV3A 4A4OA 4LRJA 4CFMA 5BYLA 4RC3A 2I7QA 4M15A 3LFQA 1CKJA 2R3IA 3CQUA 3ZYAA 5AV3A 4XOYA 4CFWA 5GZAA 2WO6A 2VWWA 3EKKA 3FQSA 3QQHA 3QXOA 4QMYA 5FGKA 3UC4A 1KUTA 5M08A 5BYYA 5AM7A 1PXKA 4G3GA 4I4FA 4DT9A 4LV5A 3PSBA 4FSUA 1YHVA 3NW7A 3OWLA 3PE1A 4YJVA 4OTDA 4EQCA 2BILB 1ZOEA 1H1WA 4YBJA 4CEGA 3KREA 5CALA 2A0CX 4EONA 4ACHA 3NAXA 4EZ3A 4I21A 3HV5A 5CQUA 1KV2A 2ZM4A 2W05A 2W1CA 3C13A 2A2AA 2VTTA 4BIBA 4BYJA 5JZJA 3LXPA 1BL6A 3IOPA 2R7IA 4TL0A 3FKNA 3UDBA 4FZ6A 2WNTA 3KGAA 4O0VA 3ZH8A 2J0JA 2G1TA 3TL8A 2WMXA 2DYLA 5A3XA 4QMTA 5AR7A 5KMJA 4X21A 4AN2A 4ZTNA 5KMNA 1QPDA 2XJ1A 4QMWA 5AP6A 2ZMDA 3KULA 3TDVA 3ZFXA 3ZO4A 2XNEA 3OY3A 4YPSA 4G6OA 1JNKA 3AQVA 4Y46A 3F5PA 4TYGA 3M1SA 3DAJA 3EFJA 4Q9SA 3FMNA 1NA7A 3LFBA 4XBRA 2XCKA 1SNXA 5I0BA 3KXMA 3NX8A 4QMZA 4ALWA 2C3IB 4ZOGA 2XNBA 1O6LA 4G6NA 3UZPA 2OF4A 3HAMA 3QU0A 3C1XA 3AT2A 4AN3A 3HECA 2XK8A 2RFSA 3SOAA 2C6IA 2X81A 3DNDA 3DXQA 3ZM4A 4EEVA 4FYNA 1WBWA 3BPRA 3FDNA 4FV8A 4JOAA 5HGIA 2QNJA 3CPCA 4OBOA 4WNKA 3I1AA 1OUYA 3DK7A 4NW6A 4X2FA 3CTJA 3Q4CA 2IZUA 4JG6A 5HVJA 4JDHA 5GJGA 1ZWSA 4HPUE 1H0WA 4FTMA 3ZEWA 2OGVA 4HCUA 3HA8A 3JYAA 4YZDA 4AX8A 1B38A 3ULZA 4AFEA 4PQNA 5CSVA 3SHEA 1H26A 3M42A 1E9HA 2BZHB 2ERKA 2BKZA 2Z02A 1Y8YA 2I1MA 3BLRA 1XQZA 1Q24A 1J91A 1SVEA 2BFYA 2F57A 4LRKA 3I6UA 4FKTA 3V5WA 3ZUUA 3ZRKA 1KE6A 5M53A 4G31A 1H08A 3EH9A 3A4OX 3EMGA 1PY5A 4FV6A 4S31A 4RIXB 1LEZA 2O64A 3I0QA 1WBSA 4JT3A 4BKZA 5K5XA 1IASA 3R7OA 5BNJA 1J1BA 1OL1A 3WI6A 2Q83A 3PP1A 2X8EA 3MTLA 2J0LA 4XG8A 2AYPA 5HG7A 3E63A 4I6BA 2PMLX 4YO6A 4ORKA 5KO1A 1P4OA 3PPZA 4QNAA 3A99A 3RPSA 3W16A 3W8LA 5JQ5A 4XG3A 5KZ0A 5AUWA 4F9AA 2QKWB 4WA9A 4NSTA 3BELA 2H34A 3R28A 2ITPA 4IWQA 3N4TA 3ZO3A 4CQGA 1P4FA 4JRVA 4WSYA 4O6LA 4X2JA 5I3OA 4BTFA 3JVRA 3RAKA 3UP7A 3AT3A 4IH8A 4PX6A 1JWHA 1OPJA 5FTGA 5KZIA 1XH8A 4BDBA 5HIDA 3QLFA 2VNWA 2QU5A 3K54A 4FZDB 5FLFA 1YWNA 4LFIA 4RVKA 2FGIA 4FA2A 5E91A 3R7VA 3SW4A 3ET7A 1H28A 3FBVA 3UMXA 2VTIA 4BHNA 4LI5A 2W4KA 3PFQA 4AW5A 4ZLYA 4O7WA 4AA0A 4L6QA 3EQBA 3RM7A 4O82A 2JDVA 2UW5A 2YHVA 1OB3A 4H1JA 1YKRA 4OR5A 5C27A 3GU7A 3Q6UA 1E1VA 3PXQA 4H3QA 4EBVA 5AUZA 4TYEA 3R9DA 1H1PA 2F2CB 3KF4A 3WE8A 4D9UA 5I9VA 3E93A 4F65A 3MV5A 4MXZA 5LVLA 3F3VA 4XOZA 3LJ0A 4J53A 2VWZA 3OP5A 4LUDA 2XH5A 5L2SA 4O27B 4HGTA 1YDSE 2XNGA 3FJQE 3QD4A 5AP2A 5JZNA 2Z7RA 1NVQA 4L9IA 3TCPA 2VO3A 4E6AA 3K2LA 2H96A 2P3GX 3SX9A 1MUOA 2F4JA 5JKGA 3DBEA 2J0IA 2QOLA 5CEQA 2PE2A 3F5GA 2HY0A 2CGXA 4G1WA 4YHJA 5EM5A 5FEQA 3W2QA 4BI1A 4BDKA 4O83A 2HWOA 3PRIA 5LARA 3R9NA 5AP5A 2GS6A 4FTNA 4FICA 4L52A 2BRGA 2P55A 3NVMB 4ZS0A 4XG4A 4GSBA 1H1SA 2UW9A 2WTIA 1M2QA 3ZSGA 3D5XA 3C5IA 3TNIA 3KU2A 1OBGA 1G5SA 5IH6A 2WTKB 3KRXA 4KIKA 4PTGA 2GQGA 5FTOA 3DK6A 3FSFA 4IM3A 4IX3A
chains in the Genus database with same CATH superfamily
3G33A 3DKCA 5AR2A 5FUTA 5IPJA 1SNUA 2BIYA 4GFOA 3JUHA 3SA0A 4C59A 3E3PA 4RJ5A 4USDA 4BCFA 1X8BA 4KAOA 5IQDA 4BDFA 4KINA 3MW1A 5DEWA 3DZQA 4ZMEA 2Z7SA 2C68A 3OXZA 3UIBA 3UTOA 4ZJJA 3QQFA 4O4DA 3FL5A 3O5AA 2HY81 3UQCA 4A9RA 4DG2E 3NFFB 1E1XA 5D1JA 4XUFA 5LCJA 5HCYA 3U4UA 4EH9A 2IVVA 4FIGA 3LM0A 4M3QA 1IRKA 4HVIA 4B4LA 4I22A 4K9YA 3DJ7A 4RX7A 4LMNA 3R71A 4TYHA 4MXOA 4CKRA 4IHPA 1SYKA 5IG1A 1PXLA 2EXEA 3BYSA 2CJMA 3EOCA 5DG5A 3NS9A 4KIOA 4O4FA 3KXXA 2JFMA 4JIKA 4C36A 4GG5A 2OZAA 4I92A 5CEMA 5HQ0A 1WCCA 3F7WA 4GVAA 4P7EA 4XLIA 1ZZLA 3JY0A 3BLQA 3MVMA 3L9NA 4GW8A 2OBJA 4K1BA 4M69B 4XS2A 5AV1A 3A7IA 5C8KA 2OI4X 3ZXZA 3ZOSA 3OUKA 2HZ4A 3KRWA 4YJNA 2C69A 2VTJA 4GK3A 3VF8A 3LXLA 3GCQA 4K2RA 3TZMA 4XYFA 4G5PA 1ZMVA 3VUMA 2QG7A 1JKTA 3NNUA 4N4SA 5DA3A 2ZDUA 4OTGA 4JS8A 5E8YA 5KHXA 5DIAA 2OZOA 4RFZA 1RE8A 5J5TA 1UU9A 4MF0A 3TIZA 3MPTA 4IACA 3RPRA 3QCSA 1DI8A 2PUNA 2PVRA 5KKRB 3A8WA 3QTRA 2WMVA 2J0MB 4FL2A 2AC3A 5D7AA 1V0OA 4C3RA 4GKIA 3VUKA 5M06A 3ELJA 4NU1A 5HLNA 1Q3WA 2UZDA 1TVOA 3I6WA 4IC7A 4W4XA 3O7LD 3D94A 3GU5A 3QCQA 4UX9A 3JR1A 3COHA 4P2KA 2AEGA 4D1SA 2VTNA 3C0GA 3QBNA 4DH7A 5C4LA 1RW8A 2UW0A 3BE2A 4U79A 4TT7A 1K9AA 2QOQA 4FTTA 4D58A 4A7CA 4QYHA 5EHOA 3R63A 3WF8A 2VD5A 3DJ5A 4RJ7A 2YABA 1J7UA 1JKLA 5JRQA 1HCKA 1H24A 5CXHA 3IOKA 1NXKA 4YURA 4DFXE 2OJJA 2NRUA 2BPMA 1URCA 3F82A 4MHAA 3BGZA 3UNJA 3ZSHA 3LVPA 2WAJA 4QOXA 1R1WA 3BV2A 4ZZOA 2YEXA 3TEIA 4AUAA 3MDYA 3D7TA 1WFCA 4A9YA 2WPAA 4L43A 3R8VA 3QQJA 4IMYA 4YZ9A 2EXCX 3UIMA 5C4KA 4EQMA 4RJ6A 5EI8A 3CLYA 2BVAA 4FT0A 4J98A 4EC8A 2WIHA 2VO7A 4J99A 2WTJA 3FLWA 3PSCA 1Q8UA 5TE0A 4MX9A 4QMQA 4Y5QA 2JBPA 2EB2A 4O22A 4MD9E 2OJ9A 5ETFA 3OY1A 4R8QA 4QMPA 3FI8A 3TDWA 3O8TA 1OZ1A 3E7VA 3KF7A 2HWPA 3H30A 4J7BA 3EN7A 3OWJA 3F3UA 3FMLA 2C6EA 2E9NA 5JGAA 2PMOX 2GNFA 3OC1A 3KXZA 2ITTA 4I0SA 5FP5A 4BN1A 3R6XA 3W8QA 3UZRA 3QQLA 3BBTB 1W7HA 5CNOA 3R30A 4RC2A 5DOSA 3R9OA 4X3FB 2R64A 1G8SA 2ZV9A 2ITNA 3MH2A 3RPVA 4W4WA 3RBWA 1U46A 4FTAA 3MB7A 4TNBA 2X39A 1IEPA 4I5PA 4XV3A 2HXLA 4MKCA 4ZJIA 5AUXA 2PUPA 4ZZNA 1Q3DA 4FG8A 3IW7A 4U6RA 4XBUA 3BU3A 4NM5A 5JFXA 3ERKA 3VUTA 1A9UA 4JMQA 5TKDA 4ZS4A 4O6EA 2NRYA 1PYXA 2YCQA 4Z9LA 4HNIA 1Y8GA 4UZHA 5KX8A 2GNGA 2PWLA 5AUYA 4NYEA 3QTUA 1JVPP 3BWJA 4RLLA 3ZC6A 1DS5A 4RBLA 4F70A 3HMPA 5CU3A 5L2TA 2FSTX 1CTPE 5KMLA 2UZVA 3OW3A 2YJRA 3UGCA 3QZIA 5L6OA 3Q53A 2RFDA 4I23A 2R3KA 3UYTA 2IW8A 5CENA 4S33A 1EH4A 2WMTA 4PUZA 4E20A 3NUPA 2BCJA 3CQEA 3TV4A 2CKPA 2QO9A 4ALVA 4E5BA 5HTIA 3MPAA 4FKJA 2YM8A 2UZLA 3IPHA 5C9CA 5HU3A 4QYFA 5JGBA 2IWIA 3LXKA 2IVUA 2KULA 1PXMA 3DT1A 4XHKB 3KCKA 2W5AA 3GNIB 4DGNA 3OHTA 3OD6X 5EDRA 3GC7A 4TTHB 3N4UA 2W06A 4JL9A 5IQEA 2ZOQA 2JIIA 4R77A 2C30A 1SVHA 1PF8A 3EQDA 5HI2A 5HNBA 4QRCA 5H3QA 5IQFA 2W1ZA 2PZ5A 4IX5A 3ZUVA 4ASZA 3WZUA 3S1HA 3E8EA 4ZY4A 4NH1A 1YVJA 4XX9A 3DKOA 3KQ7A 1H00A 5TT7A 4DGLC 4WG4A 2CNQA 5AX9A 2QODA 4FV2A 1YI3A 1MRVA 1GIIA 4M68A 4GH2A 3LLAA 3U9CA 1W82A 4R7BA 2O2UA 3L9LA 5DFPA 5M56A 2YERA 5AMNA 4UWCA 2PVFA 2VTRA 4Z7HA 3R8UA 5GIOE 4L53A 2XA4A 3ZC5A 1FMOE 1H01A 2JDTA 4WBOA 5HLWA 4WNPA 4DH3A 2XRWA 3GVUA 3PIYA 3NVKI 5LOHA 5J1VA 3FAAA 2A27A 2Z8CA 4WUAA 3HL7A 4EOJA 3CR0A 1UVRA 2VO0A 2XM9A 3BYVA 4E73A 4NCTA 3FHIA 3MPMA 5HG5A 3RK5A 3VBVA 4F6SA 3I81A 4TN6A 3G0EA 4GIIA 2CSNA 4FSWA 4O7LA 1U5RA 3DCVA 4FEWA 5BVOA 4YGAA 4RG0A 2WHBA 4AT4A 4HCVA 2XIYA 4IM2A 5I9UA 3R0TA 4FSQA 4QQTA 3FC1X 2YIQA 3ZUTA 2OWBA 4BKYA 4F7JA 2OJIA 1SMHA 4IDVA 4LM5A 4FEXA 1GY3A 3BIZA 4X2KA 2CKOA 4KSQA 3Q5ZA 2WELA 4X6RA 3PVBA 2RIOA 2OW3A 4AZVA 3NYNA 3WZDA 3MI9A 4NWMA 2PPQA 3FZRA 5FRIA 4G6LA 3RAHA 3HX4A 1ATPE 4XV1A 4KBKA 2PYWA 5AEPA 4LG4A 4JR7A 2B53A 4Q2AA 4RA4A 3RCDA 3R9RA 2JKOA 5AUUA 4KKEA 4HJOA 3VJOA 4FR4A 3OT8A 2UZBA 5AR5A 5EYKA 1FMKA 3ITZA 3RNYA 2HIWA 4I5HA 4QNYA 4UZDA 3UO6A 4XG7A 2UZTA 2V62A 4C57A 3HMOA 3LJ1A 2LAVA 5K4IA 4O0SA 4IE9A 4H3PA 3ACJA 3QD3A 4AACA 4D4SA 5EM7A 4FGBA 3FXXA 4WHZA 4BBMA 1PMNA 5DR2A 3FLNC 4F7NA 2YN8A 3DU8A 3ZZWA 3MFTA 2CCIA 3QHRA 5EOLA 4F6UA 1G8JA 4OTPA 4CKIA 1PXOA 1OUKA 4C3PA 3DXPA 1QMZA 1YOMA 4V04A 3VAPA 4L8MA 2IZTA 2WTVA 3NNVA 5HICA 3ORMA 2R3HA 2YIYA 1BLXA 4QPMA 5J95A 1STCE 3D83A 4ANQA 2R3GA 5HE2A 3LJ2A 5HVYA 3R8LA 4BF2A 2GQSA 2CGVA 3L9PA 5IQHA 4ZK5A 2OSCA 1UWHA 3V6RA 4LDTA 3I0OA 3R22A 3RZBA 2CLQA 2PVHA 4R7IA 3QCYA 5GZ9A 3UPXA 5J1WA 3DS6A 2HOGA 2OIQA 3S4QA 1WVYA 2C4GA 4KWPA 2W0JA 3ENMA 2J50A 5D41A 4AAAA 4CV8A 4CZTA 3C9WA 4L7FA 1O6KA 5HEZA 3FEGA 4ZAUA 3IKAA 3F2AA 4G17A 2QURA 1MRYA 3QKMA 4E6CA 4D55A 4EYJA 3FLZA 4YP8A 3RWPA 4BWKA 3A7GA 2P2IA 2VV9A 2V55A 4JQ7A 2JEDA 4PRJA 3V8WA 5BQ0A 1Q61A 2ESMA 5IISA 4RZWA 1U54A 5I4NA 2WEIA 2HAKA 2XEZA 4KRDA 3P79A 3THBA 3S0OA 3TG1A 1PXJA 4FOCA 4JX3A 4ERWA 3PJ3A 2E9UA 3FKOA 1UNHA 3BEAA 3EHAA 4G16A 4MWHA 1W2FA 4U44A 4YTCA 4FEVA 4BJJA 4FKWA 4ZTRA 2YCFA 3V8TA 5LVPA 2VWBA 4EOKA 2W7XA 1DAYA 2X2KA 3GENA 3OVVA 4IFCA 3F61A 3T8OA 4AGWA 3QTXA 2F7EE 4RIYA 1UA2A 2X9FA 3AT4A 2C6MA 2JAMA 4H3BA 5FM2A 5CU4A 2Y8OA 5BVEA 4D0XA 4FEUA 3RPOA 2FVDA 2YWPA 4YLLA 3SAYA 4CSVA 4KNBA 3OCGA 4CFVA 2QVSE 5ANKA 3LE6A 3TYKA 3RINA 3VS0A 2W5HA 3L8VA 4O0RA 4GUEA 4LL5A 2CN5A 5CLPA 2JLDA 3H9RA 4BCPA 4AT5A 3P0MA 3ORTA 4U3YA 4CMUA 4F6WA 1Z9XA 3ATSA 2BROA 5CY3A 1NY3A 4ZTLA 4JDIA 2QLUA 3MGYA 2QQ7A 4IWPA 3UMWA 5FXQA 3HZTA 1YOJA 3ZU7A 3FMJA 4E8AA 3IW8A 3EN5A 1G8KA 5EQEA 4AQKA 3WIGA 5A4CA 4H39A 4WG3A 2PUUA 5LMBA 3BL7A 4D5KA 1OKVA 2OIBA 2R3NA 1AD5A 4F63A 1Q8YA 4EBWA 5L3AA 1ZYLA 2UZWE 2VX3A 3OROA 1F5QA 4ASXA 4BCJA 4BTMA 4ZSAA 2H9VA 4AE9A 4YPDA 3POOA 4IZYA 5AV4A 1R0EA 4QP9A 1J3HA 4C38A 1VYZA 5JMSA 3HYHA 4BDHA 4EKLA 4ACCA 2GHGA 3AGLA 5DT0A 3UBDA 3UVPA 2BFXA 5DT4A 2WTDA 3P1AA 3WE4A 4FNXA 2X4ZA 3MSSA 2ITYA 5JK3A 2R3QA 3POZA 2ZFYA 5E1SA 4PF4A 5C01A 5HX6A 4AZWA 2BR1A 4EH4A 1FGIA 3DKGA 1W83A 4O0TA 4U42A 3WF6A 2J90A 4BCNA 1TFFA 3OW4A 3PXKA 4LV8A 3V5PA 4LGGA 4JQEA 4RFYA 2YWVA 3FZSA 2IVTA 5CASA 5EI6A 5C8NA 1FPUA 3W0NA 3HMNA 2WTCA 1DAWA 2VWIA 3B8RA 3KK8A 3IGOA 3OTVA 5HE0A 4CMOA 5CF8A 5KMOA 2VGPA 2OK1A 3LFDA 3TXOA 3R1SA 4BL1A 1ZYCA 4U40A 5AIKA 5IQBA 4F1MA 4H58A 4J8MA 2F7ZE 3NLBA 1OL5A 1OL2A 2HZNA 5IQIA 1KWPA 4FTLA 2GTNA 5LMAA 4L00A 4BBEA 3PTGA 4GK2A 4ACMA 4IM0A 5DE2A 4FYOA 5J87A 2PTKA 4RSSA 1OKYA 2ETMA 4O7YA 3UG1A 4EUUA 1GZOA 5I5ZA 1J7LA 4OTIA 5KMMA 5CSHA 3HMIA 1PKGA 3GQIA 1JLUE 2W1HA 4Y85A 2VAGA 5HESA 4WD5A 4LQMA 3ACKA 3C51A 4EK4A 5DNRA 5K0XA 4XV9A 2JC6A 4CV9A 4FVQA 2WQOA 2ERZE 4FNZA 2BZKB 2R3OA 4QT1A 1IAJA 3NMUF 3A4PA 3U54A 2J9MA 5L4QA 3AD4A 4P90A 5M4FA 4TZRA 4BGQA 2YDKA 3MFRA 3MN3A 3GU4A 4MXAA 3A62A 4CMTA 4DTBA 3MH3A 4BIEA 3WARA 4PDPA 4LOOA 3D7ZA 4RX5A 5CAUA 1GIJA 2PVJA 2Y9QA 4G3EA 5HD4A 4C7TA 5HO8A 4NJ3A 3MS9A 2VWVA 4HYSA 4PV0A 2XJ0A 5CNNA 3CGOA 4AA5A 2XAMA 5IA3A 3I60A 2EU9A 4EL9A 5HE1A 3KXGA 1JKKA 5HD7A 1JBPE 1LR4A 4CXAA 4GT3A 3F69A 4L3JA 4IX4A 3QQUA 3Q3BA 5DI1A 3CY2A 2QI8A 3NYXA 2W1EA 3FHRA 3MH1A 3O96A 4H1MA 4IVBA 3PXZA 5DRBA 3ORNA 4K18A 3GU8A 3MA6A 4GYGA 4IWDA 5LWNA 4I41A 2B7AA 2H8HA 3OTUA 4TYIA 2XVDA 5CEOA 4GL9A 3DBDA 1ZLTA 3KFAA 1YI6A 2C6KA 4QYGA 3RM6A 2IF8A 4J1RA 3LCDA 4YNOA 4Y5HA 4XP3A 4QMLA 4EWQA 2QG5A 1XH7A 4OUCA 4W4VA 2W1IA 3QXPA 1U4DA 3CKWA 3E92A 4JG8A 1Q62A 4QTDA 5AR8A 1OIUA 4BCIA 1WBPA 2ITWA 5AA9A 3V6SA 4MNEB 4Q5EA 3HGKA 4H36A 4DHZA 3SRVA 5KMIA 4BVUA 3DNEA 3GEQA 4V0GB 1W8CA 1VJYA 3TN8A 5C26A 4EOOA 5BVFA 1GZNA 4A9TA 2C0TA 4D4VA 3F66A 4EHZA 4NM7A 4RQVA 3TJCA 5CSXA 4AOTA 5HVKA 5HTBA 2R2PA 3AC4A 3QTQA 3HP2A 4IB3A 3VBXA 2KTYA 4BZNA 4DEGA 4YC3A 4MF1A 4YBKA 3FLQA 4FKUA 3V04A 4U8ZA 2ZJWA 4RFMA 3ODYX 5AR4A 3IQ7A 4IXPA 3V5QA 1YHSA 2V5QA 2Y6MA 3DAEA 2QU6A 3HRBA 1M7NA 3R00A 4X0MA 1Y57A 2UZEA 4QP6A 1GIHA 2GCDA 5GHVA 2GU8A 3ANQA 3LCOA 4A4XA 4HYUA 3FY0A 4AP7A 4JAIA 4UWBA 2GMXA 3IGGA 3O17A 5CEKA 5CAOA 1OGUA 4E93A 4QYEA 4AT3A 4BDJA 3AC2A 1Q8WA 4HGLA 2V0DA 5M44A 4MK0A 2VTPA 3AC3A 4QQJA 3LCSA 4B8LA 5TOZA 3CTHA 4DF3A 4ITHA 4J96A 2C5YA 3UDSA 2CCHA 5CVGA 4FKRA 4HZSA 1PW2A 3FI4A 4GEOA 3VC4A 1UU7A 4M7IA 3TI1A 3S95A 4ENYA 4UN0C 2PE0A 3VUIA 3ROYA 2J7TA 3BX5A 4RWIA 4RWLA 4QTCA 3BHYA 4FTUA 4IEBA 1J1CA 4FSMA 3HUBA 2X9EA 3QX4A 4RT7A 3E7OA 3HA6A 4O7NA 3GBZA 4HGSA 5EK7A 3ZBXA 2RFNA 3CS9A 4O0XA 2GFSA 4MBLA 4R5SA 3ML1A 2B52A 2I40A 3WILA 3HP5A 3KY2A 4TKSA 2BRNA 3PXYA 4D4RA 3QHWA 2QHNA 5FQDC 4DITA 4LMUA 4NCTC 3GGFA 4MBJA 5CF4A 3JS2A 4I6FA 3ZDIA 4DFNA 5J5SA 2XBAA 3WF9A 5EDQA 1T45A 4R3RA 3Q52A 2WQNA 3Q96A 5B2MA 5KCVA 1ZZ2A 5IDNA 3ALNA 4ASDA 4O1PA 2UVYA 4PPAA 3BU6A 3PDTA 3NWWA 3R73A 5ACBC 2GS7A 1BUHA 3QGYA 4D0WA 5BX0A 1YQJA 1WMKA 5FM3A 2VU3A 3SXSA 4GUBA 2QOFA 4BB4A 5ANGA 3EZRA 5L6WL 3FMKA 4CQEA 4DN5A 4TWPA 5K5NA 4PMSA 3GC9A 3NIZA 3ATTA 3GUBA 4KABA 3GU6A 5HOAA 4EK8A 3OG7A 3II5A 2WOTA 4X2NA 3KEXA 3W1FA 5E8TA 4AXCA 3I5NA 3IW5A 5HBHA 4D5HA 5L6PA 2CDZA 3TNWA 2PMIA 2HZ0A 4YR8A 2B9HA 4UB7A 5FEDA 2YFXA 2XZSA 3WF7A 3G90X 2R3RA 2VTOA 4FJVA 4ENXA 3FUPA 3HEGA 4V01A 3DLZA 4YZCA 1CM8A 5H2UA 3UVQA 4GS6A 2OG8A 3PVUA 4BZDA 2OLCA 4EZ5A 1K3AA 4ANMA 2IW6A 4IQ6A 4G2FA 4O1OA 2WEVA 2GNLA 3KULB 5E8ZA 2V22A 3CD8A 4O0UA 1ZAOA 5A9UA 2P2HA 3EQGA 3QZHA 5KBRA 5E8UA 3ZO1A 4DC2A 3SG9A 3MESA 4EK3A 2GNIA 5AX3A 3UQFA 4YTIA 3DPKA 4X6QC 3DQXA 3OF0A 1Q4LA 2W17A 2WMRA 3BYMA 1MQ4A 4FTRA 4JDJA 3RAWA 3UOKA 5CZIA 5LMKA 3CPBA 5IA4A 1W2DA 4O4BB 2PK9A 3H0YA 4EK6A 5AAEA 5I9ZA 1IA9A 2EB3A 5JQ8A 3OEFX 3TTIA 3NZ0A 1CKIA 4MXXA 4AW1A 2WQMA 3A7FA 2G2HA 2X2MA 4QQCA 1TQIA 4L7SA 3L8PA 3PJ8A 2C6DA 4WRSA 2CKQA 4IANA 2UW7A 4ZY5A 4II5A 2RF9A 3QALE 5A6OA 3ZCLA 3IO7A 4K8AA 3PG1A 4FKQA 5CVHA 5GJFA 4C33A 1OI9A 1LUFA 5EW8A 3W2OA 4ARKA 1LP4A 4IW0A 3WF5A 3WOWA 4CRLA 4W8DA 1KE5A 1OIRA 3G0FA 4ZTQA 2CHLA 2NYAA 3R02A 3HV6A 4I1ZA 5CXZA 1FQ1B 4R1YA 4DFBA 4LUEA 5IMEA 3LFNA 1V0BA 1XH4A 3AGMA 4IAIA 4NM0A 3O50A 3UIXA 1IG1A 1YWRA 2BIKB 5ICPA 3R21A 1KE7A 3TUCA 3DFAA 2C3KA 3BQRA 4KRCA 3QRJA 3QD0A 5KNJA 4BKJA 4FTJA 5JFWA 4TNDA 4OAVB 3AXWA 5BPYA 5CZHA 3FMDA 3NGAA 1AGWA 3FI2A 2C0OA 3COMA 4X7QA 4BC6A 5M07A 5CVFA 5EQPA 2YIRA 1YXTA 4QPAA 2RFEA 1MQBA 4EH5A 4WOVA 1W98A 5CI6A 3WYYA 3Q5IA 1PYEA 3BHUA 3HV7A 4WBBB 3CQWA 4YC6A 4BGGA 4FKLA 3R1NA 2REIA 4YHTA 4GFMA 5AP1A 3D4QA 3R9HA 2R4BA 5DRDA 3MB6A 4M0YA 3VBWA 3UJGA 3KA0A 4GT5A 1F3MC 3NW5A 2CNVA 1MP8A 4B99A 4CYIA 3C4CA 4S34A 3FY2A 4QMMA 4DEIA 4BICA 1GZ8A 4K0YA 1BL7A 3NNWA 3RPYA 5M57A 2Q0NA 2F7XE 5DR9A 4U45A 4BDCA 3CE3A 3E64A 3AMYA 2WMQA 4GJ2A 1Q41A 3UYSA 2F9GA 5T6KA 4PL3A 3SC1A 4C62A 4BYIA 1Q97A 4OTQA 5BVKA 3UDZA 4KUJA 4FTCA 2BRMA 3CBLA 4P5QA 2ETRA 1FOTA 3QX2A 2WB8A 1WBTA 4AA4A 3RHXA 5KHWA 5LXMA 3BKBA 3ZLWA 3G6HA 1OECA 3Q2JA 5IH4A 3DB6A 4EH7A 5DGZA 4RZVA 5HLPA 1UKHA 4ZLZA 4NKAA 4FSTA 4U3ZA 2X0GA 4YTHA 3BU5A 4QQ5A 2OJGA 4DFZE 3UOHA 3SG8A 3O7LB 4DBXA 3A8XA 2HK5A 4KSPA 5HORA 3O71A 2ZYBA 5FXRA 2XIZA 1GZKA 1I09A 3GC8A 3I7CA 4E4XA 4FKOA 4YTFA 4U80A 5A4EA 2I0YA 5EKNA 2R3MA 2WMWA 3LFCA 4L67A 1H25A 2PL0A 1QL6A 5E90A 4ANBA 3TZ9A 3MJ1A 1CKPA 2SRCA 2PULA 4GVJA 5I9WA 3DOGA 4YJPA 5JRSA 3LCKA 3K3IA 3KN6A 2X7FA 3ZS5A 2FUMA 3C0HA 4BI2A 4FE2A 3RGFA 4PL5A 3TZ8A 2XS0A 2PMNX 4ITIA 4KA3A 3U87A 4EH2A 4KIKB 3FSKA 4FZAB 4FTOA 2YAAA 1RJBA 3PXFA 2XKCA 3A61A 4HGEA 4XMOA 1SM2A 2OH4A 4ANSA 1OKZA 1OVEA 4FIEA 5LJJA 2YJSA 3VHEA 2QONA 2OO8X 2PVYA 5EQYA 2P0CA 4GT4A 3NUNA 4PPCA 4L68A 3SQQA 4DTKA 4JLCA 4YJSA 4A4LA 5AFVA 4ZSJA 2QD9A 2JFLA 3I7BA 3GI3A 4M14A 4XV2A 4UMUA 2BTSA 2I0EA 4OW8A 3OUNB 2I0VA 3VS7A 4USFA 4DCAA 3IG7A 3JY9A 5AP0A 1ZRZA 2PSQA 2AUHA 4LOPA 4O38A 2ZM3A 3KMMA 4RJ3A 4C35A 3EYGA 4RVTA 4UXLA 4AS0A 3K3JA 4FEQA 4HVGA 4EUTA 4PPBA 5I3RA 3C50A 2BDJA 2Z7QA 3TZ7A 4CFFA 3U9NA 4TYHB 5DVRA 2G2IA 4YZNA 3TV6A 5E8VA 4KIQA 2Z7LA 4BIDA 4X3JA 5CAQA 3SGCA 2JIUA 2OZAB 3ZEPA 4RIWA 3ZFYA 4DH1A 1R0PA 4PTEA 4D1ZA 1PXNA 2GNHA 2XUUA 4CCUA 1OL6A 4FIHA 4APCA 1M14A 4I6LA 3CCNA 3NUYA 2X7GA 4NZWB 4YSJA 2PZYA 4FKVA 4UY9A 1L8TA 4EZ7A 4LOQA 2R3LA 2DUVA 3AC5A 3C4WA 4FF8A 4W8EA 1RDQE 2HW6A 2VGOA 4M97A 3TNPC 2HENA 3PPJA 5TF9A 1H27A 2O3PA 3LPBA 1H0VA 3EN9A 5BVNA 4CG8A 5CT0A 1H8FA 1JSUA 4MAOA 1REKA 4L3PA 1GAGA 3CKXA 3FLYA 2BHHA 3QKLA 1Y6BA 3R04A 1WVXA 2W1DA 3KCFA 4Y83A 3ZM9A 2YISA 3FLSA 4MQ2A 5CEIA 5D9HA 4FNYA 4YZBA 4UMTA 5J9LA 4DTAA 5A6NA 5DR6A 4NIFA 1ZYDA 2ITQA 4F08A 5HTCA 4EOLA 2VTMA 3FV8A 4JNWA 1VR2A 3ZLSA 4IC8A 4AZEA 3OWPA 4BCQA 4I24A 1ST0A 3FYKX 1V0PA 1YXSA 5CX9A 1QCFA 2WMBA 2Y0AA 3A7HA 3KKVA 4GU6A 2XKFA 4O84A 4QP1A 2YCRA 3D0EA 3DY7A 1M52A 4CFXA 2J0KA 1Q5KA 2P4IA 1YOLA 3BHTA 3UOLA 3KIOC 2ITUA 3T9IA 3JVSA 4C4GA 2R3PA 2PZPA 4O2PA 2UVZA 4UV0A 4FKPA 5DPVA 5K3YA 3V8SA 1KE8A 3T3UA 1VZOA 1XR1A 4TWCA 4CZUA 4QP4A 1WAKA 1A06A 3U55A 2C3JA 1BYGA 4G3DA 3D7TB 3G9LX 2FA2A 3ALOA 3IDPA 1JOWB 2E2BA 3OS3A 4DGGA 3T9TA 3P86A 1WBOA 1M7QA 3QD2B 1XKKA 3F7ZA 4QMVA 2XCHA 4D28A 4GYIA 3W2SA 3W32A 4MNFA 3EQRA 4NTTA 5FP6A 1BI7A 4K33A 4DH5A 3MJ2A 1UV5A 3FZTA 2CN8A 2YDIA 2GHMA 2OH0E 2PVMA 1XH9A 4W9WA 3NUXA 5DEYA 3R8PA 4IAAA 5CAVA 4FIFA 3DBFA 1V1KA 2H6DA 4FV7A 5DH3A 4M12A 2ZB1A 3DBCA 2GSFA 2QOCA 3NCZA 3VBTA 4EWHA 2GDOA 2VZ6A 2UZNA 2DQ7X 4G34A 4L01A 3IDCA 5ANOA 3FPQA 2BDWA 5JGDA 1NVSA 5CYIA 3BWFA 1OIQA 4G5JA 2WFYA 3FXWA 4U5JA 5DYJA 2WQEA 3G2FA 3A7JA 4DEAA 2ITVA 4Z16A 3ZBFA 2BDFA 4D2RA 4ZTHA 3O8PA 4DLJA 4NFNA 4IB1A 4RWJA 3VUHA 4UXQA 1PMVA 4CLJA 2PVNA 4YJUA 3W0OA 2QOKA 3MBLA 3NSZA 3L9MA 4FX3A 3EFKA 4JX7A 4C58A 1PXIA 4D2SA 1Q8TA 5HIEA 1XBBA 3PY3A 4IZ5A 3VONA 4DYMA 3G9NA 4FK3A 3ULIA 5JH6A 3VN9A 4WNOA 4YLJA 1YXXA 2VX1A 4DAWA 4E4LA 3VS2A 3PVGA 5E8WA 4BI0A 2PUIA 5IF1A 1J7IA 3BI6A 3IW6A 2YDJA 4RWKA 4MVFA 3BGPA 4BDEA 5FBNC 3QAME 3GXLA 4CNHA 3QF9A 4OTRA 4ZY6A 1GOLA 1UU3A 3C5UA 1O6YA 4I5CA 2BRHA 3S2PA 2XRUA 2C6LA 3Q9YA 4LRMA 3ZLXA 2B0QA 1O9UA 5IQCA 3BHVA 4UMPA 3D5VA 3ZONA 3UZTA 4DDIA 3AMAA 3GCUA 5JN2A 3ORIA 3R7IA 3R7YA 4E7WA 3OFMA 3I4BA 3PY0A 2Y7JA 3F3ZA 2ZV8A 5H9BA 3PJ2A 3DXNA 5AUVA 3ORLA 4CKJA 5GJDA 4ZSGA 4R5YA 5EW3A 2DWBA 2J5FA 4X2GA 4PNIA 4A9UA 2OJFE 4FK6A 3U6IA 4DHIB 3GP0A 3W2CA 2VTAA 3Q4ZA 4FG9A 4G3FA 2PZRA 3GB2A