2Y6MA

Crystal structure of epha4 kinase domain
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
283
structure length
262
Chain Sequence
VREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Epha4 Protein Tyrosine Kinase Domain in the Apo- and Dasatinib-Bound State.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords EPHRIN TYPE-A RECEPTOR 4
total genus 83
structure length 262
sequence length 283
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2y6mA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2y6mA01
4LG4A 4PMMA 3RWQA 2GTNA 4KRCA 3NUPA 3KXMA 2OICA 3CPCA 4A9RA 1E1XA 4JOAA 4ZEGA 2YWVA 4LYNA 4HCUA 4YJUA 5HE2A 4YBJA 3K5UA 2QO7A 3ZSIA 4XRLA 4BHZA 4TT7A 3R9HA 2EB3A 4YNEA 4AW0A 3EH9A 3BGQA 2XEZA 4FIEA 3UQFA 1W0XC 4R5SA 2UW8A 5K4IA 1OBGA 4O84A 4YJPA 4HVDA 3HZTA 2WQMA 3FZPA 1H26A 3LFAA 4RJ3A 3QQKA 5EQPA 5ANGA 3Q4UA 2OJFE 4F9WA 3F2AA 4DEAA 2V22A 4F6WA 4MVFA 4MYGA 4DGMA 3QUDA 4B6LA 4TYHA 1STCE 4BGQA 3UE4A 3S2PA 4CGAA 4RVTA 5GHVA 3WIGA 2C5YA 4DTKA 1NY3A 2BRNA 3LXPA 2BRMA 4A9SA 3IDCA 2VTPA 4YJOA 1OKYA 3CKWA 3PZEA 2YDIA 4LOOA 5CAPA 1Q8TA 5L2WA 5AEPA 3CGFA 4L7SA 2GHLA 2J0MB 3FC1X 3AC4A 4UYAA 5FXRA 3KVXA 4L01A 1WBNA 4ZMEA 4IXPA 1ZY5A 3DTWA 5GNKA 4MAOA 2C0OA 2PMLX 4CZYB 4G2FA 4F1MA 5EHOA 2H34A 5E7RA 5CU6A 2C0TA 3DB6A 4UWBA 5J1WA 3KN6A 3OW3A 3PFQA 4CFNA 4DEEA 4IAFA 3PA3A 3VS4A 3VBYA 4RBLA 5ANDA 3VHEA 2UZTA 2Z7LA 2QU6A 2Q0BA 4G3EA 5EOLA 5EYKA 3U8WA 3RMFA 3HDMA 4BCFA 3RZFA 1GJOA 3KU2A 2QO2A 4YUQA 2PSQA 4UMTA 2A0CX 2WU6A 5HE3A 4FTCA 3SVVA 3HV7A 4LMUA 1TQPA 3SOCA 2R9SA 4ASEA 1G3NA 5M09A 2XKFA 4BTFA 2YHVA 3SXRA 2JAMA 1MRUA 2J9MA 3DKGA 1YQJA 3AT2A 5AP7A 4WG5A 5A14A 5EQYA 4FKOA 4JQ8A 2BDWA 4FEQA 4EJ7A 4L9IA 4EOIA 4QTDA 4L68A 4CFVA 2H96A 3HDNA 3OD6X 4JG7A 4FIJA 2V62A 2VTHA 3NAYA 4WA9A 2HW7A 2VWIA 4LL5A 4LI5A 3DDQA 3ZONA 3OF0A 4W4XA 3PY3A 4B0GA 4EH3A 4FZ6A 4FEUA 3B2TA 5EM6A 4EOLA 4PNKA 5FEDA 2JD5A 3PIXA 4I4EA 4EK3A 4IZAA 4LL0A 4YTIA 3SA0A 1AQ1A 4X0MA 3ZUVA 4D1XA 3OWKA 4GJ3A 5CXHA 5KZ0A 2BRBA 5DYJA 1MUOA 4ID7A 4U42A 1VZOA 4EWHA 4FV0A 4I0TA 2YJRA 5H9BA 1J7LA 2VWZA 3SC1A 2X6DA 4KKHA 4XG6A 4BVUA 4MXZA 4BB4A 4DH8A 3MDYA 3FV8A 1OUYA 3W16A 1LEZA 3MFUA 3QL8A 4J98A 4FTQA 2VO6A 2W1CA 3ZBFA 2C5VA 4NJ3A 2VO7A 4A4LA 3WF8A 4MHAA 3BQCA 3ERKA 5M4UA 3NGAA 3CD8A 4IWOA 3SX9A 3FJQE 4GEOA 3ACKA 4PDYA 4PX6A 2H8HA 3I6WA 2PMOX 3BLQA 2PUUA 1YOMA 4OTPA 3O23A 1VEBA 1YDRE 5LMAA 3NVKI 4QQCA 2YAAA 3QC4A 5IQBA 1T46A 4DH7A 2WO6A 3LMGA 3R0TA 2P4IA 2PZYA 2W06A 3ZU7A 4ZLYA 2PTKA 2C6TA 3FQHA 1XBCA 3VW6A 3C1XA 5IG1A 4X3FC 4X2GA 5E8UA 3FMLA 5M4IA 3EN7A 4AN9A 5CX9A 4IVCA 3BQRA 2JAVA 1WVXA 5HNGA 2YIXA 4W8EA 3DQXA 2X39A 5HVYA 2YEXA 3PPJA 3VS0A 5CEMA 2JFLA 4O2PA 1H07A 4UBAA 2GU8A 3WARA 5D7AA 5K9IA 1JKKA 2SRCA 4QMYA 1PKDA 2GFSA 4XG4A 3UG1A 3TKHA 4CT1A 3TUBA 4CSVA 2XF0A 1YWNA 2WU7A 3E88A 3PVUA 3EN9A 1QCFA 3HYHA 4ANBA 3R1YA 2O8YA 3BKBA 2WTKC 3DJ5A 4JR7A 2VX0A 3D2IA 4I24A 2GHGA 3LCKA 3O8PA 5HIDA 4J97A 4U6RA 3TN8A 3MIAA 4IHPA 5C8KA 4BBEA 3QTRA 2XK6A 3VNTA 4XV3A 2AYPA 3PXZA 2XK8A 3BIZA 4GU9A 1PMNA 2WTCA 2OZAB 5GJGA 3E8CA 3HA6A 4R6VA 3R7OA 2CNVA 3FI8A 4NWMA 3WF9A 2I0YA 2J2IB 3R7UA 3ZM4A 4GSBA 1OL2A 4ORKA 4FKQA 2BZHB 4N6YA 2NPQA 4MXXA 5IA3A 4S31A 1W82A 3WE8A 3QRTA 4PQNA 3OUKA 1KWPA 1LR4A 3HEGA 2IVTA 1UNGA 2WFYA 4GRBA 3OTUA 4I94A 2E9PA 3VS7A 2YA9A 4NIFA 3RK5A 3C0GA 3BBTB 3GCUA 4IH8A 3PA4A 1HOWA 3QD2B 4X2FA 4X3FB 4R5YA 1KOBA 2GMXA 5FGKA 4FE2A 4Z7HA 2QR8A 1UV5A 4GK3A 5BPYA 3PP1A 1WBTA 5LOHA 4RWLA 4BDFA 2JKMA 5BUIA 2RFSA 5TR6A 4CYIA 2PU8A 4XUFA 3TTJA 5IH6A 5JGAA 3E64A 1R0EA 3K3IA 4FK6A 3WF7A 4FSWA 3NZ0A 3CTJA 2X0GA 1IA9A 3R02A 3ZFYA 4WSQA 4E93A 5CF4A 3LMIA 3D5VA 2R3MA 4EH9A 3KXNA 4W9WA 4L67A 4E1ZA 3MPMA 3P08A 2BAQA 2PVFA 1ZZ2A 4NFMA 4NSTA 4ZSGA 2R3LA 3OWLA 4YC8A 1IG1A 3AQVA 2KULA 5IEYA 2VN9A 1PF8A 3NRMA 3HAVA 3CIKA 5EH0A 2HENA 4IAAA 4V05A 1JWHA 4EZ7A 4FKJA 3RPVA 3G9NA 2JGZA 2ONLC 3JVSA 3MTFA 3KRXA 2CGXA 4BI0A 1LEWA 3NUAA 4BZNA 1Q3WA 3LFDA 3DXPA 2H6DA 3VO3A 1SMHA 4ZIMA 2WAJA 3BYVA 3GOKA 1GIIA 3OEZA 5CASA 3FC2A 2IG7A 4KWPA 4HW7A 5CAUA 3D94A 3JS2A 5DR6A 4FKRA 3TZ8A 5LVLA 3VF9A 4KIKB 3N4TA 5DNRA 4QTAA 2CHLA 3D5WA 3R28A 4ERWA 4E4MA 4XS2A 5M51A 3VS3A 4XH6A 2WMXA 2FSOX 1XKKA 3MY5A 3O8UA 4FSYA 3RAWA 3ORZA 4RJ5A 5HESA 3QF9A 5H8GA 1WBOA 3DBDA 2Q0NA 4GK4A 4F9YA 2J0KA 3LIJA 3U55A 5J5SA 4JDKA 4M69B 4IB3A 2Y4IB 5HNBA 4DN5A 5A4EA 4GT4A 4O22A 4OLIA 4JAIA 1DS5A 2PUIA 4LGHA 3FPQA 3SHEA 2GNHA 4ALVA 4C62A 3C4WA 4ZTMA 4F6UA 1NVSA 2NP8A 2QVSE 5L8LA 3BV3A 3VAPA 4O91A 1BUHA 4FTTA 3H30A 3TXOA 4XYFA 2OXDA 1LUFA 3NYVA 3F7WA 3MA6A 4GFOA 3W55A 4EOOA 2BRGA 2WMWA 4S30A 4UMPA 2VU3A 3AC5A 3WBLA 1YXXA 3KXZA 4Q5HA 4BR3A 5FM3A 3BV2A 5T6KA 3D7ZA 5IUHA 3UNJA 2V0DA 4RIOA 2VTSA 3HX4A 3MH2A 2OW3A 1UKHA 5FD2A 1H08A 3RPYA 3S00A 3LM0A 3Q4TA 3UZPA 1IR3A 3CQWA 4PMSA 4QMPA 3CE3A 4S32A 3LQ3A 1PHKA 4BCKA 1M7NA 1LP4A 3CC6A 5FDPA 1BMKA 4QNAA 3E63A 3NNVA 4Y73A 1ERKA 2R4BA 4APPA 3DT1A 5JFXA 5JMSA 5KMMA 3ZM9A 3HGKA 2GNJA 3U6HA 3Q9WA 4KRDA 2CDZA 4EYJA 4OTFA 5JGDA 1K2PA 5EM8A 3PE1A 5FTQA 4O0VA 3R9NA 4PP9A 3KMWA 4CKJA 4ZP5A 1F0QA 3F3TA 1YI6A 3WF5A 4GT3A 3UMXA 3WIKA 4IADA 2ITYA 4GVAA 1OGUA 4QYGA 4L53A 4NH1A 4F9CA 5CZHA 3DKCA 3GQLA 1PY5A 4F99A 3S95A 4RWJA 4IB5A 4EYMA 5DGZA 4DF3A 2VTQA 4E26A 4CLIA 4IZ5A 5JFWA 4CFMA 3PXFA 3KCFA 3UPZA 4L42A 1OPJA 4J53A 4DLJA 5DFPA 3HRFA 3WYYA 2JKKA 2BAKA 4FTRA 5AAFA 2PVLA 2WTDA 4ERKA 3B2WA 4IJPA 3GU7A 4HVHA 4BRXA 2BIYA 4J7BA 3FQSA 4MH7A 3LFQA 4DITA 4X21A 3FAAA 3OMVA 5E1EA 4ZTSA 2WXVA 3TZ9A 3I79A 1J7IA 4H58A 4TWNA 4YLJA 1PXNA 4BDEA 4U44A 1YHSA 4FOCA 3EWHA 3ORTA 4Z55A 2OXYA 1W84A 2ZM1A 3R2YA 3VJNA 5IU2A 4CXAA 1TKIA 1OL1A 4K0YA 2R3NA 3UO4A 4RX9A 3OCGA 1NA7A 2ZV7A 5CVFA 3CKXA 1IEPA 4LRMA 4TN6A 5BVWA 4RX8A 3CCNA 4I5MA 3F82A 1WFCA 2O2UA 4FL3A 5L4QA 4A4XA 5E8XA 4FKGA 3LJ1A 2V7AA 3IK3A 1Z5MA 3ZRKA 2R0UA 2C6KA 3N51A 4AN3A 3JPVA 2WEVA 5KX8A 1V0OA 4RIYA 5DR2A 3IS5A 3GC9A 4M0ZA 4U41A 2IPXA 4HCTA 4DBNA 4O7VA 3DAJA 4PTCA 5HG9A 3DKFA 5CSVA 4IM3A 4ZS4A 2HOGA 2BZKB 2HY81 4BTJA 5AAGA 5BVFA 5J9ZA 3QTZA 1UVRA 2W1GA 2WKMA 4C34A 5ICPA 2YCFA 4EHVA 2VWXA 2Y6MA 1NVRA 5BMSA 5IA0A 3OY3A 4UZHA 2WMQA 3UP7A 2WIHA 1IAHA 3EHAA 2OXXA 4OTHA 4W9XA 3OTVA 4ZAUA 4L6QA 2G1TA 5KMKA 4J99A 3D9VA 2PY3A 5KKRC 3PLAE 4OT6A 3TNHA 5HIEA 4QT1A 1XQZA 3FZTA 1S9JA 3QTUA 4F7NA 2GNGA 4F65A 1R78A 4TY1A 2QOOA 2CLQA 3MTLA 4HCVA 4L52A 4EH8A 4F7JA 5I4NA 4F0IA 2ITTA 3W2PA 2QQ7A 4G9RA 3EFWA 5HU9A 3DA6A 4O86A 4RJ7A 5BVOA 1M2RA 2ZMDA 3KRWA 4AGUA 2ZOQA 4LM5A 4BBFA 2B52A 2LGCA 2Y0AA 4O83A 1F3MC 2X8IA 4ITIA 3K54A 4G3FA 3KXHA 4UX9A 4ACMA 2XB7A 3W10A 4K9YA 4YSMA 2BAJA 2IZTA 2F2UA 4PDPA 3HV4A 4AE9A 4ZJVA 3EN4A 3F3VA 5EM5A 5HE0A 4BHNA 5HX6A 3IECA 4GG7A 4GL9A 2GSFA 3BLRA 3I4BA 5IMEA 2PVNA 4FTMA 4KS8A 4FGRA 4G3GA 5EW8A 1H01A 5IH5A 3DNDA 3G51A 4JX3A 3VBTA 4AT5A 3HP5A 3GCSA 4AOTA 3AT4A 3BBWA 5I3RA 4Z7GA 3FHRA 4G3DA 3Q60A 4TTHB 5HTBA 5EYDA 4QMQA 2IW6A 2HIWA 1XWSA 4O7SA 4CQGA 4I5PA 2AC3A 2C1BA 2QOLA 4RGJA 3ZC5A 3THBA 3COMA 3UZTA 5ANEA 3P5KA 3WZJA 3DPKA 4GT5A 3SGCA 4QP4A 2GPHA 2PMNX 4LUDA 4DGNA 5CVGA 3QKKA 2E9VA 3IW7A 2R3OA 5L6PA 3Q6WA 2IVSA 1XH5A 4C58A 4AA5A 4K77A 3H4JA 4QD6A 4ALUA 2ITQA 3NUXA 3F7ZA 3VUTA 1DI9A 5EKOA 1RDQE 5C03A 5BYYA 2EXMA 3OHTA 3QZIA 4CFUA 4XNEA 3QU0A 4ZZOA 4IVDA 2FO0A 2R3QA 3ORIA 2XCHA 4S34A 4D5HA 2XK9A 4O0TA 4HYIA 3NR9A 5I9VA 1YXSA 2RFEA 2WB8A 5FBOA 3MFTA 2BTSA 1VR2A 5FRIA 3VUMA 4HZRA 4FT5A 2XIYA 3ZSHA 3CTHA 4YJVA 4FEVA 4ZLOA 2R3GA 2ITVA 3HLLA 2WTVA 4ITJA 2P2IA 4FICA 4XOZA 4N57A 3PY1A 4FTLA 5K0KA 1FINA 1QMZA 3GP0A 4U7ZA 4LMNA 3QTIA 2GQSA 3OBGA 1APME 4FV1A 3LFNA 4MNEA 2C4GA 2J0LA 2WQBA 3Q4CA 3QD4A 4XBRA 1PYXA 5DT0A 3R9RA 1OECA 2X7OA 5LQFA 4ZSEA 2RFNA 3GCPA 3KEXA 2VX1A 2W5BA 2YDKA 3LXLA 3TZ7A 2E9OA 1H28A 2OI4X 2VTIA 1OVEA 3RPSA 5AR8A 3EJ1A 2Y8OA 2W17A 3Q32A 4FV6A 4RX7A 2RG5A 4NJDA 5AP6A 5A4TA 3MESA 4GKHA 5AUVA 3KKVA 2IW8A 3ZDIA 3G9LX 1DAWA 3I7BA 4M68A 3DU8A 3EB0A 3B8RA 3H0YA 3Q9YA 2AC5A 2O3PA 4GUEA 4M7IA 4OR5A 4UALA 3ZO4A 5IA4A 3HV5A 4M0YA 3V8TA 5A4QA 1XBAA 3ET7A 4QYHA 3OC1A 1WVWA 1ZOGA 2WMTA 5CSXA 4XLIA 2G01A 2WELA 4R8QA 2KTYA 2ZB1A 2WMUA 2ONLA 4W4VA 5KKRB 4E3CA 3F69A 2XNEA 1M14A 5D1JA 5IA1A 3M1SA 4OAUC 1O6LA 3CTQA 4R3PA 3TCPA 4IEBA 5D12A 1OMWA 3E8EA 3IW4A 3UIUA 5FEQA 4ZY6A 1Q62A 2R3FA 5LXMA 1G8SA 1R39A 3A7JA 3I6UA 2XKCA 3CQUA 3P7CA 4GG5A 4IM2A 5M06A 5IQGA 1ZOEA 3QLGA 3R7YA 1FVVA 5AR7A 4Z9LA 1CKJA 2XM9A 4JQ7A 5JKGA 2QU5A 2R7BA 3ALOA 3SKCA 1BI7A 4LGGA 3LE6A 2YCRA 3C0HA 3EFJA 3ELJA 3QFVA 1JSTA 1I44A 2RFDA 4QP6A 5AA8A 5C4LA 3MN3A 3ORKA 2CMWA 2REIA 3KXXA 4QMMA 1SVEA 3KN5A 4FK3A 4YLKA 3UYSA 2R7IA 1FPUA 3D83A 3C4XA 3GENA 5CQUA 5AP2A 4MEDA 4YNOA 3MW1A 4N0SA 4XV2A 5J79A 4FF8A 4IZ7A 1QPJA 4UN0C 2QNJA 2GNLA 4FV7A 4EC9A 2WOUA 2EXEA 2WPAA 3II5A 4O38A 3LJ0A 2C6DA 1ZMUA 2B9HA 4QMXA 3UOKA 3F5UA 4R78A 5CALA 3CD3A 4GU6A 3T3UA 1Q41A 1XO2B 2R64A 2VGOA 3MI9A 1U5RA 2Z7QA 3CBLA 3H9FA 3W18A 5DT4A 4GH2A 3DOGA 2QC6A 4U0IA 4EQCA 3FKOA 4GIIA 3HMOA 2VNWA 1W7HA 4NU1A 3AT3A 4PV0A 4UY9A 5BMMA 1YWVA 2C6IA 2B0QA 4NM7A 3MB6A 1ZRZA 2BMCA 3FE3A 3HMIA 3ZEPA 5IA5A 3PWYA 1AD5A 2WTWA 3RAKA 5AFVA 3REPA 2ETMA 4XG8A 4FG9A 3VBXA 3KK9A 2QONA 1JNKA 2OSCA 4AN2A 2B9JA 1U54A 3FLZA 4IBMA 2X4FA 3Q5IA 1J91A 2BZJA 2UW0A 4I93A 5C8NA 5KBQA 2XJ0A 3PXYA 2J51A 2W1IA 4FTIA 5E8SA 3UQGA 3UVPA 1HCKA 1JSUA 3N4VA 4FKVA 5J87A 2W05A 5AUUA 4DGLC 3I0OA 3R8ZA 1JSVA 4DFYA 5HD4A 1Y57A 4O96A 5F4NA 2ZDTA 5AUWA 4RPVA 3NUYA 2IN6A 2QO9A 1FGKA 1KOAA 2OF4A 1PXIA 3WILA 5CAVA 3S3IA 3NS9A 2PVRA 4I6FA 4IAYA 4MCVA 4BTKA 1J1BA 4KBCA 1KV1A 3QC9A 5HO6A 5BVNA 2VUWA 5D7VA 3NW5A 1WCCA 2YLFA 3HMNA 2PL0A 3FLWA 2W9FB 1R0PA 1OIUA 3PLSA 4C35A 4O0YA 1H1QA 2YM6A 5KMOA 4YPDA 4FNXA 4G31A 5TO8A 3PSCA 3ZO2A 2OFUA 3VC4A 4AZFA 4BZOA 5EI2A 2G2IA 3O8TA 4FX3A 4H3QA 2EB2A 1W98A 4BIEA 5JT2A 4X2NA 5DIAA 1K9AA 4YJQA 1PXKA 1YRPA 3LCOA 3UP2A 5I9XA 1Y8YA 4EEVA 3L8PA 4M8TA 1QPCA 5CF5A 5CS6A 2UV2A 3W2SA 4AXAA 4AZSA 3TI1A 5E8VA 5EYCA 3NLBA 2A2AA 3C4CA 4IMYA 1M7QA 2DS1A 3GC7A 3U4UA 3R00A 4U5JA 1VJYA 2BZIB 4KS7A 5TT7A 5FXSA 3E3PA 4AZVA 3GC0A 4R1YA 1AGWA 3RCDA 4FYOA 3S0OA 3DBFA 3ZXTA 2E9UA 4IJ9A 4WBOA 5CU0A 3MH3A 4BKYA 3S4QA 2GQGA 5JQ5A 2IZRA 4FKUA 2O65A 3GGFA 2XJ1A 4MTAA 2X4ZA 5HD7A 4E4LA 5HE1A 2CCHA 3R21A 5EHLA 1PRYA 3R9DA 5A4LA 3RINA 4ZMFA 2XRUA 4HOKA 2RG6A 2QHNA 4OT5A 5FDXA 4O21A 2R2PA 2R3RA 2WD1A 1YXUA 3ORPA 3PG3A 3I0QA 2BDFA 4RRVA 3L8SA 1CM8A 2CCIA 2ERZE 2PZRA 4LRKA 5DE2A 3P23A 4G1WA 5CU2A 3OW4A 2VWWA 2HYYA 3AD4A 3WZDA 5IDPA 2XUUA 2FUMA 3MVLA 5CVHA 5KUPA 3C9WA 4O0WA 5D9HA 3A99A 5ANIA 4C4EA 4WRGA 4PDSA 2YISA 3GT8A 3MIYA 5GJFA 4BDIA 3Q4ZA 4DC2A 3U6IA 4Q9ZA 5FP6A 3DK6A 4DEDA 3QQLA 4EONA 5HTCA 3EQHA 4O82A 3CPBA 3IG7A 4DEHA 4LGDA 4C3FA 3UYTA 3SOAA 3PJ8A 1CKIA 3GU6A 3IGGA 3M42A 3BGPA 4QTBA 3RI1A 4FMQA 1Q61A 2XNNA 5E8WA 2YITA 4HNIA 4IE9A 5BUEA 3LFFA 4AT3A 4JR3A 3G6GA 3ULIA 4X2JA 3BEGA 4I6BA 4E4NA 4CFWA 3DGKA 4L3PA 2ACXA 2PMIA 4V04A 4LUEA 4FNZA 2Y7JA 5A3XA 3V6RA 4TRLA 4TYHB 3OCBA 5L6OA 4G5JA 4DGOA 2R3JA 5EG3A 2Y6OA 3A62A 3HNGA 2QHMA 1PMEA 3DZOA 4O7NA 1A06A 4GVJA 5HBJA 3M2WA 4D2VA 3A8WA 1QPEA 3LCTA 3QD0A 4QYFA 3N4UA 4QP3A 1YI3A 4N6ZA 3RHXA 3C5IA 2X2LA 3NX8A 4KB8A 4A7CA 2Z60A 3P7BA 3UDBA 3TDWA 3ANRA 3G0FA 2YIRA 3F3UA 3GC8A 3G90X 4RFYA 4QMOA 5CANA 5I0BA 3QZFA 4QP7A 4D4YA 4D4VA 2QI8A 4NCTC 2A4LA 2HZ4A 4E8AA 4M67A 3FBVA 4DFUA 2UW5A 3OXZA 3QRUA 4IW0A 4F09A 5CXZA 4YZDA 1BKXA 3BELA 5ETAA 4EOSA 3R8LA 4EOJA 3UQCA 4NEUA 1CTPE 3KCKA 4XP0A 2OO8X 4WNOA 4Y5HA 2UVXA 1Z9XA 2JDSA 3RGFA 2XP2A 3FDNA 3W2RA 2IWIA 5JSMA 4KUJA 4AZEA 2B53A 4FKWA 4GMYA 3W2QA 2P0CA 4C4GA 5AM6A 4ZTQA 4QMTA 3V5PA 3W32A 5AV1A 2HCKA 4DFXE 4F9AA 5M53A 3FYKX 1B6CB 4FIHA 1TQIA 1YDTE 4K18A 4UEUA 4WUAA 3CR0A 3ALNA 4I0RA 4BCPA 3VN9A 2YIQA 3HMMA 4R77A 2CKQA 2YACA 3UC4A 1Y6AA 5LVMA 4UWCA 4G17A 1MQ4A 2J50A 3UBDA 4CKRA 2Y4PA 4TKSA 3ORXA 3ZS5A 2ITWA 3O17A 2OF2A 4ANSA 2VWVA 3BRBA 4QQTA 4FC0A 3TG1A 5I9ZA 4IWQA 5IF1A 4YJTA 3EZRA 4MXAA 4ZOGA 1OPKA 3OT3A 2XH5A 4G5PA 3UO6A 1CSNA 2CNQA 3ZXZA 3W1FA 3FMJA 4RJ4A 5LJJA 4C36A 4PL4A 3VS1A 4RLKA 3BU3A 3EKKA 3VHKA 2PK9A 4P90A 4MQ2A 4CZUA 2XA4A 3FLNC 1Q99A 1ZYDA 2O64A 3FKNA 3IONA 3EFLA 4HGEA 5IQFA 2QD9A 5HLNA 3QD3A 3GOPA 2E2BA 3P86A 3QQHA 3WOWA 5CF8A 2CLXA 2CKEA 4LRJA 4AW2A 1SNXA 3COHA 4GYIA 3TJDA 3MSSA 4G6NA 4FR4A 4TYGA 4F70A 2HZNA 3AGMA 5ETFA 3QUEA 4CMTA 1YW2A 3TNPC 1FMOE 2QLQA 3LQ8A 3TEIA 5ITAA 4OBOA 3FYJX 5C26A 4RWIA 2UW4A 2VTTA 2VTLA 1KE6A 5M44A 1JKTA 2X8EA 4EK6A 5LWMA 5B0XA 3ROYA 4I1ZA 3O96A 3OY1A 3SAYA 3Q2JA 3QYZA 5AR3A 4BN1A 3VJOA 2EUFB 3OOGA 5AMNA 4BICA 3BYMA 4I21A 4XV1A 3NUSA 1OUKA 2GTMA 3QX2A 5JRSA 4CRSA 4D2WA 3W2OA 2PWLA 5EK7A 3FL5A 4X2KA 3R30A 4UXLA 3SQQA 5M4CA 1BL7A 2YCSA 5HVKA 1SM2A 4H3PA 1YOLA 1JOWB 5GZ8A 3TJCA 4D2RA 2F49A 2WMVA 4ZJJA 4D0XA 3GUBA 2G2HA 3PZHA 4AS0A 2OWBA 5BYZA 3SRVA 3MFRA 4NKSA 4W8DA 5CQWA 3HV6A 1KE8A 5HG8A 1U5QA 3KRJA 4DFNA 5AV0A 4U81A 4USFA 5K5XA 3NNXA 3OXTA 4XV9A 5L8KA 2ZV9A 2CSNA 3NWWA 4FKTA 4NT4A 3BCEA 5LVNA 4IQ6A 1PYEA 4EBWA 4EUTA 3BGZA 5CT0A 4C4HA 2ZB0A 1P4OA 5A6NA 4XCUA 3V04A 4E6QA 3OCSA 5DOSA 5HCZA 4BCGA 1JKSA 4BDKA 3G0EA 4BDHA 3C4EA 4DH5A 3NW6A 3EZVA 3QTWA 4BFMA 1H1SA 3OG7A 4E7WA 2XIZA 3UVRA 2R3KA 3GBZA 3C7QA 3QA0A 4WHZA 2W4OA 1ZYSA 3NEWA 3R1SA 3FPMA 4TPTA 4EK8A 1FGIA 2UZOA 5D11A 4AT4A 2FSTX 1KV2A 4O1OA 3FI2A 4C02A 4MD9E 1GZ8A 2JKQA 4OUCA 3R8UA 3TIZA 3AMBA 4IFCA 4YJSA 4ACCA 3KQ7A 5F94A 3PVBA 2C3LA 2F2CB 3GQIA 3Q96A 2WZJA 3KC3A 4I3ZA 3PXKA 1V0PA 3BWJA 2HWOA 5E1SA 3SLSA 5JEBA 4YPSA 1KUTA 3G5DA 2XKDA 1UA2A 5CU3A 4BWKA 3FSFA 4WUNA 1R3CA 3MYGA 4EH5A 2IVVA 3TNIA 5AM7A 2UW3A 3QUPA 2YM8A 2O5KA 4KINA 3QCYA 2PUNA 4AGWA 1ZZLA 4ZY4A 1CDKA 3FI4A 2JITA 4A9TA 2PVMA 1OIRA 4KKGA 3TT0A 4NM5A 2F4JA 3Q04A 2GNFA 3FLSA 4QTCA 4QQ5A 5HLWA 4GW8A 4DG2E 3TNQB 4F0GA 5IUIA 3U51A 1O6YA 4TXCA 4HVSA 2R3IA 3WE4A 4EOPA 3E92A 3FMHA 4IC8A 2WQOA 5CENA 5BYLA 3QWKA 4IDVA 3FMMA 5L8JA 2QOFA 4H1MA 5JZNA 4G16A 3DBEA 4BCOA 2YM5A 2G15A 4BI1A 2BROA 4C2VA 3FZRA 4DEIA 4NKAA 4BTMA 5E9EA 4CD0A 4FSNA 5M55A 3LM5A 2X9EA 4OTGA 5DBXA 3FKLA 3MPTA 3TV4A 5K4JA 1ZARA 3COIA 4GFMA 4YJNA 4QYEA 2QCSA 3UNKA 4IWDA 3GCVA 2W4JA 4IX5A 3V5QA 1Y8GA 3DKOA 4M15A 1B39A 3QGWA 4UV0A 1GNGA 4IIRA 5BVDA 2BKKA 2I0EA 3BHYA 4J8MA 3OUNB 4JDIA 4KIPA 3KA0A 3VRZA 4FT7A 5LCJA 4O81A 3A4OX 5FWKK 3T9TA 4FT3A 4M14A 5LMKC 1ZY4A 2PE2A 4AOJA 4QP8A 4G9CA 4EBVA 4CG9A 3E5AA 4C3RA 1OI9A 3KY2A 2RSVA 1O6KA 3ID6C 2XS0A 4EL9A 3VS6A 1OITA 2OH4A 4FV9A 2HZIA 3L9MA 1Q24A 2P3GX 4J96A 5AUZA 2JKOA 3EQBA 3EQDA 2WHBA 2XVDA 4C37A 3B8QA 3OP5A 2W1HA 3BE9A 2P2HA 3BHUA 3UNZA 4C59A 2OJJA 4OBPA 3IOKA 1A9UA 1SZMA 2J5EA 2C69A 2UW6A 3AC8A 4RC3A 2OIQA 3TKUA 4BWPA 4PRJA 5J9YA 4PPCA 5FTOA 2QODA 1TQMA 5AIRA 1Y91A 2O0UA 2UVZA 4RFZA 2IVUA 2WMAA 3ZCLA 4ALWA 4R7BA 4MNEB 3SRVB 4RJ8A 3NCGA 4FI1A 4Y5QA 3M11A 3VF8A 1OB3A 3H0ZA 3NNWA 4O27B 1FMKA 4C33A 3COKA 4JG8A 3CY2A 4ZTLA 4DAWA 4D5KA 4BDGA 1PXJA 3PPKA 4J95A 4BDDA 5DR9A 4A4OA 1OIQA 3L9PA 4O7TA 4KNBA 3IDPA 4HGTA 3WYXA 4FGBA 3BYSA 1ZYCA 2GFCA 4P5ZA 5HU3A 3VS2A 4NUSA 1XH7A 2B54A 3DFAA 4FV8A 4Q5EA 1U59A 2OG8A 4E5AX 2NNWB 4U3ZA 2WTIA 3OFMA 2ZDUA 4KSPA 3AGLA 3CY3A 4QMVA 3VBVA 2F7ZE 3ZYAA 4ANOA 5AX9A 1Q8ZA 3AOXA 3G6HA 3R22A 4EJNA 4ENYA 2FGIA 4U97A 3K5VA 3ETAA 3I1AA 3DLZA 3U9NA 2RF9A 2VWBA 3HV3A 1W8CA 4DG3E 4K11A 4N4SA 2GHMA 2XNPA 3VWAA 4IVAA 3CS9A 3QRJA 2EWAA 3PJ2A 1ZXEA 5M57A 3DXNA 2HELA 1Q3DA 5CF6A 4E5WA 1M2PA 4IWPA 3DDPA 4D58A 4RLLA 3U87A 2PE1A 5DEYA 4EHZA 5B2KA 3LZBA 3RM6A 5H3QA 3BHTA 1NW1A 3EQCA 2EU9A 2GQRA 4R3RA 3FL4A 4V01A 1YXTA 5TF9A 5KNJA 1P14A 3HMPA 4MF1A 5CU4A 4ZTNA 4KABA 5TOZA 2ZV8A 4FSMA 4IM0A 5CTPA 5AP5A 3NW7A 3ROCA 2BFXA 5E92A 4AOIA 3CLYA 4JRVA 3W2CA 2WGJA 4I0SA 3O7LD 3W8LA 3VRYA 5L6WL 3IW8A 4L46A 4JBPA 4ACDA 3QCSA 1FOTA 3HRCA 3ORMA 4EH4A 5M56A 3KULB 3MPAA 3POOA 2H9VA 2LAVA 2UZWE 3R04A 3VS5A 5IMXA 4K2RA 3QTQA 3JY0A 4CV9A 1OIYA 4EWQA 2Y9QA 4EUUA 3EQGA 2J0JA 3P78A 4ANNA 3QQFA 4BDAA 4F9BA 3H3CA 3L8VA 4H39A 5DN3A 4YU2A 4RVMA 4II5A 1GAGA 4TL0A 2YABA 3ENHA 2BHEA 3ZUTA 2AUHA 3KK8A 2JIIA 4PDOA 5H2UA 4CEGA 3TKIA 5IH4A 3GXLA 5DI1A 4ACGA 2BUJA 4HGLA 3KULA 4XEYA 3V5JA 3QZGA 3FY2A 2VTOA 2BFYA 2WQNA 4JNWA 3ZDUA 4KA3A 4GS6A 5EI8A 2G2FA 4APCA 3UVQA 2QOIA 1FQ1B 4CTBA 5GZ9A 1GZOA 4J8NA 2UZVA 3C4ZA 4V0GA 3VBQA 3AXWA 3RPRA 2DWBA 3VQHA 4BL1A 1QL6A 4YHTA 2QOBA 3Q3BA 4D4RA 5CEQA 5HORA 4AWIA 5LWNA 4JIAA 4S33A 3HUCA 3RK9A 2XEYA 4E4XA 4DFBA 4JAJA 3DCVA 5AP4A 1L8TA 3MJ1A 5DMZA 2R3PA 5FG8A 5C8MA 4M97A 4DTBA 2QR7A 3EL7A 2VD5A 5JH6A 5IQCA 1NVQA 1ZOHA 2X1NA 3Q9ZA 3QAME 4W4YA 4ANMA 4DBXA 4C4FA 4E6AA 4RSSA 2W5AA 2C5XA 2BPMA 2YIYA 5F1ZA 1CKPA 2OIBA 3HRBA 2F9GA 2RIOA 1ZAOA 3OCTA 3PJCA 3NCZA 2W4KA 2FB8A 2UZUE 2W7XA 4OTWA 4OAVB 3QKMA 4GIHA 2B4SB 4RVLA 4MNFA 1HCLA 3E8NA 3BE2A 3NIEA 2UZBA 3A7HA 4XOYA 3RNIA 5J7BA 5K0XA 1URCA 3VULA 2J0IA 4B8LA 3QBNA 1JAMA 3L9NA 3ZUUA 4C38A 4YTFA 2ZM3A 3I5NA 5EI6A 1JPAA 1OKVA 2EXCX 3L8XA 2XBAA 4EC8A 1PXPA 4XHKB 4L45A 1Z57A 3ZZEA 1YHVA 3IKAA 1UWHA 3ODYX 4I6HA 4O1PA 1OL5A 4TYJA 4CVAA 1G8AA 3DNEA 1H1WA 1H1PA 1VYWA 2BALA 2Z7SA 2YM7A 1E9HA 3MH0A 3ODZX 4YO6A 4AGCA 2ZM4A 3CP9A 2YFXA 5DEWA 4UMQA 4NIFB 3F9NA 3GVUA 2VGPA 3MVHA 1E1VA 4BDCA 2ETRA 3F66A 2CKPA 2X7FA 3ATTA 3CXWA 3KGAA 4YMJA 3BU6A 3FQEA 3KL8A 4EQMA 2XZSA 4ZXTA 3BI6A 4QOXA 1GIHA 3V8SA 2A27A 5M4FA 4WNKA 4M13A 4FSTA 5AV4A 4RG0A 3D5UA 3GFEA 5FEEA 3T9IA 2X2KA 4AAAA 2OJ9A 4BYIA 4PP7A 3UO5A 2OKRA 4F7LA 1KE7A 5K3YA 3BYUA 3TDVA 4HYHA 4RIWA 4IX6A 4BDJA 5AJQA 5C01A 3C51A 3T3VA 4L3JA 2QOQA 5EDRA 3D7TB 5GIOE 2P55A 4YZMA 4UMUA 5M07A 1GIJA 5CLPA 3L1SA 3F3WA 4KSQA 4GV1A 2YCQA 4WRSA 3ZFMA 5DPVA 4QPAA 4TYEA 4HVGA 4O6LA 5IDNA 5J9LA 4FEWA 2QLUA 4OTRA 5DT3A 4CZTA 2PZPA 2C5OA 3JVRA 2ITZA 3EQPA 3IDBA 3K3JA 1WVYA 3NYOA 5CSWA 5KE0A 3V5WA 2BHHA 3FUPA 1K3AA 4ASXA 2BR1A 3FMKA 4FV3A 4WD5A 5I9YA 4YP8A 2PYWA 3PXQA 4JS8A 3FY0A 5HTIA 4IACA 5FM2A 3MGYA 2I0VA 2VO3A 2JIUA 4QP1A 1OM1A 3E62A 1JKLA 4ITHA 4FTAA 3NAXA 2C3KA 4NTSA 4P4CA 2HY0A 4IDTA 4FSRA 5J95A 3JR1A 3PY0A 1J3HA 3AD5A 4AZWA 4E73A 5LMKA 3NIZA 3ZO1A 5E90A 4FIIA 2VWUA 3DJ7A 1H0WA 3ZH8A 3KB7A 3QCXA 1PW2A 3O0GA 3QTSA 4HPUE 4UZDA 4AP7A 4ZY5A 1QPDA 4K33A 4QQJA 4YTCA 2XIKA 5HEZA 3QTXA 3PDTA 3LXNA 3KFAA 4F64A 5JFVA 4YTHA 3UZRA 5HIBA 4NTTA 4B4LA 5KHXA 1BI8A 2C6LA 1P5EA 4WNMA 3ATSA 3IW6A 2HZ0A 3POZA 4XG3A 5L2SA 3D2KA 3SD0A 1V1KA 2CPKE 2WTJA 4I6QA 3BPRA 3JYAA 3QXPA 4RIXB 5EYMA 5H8EA 5EDQA 2FSLX 3LHJA 4IX3A 5I9WA 4QPSA 4JBQA 4FVRA 4RZVA 1W83A 3R63A 5E8ZA 3NNUA 4FL2A 2XJ2A 4F4PA 2B7AA 4EZ3A 5HNIX 4EI4A 3R8MA 4FUYA 4JRNA 3ZO3A 2B55A 4FIFA 1H4LA 5ANOA 5G1XA 2C6EA 4A07A 4EH2A 5AADA 2PZIA 4Y46A 2ITUA 3A2CA 1M2QA 4UWYA 2WEIA 3NUNA 2BRHA 1PMVA 3QQUA 4WBBB 1XR1A 4YHFA 4YHJA 1RW8A 2OGVA 4NZWB 4I41A 4XG7A 3BHHA 4GYGA 2FH9A 3U6JA 4AX8A 5A6OA 1IASA 4Z3VA 4FZDB 4QP2A 2JDVA 3RK7A 5CEKA 4GKIA 1XH8A 4FTUA 2PPQA 4QTEA 5F20A 3MY1A 4AA0A 3ANQA 4BGGA 3H10A 5FLFA 5AWMA 2YJSA 3O71A 2RGPA 4MQ1A 4FNWA 2G9XA 3PG1A 4G6OA 3RBWA 3MA3A 2C1AA 4X3JA 3BZ3A 4OGRA 4LOPA 4O7YA 4DHFA 5HQ0A 4PTEA 3C50A 3E93A 3QGYA 4QO9A 5CEIA 5HGIA 4J1RA 3LCDA 4B8MA 4TYIA 3VUGA 5CZIA 3IGOA 4L43A 2QG7A 3FLQA 5AV3A 3UGCA 4C2WA 4MXOA 3GB2A 4IZYA 2I6LA 4WNPA 3WZKA 3CEKA 2GS6A 2FVDA 1WAKA 2C6MA 4NFNA 4BZDA 1PMUA 4ZZNA 3PSDA 4KBAA 4Y8DA 1REKA 4P5QA 3PVWA 4B7TA 5FTGA 4FV4A 2OH0E 3V3VA 2V7OA 3PVGA 3G15A 3CJFA 2PUPA 2Z8CA 1UWJA 5C4KA 5C27A 4DEGA 4BCHA 2CGUA 3VVHA 3TACA 3D7TA 3R71A 2XCKA 4FKLA 4NL0A 2GNIA 5TE0A 3V01A 3ZRMA 4E5BA 1Q8UA 2FYSA 2O63A 2DUVA 4JXFA 1RE8A 4CCBA 4D1SA 2JDTA 2C3IB 1DI8A 3A7GA 3IW5A 4RA5A 4YZBA 4O7WA 3SXFA 3SV0A 3RP9A 1H1RA 2P33A 5LVPA 5ETIA 2X6EA 3OOMA 4U80A 5G6VA 4F6SA 2W1FA 3A61A 3LMHA 1Q5KA 1XH9A 5HG7A 4AACA 4FZ7A 5HBEA 1WBSA 5IKWA 3SG8A 4TW9A 4XX9A 4R7IA 1H0VA 1G5SA 2C3JA 2XK3A 5HCYA 2X81A 4TNBA 1M52A 5CSPA 1P4FA 3LLAA 2QKRA 4IAIA 4AF3A 2BVAA 3FZOA 3TIYA 4LV8A 3P7AA 4KKEA 2XNOA 3E8DA 4BI2A 5IISA 5C9CA 2W1DA 4EKLA 2NRUA 5DHJA 2UZDA 4USDA 4IAKA 3ZOSA 5CAQA 4AUAA 3QLFA 5EOBA 3R7IA 2XNMA 5GJDA 3EOCA 4I20A 4R1VA 4YURA 2F7XE 2OIDA 3TV6A 3ENMA 4DCAA 5HG5A 2JDOA 5I3OA 2C30A 3PSBA 4JX7A 3F6XA 1Q4LA 3SDJA 1ZMVA 2YAKA 3DQWA 3ZHPC 1UU7A 2ITXA 5CI6A 5EQEA 4JQEA 4ZS0A 3NPCA 4OW8A 3TM0A 1FVTA 4K6ZA 3P9JA 1WMKA 5B2LA 1RQQA 3GEQA 3BYOA 3U54A 4XBUA 3NYXA 4PY1A 4BCNA 5LVOA 4ZSAA 2VTMA 4U9AA 3IOPA 2UW9A 4GJ2A 3EN6A 3PJ3A 1J1CA 2VZ6A 4R3CA 4TWPA 2RKUA 4KAOA 4RC4A 5HLPA 4MD7E 3RNYA 4DINA 3VUHA 4HVIA 2CKOA 3D0EA 4XG9A 2QURA 4FSUA 3UPXA 4X7QA 4PWNA 3E87A 5ACBC 3NSZA 2PVHA 3V51A 2I1MA 4ASZA 5AA9A 4DE4A 4HZSA 4RQVA 3UIMA 3RCJA 3MVJA 5CEOA 3F5PA 3QALE 3EKNA 5J7HA 4NW6A 4EZ5A 5JN2A 3I7CA 1YXVA 4MBIA 5I9UA 3W8QA 1ZLTA 1KE5A 2XKEA 5KMJA 3FMNA 3NUUA 1ZYJA 2X8DA 1IA8A 3PRIA 5DLSA 5HI2A 5HICA 3LFSA 5BUJA 2HXQA 3PXRA 2YDJA 4N70A 2HXLA 3AC2A 4QRCA 4Z16A 4AFEA 4CV8A 3WZEA 1U46A 3DB8A 3ZEWA 5JQ8A 2PULA 3Q5ZA 4AQCA 4UMRA 2X9FA 4J71A 4AW5A 5CI7A 1J7UA 4K1BA 3EYHA 3ZFXA 4AA4A 2W1EA 5DRBA 3ZLYA 4D2SA 2IZSA 2DYLA 3FXWA 1GZNA 3DBQA 1WZYA 2X7GA 4QMSA 3UOJA 5IZFA 4C8BA 5AUYA 3TV7A 2YM4A 3UOLA 5ANJA 3DV3A 2YN8A 4RA4A 4EHGA 2V55A 1SNUA 3R01A 4EK5A 3FZ1A 3KXGA 4O0SA 3AC1A 4O2ZA 2JEDA 4BBMA 4WG4A 3P1AA 4NM3A 4HGSA 4Q9SA 4XRJA 3UODA 4U8ZA 4CMOA 3FSKA 3ULZA 4RJ6A 3TWJA 1XHAA 5L2QA 3F2RA 1PXMA 3OZ6A 3ITZA 1TVOA 4M69A 4DEBA 5IUGA 1ZWSA 2DQ7X 2YWPA 4M66A 4WKQA 4JI9A 1NXKA 2Z7RA 5FQDC 3EIDA 3BEAA 4ACHA 2ZV2A 4Y72A 5T3QA 1UNHA 1F5QA 3QRIA 4QPMA 4CNHA 4UB7A 3C5UA 4C3PA 2Z2WA 3BHVA 3DAKA 4E6CA 4BCJA 5IA2A 1WBVA 2JFMA 2XNBA 3RM7A 4JBVA 3CGOA 3KRRA 4MX9A 1H24A 3V8WA 4QMNA 4O0RA 5BX0A 4USEA 3GU8A 2B9FA 4F7SA 4C7TA 4DTAA 2OBJA 3PUPA 2PVJA 2OLCA 2C0IA 2XK4A 4D4SA 4BY9E 3IPHA 5DWRA 3CJGA 3R8VA 3DY7A 1H25A 4C4JA 5KMLA 1Q8WA 3O7LB 5AP1A 4EKKA 4ZTRA 3T8OA 2V5QA 5H8BA 5IPJA 5JZJA 4O0UA 5EW3A 4LQMA 4DH1A 3F3ZA 4FZFB 1P2AA 3E7VA 4U3YA 3ZLXA 1CMKE 5IQHA 3EYGA 1RJBA 5AUXA 3Q2MA 4L00A 1BYGA 1VYZA 3GI3A 3EQRA 1DM2A 3LLTA 4FSZA 4QMWA 2ERKA 5DH3A 5LARA 3R1NA 1YVJA 2IW9A 3SW4A 5HZNA 5JFSA 1UU3A 3P79A 4QMLA 2WMBA 3ZBXA 3UIXA 4NK9A 5BNJA 4ENXA 2IO6A 3G2FA 2XK7A 5AR4A 2ITOA 4XMOA 4AGDA 3D15A 3QRKA 4DH3A 2JBPA 3R7GA 4FODA 2Y4IC 4PL5A 1IRKA 4JLCA 3QQJA 3A7FA 4ANQA 2ITPA 3BU5A 3R1QA 4MWHA 3ZRLA 1KE9A 4H36A 5J5TA 3R7EA 4HYSA 1Y6BA 2JLDA 3FMEA 5GINE 4HPTE 5IQEA 4YO4A 1Q8YA 4FL1A 4M3QA 4ASDA 1JVPP 3Q53A 4M12A 3FMDA 4C61A 1H00A 4CLJA 4DA5A 4W4WA 4X6QC 2I0HA 4QMUA 5CT7A 1OPLA 1XBBA 5KCVA 3TZMA 4FIGA 1T45A 4WG3A 5CWZA 5M08A 3VQUA 3R7VA 3PYYA 1M17A 2JDRA 3R83A 4FA2A 2OFVA 3F88A 1BLXA 4GUBA 3VIDA 4F63A 4MK0A 4QP9A 5L3AA 5CY3A 5D41A 3WI6A 3C0IA 4UYNA 4XLVA 4DGGA 4WSYA 3TUCA 4RIXA 5FUTA 4OTIA 3ORLA 5GIPE 3GU4A 2WIPA 3FXXA 4FVPA 3WF6A 4B9DA 4MBLA 2W1ZA 5BVKA 3RZBA 2WQEA 3OWJA 3F61A 4DYMA 2ZAZA 2EVAA 4E6DA 3KREA 2F57A 1UU8A 3GNIB 4HYUA 4L8MA 4EORA 2J5FA 3TNWA 5KMIA 4ONAA 2HWPA 3ZTXA 2RL5A 4CRLA 2WTKB 4BDBA 3QKLA 5EDPA 2XMYA 4DT9A 3ORNA 3QQGA 2F7EE 4XP2A 2VO0A 4U40A 2XBJA 4FG7A 1YWRA 4CT2A 4KIOA 5KBRA 1L3RE 1XJDA 2I40A 4G3CA 3ZZWA 1YKRA 1R1WA 2J4ZA 4CQEA 4IAZA 2Z02A 4PL3A 5J1VA 2YIWA 3P0MA 4WT6A 3OXIA 3A4PA 5ETCA 3VBWA 4XG2A 2QOCA 1OKZA 5AP3A 3FLYA 4GK2A 4GFGA 2OZOA 3EL8A 3DZQA 4MKCA 2R3HA 3TTIA 4CCUA 2Q83A 5A46A 1XH4A 2YZAA 3DLSA 3QHWA 2XRWA 3HKOA 4FVQA 4QNYA 2W96B 5B7VA 4IC7A 2WMSA 4RIWB 1MRYA 5E8TA 3NYNA 5HO8A 4H3BA 3LAUA 2GS2A 4BWXA 4LOQA 3HAMA 4FYNA 4C0TA 4YSJA 2JC6A 4ZJIA 4D28A 4BCQA 1XH6A 2XIXA 2VTNA 3KF7A 2UW7A 2R0IA 3MWUA 3OS3A 3R2BA 4MXYA 4D2PA 4RX5A 3RVGA 4E20A 3IQ7A 2UZLA 4FKIA 5JGBA 5A9UA 3AMAA 4FV5A 5E8YA 4NM0A 4MXCA 4I23A 4U43A 2GS7A 3O2MA 3VW8A 2BILB 3GU5A 5IQDA 4FG8A 2BTRA 2YLEA 3IO7A 5JK3A 3PWDA 4BIBA 1OZ1A 3LVPA 4H1JA 4JVGA 4XP3A 3VUIA 5AAEA 3LFBA 2ETKA 5AR2A 3ZMMA 3ZC6A 4Y95A 2PE0A 2VRXA 2W5HA 4RIYB 5FP5A 3RKBA 5AUTA 4C4IA 2QOHA 4BGHA 2IJMA 4P2KA 3PTGA 5B2MA 3E3BX 4I22A 2C6OA 4OTDA 4YJRA 1I09A 3OROA 2IZUA 3F5XA 5IQAA 4CFXA 1O9UA 4YZ9A 3D14A 2UZEA 1UKIA 4BCMA 3I81A 4IB0A 3ZSGA 1UU9A 2QG5A 3EN5A 3HA8A 5EKNA 1JLUE 4FTKA 4MD8E 1ND4A 4D1ZA 5KMNA 2XM8A 4UXQA 2CNUA 3K2LA 3DK7A 4FTJA 3W33A 1GZKA 3H9OA 1URWA 5AX3A 4AG8A 1U4DA 4L3LA 3G33A 3ZLSA 2JBOA 4ZSLA 5T68A 1YI4A 3JXWA 5EFQA 4R7HA 4FOBA 3KVWA 5AIKA 4D55A 4LV5A 5KO1A 4JIKA 1ATPE 5BQ0A 3O50A 4H05A 5ACKA 5HX8A 3F5GA 3NDMA 3EMGA 3MV5A 5EM7A 4EOKA 4RFMA 1MQBA 3MS9A 2VV9A 3V6SA 4WO5A 1OL7A 4X3FA 4ZSJA 3UOHA 5F95A 4FKPA 2BDJA 4PTGA 3RJCA 1ZMWA 3FI3A 2A1AB 3UJGA 5A54A 3MH1A 4L44A 2OZAA 3ZLWA 3D4QA 5LMBA 4AU8A 4B99A 1U54B 5E4HA 4CKIA 2J6MA 5CAOA 2W9ZB 2WNTA 5F9EA 1FVRA 5FBNC 3PJ1A 4MBJA 4ZTHA 4DFLA 5J8IA 4I5HA 4ZZMA 2OJIA 5HBHA 1BX6A 4JG6A 3PPZA 2CN8A 4FT9A 4A9UA 2R5TA 1NT2A 3HL7A 3KF4A 4PF4A 4PNIA 2VTAA 4EQUA 3SW7A 4IFGA 3LQ5A 3I60A 4O6EA 4EH6A 3QWJA 4PMPA 3DK3A 2CN5A 4TNDA 5L2IA 4YZCA 4I92A 2B1PA 3UC3A 4BYJA 4F1TA 4AW1A 4M84A 1MP8A 2PHKA 1FBNA 2WOTA 4O0XA 4KBKA 4AZTA 3QA8A 4F0FA 3R9OA 2OU7A 4RWKA 3FZSA 2ZYBA 3ACJA 2BIKB 3I5ZA 4KIQA 1SVHA 3GCQA 1OBDA 2A19B 3KMUA 2UZNA 3LCSA 4I5CA 2PVYA 3RAHA 2ZVAA 3H9RA 2XNGA 3JUHA 3RHKA 4CMUA 5FXQA 1WBWA 3AG9A 4KD1A 3Q52A 4IB1A 5D10A 4PPAA 4ANLA 3RTPA 5K5NA 1YHWA 3SG9A 2B9IA 4WIHA 4PMTA 2C47A 3A60A 3EQFA 2C68A 5HKMA 4EH7A 4MF0A 2UVYA 3DFCB 5L2TA 4NYEA 3AMYA 4FTOA 4I4FA 4D2TA 4PPBA 1SYKA 5CYIA 1WBPA 1YDSE 4DG0E 4Q2AA 3DS6A 4RC2A 3DXQA 2NO3A 4JL9A 5AP0A 3FXZA 3MJ2A 3E7OA 4YLLA 4RMZA 4DT8A 3LFEA 1Q97A 4YGAA 3LPBA 3MVMA 5E91A 3LXKA 5EHYA 4EOMA 4KIKA 3P4KA 2CGVA 3RWPA 3EFKA 3JY9A 2WMRA 3Q6UA 4JDJA 4LFIA 4P7EA 1MRVA 4S2ZA 1OL6A 3F2NA 2ITNA 4AE6A 4EK4A 2OJGA 1DAYA 4ZK5A 2PVKA 3QYWA 2XIRA 4JT3A 3VUDA 3A7IA 2VWYA 3QZHA 3UIBA 4RQKA 4O7LA 2YERA 3VUKA 5TKDA 3MY0A 3R8PA 1OKWA 3CQEA 1KSWA 2ZJWA 3DJ6A 1PKGA 3L9LA 4TZRA 5DVRA 2HK5A 3UTOA 3KRLA 4D9TA 4OTQA 2HAKA 5HO7A 2BKZA 4DCEA 1PXOA 3UMWA 3S1HA 4HJOA 3DTCA 3FEGA 4FZAB 4CFFA 4CG8A 3GFWA 4TWOA 4XJ0A 5LCKA 4X6RA 5C1QB 2ZMCA 3KMMA 5HOAA 4CTCA 4CYJA 3LKMA 3U4WA 4J52A 4FNYA 3OWPA 4IVBA 5IQIA 3D5XA 4F1OA 3UG2A 3CSVA 4FEXA 3DBCA 2XYUA 2YM3A 4HNFA 1PJKA 1UNLA 2QOKA 1PXLA 4RZWA 3BWFA 4V0GB 1SVGA 4NCTA 3C13A 4C57A 3TUDA 3MB7A 3QX4A 2ESMA 4NW5A 3HP2A 4O7ZA 3MFSA 4PUZA 2VNYA 3RPOA 3PIYA 4ZLZA 4BIDA 1JQHA 2J7TA 5EW9A 3OEFX 2YZLA 4G6LA 2BCJA 3BX5A 2VX3A 5DA3A 3LOKA 4Y83A 2J90A 5DG5A 4QYYA 3TL8A 3OBJA 4IANA 4BCIA 5KHWA 4MWIA 1GOLA 1S9IA 5ANKA 1A48A 3HUBA 1GY3A 2VAGA 4BC6A 4A9YA 3SXSA 4DFZE 1X8BA 3N9XA 3U9CA 4BKJA 4BF2A 1EH4A 4YC6A 3PE2A 3AC3A 5KZIA 4F08A 5IEXA 2I7QA 5JRQA 5HVJA 5HCXA 4BKZA 3FWQA 4G34A 4O7RA 2VTRA 2W99B 4FUXA 4RVKA 3BLHA 1H27A 3RAIA 3QHRA 4JBOA 3LW0A 4JJRA 5HHWA 1REJA 3QXOA 4K8AA 5I5ZA 5IEVA 2FA2A 2UUEA 1JBPE 2CGWA 3HVCA 1LPUA 3A8XA 3O51A 3C4FA 2X2MA 2W0JA 5DRDA 3EQIA 3OVVA 4RT7A 2C5NA 4Y85A 3PA5A 4TWCA 4EOQA 3PP0A 1ZYLA 4D9UA 4FKSA 1H8FA 5CNNA 4YC3A 1B38A 3FHIA 4FBXA 4AFJA 3OT8A 3HECA 3PIZA 5BVEA 1BL6A 2FSMX 4L7FA 3V5LA 4DLIA 2HW6A 4OBQA 5AR5A 4D0WA 4U79A 2NRYA 4IX4A 4FSQA 5CSHA 4YR8A 3Q9XA 1IAJA 3LFCA 1YOJA 3DAEA 3PRFA 2OK1A 3MBLA 3R6XA 4FV2A 5CNOA 3NVMB 2PZ5A 4GCJA 3RALA 3V5TA 3LJ2A 2CJMA 4YBKA 2E9NA 2VTJA 3NMUF 1V0BA 4YZNA 5CEPA 4U45A 4EHEA 4JDHA 2GDOA 2GCDA 4FT0A 4QMZA 5A4CA 4FTNA 2QKWB 3R73A 4WOVA 3WZUA 4ARKA 5GZAA 2JIVA 3AD6A 5AV2A 3QCQA 2XYNA 4A06A
chains in the Genus database with same CATH superfamily
4LG4A 4PMMA 3RWQA 2GTNA 4KRCA 3NUPA 3KXMA 2OICA 3CPCA 4A9RA 1E1XA 4JOAA 4ZEGA 2YWVA 4LYNA 4HCUA 4YJUA 5HE2A 4YBJA 1VLRA 3K5UA 2QO7A 3ZSIA 4XRLA 4BHZA 4TT7A 3R9HA 2EB3A 4YNEA 4AW0A 3EH9A 3BGQA 3NFFB 2XEZA 4FIEA 3UQFA 1W0XC 4R5SA 2UW8A 5K4IA 1OBGA 4O84A 4YJPA 4HVDA 3HZTA 2WQMA 3FZPA 1H26A 3LFAA 4RJ3A 3QQKA 5EQPA 2A98A 5ANGA 3Q4UA 2OJFE 4F9WA 3F2AA 4DEAA 2V22A 4F6WA 4MVFA 4MYGA 4DGMA 3QUDA 4B6LA 4TYHA 1STCE 4BGQA 3UE4A 3S2PA 4CGAA 4RVTA 5GHVA 3WIGA 2C5YA 4DTKA 1NY3A 2BRNA 3LXPA 2BRMA 4A9SA 3IDCA 2VTPA 4YJOA 1OKYA 3CKWA 3PZEA 2YDIA 4LOOA 5CAPA 1Q8TA 5L2WA 5AEPA 3CGFA 4L7SA 2GHLA 2J0MB 3FC1X 3AC4A 4UYAA 5FXRA 3KVXA 4L01A 1WBNA 4ZMEA 4IXPA 1ZY5A 3DTWA 5GNKA 4MAOA 2C0OA 2PMLX 4CZYB 4G2FA 4F1MA 5EHOA 2H34A 5E7RA 5CU6A 2C0TA 3DB6A 4UWBA 5J1WA 3KN6A 3OW3A 3PFQA 4CFNA 4DEEA 4IAFA 3PA3A 3VS4A 3VBYA 4RBLA 5ANDA 3VHEA 2UZTA 2Z7LA 2QU6A 2Q0BA 4G3EA 5EOLA 5EYKA 3U8WA 3RMFA 3HDMA 4BCFA 3RZFA 1GJOA 3KU2A 2QO2A 4YUQA 2PSQA 4UMTA 2A0CX 2WU6A 5HE3A 4FTCA 3SVVA 3HV7A 4LMUA 1TQPA 3SOCA 2R9SA 4ASEA 1G3NA 5M09A 2XKFA 4BTFA 2YHVA 3SXRA 2JAMA 1MRUA 2J9MA 3DKGA 1YQJA 3AT2A 5AP7A 4WG5A 5A14A 5EQYA 4FKOA 4JQ8A 2BDWA 4FEQA 4EJ7A 4L9IA 4EOIA 4QTDA 4L68A 4CFVA 2H96A 3HDNA 3OD6X 4JG7A 4FIJA 2V62A 2VTHA 3NAYA 4WA9A 2HW7A 2VWIA 4LL5A 4LI5A 3DDQA 3ZONA 3OF0A 4W4XA 3PY3A 4B0GA 4EH3A 4FZ6A 4FEUA 3B2TA 5EM6A 4EOLA 4PNKA 5FEDA 2JD5A 3PIXA 4I4EA 4EK3A 4IZAA 4LL0A 4YTIA 3SA0A 1AQ1A 4X0MA 3ZUVA 4D1XA 3OWKA 4GJ3A 5CXHA 5KZ0A 2BRBA 5DYJA 1MUOA 4ID7A 4U42A 1VZOA 4EWHA 4FV0A 4I0TA 2YJRA 5H9BA 1J7LA 2VWZA 3SC1A 2X6DA 4KKHA 4XG6A 4BVUA 4MXZA 4BB4A 4DH8A 3MDYA 3FV8A 1OUYA 3W16A 1LEZA 3MFUA 3QL8A 4J98A 4FTQA 2VO6A 2W1CA 3ZBFA 2C5VA 4NJ3A 2VO7A 4A4LA 3WF8A 4MHAA 3BQCA 3ERKA 5M4UA 3NGAA 3CD8A 4IWOA 3SX9A 3FJQE 4GEOA 3ACKA 4PDYA 4PX6A 2H8HA 4QEBA 3I6WA 2PMOX 3BLQA 2PUUA 1YOMA 4OTPA 3O23A 1VEBA 1YDRE 5LMAA 4AXEA 4QQCA 2YAAA 3NVKI 3QC4A 5IQBA 1T46A 4DH7A 2WO6A 3LMGA 3R0TA 2P4IA 2PZYA 2W06A 3ZU7A 4ZLYA 2PTKA 2C6TA 3FQHA 1XBCA 2ZFYA 3VW6A 3C1XA 5IG1A 4X3FC 4X2GA 5E8UA 3FMLA 5M4IA 3EN7A 4AN9A 5CX9A 4IVCA 3BQRA 2JAVA 1WVXA 5HNGA 2YIXA 4W8EA 3DQXA 2X39A 5HVYA 2YEXA 3PPJA 3VS0A 5CEMA 2JFLA 4O2PA 1H07A 4UBAA 2GU8A 3WARA 5D7AA 5K9IA 1JKKA 2SRCA 4QMYA 1PKDA 2GFSA 4XG4A 3UG1A 3TKHA 4CT1A 3TUBA 4CSVA 2XF0A 1YWNA 2WU7A 3E88A 3PVUA 3EN9A 1QCFA 3HYHA 4ANBA 4DHIB 3R1YA 2O8YA 3BKBA 2WTKC 3DJ5A 4JR7A 2VX0A 3D2IA 4I24A 2GHGA 3LCKA 3O8PA 5HIDA 4J97A 4U6RA 3TN8A 3MIAA 4IHPA 5C8KA 4BBEA 3QTRA 2XK6A 3VNTA 4XV3A 2AYPA 3PXZA 2XK8A 3BIZA 4GU9A 1PMNA 2WTCA 2OZAB 5GJGA 3E8CA 3HA6A 4R6VA 3R7OA 2CNVA 3FI8A 4NWMA 3WF9A 2I0YA 2J2IB 3R7UA 3ZM4A 4GSBA 1OL2A 4ORKA 4FKQA 2BZHB 4N6YA 2NPQA 4MXXA 5IA3A 4S31A 1W82A 3WE8A 3QRTA 4PQNA 3OUKA 2AQXA 1KWPA 1LR4A 3HEGA 2IVTA 1UNGA 3W0PA 2WFYA 4GRBA 3OTUA 4I94A 2E9PA 3VS7A 2YA9A 4NIFA 3RK5A 3C0GA 3BBTB 3GCUA 4IH8A 3PA4A 1HOWA 3QD2B 4X2FA 4X3FB 4R5YA 2XAOA 1KOBA 2GMXA 5FGKA 4FE2A 4Z7HA 2QR8A 1UV5A 4GK3A 5BPYA 3PP1A 4QDEA 1WBTA 5LOHA 4RWLA 4BDFA 2JKMA 5BUIA 2RFSA 5TR6A 4CYIA 2PU8A 4XUFA 3TTJA 5IH6A 5JGAA 3E64A 1R0EA 3K3IA 4FK6A 3WF7A 4FSWA 3NZ0A 3CTJA 2X0GA 1IA9A 3R02A 3ZFYA 4WSQA 4E93A 5CF4A 3LMIA 3D5VA 2R3MA 4EH9A 3KXNA 4W9WA 4L67A 4E1ZA 3MPMA 3P08A 2BAQA 2PVFA 1ZZ2A 4NFMA 4NSTA 4ZSGA 2R3LA 3OWLA 4YC8A 1IG1A 3AQVA 2KULA 5IEYA 2VN9A 1PF8A 3NRMA 3HAVA 3CIKA 5EH0A 2HENA 4IAAA 4V05A 1JWHA 4EZ7A 4FKJA 3W0SA 3RPVA 3G9NA 2JGZA 2ONLC 3JVSA 3MTFA 3KRXA 2CGXA 4BI0A 1LEWA 3NUAA 4BZNA 1Q3WA 3LFDA 3DXPA 2H6DA 3VO3A 1SMHA 4ZIMA 2WAJA 3BYVA 3GOKA 1GIIA 3OEZA 5CASA 3FC2A 2IG7A 4KWPA 4HW7A 5CAUA 3D94A 3JS2A 5DR6A 4FKRA 3TZ8A 5LVLA 3VF9A 4KIKB 3N4TA 5DNRA 4QTAA 2CHLA 3D5WA 3R28A 4ERWA 4E4MA 4XS2A 5M51A 3VS3A 4XH6A 2WMXA 2FSOX 1XKKA 3MY5A 3O8UA 4FSYA 3RAWA 3ORZA 4RJ5A 5HESA 3QF9A 5H8GA 1WBOA 3DBDA 2Q0NA 4GK4A 4F9YA 2J0KA 3LIJA 3U55A 5J5SA 4JDKA 4M69B 4IB3A 2Y4IB 5HNBA 4DN5A 5A4EA 4GT4A 4O22A 4OLIA 4JAIA 1DS5A 2PUIA 4LGHA 3FPQA 3SHEA 2GNHA 4ALVA 4C62A 3C4WA 4ZTMA 4F6UA 1NVSA 2NP8A 2QVSE 5L8LA 3BV3A 3VAPA 4O91A 1BUHA 4FTTA 3H30A 3TXOA 4XYFA 2OXDA 1LUFA 3NYVA 3F7WA 3MA6A 4GFOA 3W55A 4EOOA 3KIOC 3TYKA 2BRGA 2WMWA 4S30A 4UMPA 2VU3A 3AC5A 3WBLA 1YXXA 3KXZA 4Q5HA 4BR3A 5FM3A 3BV2A 5T6KA 3D7ZA 5IUHA 3UNJA 2V0DA 4RIOA 2VTSA 3HX4A 3MH2A 2OW3A 1UKHA 5FD2A 1H08A 3RPYA 3S00A 3LM0A 3Q4TA 3UZPA 1IR3A 3CQWA 4PMSA 4QMPA 3CE3A 2IEWA 4S32A 1PHKA 3LQ3A 4BCKA 1M7NA 1LP4A 3CC6A 5FDPA 1BMKA 4QNAA 3E63A 3NNVA 4Y73A 1ERKA 2R4BA 4APPA 3DT1A 5JFXA 5JMSA 5KMMA 3ZM9A 3HGKA 2GNJA 3U6HA 3Q9WA 1ST0A 4KRDA 2CDZA 4EYJA 4OTFA 5JGDA 1K2PA 5EM8A 3PE1A 5FTQA 4O0VA 3R9NA 4PP9A 3KMWA 4CKJA 2XAMA 4ZP5A 1F0QA 3F3TA 1YI6A 3WF5A 4GT3A 3UMXA 3WIKA 3VONA 4IADA 2ITYA 4GVAA 1OGUA 4QYGA 4L53A 4NH1A 4F9CA 5CZHA 3DKCA 3GQLA 1PY5A 4F99A 3S95A 4RWJA 4IB5A 4EYMA 5DGZA 4DF3A 2VTQA 4E26A 4CLIA 4IZ5A 5JFWA 4CFMA 3PXFA 3KCFA 3UPZA 4L42A 1OPJA 4J53A 4DLJA 5DFPA 3HRFA 3WYYA 2JKKA 2BAKA 4FTRA 5AAFA 2PVLA 2WTDA 4ERKA 3B2WA 4IJPA 3GU7A 4HVHA 4BRXA 2BIYA 4J7BA 3FQSA 4MH7A 3LFQA 4DITA 4X21A 3FAAA 3OMVA 5E1EA 4ZTSA 2WXVA 3TZ9A 3I79A 1J7IA 4H58A 4TWNA 4YLJA 1PXNA 4BDEA 4U44A 1YHSA 4FOCA 3EWHA 3ORTA 4Z55A 2OXYA 1W84A 2ZM1A 3R2YA 3VJNA 5IU2A 4CXAA 1TKIA 1OL1A 4K0YA 2R3NA 3UO4A 4RX9A 3OCGA 1NA7A 2ZV7A 5CVFA 3CKXA 1IEPA 4LRMA 4TN6A 5BVWA 4RX8A 3CCNA 4I5MA 3F82A 1WFCA 2O2UA 4FL3A 5L4QA 4A4XA 5E8XA 4FKGA 3LJ1A 2V7AA 4FRFA 3IK3A 1Z5MA 3ZRKA 2R0UA 2C6KA 3N51A 4AN3A 3JPVA 2WEVA 5KX8A 1V0OA 4RIYA 5DR2A 3IS5A 3GC9A 4M0ZA 4U41A 2IPXA 4HCTA 4DBNA 4O7VA 3DAJA 4PTCA 5HG9A 3DKFA 5CSVA 4IM3A 4ZS4A 2HOGA 2BZKB 2HY81 4BTJA 5AAGA 5BVFA 5J9ZA 3QTZA 1UVRA 2W1GA 2WKMA 4C34A 5ICPA 2YCFA 4EHVA 2VWXA 2Y6MA 1NVRA 5BMSA 5IA0A 3OY3A 4UZHA 2WMQA 3UP7A 2WIHA 1IAHA 3EHAA 2OXXA 4OTHA 4W9XA 3OTVA 4ZAUA 4L6QA 2G1TA 5KMKA 4J99A 3D9VA 2PY3A 5KKRC 3PLAE 4OT6A 3TNHA 5HIEA 4QT1A 1XQZA 3FZTA 1S9JA 3QTUA 4F7NA 2GNGA 4F65A 1R78A 4TY1A 2QOOA 2CLQA 3MTLA 4HCVA 4L52A 4EH8A 4F7JA 5I4NA 2XARA 4F0IA 2ITTA 3W2PA 2QQ7A 4G9RA 3EFWA 5HU9A 3DA6A 4O86A 4RJ7A 5BVOA 1M2RA 2ZMDA 3KRWA 4AGUA 2ZOQA 4LM5A 4BBFA 2B52A 2LGCA 2Y0AA 4O83A 1F3MC 2X8IA 4ITIA 3K54A 4G3FA 3KXHA 4UX9A 4ACMA 2XB7A 3W10A 4K9YA 4YSMA 4AXDA 2BAJA 2IZTA 2F2UA 4PDPA 3HV4A 4AE9A 4ZJVA 3EN4A 3F3VA 5EM5A 5HE0A 4BHNA 5HX6A 3IECA 4GG7A 4GL9A 2GSFA 3BLRA 3I4BA 5IMEA 2PVNA 4FTMA 4KS8A 4FGRA 4G3GA 5EW8A 1H01A 5IH5A 3DNDA 3G51A 4JX3A 3VBTA 4F78A 4AT5A 3HP5A 3GCSA 4AOTA 3AT4A 3BBWA 5I3RA 4Z7GA 3FHRA 4G3DA 3Q60A 4TTHB 5HTBA 5EYDA 4QMQA 2IW6A 2HIWA 1XWSA 4O7SA 4CQGA 4I5PA 2AC3A 2C1BA 2QOLA 4RGJA 3ZC5A 3THBA 3COMA 3UZTA 5ANEA 3P5KA 3WZJA 3W0NA 3DPKA 4GT5A 3SGCA 4QP4A 2GPHA 2PMNX 4LUDA 4DGNA 5CVGA 4FJVA 3QKKA 2E9VA 3IW7A 2R3OA 5L6PA 3Q6WA 2IVSA 1XH5A 4C58A 4AA5A 4K77A 3H4JA 4QD6A 4ALUA 2ITQA 3NUXA 3F7ZA 3VUTA 1DI9A 5EKOA 1RDQE 5C03A 5BYYA 2EXMA 3OHTA 3QZIA 4CFUA 4XNEA 3QU0A 4ZZOA 4IVDA 2FO0A 2R3QA 3ORIA 2XCHA 4S34A 4D5HA 2XK9A 4O0TA 4HYIA 3NR9A 5I9VA 1YXSA 2RFEA 2WB8A 5FBOA 3MFTA 2BTSA 1VR2A 5FRIA 3VUMA 4HZRA 4FT5A 2XIYA 3ZSHA 3CTHA 4YJVA 4FEVA 4ZLOA 2R3GA 2ITVA 3HLLA 2WTVA 4ITJA 2P2IA 4FICA 4XOZA 4N57A 3PY1A 4FTLA 4O4BB 1FINA 1QMZA 3GP0A 4U7ZA 5K0KA 4LMNA 3QTIA 2GQSA 3OBGA 1APME 4FV1A 3LFNA 4MNEA 2C4GA 2J0LA 2WQBA 3Q4CA 3QD4A 4XBRA 1PYXA 5DT0A 3R9RA 1OECA 2X7OA 5LQFA 3UDSA 4ZSEA 2RFNA 3GCPA 3KEXA 2VX1A 2W5BA 2YDKA 3LXLA 3TZ7A 2E9OA 1H28A 2OI4X 2VTIA 1OVEA 3RPSA 5AR8A 3EJ1A 2Y8OA 2W17A 3Q32A 4FV6A 4RX7A 2RG5A 4NJDA 5AP6A 5A4TA 3MESA 4GKHA 5AUVA 3KKVA 2IW8A 3ZDIA 3G9LX 1DAWA 3I7BA 4M68A 3DU8A 3EB0A 3B8RA 3H0YA 3Q9YA 2AC5A 2O3PA 4GUEA 4M7IA 4OR5A 4UALA 3ZO4A 5IA4A 3HV5A 4M0YA 3V8TA 5A4QA 1XBAA 3ET7A 4QYHA 3OC1A 1WVWA 1ZOGA 2WMTA 3AKLA 5CSXA 4XLIA 2G01A 2WELA 4R8QA 2KTYA 2ZB1A 2WMUA 2ONLA 4W4VA 5KKRB 4E3CA 3F69A 2XNEA 1M14A 5D1JA 5IA1A 3M1SA 4OAUC 1O6LA 3CTQA 4R3PA 3TCPA 4IEBA 5D12A 1OMWA 3E8EA 3IW4A 3UIUA 5FEQA 4ZY6A 1Q62A 2R3FA 5LXMA 1G8SA 1R39A 3A7JA 3I6UA 2XKCA 3CQUA 3P7CA 4GG5A 4IM2A 5M06A 5IQGA 1ZOEA 3QLGA 3R7YA 1FVVA 5AR7A 4Z9LA 1CKJA 2XM9A 4JQ7A 5JKGA 2QU5A 2R7BA 3ALOA 3SKCA 1BI7A 4LGGA 3LE6A 2YCRA 3C0HA 3EFJA 3ELJA 3QFVA 1JSTA 3NFGB 1I44A 2RFDA 4QP6A 5AA8A 5C4LA 3MN3A 3ORKA 2CMWA 2REIA 3KXXA 4QMMA 1SVEA 3KN5A 4FK3A 4YLKA 3UYSA 2R7IA 1FPUA 3D83A 3C4XA 3GENA 5CQUA 5AP2A 4MEDA 4YNOA 3MW1A 4N0SA 4XV2A 5J79A 4FF8A 4IZ7A 1QPJA 4UN0C 2QNJA 2GNLA 4FV7A 4EC9A 2WOUA 2EXEA 2WPAA 3II5A 4O38A 3LJ0A 2C6DA 1ZMUA 2B9HA 4QMXA 3UOKA 3F5UA 4R78A 5CALA 3CD3A 4GU6A 3T3UA 1Q41A 1XO2B 2R64A 2VGOA 3MI9A 1U5RA 2Z7QA 3CBLA 3H9FA 3W18A 5DT4A 4GH2A 3DOGA 2QC6A 4U0IA 4EQCA 3FKOA 4GIIA 3HMOA 2VNWA 1W7HA 4NU1A 3AT3A 4PV0A 4UY9A 5BMMA 1YWVA 2C6IA 2B0QA 4NM7A 3MB6A 1ZRZA 2BMCA 3FE3A 3HMIA 3ZEPA 5IA5A 3PWYA 1AD5A 2WTWA 3RAKA 5AFVA 3REPA 4O4CA 2ETMA 4XG8A 4FG9A 3VBXA 3KK9A 2QONA 1JNKA 2OSCA 4AN2A 2B9JA 1U54A 3FLZA 4IBMA 2X4FA 3Q5IA 1J91A 2BZJA 2UW0A 4I93A 5C8NA 5KBQA 2XJ0A 4O4DA 3PXYA 2J51A 2W1IA 4FTIA 5E8SA 3UQGA 3UVPA 1HCKA 1JSUA 3N4VA 4FKVA 5J87A 4LV7A 2W05A 5AUUA 4DGLC 3I0OA 3R8ZA 1JSVA 4DFYA 5HD4A 1Y57A 4O96A 5F4NA 2ZDTA 5AUWA 4RPVA 3NUYA 2IN6A 2QO9A 1FGKA 1KOAA 2OF4A 1PXIA 3WILA 5CAVA 3S3IA 3NS9A 2PVRA 4I6FA 4IAYA 4MCVA 4BTKA 1J1BA 4KBCA 1KV1A 3QC9A 5HO6A 5BVNA 2VUWA 5D7VA 3NW5A 1WCCA 2YLFA 3HMNA 2PL0A 3FLWA 2W9FB 1R0PA 1OIUA 3PLSA 4C35A 4O0YA 1H1QA 2YM6A 5KMOA 4YPDA 4FNXA 4G31A 5TO8A 3PSCA 3ZO2A 2OFUA 3VC4A 4AZFA 4BZOA 5EI2A 2G2IA 3O8TA 4FX3A 4H3QA 2EB2A 1W98A 4BIEA 5JT2A 4X2NA 5DIAA 1K9AA 4YJQA 1PXKA 1YRPA 3LCOA 3UP2A 5I9XA 1Y8YA 4EEVA 3L8PA 4M8TA 1QPCA 5CF5A 5CS6A 2UV2A 3W2SA 4AXAA 4AZSA 3TI1A 5E8VA 5EYCA 3NLBA 2A2AA 3C4CA 4IMYA 1M7QA 2DS1A 3GC7A 3U4UA 3R00A 4U5JA 1VJYA 2BZIB 4KS7A 5TT7A 5FXSA 3E3PA 4AZVA 3GC0A 2X0QA 4R1YA 1AGWA 3RCDA 4FYOA 3S0OA 3DBFA 3ZXTA 2E9UA 4IJ9A 4WBOA 5CU0A 3MH3A 4BKYA 3S4QA 2GQGA 5JQ5A 2IZRA 4FKUA 2O65A 1XMLA 3GGFA 2XJ1A 4MTAA 2X4ZA 5HD7A 4E4LA 5HE1A 2CCHA 3R21A 5EHLA 1PRYA 3R9DA 5A4LA 3RINA 4ZMFA 2XRUA 4HOKA 2RG6A 2QHNA 4OT5A 5FDXA 4O21A 2R2PA 2R3RA 2WD1A 1YXUA 3ORPA 3PG3A 3I0QA 2BDFA 4RRVA 3L8SA 1CM8A 2CCIA 2ERZE 2PZRA 4LRKA 5DE2A 3P23A 4G1WA 5CU2A 3OW4A 2VWWA 2HYYA 3AD4A 3WZDA 5IDPA 2XUUA 2FUMA 3MVLA 5CVHA 5KUPA 3C9WA 4O0WA 5D9HA 3A99A 5ANIA 4C4EA 4WRGA 4PDSA 2YISA 3GT8A 3MIYA 5GJFA 4BDIA 3Q4ZA 4DC2A 3U6IA 4Q9ZA 5FP6A 3DK6A 4DEDA 3QQLA 4EONA 5HTCA 3EQHA 3PUFC 4O82A 3CPBA 3IG7A 4DEHA 4LGDA 4C3FA 3UYTA 3SOAA 3PJ8A 1CKIA 3GU6A 3IGGA 3M42A 3BGPA 4QTBA 3RI1A 4FMQA 1Q61A 2XNNA 5E8WA 2YITA 4HNIA 4IE9A 5BUEA 1ST4A 3W0MA 3LFFA 4AT3A 4JR3A 3G6GA 3ULIA 4X2JA 3BEGA 4I6BA 4E4NA 4CFWA 3DGKA 4L3PA 2ACXA 2PMIA 4V04A 4LUEA 4FNZA 2Y7JA 5A3XA 3V6RA 4TRLA 4TYHB 3OCBA 5L6OA 4G5JA 4DGOA 2R3JA 5EG3A 2Y6OA 3A62A 3HNGA 2QHMA 1PMEA 3DZOA 4O7NA 1A06A 4GVJA 5HBJA 3M2WA 4D2VA 3A8WA 1QPEA 3LCTA 3QD0A 4QYFA 3N4UA 4QP3A 1YI3A 4N6ZA 3RHXA 3C5IA 2X2LA 3NX8A 4KB8A 4A7CA 2Z60A 3P7BA 3UDBA 3TDWA 3ANRA 3G0FA 2YIRA 3F3UA 3GC8A 3G90X 4RFYA 4QMOA 5CANA 5I0BA 3QZFA 4QP7A 4D4YA 4D4VA 2QI8A 4NCTC 2A4LA 2HZ4A 4E8AA 4M67A 3FBVA 4DFUA 2UW5A 3OXZA 3QRUA 4IW0A 4F09A 5CXZA 4YZDA 1BKXA 3BELA 5ETAA 4EOSA 3R8LA 4EOJA 3UQCA 4NEUA 1CTPE 3KCKA 4XP0A 2OO8X 4WNOA 4Y5HA 2UVXA 1Z9XA 2JDSA 3RGFA 2XP2A 3FDNA 3W2RA 2IWIA 5JSMA 4KUJA 4AZEA 2B53A 4FKWA 4GMYA 3W2QA 2P0CA 4C4GA 5AM6A 4ZTQA 4QMTA 3V5PA 3W32A 5AV1A 2HCKA 4DFXE 4F9AA 5M53A 3FYKX 1B6CB 4FIHA 1TQIA 1YDTE 4K18A 4UEUA 4WUAA 3CR0A 3ALNA 1W2CA 4I0RA 4BCPA 3VN9A 2YIQA 3HMMA 4R77A 2CKQA 2YACA 3UC4A 1Y6AA 5LVMA 4UWCA 4G17A 1MQ4A 2J50A 3UBDA 4CKRA 2Y4PA 4TKSA 3ORXA 3ZS5A 2ITWA 3O17A 2OF2A 4ANSA 2VWVA 3BRBA 4QQTA 4FC0A 3TG1A 5I9ZA 4IWQA 5IF1A 4YJTA 3EZRA 4MXAA 4ZOGA 1OPKA 3OT3A 2XH5A 4G5PA 3UO6A 1CSNA 2CNQA 3PFYA 3ZXZA 3W1FA 3FMJA 4RJ4A 5LJJA 4C36A 4PL4A 3VS1A 4RLKA 3BU3A 3EKKA 3VHKA 2PK9A 4P90A 4MQ2A 4CZUA 2XA4A 3FLNC 1Q99A 1ZYDA 2O64A 3FKNA 3IONA 3EFLA 4HGEA 5IQFA 2QD9A 5HLNA 3QD3A 3GOPA 2E2BA 3P86A 3QQHA 3WOWA 5CF8A 2CLXA 2CKEA 4LRJA 4AW2A 1SNXA 3COHA 4GYIA 3TJDA 3MSSA 4G6NA 4FR4A 4TYGA 4F70A 2HZNA 3AGMA 5ETFA 3QUEA 4CMTA 1YW2A 3TNPC 3ML1A 1FMOE 2QLQA 3LQ8A 3TEIA 5ITAA 4OBOA 3FYJX 5C26A 4RWIA 2UW4A 2VTTA 2VTLA 1KE6A 5M44A 1JKTA 2X8EA 4EK6A 5LWMA 5B0XA 3ROYA 4I1ZA 3O96A 3OY1A 3SAYA 3Q2JA 3QYZA 5AR3A 4BN1A 3VJOA 2EUFB 3OOGA 5AMNA 4BICA 3BYMA 4I21A 4XV1A 3NUSA 1OUKA 2GTMA 3QX2A 5JRSA 4CRSA 4D2WA 3W2OA 2PWLA 5EK7A 3FL5A 4X2KA 3R30A 4UXLA 3SQQA 4JMQA 5M4CA 1BL7A 2YCSA 5HVKA 1SM2A 4H3PA 3BL7A 1YOLA 1JOWB 5GZ8A 3TJCA 4D2RA 2F49A 2WMVA 4ZJJA 4D0XA 3GUBA 2G2HA 3PZHA 4AS0A 2OWBA 5BYZA 3SRVA 2X0OA 3MFRA 4NKSA 4W8DA 5CQWA 3HV6A 1KE8A 5HG8A 1U5QA 3KRJA 4DFNA 5AV0A 4U81A 4USFA 5K5XA 3NNXA 3OXTA 4XV9A 5L8KA 2ZV9A 2CSNA 3NWWA 4FKTA 4NT4A 3BCEA 5LVNA 4IQ6A 1PYEA 4EBWA 4EUTA 3BGZA 5CT0A 4C4HA 2ZB0A 1P4OA 5A6NA 4XCUA 3V04A 4E6QA 3OCSA 5DOSA 5HCZA 4BCGA 1JKSA 4BDKA 1G8KA 3G0EA 4BDHA 3C4EA 4DH5A 3NW6A 3EZVA 3QTWA 4BFMA 1H1SA 3OG7A 4E7WA 2XIZA 3UVRA 2R3KA 3GBZA 3C7QA 3QA0A 4WHZA 2W4OA 1ZYSA 3NEWA 3R1SA 3FPMA 4TPTA 4EK8A 1FGIA 2UZOA 5D11A 4AT4A 2FSTX 1KV2A 4O1OA 3FI2A 4C02A 4MD9E 1GZ8A 2JKQA 4OUCA 3R8UA 3TIZA 3AMBA 4IFCA 4YJSA 4ACCA 3KQ7A 5F94A 3PVBA 2C3LA 2F2CB 3GQIA 3Q96A 2WZJA 3KC3A 4I3ZA 3PXKA 1V0PA 3BWJA 2HWOA 5E1SA 3SLSA 5JEBA 4YPSA 1KUTA 3G5DA 2XKDA 1UA2A 5CU3A 4BWKA 3FSFA 4WUNA 1R3CA 3MYGA 4EH5A 2IVVA 3TNIA 5AM7A 2UW3A 3QUPA 2YM8A 2O5KA 4KINA 3QCYA 2PUNA 4AGWA 1ZZLA 4ZY4A 1CDKA 3FI4A 2JITA 4A9TA 2PVMA 1OIRA 4KKGA 3TT0A 4NM5A 2F4JA 3Q04A 2GNFA 3FLSA 4QTCA 4QQ5A 5HLWA 4GW8A 4DG2E 3TNQB 4F0GA 5IUIA 3U51A 1O6YA 4TXCA 4HVSA 2R3IA 3WE4A 4EOPA 3E92A 3FMHA 4IC8A 2WQOA 5CENA 5BYLA 3QWKA 4IDVA 3FMMA 5L8JA 2QOFA 4H1MA 5JZNA 4G16A 3DBEA 4BCOA 2YM5A 2G15A 4BI1A 2BROA 4C2VA 3FZRA 4DEIA 4NKAA 3W0QA 4BTMA 5E9EA 4CD0A 4FSNA 5M55A 3LM5A 2X9EA 4OTGA 5DBXA 3FKLA 3MPTA 3TV4A 5K4JA 1ZARA 3COIA 4GFMA 4YJNA 4QYEA 2QCSA 3UNKA 4IWDA 3GCVA 2W4JA 4IX5A 3V5QA 1Y8GA 3DKOA 4M15A</