2Y6MA

Crystal structure of epha4 kinase domain
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
283
structure length
262
Chain Sequence
VREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords EPHRIN TYPE-A RECEPTOR 4
publication title Crystal Structure of the Epha4 Protein Tyrosine Kinase Domain in the Apo- and Dasatinib-Bound State.
pubmed doi rcsb
source organism Mus musculus
total genus 83
structure length 262
sequence length 283
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2y6mA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2y6mA01
1OUYA 4WOVA 4ZSAA 1OL5A 4XNEA 3OC1A 3V5WA 5HD4A 3IW7A 3MW1A 2YABA 5K5NA 5DRDA 2J0MB 2XM8A 1GNGA 4MEDA 4EOSA 4EWHA 4QD6A 5IDNA 3PA4A 3PYYA 4QMLA 4YTHA 5BYYA 4GYGA 3QWKA 4H05A 3U54A 4PF4A 3P08A 4GT4A 3QYZA 5IQIA 3W2SA 4CCUA 3ZMMA 5ANIA 5CF8A 3QL8A 4C4GA 3LJ1A 5M4UA 1KE9A 2G9XA 3NUAA 1RE8A 5FP5A 4BI0A 4DGMA 2ZYBA 3S0OA 2H34A 3ACKA 5BVEA 2O3PA 3MV5A 4NTSA 4DC2A 2VWZA 3EHAA 2REIA 4B9DA 4X2KA 2DS1A 3QRKA 3R9OA 3PPJA 4AX8A 1XH8A 4DCEA 4TYHB 3K3JA 1XBCA 3I6WA 4FV6A 5J9LA 5JQ8A 2HXQA 1DAWA 2O63A 5HBHA 4E4NA 2UVXA 4WNOA 3AT2A 3GCPA 3PY1A 5JZJA 3PLSA 2WNTA 4LMNA 3PJCA 2YIYA 3UNKA 4FIHA 2VD5A 2FA2A 5CXHA 2C6KA 3PWYA 5M07A 4CFUA 5HI2A 4O7NA 2CMWA 3ORZA 4R3CA 3OF0A 4QQTA 2NPQA 4X2NA 4FKSA 4G3DA 4X3FB 3UE4A 3BI6A 4MXOA 2ACXA 5CSXA 4KSQA 1NW1A 4XCUA 4EOQA 1Y57A 2JD5A 2PWLA 2X8DA 4IC7A 4C4JA 5JSMA 3FZTA 3FDNA 1P14A 4LUEA 2BKKA 3ZM4A 1UNGA 4F9CA 3FJQE 4IH8A 1YDTE 4DAWA 4K11A 4BDBA 5J5SA 4V0GA 4PX6A 4DINA 5DG5A 3IDBA 4HVSA 2FH9A 3FL4A 3QFVA 4ANBA 3F2RA 4NJDA 3UIUA 1Q3WA 2QO2A 2C6DA 4R7IA 3Q4ZA 3MVMA 1CKIA 3OT8A 3OXTA 1I09A 2ITNA 3DAKA 2HZIA 4HGEA 2B9JA 1XBAA 3O50A 2IZUA 3EQRA 1UA2A 4O27B 3NUNA 2GNJA 1CKJA 4GFMA 5FUTA 4QMUA 4N6ZA 5CVFA 4CMTA 2JDVA 5A4EA 4KB8A 2X39A 3TUDA 4AGDA 3TM0A 3FKLA 1O6YA 4G6LA 5M51A 4IZAA 2OIQA 4HVHA 3ZU7A 5EI2A 4APCA 2ERKA 3CBLA 3RZBA 5CU6A 2W17A 2OU7A 2RFSA 3QC9A 1SM2A 3KK8A 3SW4A 3KA0A 4BC6A 2NP8A 2WMRA 2WTJA 3C50A 3ZSIA 4ALVA 4KIOA 4DG0E 5L2SA 4CV9A 2HWPA 3AC1A 4KIQA 4PDPA 3RK9A 2GTMA 4F7NA 4A9TA 3BHYA 1JBPE 2HENA 4FTQA 2C6EA 3ACJA 2XIRA 4BCHA 5HGIA 3S1HA 5FTGA 2FVDA 3HMPA 2XK4A 3BZ3A 3ZSHA 4MCVA 1ND4A 4FL3A 5IQGA 1FVVA 3F9NA 3PSCA 2X8IA 3KREA 4M14A 4MWIA 4O96A 2CLXA 5JFSA 4FTJA 4FTKA 2JFLA 1CM8A 2GNGA 1SMHA 3PE2A 4IVCA 2RIOA 2YDIA 1YXUA 2BDJA 1WBSA 3W18A 2VTPA 4XX9A 3ZLWA 4JG7A 4F1TA 4ORKA 5HCYA 4HZSA 5IUGA 2CNVA 3TNPC 4FSZA 5IA5A 3O51A 4I4EA 4APPA 5FQDC 4CMUA 3KXNA 4OW8A 4U43A 3VRZA 3B2WA 2CDZA 3PVUA 3R1NA 4RIYB 4RGJA 1W82A 5CAUA 4QNAA 2H6DA 2XEZA 3VBWA 5CF6A 3PRIA 5CZIA 4D2RA 5IA3A 4Q5EA 1GOLA 4RVMA 5J87A 1G3NA 3ENHA 3KF7A 5EYMA 3QQUA 4WSQA 3SOCA 3VUIA 3BGZA 1FGIA 4WBOA 4USFA 3DBDA 4IACA 4Z3VA 4TXCA 5K5XA 3JYAA 4Q9SA 4H1MA 1U54A 2O5KA 3IPHA 3F66A 3HVCA 4U0IA 3E7VA 4U40A 1PXPA 4AN2A 1ZZLA 4KD1A 4XH6A 4XUFA 4D0XA 4QMOA 4QOXA 5M4IA 3SQQA 3AOXA 4NKSA 3NCZA 2W9ZB 1OIQA 4M97A 2R3GA 4AF3A 3TKUA 4F64A 4C4HA 2P3GX 3ZO1A 4OUCA 3LFSA 2WMVA 2WFYA 2Z7RA 4GFGA 5D10A 4YZDA 3RAKA 4RIXB 2J5EA 2FSLX 3QHWA 4XRJA 4C58A 3WZJA 3DXPA 4BCNA 3R83A 2QR7A 5EFQA 4IWPA 1PYEA 4C0TA 3FPMA 2AC5A 5J7BA 2QC6A 4MBIA 3LZBA 1OGUA 3BYMA 4IAFA 5CLPA 2F2UA 2JKOA 3SLSA 3MTFA 4PMTA 4A4XA 4F9AA 1OECA 4L67A 4I1ZA 2ZMDA 3KXGA 5EDRA 3UOLA 3FEGA 5J7HA 3DY7A 5JFXA 3Q2JA 5EQEA 5GIOE 3DFAA 5M53A 2OJIA 2HZ0A 3RAIA 3NUSA 3SXFA 3MIYA 3CR0A 4ZZMA 3W2QA 3NEWA 5EI8A 4AGWA 4AE6A 4YTFA 5JK3A 1FOTA 3PG1A 3KEXA 1BI7A 2BAJA 3C4FA 3FLNC 3COKA 5K0XA 2ZOQA 4QP1A 2PYWA 3F69A 5CSHA 5GZ9A 2IZRA 3C0GA 3PPZA 4FYNA 3NVMB 4F09A 2O2UA 3RZFA 3CQUA 4I6FA 2ZV8A 3CTHA 5HO7A 4FL1A 4WA9A 4I21A 3LCTA 4MK0A 3BKBA 4XP0A 3U9CA 5AR8A 2X81A 4JRVA 4EQMA 3FV8A 4J7BA 3RNIA 3F3VA 3NW5A 5HE2A 4BCMA 4RJ4A 3NZ0A 3P23A 3EKNA 4ZS0A 3TZ9A 1UVRA 4IVDA 3FUPA 4N70A 5I9UA 2Z60A 5AA9A 3ZBFA 3IECA 4IEBA 4FTUA 2WQOA 1FBNA 2R0UA 4IDVA 2XCKA 3EQGA 1ZOEA 3R28A 4PTGA 3RI1A 2PE0A 2OZAB 1CKPA 3GC7A 2XIXA 4FKPA 5IH6A 2G01A 3VO3A 5E1SA 5EHOA 5CSVA 4F6SA 4XEYA 4YC6A 2YM8A 4BY9E 3V8TA 5IEVA 2YM4A 3PVGA 3FHRA 3OWPA 1X8BA 3FWQA 3QGWA 5BVFA 2C5YA 5T3QA 2JIUA 3MB7A 2BILB 1IEPA 4HCTA 1SVGA 2QKRA 2VTRA 4GJ3A 3WF9A 4X7QA 5LVMA 3WF6A 3QRTA 3KULB 2R3LA 3GU7A 3UQCA 3ZM9A 3LLTA 2J7TA 4RC3A 2ESMA 3TTJA 2GDOA 4RQVA 5I9YA 2BMCA 2OI4X 4KAOA 3AC4A 2CKOA 4QMSA 5AP2A 3CQEA 4R1VA 4D4YA 2JC6A 3FHIA 4H58A 4IHPA 4PPCA 4PRJA 3GNIB 4HNIA 5DEYA 4QMMA 3QQKA 2G1TA 2XNBA 2G2FA 3HV3A 5L8LA 4NW5A 2J4ZA 3R0TA 4EHGA 3IW8A 4O22A 1BLXA 4IVAA 2EU9A 3K3IA 3RWQA 5EKNA 3PIXA 2BRMA 4MD9E 3QAME 5BYLA 5DR9A 3CSVA 1J7UA 2RKUA 4M0ZA 4CVAA 4I22A 3DQWA 3QXPA 4BGHA 5HX6A 4M8TA 2RF9A 3IW4A 4MYGA 3W16A 2YHVA 1KUTA 5FEQA 2VWWA 4BIDA 3DTCA 1WBWA 3WZEA 1JSTA 3P1AA 3KMWA 4YHJA 3WOWA 5IQDA 2WKMA 5HQ0A 3EFLA 3ZTXA 1V1KA 1PHKA 1O6LA 4UXLA 4DYMA 5BUJA 1W7HA 2YM6A 3DK6A 5HE0A 3QQJA 1V0PA 3OROA 2W96B 3UODA 4C35A 1PMUA 2ZDTA 3UQGA 4C38A 4FVPA 4BTMA 4H3QA 2PVMA 3OXZA 2QD9A 2IWIA 3ZCLA 5FTOA 4ZMEA 4TZRA 2I40A 2JDTA 4D1SA 3R01A 1H1QA 2BZJA 5M55A 3OCGA 3BEAA 4PP7A 5KMLA 4XJ0A 3TEIA 3EN6A 1PW2A 4HCVA 4GRBA 3RHXA 2PZ5A 2PZRA 4FTMA 2W4JA 4AT3A 4BTJA 2X7GA 1Y8GA 2ETKA 4II5A 4L3LA 4EH9A 4ZJIA 5EHYA 1ZY4A 1PMEA 5GZAA 2JFMA 4FKQA 3RPOA 1FQ1B 3MFTA 2CGWA 4O0TA 5HBEA 4YHFA 4QYEA 3ATSA 5J1WA 3UYSA 4D2WA 4KUJA 2R5TA 4K1BA 4G6OA 4O1PA 5A4CA 3C9WA 1XH5A 2B1PA 4RZVA 4Y5QA 5IQEA 2B4SB 2X2LA 4I5MA 2I1MA 1H0WA 3R1QA 4P7EA 5L2IA 3E87A 1MQ4A 4FTRA 1YXTA 4WIHA 4AW0A 2UVYA 4GIIA 4YC3A 3GVUA 2C5XA 3FAAA 4Q5HA 2YA9A 4DGOA 2ONLA 4MTAA 5DH3A 3P9JA 4JQEA 4QMPA 5E8ZA 3ZSGA 3MY0A 3OUNB 4C57A 5FEEA 3PJ8A 5DNRA 3V3VA 2OK1A 5E90A 3DB6A 3NNXA 5LMKA 3IDCA 1NA7A 3FMJA 3MVJA 1BMKA 5CI6A 5HTIA 3I5NA 4NT4A 4UYAA 4DGGA 3ZHPC 4I6HA 4HPTE 5HOAA 4DFBA 4P4CA 4V05A 4C61A 4D1XA 3HZTA 4IAYA 3WZUA 4O2PA 4WRSA 3ORMA 2E2BA 4G16A 3ROYA 3VC4A 2B7AA 1WBTA 1H01A 3PJ1A 3SA0A 4O86A 4CYIA 4FK3A 1J91A 4EYMA 3ZRLA 2QU5A 4RIOA 4O6LA 3ZBXA 4FKIA 2G15A 4DITA 4KIKB 4RX5A 3T9IA 3TL8A 3N4TA 3DJ7A 5EG3A 3ZC5A 3D2IA 4ZSJA 1H1WA 2W05A 3AQVA 3HL7A 4XYFA 3ZEPA 4AW5A 4FEWA 3ALOA 3QRJA 4R3PA 5EDQA 1M7QA 4G9CA 4J53A 5HNBA 3PVBA 5AP1A 3VS1A 4EC8A 1PMNA 2F7XE 4HVDA 4F7SA 2GSFA 2WIPA 1ZYJA 2XBAA 4IW0A 3G9LX 4RT7A 4ZTHA 3COMA 1U5RA 2KULA 4ZSLA 4IX4A 4HGSA 3LLAA 2JDOA 2BTSA 4TRLA 3HV5A 1WBVA 2G2IA 4O7RA 4X3FC 1FMKA 4FNYA 4OLIA 3PIZA 2QOBA 3EQFA 3SAYA 3ORLA 5F94A 2OWBA 3QALE 3S2PA 5IA1A 2OIBA 3LXNA 4Z9LA 5ICPA 3N4VA 2JKQA 5KX8A 4IZ5A 1KV2A 2CN8A 3HMIA 2BZHB 3E92A 3FMDA 2OFUA 4QMYA 1H28A 3WE8A 3T9TA 2W7XA 5AM7A 2J90A 4KKHA 4L6QA 1ZZ2A 3U9NA 2YITA 2DWBA 3TKHA 2XEYA 3KKVA 5EM7A 1Q61A 4KRDA 4U6RA 4IBMA 2R3HA 2W99B 1E1VA 3F3ZA 2WMWA 3VNTA 4AT5A 4R8QA 4AU8A 3D83A 3QTXA 4FTLA 4JBOA 4ZS4A 1ZXEA 2FSTX 3PJ3A 3EN7A 4AFJA 5BPYA 4EOKA 2OF4A 2JAMA 1Y6BA 3FY0A 3HP5A 2IG7A 4FVQA 1YOJA 1IAJA 4J71A 4X2FA 4TYGA 2GU8A 2R3MA 2C5OA 3HYHA 4C4EA 2OH4A 5I3RA 3U6IA 2EB3A 2BTRA 3KK9A 4UB7A 2VRXA 1PXOA 4U3YA 2OW3A 3ORPA 5CYIA 1LPUA 3R8LA 4I24A 2V22A 2EVAA 5G1XA 3WZDA 4ZLZA 4O0UA 5D12A 2VO3A 1ZWSA 5CTPA 5LJJA 3H30A 4AZVA 2CCHA 4ANSA 3BLHA 4BCPA 5FDPA 1ZMUA 5FBNC 3U55A 2OO8X 2JKKA 3F6XA 1NT2A 4JX3A 3DNEA 3Q9YA 1GZ8A 3PUPA 1M2QA 4RWIA 3HDMA 5FXRA 5KMNA 3H4JA 2WU6A 4I0TA 3GU8A 4FSTA 3GGFA 4GV1A 3L8PA 2XJ0A 3G6HA 3I5ZA 4S34A 3LQ3A 5F95A 4W9XA 3DLZA 3QTQA 5IU2A 3TXOA 4CSVA 1GIIA 3K54A 1H1SA 1NVSA 5HU3A 3UNJA 4JDIA 3IDPA 4IX6A 2J2IB 1R78A 3EN4A 3HUCA 3OOMA 3P86A 3U8WA 5LVOA 2PUNA 4LM5A 4V0GB 4MAOA 5DT4A 3H9FA 2HZ4A 3KF4A 3KN5A 4O0YA 4N4SA 4IC8A 4M12A 5HU9A 4A9SA 2CKEA 3MPAA 5DT0A 2UUEA 5EOLA 3IQ7A 3WYXA 1K9AA 4RX9A 5I9WA 3OMVA 2BIKB 3V01A 2KTYA 2CGVA 4U3ZA 4GK2A 1IG1A 5CI7A 4XHKB 3A7GA 1PXMA 3O7LD 3QZHA 3EZRA 1ZOGA 4FG8A 1Q97A 4F6UA 4M69A 4YZMA 2OICA 5EOBA 4OTRA 3LCSA 4HNFA 3K5VA 1SYKA 2Z7QA 1Q5KA 4CFFA 2E9PA 5B2LA 4O7LA 4PDSA 3CIKA 2HK5A 4U5JA 3RCJA 3AGLA 5CU0A 3NRMA 3UBDA 4A06A 4RPVA 2BALA 4AZTA 4TPTA 3F3WA 2VTJA 2X9FA 5IZFA 4MX9A 5CAPA 1URCA 3Q9ZA 4GK3A 4ZSGA 2GCDA 3ZC6A 3ZH8A 4CKRA 1JKSA 1Q8ZA 3EYHA 5HICA 5I9XA 3OEFX 1ZOHA 1IA8A 1OKYA 3L8VA 3SV0A 1KOAA 1T46A 3EQCA 1R3CA 4ASXA 4L68A 3EQDA 4I5PA 5JZNA 3UG2A 3MSSA 4BDEA 1UNLA 2A19B 4G5PA 4IWQA 5CU2A 1CSNA 3C13A 3UDBA 4CZTA 3PP0A 4WUNA 4EHVA 1PRYA 3RMFA 2A1AB 2X0GA 3BLRA 2I0VA 3ZFXA 4TNDA 1JWHA 4FKGA 2ERZE 4E7WA 1Q3DA 3MI9A 3TIZA 5KHXA 4DH3A 2W9FB 2JIVA 5HLPA 2OSCA 3UZRA 3GBZA 1OIRA 3HMMA 4PQNA 1H1RA 1GY3A 5F20A 3R02A 4AZEA 5KBQA 4MHAA 3VUDA 4JAIA 4RSSA 5E8TA 1U46A 3C4WA 4MBLA 5IMXA 4G3EA 1R39A 4YU2A 3BYOA 3QTWA 1OKWA 4FZ7A 4O7VA 1M17A 3NUPA 3F88A 2QLQA 1RJBA 5ETCA 4D58A 3UTOA 2YDJA 4C36A 3COIA 5ETIA 1T45A 1YWRA 3R30A 1Q8TA 4QPMA 3NAXA 3UC4A 4QMQA 3WBLA 5HZNA 3FZOA 3GP0A 4JT3A 2PZYA 5JQ5A 3C51A 3LFCA 1OMWA 2P2IA 4OTGA 4CRSA 4PDYA 2Y6OA 3H10A 3Q3BA 3VULA 3VN9A 4O2ZA 4EONA 3QF9A 2VX3A 5AP5A 5ACBC 4E5WA 5FD2A 5AFVA 1U54B 3AD4A 4FNZA 1S9IA 4QQCA 4FSNA 5IA4A 4EH2A 3QYWA 1NVQA 4J1RA 3JXWA 3W2OA 4ZMFA 5HNIX 2PVLA 5LCKA 3RALA 4WO5A 2R7BA 2YCQA 3LW0A 5CNNA 4FTOA 4PPAA 4XP2A 4B7TA 2F9GA 3OP5A 3FZPA 3R1SA 4GVAA 4TN6A 4YJVA 4IMYA 3RCDA 4IE9A 1O6KA 4QMXA 4Y72A 2HXLA 4HVGA 2QG5A 4BN1A 5TE0A 4QTCA 3OCTA 2YDKA 5DMZA 4GU9A 3V8SA 4KBKA 3TTIA 5K4IA 1YOLA 3SHEA 4E20A 4BWPA 2ZV2A 3ZLSA 3UYTA 5TOZA 5AUWA 4K6ZA 1VR2A 3D5WA 2UW7A 4HOKA 3EL7A 4MBJA 2OBJA 3DAEA 3EB0A 5AR4A 2UW9A 5DT3A 4ACDA 5LMAA 4EZ3A 5HO6A 4HVIA 3B8QA 5LCJA 3CPBA 3OW4A 5HG7A 3I7CA 3MJ2A 1WVWA 3V8WA 3VS6A 2WAJA 1DM2A 3G5DA 4L7SA 4AXAA 2WTVA 5CQWA 5JGAA 4RFYA 5I0BA 1K2PA 2XK9A 3EZVA 4ZK5A 2PE1A 3V51A 3Q04A 4XG8A 3ET7A 2BAKA 2WHBA 1XKKA 4IFCA 4G17A 2XNPA 3W33A 3F5XA 4FVRA 3U87A 3DNDA 3LHJA 5B2KA 4D4RA 2LGCA 4BBMA 4CT1A 2YZAA 2OZOA 4PTCA 3RNYA 2R3PA 5AR2A 5DBXA 3QQHA 5CSPA 3TACA 3ZOSA 1QPEA 4CQEA 5DVRA 2WMAA 1OI9A 3PDTA 4ENXA 3PRFA 1UU7A 3TV7A 2UZLA 3QD3A 4X6QC 3WE4A 4BGGA 4PTEA 3R6XA 3E8EA 5FDXA 5HE3A 5CEOA 3Q53A 5AP6A 5DFPA 3QZGA 4I93A 5HO8A 3EQHA 4ITHA 3G15A 4IJPA 5KMJA 4XBUA 2YCFA 3EN5A 4OAUC 3QQGA 4JXFA 4OTWA 2BRGA 1OBGA 3GU5A 4U9AA 4EBVA 1BL7A 5JFWA 3A62A 2QOKA 5L8KA 3MB6A 3KQ7A 1P5EA 1JKKA 3F5UA 3HGKA 3QTZA 3UOKA 1YXVA 3JVRA 3HRFA 3C5IA 4G6NA 4R5SA 1W84A 3ZO2A 2ETRA 3NWWA 2P4IA 4CT2A 3GU4A 2HW6A 4LI5A 3TG1A 4TY1A 2WZJA 3VWAA 2W5BA 4QRCA 4FKWA 4Z7GA 4JVGA 5AM6A 3FLYA 2UVZA 3LFAA 4F0GA 3MGYA 3E7OA 4USDA 3QKKA 4NFMA 5AX9A 4YGAA 3Q6UA 4G3CA 3POOA 4RX8A 4ITJA 1ZYCA 5T68A 4EWQA 5AX3A 5AADA 3NW6A 4YJOA 3RPSA 3ZS5A 1OL6A 2VU3A 5AV0A 5HVJA 2R7IA 3QLFA 3JY9A 3MJ1A 1ATPE 3RHKA 2XZSA 5I5ZA 4FV2A 2GNIA 2XIYA 4EJNA 3FSFA 4I23A 4I5HA 4WHZA 4BBFA 3C4EA 4JQ8A 4M68A 3BYUA 5JEBA 5KUPA 4GG5A 2C68A 1K3AA 5AUZA 4CV8A 2XIKA 2XMYA 5C01A 1H24A 3TJCA 2QHNA 1Q8UA 5HIBA 3DLSA 3TNWA 1EH4A 2EWAA 2VTLA 3DCVA 5CS6A 3R9RA 3ROCA 3ZLXA 4ASDA 5E7RA 3BYSA 3ZFMA 3Q96A 5J9ZA 4FEXA 5J9YA 3ZYAA 4A4OA 5C4KA 4DEBA 2R3OA 4FV9A 5EYCA 2VGOA 5A4TA 3UJGA 4ALUA 4AW2A 4EH5A 4NK9A 2XNOA 4KKGA 1YKRA 3BU3A 3PA3A 4OTQA 5J1VA 2A0CX 2UW6A 3HAVA 3D94A 3V5LA 4XV9A 3FZRA 5ETAA 3Q32A 2BRBA 3LMGA 5EH0A 5CEMA 3ELJA 1JNKA 4DF3A 4NSTA 3FMMA 3NX8A 2X8EA 4JR7A 5CEQA 3D7TA 4RFMA 5C9CA 3KRLA 5CVGA 4JDHA 4ZP5A 5JGBA 1G5SA 2WMUA 3E64A 3VJNA 3PFQA 2EXEA 2YAKA 4FKJA 3OT3A 4FA2A 4M67A 5CU4A 4U41A 5AUUA 4C7TA 1WBPA 3DKFA 4FK6A 2ITPA 4QMNA 3FXXA 4NL0A 4O7SA 2C47A 3ZRMA 4R7HA 2GHMA 2UZUE 3BIZA 5AIKA 2WGJA 3NYOA 3VS7A 3VF8A 4KSPA 4FIEA 3R7UA 3HNGA 3BE9A 3WI6A 4K18A 3FXWA 5DOSA 4AZWA 5AR5A 4ZTMA 3MESA 2VTMA 3IONA 4XG4A 3WF5A 4AZSA 2OG8A 2QOCA 1QPCA 4KRCA 3VRYA 3SGCA 4UMTA 3KRJA 4BWKA 2GMXA 2I7QA 2E9OA 4PNIA 4OT5A 4XG7A 3LCDA 3PVWA 5KCVA 3T3VA 3QQFA 4QMVA 3MFRA 2J5FA 3W8LA 1YI6A 3BBTB 4CLIA 1GIHA 4KABA 3DBFA 1Q41A 5EW8A 3GT8A 2B0QA 3IK3A 2YISA 2YWPA 3O71A 4YO4A 4ZZOA 4NM3A 4CYJA 3NS9A 5ANKA 3NIZA 3KL8A 5A4LA 4UZHA 4IVBA 1P4OA 1CMKE 2H96A 3MH1A 4DH1A 3E3BX 5GJFA 4BL1A 4BIBA 4UN0C 3FMEA 4IB5A 5HORA 4CGAA 2OKRA 2QONA 1OPJA 1GIJA 3FKNA 4D5KA 3CD8A 2YM7A 4QYHA 2ITUA 3CY2A 3G0EA 3GUBA 3MTLA 4JL9A 2X6EA 2C30A 2VWIA 2UZWE 3LFFA 2XUUA 3ODYX 1OVEA 3U51A 2BZKB 4HGTA 2BFYA 3BGPA 2FSOX 4RZWA 3LFNA 1QPJA 1M2PA 2PVNA 3Q52A 2ITOA 5E8YA 2XYUA 4QYFA 2Q83A 4BDAA 4PY1A 5GHVA 3GI3A 3LJ0A 3T3UA 4YTIA 2F4JA 2IJMA 5HVKA 4BKJA 1FGKA 3SD0A 3UMXA 5BQ0A 2V7OA 3KGAA 4PP9A 3G6GA 3BEGA 4E6CA 5IA2A 3EWHA 5TO8A 1UWJA 3QWJA 5C8MA 1JPAA 2X1NA 3E5AA 4OR5A 5I9ZA 4XP3A 4BCGA 3QGYA 3Q4CA 5IQBA 5LVPA 2C6MA 2VWYA 4FSRA 1S9JA 4R1YA 4YTCA 2WEVA 1BL6A 4AA4A 4UMQA 3GQIA 4G5JA 3ULZA 2C0TA 2X4FA 4GH2A 2IW9A 4JQ7A 5C26A 3P0MA 3Q60A 4FODA 4O7YA 2IVUA 4W4VA 3S4QA 4CRLA 1ERKA 5JFVA 1KSWA 1OKVA 4TWOA 1YDRE 2JBPA 5IISA 2P0CA 2R9SA 4QP9A 5KKRB 3DXNA 4PV0A 1M7NA 1WVYA 1E1XA 1H4LA 5CAOA 3NSZA 4I3ZA 4RMZA 1FVTA 2QO9A 4RJ6A 2W4KA 3HA6A 4JX7A 5ANEA 1PKDA 3IOPA 4BICA 4NW6A 5E92A 1J1BA 2XK8A 2YM3A 2XVDA 3VUKA 3QRUA 3LFBA 4M66A 4ZXTA 3RKBA 1WMKA 4P5QA 4BKZA 3TZ8A 4TTHB 4AS0A 2ITYA 3PE1A 3GU6A 4MXXA 4M3QA 4EBWA 2DUVA 5GJGA 2A27A 4NYEA 5IQCA 4LGDA 2ZV9A 4YZCA 4AUAA 5GNKA 1V0OA 2F7EE 1PXJA 2HW7A 2YFXA 4O0XA 5AV2A 3BU5A 2CSNA 5EW9A 4BKYA 1U4DA 3C5UA 5DPVA 2PL0A 3HDNA 5TF9A 4F63A 3ZONA 4A9YA 3FQSA 3PP1A 5HG8A 4A4LA 3OEZA 4FT7A 4CEGA 3V5PA 3EFWA 3O8TA 2I0HA 4LQMA 3PZEA 5LQFA 4FUYA 4C34A 3F5GA 4E5BA 3O96A 4QMZA 4EORA 5IQHA 5H8EA 4L52A 5B2MA 2PVHA 2UW0A 4ERKA 1NY3A 4LV5A 3FC2A 4FT0A 4MD8E 5K9IA 3HAMA 4D4SA 3PXRA 2UV2A 3NVKI 4M13A 4ERWA 2WQNA 3VUTA 4FGRA 3THBA 2VTIA 2F7ZE 1F0QA 3F61A 4FX3A 4L43A 3MFUA 3GXLA 4FOCA 4R77A 2WELA 3HECA 3KC3A 2BKZA 3MH3A 2J9MA 3OD6X 4EK8A 4OTIA 4KBAA 5FEDA 2CKPA 1U59A 3CGFA 3ODZX 4DTAA 2CKQA 4I92A 2ZB1A 3FLWA 4FNXA 1VYWA 3WYYA 3MPTA 5HTBA 4DFUA 2WPAA 3EH9A 3EL8A 4IAIA 2C3IB 2C3LA 1H08A 4H39A 4J98A 1YW2A 4FSYA 3Q9XA 2B54A 2Q0NA 3PZHA 4E4LA 2IPXA 4K0YA 4FG9A 1WZYA 3AT4A 4M69B 3BRBA 3TUBA 3EQBA 3L9MA 5FTQA 4AGCA 4BRXA 4CLJA 5H3QA 3VBVA 4NH1A 3GCSA 2CCIA 2WMQA 1BKXA 3OWKA 4BZNA 4EOJA 1SVEA 4DE4A 2NRUA 4L3PA 4YBKA 2WD1A 2QR8A 5BVNA 5TKDA 1ZRZA 1AQ1A 1AD5A 2HIWA 4P5ZA 3RINA 4UMPA 5CQUA 3NNUA 4QP4A 4J95A 4GVJA 4W4WA 3W2RA 1QL6A 2C6OA 1BUHA 2ZAZA 2XS0A 4M15A 3W8QA 3NCGA 5ITAA 2PTKA 3PXYA 4JLCA 5C27A 2OJFE 3DPKA 3LFQA 2VN9A 1Z5MA 3HMNA 3ORTA 4HGLA 1GZKA 4IIRA 3G33A 3NLBA 1JQHA 4D9UA 1PJKA 4FTCA 4RFZA 3HA8A 2VGPA 3LQ8A 3NAYA 4FIGA 4RX7A 1LEZA 4RLKA 3RWPA 4RIYA 3G0FA 3AT3A 3IOKA 4RWLA 4UYNA 5DI1A 4EJ7A 4MQ1A 2PMIA 2RFDA 3FI4A 4ITIA 4EC9A 1OM1A 2V0DA 3O23A 3QA0A 1TQMA 5I4NA 3CJGA 3RBWA 1V0BA 5EKOA 2XBJA 3R7YA 2ITZA 2BRHA 3DV3A 4BYJA 3MVLA 3MA6A 3R71A 1UV5A 4EOPA 2YLFA 2ZM4A 4PL5A 4NIFB 5CANA 1OBDA 4AQCA 1GAGA 2OXXA 3NNWA 4ZOGA 1LP4A 2WTIA 1YWNA 3DJ5A 3FMNA 5J79A 4D28A 4JR3A 3GB2A 4FV8A 5DEWA 5J8IA 2W5AA 3L1SA 1VEBA 2VV9A 2W1EA 2WU7A 4RJ3A 3A7JA 3VBXA 5K3YA 3CLYA 4GCJA 3FI3A 5HD7A 3R9HA 4GW8A 2Y4IB 4EOMA 4EUTA 3LXPA 4IAKA 2XRUA 2XKEA 2XYNA 1G8SA 2FYSA 2P33A 5KMOA 1W98A 2C0OA 5AP0A 5KBRA 2WQMA 4WKQA 2YWVA 4X3JA 5IG1A 2Y7JA 4R7BA 3ZO4A 4FKTA 3II5A 3GC9A 2BROA 1P4FA 4GT5A 4LG4A 4YPDA 3AMBA 3I6UA 5DLSA 5KZ0A 2R3IA 2X2KA 4IX5A 3FZSA 3O8UA 4ONAA 4BCIA 3NR9A 4D55A 3WIKA 5HG9A 3PLAE 1PKGA 3D15A 2QNJA 5HG5A 3KRXA 2YJRA 5HCZA 3SKCA 3DGKA 2F2CB 4YLLA 3DAJA 4U97A 3FY2A 4K8AA 3JS2A 4FKOA 4DGLC 4TT7A 1JKLA 1OL2A 5E8VA 1F3MC 3BHHA 4XG2A 4U79A 3QCSA 2OFVA 2PMOX 2R3FA 5ANDA 2UZEA 1PYXA 3ZUVA 2OJJA 5CZHA 4F6WA 1YDSE 4QYGA 3SXRA 3TKIA 4YMJA 4Y5HA 3VS0A 5AAEA 4EEVA 4LOPA 4O91A 4BDIA 3E63A 4ZTNA 4E73A 4BI2A 5I3OA 5HBJA 4NUSA 2R0IA 5M4CA 2WQEA 4G1WA 4KS8A 2BDFA 4RJ7A 1LEWA 4V01A 4F99A 4I6BA 3V6SA 4LRJA 4F9BA 4CCBA 5K4JA 3GFWA 5FM2A 4GEOA 4FTAA 3A7IA 2UW4A 4K9YA 2RG5A 2XKCA 2Z2WA 5EM5A 2R64A 1OKZA 3P4KA 1BYGA 4W4YA 5H8BA 3VBTA 4LRMA 3G90X 4FIJA 3OUKA 4FICA 4LUDA 4UV0A 5LVNA 2UZOA 4I0SA 2PVRA 3FSKA 3DKCA 4HCUA 4BI1A 4BCKA 5IF1A 1YXXA 4RJ5A 2R3KA 3QBNA 1H1PA 3RPVA 4ZTLA 1XHAA 4RVLA 4XG9A 4MNEA 4O0VA 3UIBA 5AAGA 3DA6A 2EUFB 2BR1A 1YHVA 3CEKA 5BUEA 3EJ1A 1JVPP 3E88A 4DT9A 5EM6A 3P7BA 3QA8A 3A7HA 3KULA 4PWNA 3CE3A 4PDOA 3E8DA 5EYDA 4DEDA 2V7AA 4E3CA 5HLNA 3R22A 5E8XA 3DS6A 3CPCA 1Y91A 3BHVA 4X21A 1E9HA 3M42A 1BX6A 4QYYA 4IM0A 2PU8A 4ZSEA 3UG1A 3QXOA 3VVHA 3KXHA 4C62A 3PTGA 1XWSA 2C1AA 3E93A 3OTUA 4CQGA 4I4FA 4ZY5A 5M06A 2QVSE 5I9VA 3VS2A 2XNGA 5M09A 4WG5A 1YHSA 2QOFA 2R3NA 5CEKA 4CD0A 5HX8A 4BDHA 4E6QA 2B52A 3IO7A 4WUAA 3SW7A 3R63A 4O1OA 2X2MA 3OBJA 4TWNA 4I0RA 5AV3A 1KE7A 5FRIA 1OIUA 5CVHA 5DR2A 3P78A 2W1FA 4MKCA 4D9TA 3P7AA 1QCFA 3ANRA 4IANA 3BE2A 3C4XA 5CF5A 1STCE 4FZFB 1RW8A 1YVJA 5C8NA 3ENMA 4IAAA 2OGVA 4F0FA 3G2FA 4ZTRA 5AUVA 2VO0A 4Q9ZA 3RK5A 5HESA 3ETAA 3DZQA 3FPQA 3SG9A 3ID6C 1DS5A 3PY0A 5LMKC 4XS2A 2HY81 4U81A 3I0OA 4I20A 4XV2A 4E5AX 2BZIB 2RFNA 3OWLA 3ORXA 4GJ2A 4PL4A 4FV1A 4HYHA 2DQ7X 4ASZA 2NNWB 4ZY6A 1YI3A 3QZFA 4LRKA 2Q0BA 2QOQA 2GS6A 3AMYA 4UWCA 1GZNA 1FINA 3W2CA 3NGAA 3EQPA 4YUQA 5BVWA 4IB3A 4S31A 3G9NA 2C1BA 3M2WA 4ID7A 4IFGA 4TWCA 4FYOA 4ASEA 2PY3A 2FUMA 4DH5A 4FI1A 4JNWA 3ERKA 4BCOA 2XF0A 2W1ZA 4KWPA 2IVVA 3N4UA 2IN6A 5KHWA 2C3JA 3BBWA 4AOJA 2Y6MA 3ANQA 2GNLA 4ACHA 3BV3A 2PK9A 1UU8A 3P7CA 4EOLA 3VW8A 4TYEA 4C4IA 5CALA 4ANOA 3VAPA 4DBXA 4F0IA 1Y8YA 3BHTA 4FR4A 5L6PA 1M52A 3PXQA 3QTRA 3QTUA 4GK4A 3OS3A 4KKEA 4LOOA 3FMKA 4QNYA 3TIYA 4DFZE 3TN8A 5A4QA 2PSQA 4FT3A 4GYIA 3RTPA 3ULIA 2BAQA 4DEHA 3CP9A 1OL7A 4WSYA 4LFIA 4IQ6A 4L53A 5FBOA 5EM8A 4YNOA 4BIEA 3BYVA 4FG7A 4Y95A 1F5QA 5IUHA 3N9XA 3R2YA 3KCKA 4L9IA 4CZUA 2CJMA 5M56A 4DFXE 4WNMA 5LOHA 3UZTA 5A9UA 4CFXA 4GS6A 5T6KA 4DLJA 5CU3A 4FZ6A 4WNPA 4ZTSA 5BNJA 3PY3A 5H9BA 4ZAUA 4J96A 5EHLA 2A4LA 3CKWA 3O7LB 5J5TA 4ZY4A 2DYLA 2J51A 2GHGA 1XJDA 4S30A 3MDYA 3A2CA 4FV4A 3E8NA 1P2AA 3D5UA 2ZJWA 3SXSA 3MYGA 4CFMA 4U42A 2C6TA 4GKIA 3Q4UA 4QP3A 3OCSA 4YJNA 4JBPA 3PWDA 2BPMA 2BDWA 4IM3A 4YZNA 1WBNA 2OLCA 3KFAA 1FPUA 4R5YA 3A4OX 4BDGA 4DA5A 2RFEA 4RWKA 4RQKA 4MWHA 3A61A 3KN6A 4D2PA 4M7IA 4N6YA 2GQRA 4MF0A 4ANNA 4OTPA 3WARA 2B9HA 4FEQA 3UO5A 5GJDA 4QMWA 3GEQA 1OITA 3JY0A 3POZA 2O64A 4RC2A 2IW8A 4ZZNA 3QCXA 3A4PA 1RDQE 3OZ6A 5G6VA 4AZFA 4MF1A 4WBBB 4EH3A 1ZARA 4NCTC 4UWBA 5ACKA 4YJPA 4E4XA 3F2AA 4BYIA 4FV7A 4YO6A 2X9EA 3SRVA 3ZRKA 1KOBA 4N57A 3BX5A 4QTAA 1H26A 2GS7A 3T8OA 4ALWA 4H3PA 1B38A 1WBOA 5HE1A 3R7OA 1ZYLA 4C8BA 2XB7A 3V6RA 1UU9A 1Z57A 4C3RA 3KY2A 4G34A 4F08A 1NXKA 3VS4A 4DLIA 1PXIA 5A14A 2W1DA 5IEYA 1LR4A 2VX0A 4DH7A 3C1XA 4BDKA 3FC1X 4OGRA 5L2TA 4AP7A 2VTQA 4B99A 2BIYA 3LCKA 2PMNX 4V04A 4GG7A 4I94A 2XJ2A 3RJCA 4GFOA 3C4ZA 3GOPA 4JDJA 5EI6A 5AJQA 3KMMA 4FSMA 1SZMA 4FEVA 4O81A 1CTPE 2ITTA 5KE0A 4W8DA 4ACMA 4W4XA 4BZDA 4UMRA 4EKLA 3DBCA 3ZEWA 3MH0A 3QX2A 4EOIA 1XH7A 4A9UA 3CD3A 1G8AA 1JKTA 3EFKA 1UNHA 4U44A 1SNXA 3R7EA 1JSVA 3UMWA 5L2QA 1Z9XA 2CNQA 5BVDA 1Q99A 4S32A 2W1HA 3BWJA 3O2MA 5C03A 3V5TA 3CQWA 4ZJVA 4DT8A 2JBOA 3HV7A 3BGQA 1Y6AA 3D5XA 2YAAA 2OH0E 4O21A 4U80A 4Y73A 4KINA 4ARKA 4AA5A 1A48A 5JKGA 2BUJA 2BFXA 3UO4A 5LWMA 1PMVA 5C4LA 4GIHA 3QRIA 4RBLA 3FLSA 3F5PA 3Q6WA 5C8KA 3UVRA 3R1YA 5F9EA 2R3JA 5DYJA 1PY5A 4GU6A 4IXPA 1KV1A 2XK6A 1FMOE 2YIWA 3NYVA 4HPUE 2JDRA 5JN2A 2V5QA 5AP7A 4LGGA 4AT4A 3PJ2A 1KE8A 5FLFA 4YBJA 3GCUA 4GUBA 5HKMA 2HZNA 1AGWA 2QOIA 3HRCA 1W83A 5JMSA 3H0ZA 4OT6A 2OF2A 1LUFA 2VO7A 4PL3A 5CAVA 2GHLA 1I44A 1UKIA 4J97A 3KVXA 5JH6A 3UPZA 3SOAA 3VUHA 4AGUA 3R04A 4GT3A 3LIJA 2OXYA 2GPHA 3R73A 4FKLA 2B9IA 3QCYA 2WTDA 5AV1A 1SVHA 3F82A 3DDPA 3MA3A 4R78A 4QMTA 4B4LA 4CTBA 5FM3A 1ZAOA 1TQIA 3F3UA 1NVRA 2IO6A 4F65A 1MRUA 4BVUA 2ZV7A 5CEIA 3WF8A 2XNNA 4O7ZA 2WO6A 1HOWA 4YLKA 3TDWA 1YQJA 4L46A 4HYUA 4RIWA 4TNBA 4C3FA 4D4VA 4L42A 1APME 4C3PA 3S3IA 3ZXTA 4D0WA 1YOMA 2QKWB 4AW1A 5CT0A 1REKA 3VJOA 2J0JA 2EXCX 2VNYA 2B55A 3DQXA 4FTTA 4GSBA 3TNQB 3HX4A 4DG3E 3VS3A 4F1OA 4EHZA 3TDVA 4FF8A 1B6CB 5FXQA 2WB8A 2SRCA 3QD4A 2C5VA 1TVOA 1URWA 2HYYA 5FWKK 4QP7A 4Z16A 3FLZA 3PSBA 3HRBA 3LJ2A 4FV5A 4C37A 2PVYA 4ANQA 2CN5A 3H0YA 4NM7A 4X2JA 4EK5A 2WEIA 3AD6A 3VHEA 1PXKA 2QQ7A 2EB2A 2R4BA 1OPKA 2Y4IC 5KMKA 4FSQA 3R9NA 4LV8A 4ZIMA 3MFSA 4B8MA 3TI1A 3EN9A 3MWUA 4G3FA 5LXMA 3K5UA 4MD7E 1MRYA 3DKOA 3UVPA 3ZXZA 2RL5A 1OL1A 3VQUA 3R2BA 3JVSA 1R0PA 1ZMWA 4FIIA 4WG3A 5CEPA 4FV3A 4CXAA 5C1QB 1WCCA 3LVPA 3AMAA 2X6DA 1WVXA 2YIRA 4FT5A 2W1IA 3TV4A 3R7VA 2VWBA 3ZUUA 3FXZA 4ACCA 1Q8YA 3AC3A 3QX4A 3D5VA 4XOZA 3JR1A 2GNFA 4E4MA 2QOOA 4AN9A 1YXSA 5LWNA 2VWVA 4DHFA 3NIEA 1IAHA 3TT0A 2O0UA 1YRPA 3K2LA 4FC0A 4S33A 1ZYDA 3SVVA 2J0LA 4X2GA 5KMIA 1M14A 5M4FA 1UU3A 5IH5A 3OW3A 4UEUA 2VTHA 5CNOA 3VBQA 1HCKA 4BHNA 2UZBA 3IS5A 3U4WA 1XH9A 4EH6A 3PA5A 1OIYA 2C3KA 4EK6A 1XQZA 2ITVA 2YN8A 3QHRA 4JBVA 3LE6A 3MVHA 1GJOA 4J8MA 2J50A 4XBRA 2QCSA 3QLGA 4F9YA 5AUTA 2YZLA 3H9OA 5HEZA 3B8RA 4YJUA 1KE5A 3CXWA 4C4FA 3HUBA 2W1GA 3PXFA 3FKOA 3I1AA 4O6EA 3QU0A 4I6QA 1H0VA 2AC3A 4EH8A 3OXIA 4FE2A 5KNJA 2W1CA 1UKHA 3I4BA 2I0YA 1B39A 3I81A 4FSWA 1M2RA 4NTTA 2GQSA 4FEUA 5DGZA 4MQ2A 3ORIA 4AOIA 2VZ6A 2HCKA 1H00A 4FOBA 4MXCA 5B7VA 3QKLA 2OXDA 4IZ7A 3LM0A 4TW9A 4C2VA 3D9VA 4JG6A 5LARA 4NM0A 1ZY5A 3DU8A 4TL0A 2Y9QA 4NFNA 4RLLA 3RPRA 5IPJA 4CG9A 2JITA 2PHKA 3QUDA 3UVQA 4BWXA 5LVLA 4ZJJA 4U8ZA 2PZPA 4UXQA 3IG7A 3RM7A 2BHHA 2HAKA 3UO6A 4DEAA 3EMGA 4I5CA 3A8XA 3D7ZA 2Y4PA 4KIPA 5DA3A 3V5JA 4UMUA 4F70A 3CJFA 3MY5A 3P79A 2JGZA 3F2NA 4A07A 4ZEGA 4BDFA 3QC4A 2PULA 4BR3A 5M44A 2C6IA 2G2HA 2YIXA 4DBNA 3Q5ZA 4O82A 3UZPA 4FZDB 5IKWA 5AP3A 3TUCA 2W0JA 4IB0A 3RGFA 2PZIA 2IZSA 4I41A 5AA8A 4M84A 3LFDA 4EH4A 2IVSA 2IVTA 2XK7A 4QT1A 1WFCA 3LFEA 4MXAA 5HHWA 3VS5A 5E4HA 1Q62A 2ETMA 2P2HA 3FE3A 2WMXA 3VF9A 4A7CA 2BHEA 5FXSA 1ZYSA 4CNHA 5IMEA 2GFSA 4HJOA 1IR3A 3F7WA 3E3PA 4L01A 4YLJA 5D41A 3EQIA 5D7VA 4QP2A 3NUYA 3OTVA 3R7GA 4RG0A 3NW7A 4TYHA 5FG8A 2CGXA 3W1FA 3W2PA 2Y0AA 3I79A 2C4GA 5JGDA 3KCFA 4DEEA 4DEIA 4WT6A 4DFYA 4XRLA 4CTCA 3HLLA 1JLUE 3KRWA 3W32A 3U6HA 2WXVA 2I0EA 1A06A 2WTKB 4IWDA 3AG9A 4N0SA 4YR8A 3BPRA 3TNHA 5JT2A 2YIQA 5KMMA 3VUMA 1IA9A 4FSUA 4E8AA 4AOTA 1JOWB 1MUOA 3AXWA 2ZMCA 3BV2A 5EYKA 4BHZA 5M57A 3I0QA 3IW5A 4RJ8A 4X3FA 2V62A 5JRQA 3GCVA 3LPBA 4UWYA 4NWMA 4JG8A 5A54A 5KO1A 1VJYA 1H27A 5CT7A 5H2UA 3UOJA 1W8CA 4A9RA 4MNEB 1GZOA 2XRWA 4BBEA 3GFEA 4E1ZA 3TV6A 5B0XA 5AIRA 4WD5A 4W8EA 4O0WA 3QZIA 3A7FA 3KXMA 3TWJA 1UWHA 5HIEA 5L6OA 4CKIA 2ZVAA 4L8MA 3IGGA 3DKGA 3ORKA 5A6NA 1JAMA 3QTSA 4WG4A 3CTJA 2J6MA 4HYIA 4YPSA 3DK3A 3AC8A 4R6VA 4UZDA 4PMPA 2PVFA 2WQBA 2WTWA 3PIYA 5DHJA 3EKKA 4ANMA 3FL5A 4JIAA 4L7FA 1XH4A 2UW3A 3HV6A 2Y8OA 3DB8A 4TKSA 3QUPA 4BCFA 1H25A 5L3AA 1R0EA 1H07A 5BVOA 2HWOA 3LXKA 4YZBA 4D2SA 3DZOA 3QKMA 2QLUA 3QCQA 4Y83A 3S00A 2OIDA 4GUEA 3TZ7A 3MN3A 3OCBA 4DTKA 1REJA 2X7OA 4FZAB 4D2VA 4YC8A 3KB7A 4FT9A 4RRVA 2VNWA 4WRGA 4O0RA 1HCLA 4RA5A 1SNUA 4QO9A 3R8ZA 4O38A 4QP8A 3QD2B 4DTBA 1J3HA 2EXMA 1O9UA 3FQHA 4D2TA 3OHTA 3R8PA 1VYZA 4BF2A 4ZLOA 3H3CA 5CASA 2VWUA 4XLVA 4C33A 3GC0A 3NUXA 4CFWA 5BMSA 5L6WL 2ZB0A 4GL9A 4IAZA 3BWFA 5IDPA 3UQFA 2I6LA 2PPQA 4OAVB 3FMHA 5AV4A 1KWPA 2ZDUA 4NU1A 4AN3A 3MBLA 4BCQA 1YWVA 2W5HA 5BX0A 4E93A 4O83A 1MQBA 3S95A 4EHEA 4USEA 3CTQA 5CXZA 3PXKA 4PMSA 4DEGA 1IASA 3REPA 3V5QA 4M0YA 4OBPA 5DN3A 3R7IA 4PNKA 2QODA 3GOKA 3Q9WA 3R8VA 3TCPA 3AD5A 3VW6A 3B2TA 3C0HA 4QTDA 3UPXA 4GKHA 5GINE 3PSDA 4MH7A 4BDJA 4ENYA 4P2KA 5D9HA 4YJQA 5DRBA 3RM6A 3D14A 2P55A 1Q8WA 5E8UA 5HVYA 1TQPA 2NRYA 3V04A 2ZM3A 4FUXA 4RC4A 3ZLYA 2XKDA 3Q4TA 4X0MA 4EH7A 3COHA 4DGNA 3BQCA 4U7ZA 2E9VA 3UP2A 1QPDA 4MXZA 2AYPA 3PPKA 4WNKA 4E26A 5AR7A 3PG3A 3FQEA 3U6JA 5JRSA 2BRNA 1PF8A 4KBCA 5BVKA 4EOOA 5EDPA 1OZ1A 2AUHA 4FNWA 4BB4A 3E62A 2HY0A 5KZIA 5D7AA 3ORNA 2QOHA 2X7FA 4RWJA 4Y46A 4F1MA 4CZYB 1H8FA 2H8HA 1XO2B 3DBEA 3RK7A 4D1ZA 5BYZA 2F57A 4PMMA 4AG8A 3SX9A 4IB1A 1PXNA 3KMUA 4IDTA 4Q2AA 5FGKA 5L4QA 3ZO3A 4MNFA 1U5QA 5K0KA 5CENA 1IRKA 3NUUA 3ZFYA 1TKIA 4JAJA 1FVRA 2FGIA 3H9RA 2YJSA 3LCOA 4LL0A 5DE2A 3AC5A 4XG3A 2ZM1A 4DCAA 2IZTA 3CY3A 3NDMA 3D0EA 4RIXA 4FL2A 4Y85A 3TZMA 4L3JA 1Q4LA 4MVFA 3RPYA 3W55A 3DJ6A 3FI2A 4FGBA 4EZ7A 3BLQA 4RVKA 2RG6A 2WMBA 2VTSA 4FIFA 4Y8DA 3MH2A 4AE9A 4JBQA 4LL5A 4CFVA 3GC8A 3C4CA 3OOGA 2WIHA 4NM5A 5AUYA 5HTCA 2JLDA 1YHWA 4AWIA 3L9NA 3DBQA 2GNHA 3LXLA 2BVAA 5HNGA 1QMZA 4TYJA 1XH6A 5AAFA 4FMQA 3KXXA 3FI8A 2GQGA 3LMHA 2B9FA 2RSVA 3PXZA 4C2WA 3GCQA 1WAKA 3M11A 4YP8A 1DI9A 5FP6A 3D2KA 2R3RA 2YACA 1OUKA 5A6OA 5HCXA 3SRVB 3ATTA 2X4ZA 4FKUA 5AR3A 3LOKA 3BHUA 3LQ5A 3TNIA 3A60A 4H1JA 3LM5A 4L45A 4OTFA 4D5HA 5M08A 3HV4A 3FZ1A 3AC2A 3KVWA 1OPLA 5EK7A 3AGMA 4PPBA 3MPMA 2JIIA 4YJTA 3RAWA 3QD0A 4LMUA 3DTWA 2RGPA 3NYNA 4BGQA 2O8YA 3LMIA 2B53A 2VTNA 2LAVA 1J7IA 2WOUA 3CGOA 4KS7A 4FV0A 2UZTA 5AEPA 2XJ1A 4BTKA 2OJGA 3I7BA 3QQLA 4EYJA 5BMMA 1W0XC 4EK3A 4F4PA 5CY3A 3UC3A 2JAVA 1YI4A 3DDQA 4EKKA 2YEXA 5AWMA 2FO0A 5DWRA 2F49A 4O7WA 2VO6A 3F7ZA 4NJ3A 4AA0A 2YCSA 3MY1A 2OZAA 4DH8A 1RQQA 5HLWA 3SG8A 3FYJX 5L2WA 3BELA 3DOGA 4YSMA 4O7TA 2HELA 3IW6A 4DFLA 5ANOA 4XV1A 3OY1A 4GMYA 4L44A 4FTIA 2V55A 4C59A 5ANJA 5IA0A 4UALA 4KNBA 1MRVA 2QHMA 5F1ZA 4RA4A 4Z55A 2VUWA 4BTFA 2PVKA 5D1JA 1XBBA 5D11A 4J99A 2W06A 3HEGA 5E8SA 3R9DA 4NCTA 2Z02A 2C69A 3GQLA 4NEUA 3NMUF 4EK4A 4QTEA 4FTNA 4IM2A 3OFMA 2YM5A 1MP8A 3N51A 3CS9A 3ITZA 2ITWA 3ZUTA 2PE2A 2JEDA 4AAAA 3OWJA 4IZYA 4JJRA 3L8SA 5IEXA 3A99A 2VAGA 2NO3A 3DK7A 4G2FA 4OTDA 2QOLA 5CAQA 2GFCA 2XP2A 2PUIA 2XNMA 2CPKE 2Z8CA 1OB3A 3EFJA 4PUZA 5A46A 3LAUA 3RVGA 2R3QA 3ZDIA 4K33A 5ANGA 2HOGA 4FBXA 2CLQA 3FMLA 3W10A 1PXLA 2E9UA 2H9VA 2UW8A 4FKRA 3GENA 4BDCA 4ANLA 4CKJA 3ZZWA 4OBOA 3UIXA 4TYIA 5BUIA 4BFMA 4F7LA 4EQUA 4HW7A 2YLEA 4B0GA 1J7LA 5HIDA 2XKFA 4QQ5A 4C02A 5EQPA 3FLQA 4LOQA 2ITXA 5TT7A 2ONLC 4UY9A 3ZDUA 4LGHA 2QO7A 2XK3A 2C6LA 3MIAA 5LMBA 3EOCA 5IUIA 3R8UA 4EI4A 3R00A 4EQCA 3A8WA 4JDKA 1L3RE 2W4OA 4QPSA 4CMOA 2IW6A 3UOHA 2JKMA 1DAYA 4RIWB 1ZMVA 3UIMA 5TR6A 2E9NA 2FSMX 4JRNA 2XH5A 5H8GA 2UZDA 3Q5IA 2CGUA 2WOTA 4DFNA 2QI8A 4EUUA 3UGCA 5J95A 4O0SA 4QQJA 2Z7SA 3Q2MA 4K77A 3F3TA 3VUGA 2VTTA 2PUPA 3LKMA 4OTHA 3OG7A 3O0GA 3L9LA 4O84A 4BCJA 4JIKA 3FBVA 3WIGA 3ALNA 2FB8A 4QPAA 2QU6A 2XM9A 3G51A 4MXYA 3HMOA 4HYSA 4J52A 4F9WA 5A3XA 3VHKA 3D7TB 5F4NA 3FYKX 3L9PA 4IX3A 4UX9A 2J0IA 2OJ9A 1Q24A 2R2PA 3O17A 3OBGA 3D4QA 4H36A 5CX9A 2JDSA 5IQFA 3VQHA 4B8LA 5E9EA 4E6DA 2UW5A 3DFCB 2XIZA 2J0KA 4G31A 4G9RA 4IJ9A 4TWPA 4BZOA 2PMLX 4E6AA 3C7QA 5DR6A 3VIDA 4OBQA 2ITQA 3RP9A 3QTIA 3SDJA 4YHTA 5DIAA 4XV3A 5AMNA 3JUHA 2QG7A 2C0IA 4F7JA 4FKVA 1L8TA 4JOAA 5AP4A 3DT1A 3WILA 5L8JA 2GS2A 4L00A 2XA4A 4G3GA 2QURA 3BQRA 4YZ9A 4Z7HA 2PUUA 4CFNA 3C0IA 2PVJA 3BU6A 4K2RA 5EQYA 2YCRA 3MS9A 4JI9A 2Z7LA 4W9WA 4NKAA 4XMOA 3OVVA 4XG6A 4YSJA 3I60A 4LYNA 5E1EA 2CHLA 1CDKA 1DI8A 2BCJA 4U45A 2A2AA 3RAHA 4EZ5A 5IH4A 3JPVA 3CKXA 3HKOA 1ZLTA 2C5NA 3NPCA 5CF4A 3TJDA 3CCNA 5IQAA 3IGOA 3EYGA 4KIKA 4NIFA 4JS8A 4AACA 3R21A 3OY3A 2GTNA 4KA3A 5E91A 4QTBA 3KXZA 2CNUA 3P5KA 4XOYA 2VX1A 4DN5A 1A9UA 3L8XA 4EL9A 5KKRC 4J8NA 3O8PA 3KRRA 3NNVA 3WZKA 1BI8A 5AUXA 3R8MA 4HZRA 5CWZA 4ZTQA 3WF7A 3EIDA 3E8CA 4X6RA 2VTOA 4BDDA 3UNZA 2VTAA 2YERA 4R3RA 2WMTA 2WTKC 4ZLYA 4YJSA 3DXQA 5GZ8A 1R1WA 4XLIA 4B6LA 4RVTA 4YNEA 2UZVA 1JSUA 3CC6A 3M1SA 4YJRA 3ZZEA 3QUEA 2UZNA 4DG2E 2XCHA 5EW3A 4S2ZA 1XR1A 2O65A 1VZOA 2XNEA 4IADA 5CSWA 4CG8A 4AFEA 4NZWB 3HP2A 5GIPE 4H3BA 5E8WA 4IWOA 2WMSA 2WTCA 4QP6A 3VBYA 4P90A 3BCEA 3IKAA 1KE6A 2VWXA 3NYXA 3UP7A 3KU2A 4ACGA 3SC1A 4UBAA 1J1CA 4YURA 5ETFA 3U4UA
chains in the Genus database with same CATH superfamily
1OUYA 4WOVA 4ZSAA 1OL5A 2X0OA 4XNEA 3OC1A 3V5WA 5HD4A 3IW7A 3MW1A 2YABA 5K5NA 5DRDA 2J0MB 2XM8A 1GNGA 4MEDA 4EOSA 4EWHA 4QD6A 5IDNA 3PA4A 3PYYA 4QMLA 4YTHA 5BYYA 4AAYA 4GYGA 3QWKA 4H05A 3U54A 4PF4A 3P08A 4GT4A 3QYZA 5IQIA 3W2SA 4CCUA 3ZMMA 5ANIA 5CF8A 3QL8A 4C4GA 3LJ1A 5M4UA 1KE9A 2G9XA 3NUAA 1RE8A 5FP5A 4BI0A 4DGMA 2ZYBA 3S0OA 2H34A 3ACKA 5BVEA 2O3PA 3MV5A 4NTSA 3BL9A 4DC2A 2VWZA 3EHAA 2REIA 4B9DA 4X2KA 2DS1A 3QRKA 3R9OA 3PPJA 4AX8A 1XH8A 4DCEA 4TYHB 3K3JA 1XBCA 3I6WA 4FV6A 5J9LA 5JQ8A 2HXQA 1DAWA 2O63A 5HBHA 4E4NA 3KIOC 2UVXA 4WNOA 3AT2A 3GCPA 3PY1A 5JZJA 3PLSA 2WNTA 4LMNA 3PJCA 2YIYA 3UNKA 4FIHA 2VD5A 2FA2A 5CXHA 2C6KA 3PWYA 5M07A 4CFUA 5HI2A 4O7NA 2CMWA 3ORZA 4R3CA 3OF0A 4QQTA 2NPQA 4X2NA 4FKSA 4G3DA 4X3FB 4BJJA 3UE4A 3BI6A 4MXOA 2ACXA 5CSXA 4KSQA 1NW1A 4XCUA 4EOQA 1Y57A 2JD5A 2PWLA 2X8DA 4IC7A 4C4JA 5JSMA 3FZTA 3FDNA 1P14A 4LUEA 2BKKA 3ZM4A 1UNGA 4F9CA 3FJQE 4IH8A 1YDTE 4O4FA 4DAWA 4K11A 4BDBA 5J5SA 4V0GA 4PX6A 4DINA 5DG5A 3IDBA 4HVSA 2FH9A 3FL4A 3QFVA 4ANBA 3F2RA 4NJDA 3UIUA 1Q3WA 2QO2A 2C6DA 4R7IA 3Q4ZA 3MVMA 1CKIA 3OT8A 3OXTA 1I09A 2ITNA 3DAKA 2HZIA 4HGEA 2B9JA 1XBAA 3AKLA 3O50A 2IZUA 3EQRA 1UA2A 4O27B 3NUNA 2GNJA 1CKJA 4GFMA 5FUTA 4QMUA 4N6ZA 5CVFA 4CMTA 2JDVA 5A4EA 4KB8A 2X39A 3TUDA 4AGDA 3TM0A 3FKLA 1O6YA 4G6LA 5M51A 4IZAA 2OIQA 4AQKA 4HVHA 3ZU7A 5EI2A 4APCA 2ERKA 3CBLA 3RZBA 5CU6A 2W17A 2OU7A 2RFSA 3QC9A 1SM2A 3KK8A 3SW4A 3KA0A 4BC6A 2NP8A 2WMRA 2WTJA 3C50A 3ZSIA 4ALVA 4KIOA 4DG0E 5L2SA 4CV9A 2HWPA 3AC1A 4KIQA 4PDPA 3RK9A 2GTMA 4F7NA 4A9TA 3BHYA 1JBPE 2HENA 4FTQA 2C6EA 3ACJA 2XIRA 4BCHA 5HGIA 3S1HA 5FTGA 2FVDA 3HMPA 2XK4A 3BZ3A 3ZSHA 4MCVA 1ND4A 4FL3A 5IQGA 1FVVA 3F9NA 3PSCA 2X8IA 3KREA 4M14A 4MWIA 4O96A 2CLXA 5JFSA 4FTJA 4FTKA 2JFLA 4F78A 1CM8A 2GNGA 1SMHA 3PE2A 4IVCA 2RIOA 2YDIA 1YXUA 2BDJA 1WBSA 3W18A 2VTPA 4XX9A 3ZLWA 4JG7A 4F1TA 4ORKA 5HCYA 4HZSA 5IUGA 2CNVA 3TNPC 4FSZA 5IA5A 3O51A 4I4EA 4APPA 5FQDC 4CMUA 3KXNA 4OW8A 4U43A 3VRZA 3B2WA 2CDZA 3PVUA 3R1NA 4RIYB 4RGJA 1W82A 5CAUA 4QNAA 2H6DA 2XEZA 3VBWA 5CF6A 3PRIA 5CZIA 4D2RA 5IA3A 4Q5EA 1GOLA 4RVMA 5J87A 1G3NA 3ENHA 3KF7A 5EYMA 3QQUA 4WSQA 3SOCA 3VUIA 3BGZA 1FGIA 4WBOA 4USFA 3DBDA 4IACA 4Z3VA 4TXCA 5K5XA 3JYAA 4Q9SA 4H1MA 1U54A 2O5KA 3IPHA 3F66A 3HVCA 4U0IA 3E7VA 4U40A 1PXPA 4AN2A 1ZZLA 4KD1A 4XH6A 4XUFA 4D0XA 4QMOA 4QOXA 5M4IA 3SQQA 3AOXA 4NKSA 3NCZA 2W9ZB 1OIQA 4M97A 2R3GA 4AF3A 3TKUA 4F64A 4C4HA 2P3GX 3ZO1A 4OUCA 3P5JC 3LFSA 2WMVA 2WFYA 2Z7RA 4GFGA 5D10A 3W0SA 4YZDA 3RAKA 4RIXB 2J5EA 2FSLX 3QHWA 4XRJA 4C58A 3WZJA 3DXPA 4BCNA 3R83A 2QR7A 5EFQA 4IWPA 1PYEA 4C0TA 3FPMA 2AC5A 5J7BA 2QC6A 4MBIA 3LZBA 1OGUA 3BYMA 4IAFA 5CLPA 2F2UA 2JKOA 3SLSA 3MTFA 4PMTA 4A4XA 4F9AA 5BV3A 1OECA 4L67A 4I1ZA 1OGYA 2ZMDA 3KXGA 5EDRA 3UOLA 3FEGA 5J7HA 3DY7A 5JFXA 3Q2JA 5EQEA 5GIOE 3DFAA 5M53A 2OJIA 2HZ0A 3RAIA 3NUSA 3SXFA 3MIYA 3CR0A 4ZZMA 3W2QA 3NEWA 5EI8A 4AGWA 4AE6A 4YTFA 5JK3A 1FOTA 3PG1A 3KEXA 1BI7A 2BAJA 3C4FA 3FLNC 3COKA 5K0XA 2ZOQA 4QP1A 2PYWA 3F69A 5CSHA 5GZ9A 2IZRA 3C0GA 3PPZA 4FYNA 3NVMB 4F09A 2O2UA 3RZFA 3CQUA 4I6FA 2ZV8A 3CTHA 5HO7A 4FL1A 4WA9A 4I21A 3LCTA 4MK0A 3BKBA 4XP0A 3U9CA 5AR8A 2X81A 4JRVA 4EQMA 3FV8A 4J7BA 3RNIA 3F3VA 3NW5A 5HE2A 4BCMA 4RJ4A 3NZ0A 3P23A 3EKNA 4ZS0A 3TZ9A 1UVRA 4IVDA 3FUPA 4N70A 5I9UA 4LV7A 2Z60A 5AA9A 3ZBFA 3IECA 4IEBA 4FTUA 2WQOA 1FBNA 2R0UA 4IDVA 2XCKA 3EQGA 1ZOEA 3R28A 4PTGA 3RI1A 2PE0A 2OZAB 1CKPA 3GC7A 2XIXA 4FKPA 5IH6A 2G01A 3VO3A 5E1SA 5EHOA 5CSVA 4F6SA 4XEYA 4YC6A 2YM8A 4BY9E 3V8TA 5IEVA 2YM4A 3PVGA 3FHRA 3OWPA 1X8BA 3FWQA 3QGWA 5BVFA 2C5YA 5T3QA 2JIUA 3MB7A 2BILB 1IEPA 4HCTA 1SVGA 2QKRA 2VTRA 4GJ3A 3WF9A 4X7QA 5LVMA 3WF6A 3QRTA 3KULB 2R3LA 3GU7A 3UQCA 3ZM9A 3LLTA 2J7TA 4RC3A 2ESMA 3TTJA 2GDOA 4RQVA 5I9YA 2BMCA 2OI4X 4KAOA 3AC4A 2CKOA 4QMSA 5AP2A 3CQEA 4R1VA 4D4YA 2JC6A 3FHIA 4H58A 4IHPA 4PPCA 4PRJA 3GNIB 4HNIA 5DEYA 4QMMA 3W0RA 3QQKA 2G1TA 2XNBA 2G2FA 3HV3A 5L8LA 4NW5A 2J4ZA 3R0TA 4EHGA 3IW8A 4O22A 1BLXA 4IVAA 2EU9A 3K3IA 3RWQA 5EKNA 3PIXA 2BRMA 4MD9E 3QAME 5BYLA 5DR9A 3CSVA 1J7UA 2RKUA 4M0ZA 4CVAA 4I22A 3DQWA 3QXPA 4BGHA 5HX6A 4M8TA 2RF9A 3IW4A 4MYGA 3W16A 2YHVA 1KUTA 5FEQA 2VWWA 4BIDA 3DTCA 1WBWA 3WZEA 1JSTA 3P1AA 3KMWA 4YHJA 1W2DA 3WOWA 5IQDA 2WKMA 5HQ0A 3EFLA 3ZTXA 1V1KA 1PHKA 1O6LA 4UXLA 4DYMA 5BUJA 1W7HA 2YM6A 3DK6A 5HE0A 3QQJA 1V0PA 3OROA 2W96B 3UODA 4C35A 1PMUA 4MUQA 2ZDTA 3UQGA 4C38A 4FVPA 4BTMA 4H3QA 2PVMA 3OXZA 2QD9A 2IWIA 3ZCLA 5FTOA 4ZMEA 4TZRA 2I40A 2JDTA 4D1SA 3R01A 1H1QA 2BZJA 5M55A 3OCGA 3BEAA 4PP7A 5KMLA 4XJ0A 3TEIA 3EN6A 1PW2A 4HCVA 4GRBA 3RHXA 2PZ5A 2PZRA 4FTMA 2W4JA 4AT3A 4BTJA 2X7GA 1Y8GA 2ETKA 4II5A 4L3LA 4EH9A 4ZJIA 5EHYA 1ZY4A 1PMEA 5GZAA 2JFMA 4FKQA 3RPOA 1FQ1B 3MFTA 2CGWA 4O0TA 5HBEA 4YHFA 4QYEA 3ATSA 5J1WA 3UYSA 4D2WA 4KUJA 2R5TA 4K1BA 4G6OA 4O1PA 5A4CA 3C9WA 1XH5A 2B1PA 4RZVA 4Y5QA 5IQEA 2B4SB 2X2LA 4I5MA 2I1MA 1H0WA 3R1QA 4P7EA 5L2IA 3E87A 1MQ4A 4FTRA 1YXTA 4WIHA 4AW0A 2UVYA 4GIIA 4YC3A 3GVUA 2C5XA 3FAAA 4Q5HA 2YA9A 4DGOA 2ONLA 4MTAA 5DH3A 3P9JA 4JQEA 4QMPA 5E8ZA 3ZSGA 3MY0A 3OUNB 4C57A 5FEEA 3PJ8A 5DNRA 3V3VA 2OK1A 5E90A 3DB6A 3NNXA 5LMKA 3IDCA 1NA7A 3FMJA 3MVJA 1BMKA 5CI6A 5HTIA 3I5NA 4NT4A 4UYAA 4DGGA 3ZHPC 4I6HA 4HPTE 5HOAA 4DFBA 4P4CA 4V05A 4C61A 4D1XA 3HZTA 4IAYA 3WZUA 4O2PA 4WRSA 3ORMA 2E2BA 4G16A 3ROYA 3VC4A 2B7AA 1WBTA 1H01A 3PJ1A 3SA0A 4O86A 4CYIA 4FK3A 1J91A 4EYMA 3ZRLA 2QU5A 4RIOA 4O6LA 3ZBXA 4FKIA 2G15A 4DITA 4KIKB 4RX5A 3T9IA 3TL8A 3N4TA 3DJ7A 5EG3A 3ZC5A 3D2IA 4ZSJA 1H1WA 2W05A 3AQVA 3HL7A 4XYFA 3ZEPA 4AW5A 4QEBA 4FEWA 3ALOA 3QRJA 4R3PA 5EDQA 1M7QA 4G9CA 4J53A 5HNBA 3PVBA 5AP1A 3VS1A 4EC8A 1PMNA 2F7XE 4HVDA 4F7SA 2GSFA 2WIPA 1ZYJA 2XBAA 4IW0A 3G9LX 4RT7A 4ZTHA 3COMA 1U5RA 2KULA 4ZSLA 4IX4A 4HGSA 3LLAA 2JDOA 3NFFB 2BTSA 4TRLA 3HV5A 1WBVA 2G2IA 4O7RA 4X3FC 1FMKA 4FNYA 4OLIA 3PIZA 2QOBA 3EQFA 3SAYA 4AXEA 3ORLA 5F94A 2OWBA 3QALE 3S2PA 5IA1A 2OIBA 3LXNA 4Z9LA 5ICPA 3N4VA 2JKQA 5KX8A 4IZ5A 1KV2A 2CN8A 3HMIA 2BZHB 3E92A 3FMDA 2OFUA 4QMYA 1H28A 3WE8A 3T9TA 2W7XA 5AM7A 2J90A 4KKHA 4L6QA 1ZZ2A 3U9NA 2YITA 2DWBA 3TKHA 2XEYA 3KKVA 5EM7A 1Q61A 4KRDA 4U6RA 4IBMA 2R3HA 2W99B 1E1VA 3F3ZA 2WMWA 3VNTA 4AT5A 4R8QA 4AU8A 3D83A 3QTXA 4FTLA 4JBOA 4ZS4A 1ZXEA 2FSTX 3PJ3A 3EN7A 4AFJA 5BPYA 4EOKA 2OF4A 2JAMA 1Y6BA 3FY0A 3HP5A 2IG7A 4FVQA 1YOJA 1IAJA 4J71A 4X2FA 4TYGA 2GU8A 2R3MA 2C5OA 3HYHA 4C4EA 2OH4A 5I3RA 3U6IA 2EB3A 2BTRA 3KK9A 4UB7A 2VRXA 1PXOA 4U3YA 2OW3A 3ORPA 5CYIA 1LPUA 3R8LA 4I24A 2V22A 2EVAA 5G1XA 3WZDA 4ZLZA 4O0UA 5D12A 2VO3A 1ZWSA 5CTPA 5LJJA 3H30A 4AZVA 2CCHA 4ANSA 3BLHA 4BCPA 5FDPA 1ZMUA 5FBNC 3U55A 2OO8X 2JKKA 3F6XA 1NT2A 4JX3A 3DNEA 3Q9YA 1GZ8A 3PUPA 1M2QA 4RWIA 3HDMA 5FXRA 5KMNA 3H4JA 2WU6A 4I0TA 3GU8A 4FSTA 4BJJB 3GGFA 4GV1A 3L8PA 2XJ0A 3G6HA 3I5ZA 4S34A 3LQ3A 5F95A 4W9XA 3DLZA 3QTQA 5IU2A 3TXOA 4CSVA 1GIIA 3K54A 1H1SA 1NVSA 5HU3A 3UNJA 4JDIA 3IDPA 4IX6A 2J2IB 1R78A 3EN4A 3HUCA 3OOMA 3P86A 3U8WA 5LVOA 2PUNA 4LM5A 4V0GB 4MAOA 5DT4A 3H9FA 2HZ4A 3KF4A 3KN5A 4O0YA 4N4SA 4IC8A 4M12A 5HU9A 4A9SA 2CKEA 3MPAA 5DT0A 2UUEA 5EOLA 3IQ7A 3WYXA 1K9AA 4RX9A 5I9WA 3OMVA 2BIKB 3V01A 2KTYA 2CGVA 4U3ZA 4GK2A 1IG1A 5CI7A 4XHKB 3A7GA 1PXMA 3O7LD 3QZHA 3EZRA 1ZOGA 4FG8A 1Q97A 3W0NA 4F6UA 4M69A 4YZMA 2OICA 5EOBA 4OTRA 3LCSA 4HNFA 3K5VA 1SYKA 2Z7QA 1Q5KA 4CFFA 2E9PA 5B2LA 4O7LA 4PDSA 3CIKA 2HK5A 4U5JA 3RCJA 3AGLA 5CU0A 3NRMA 3UBDA 4A06A 4RPVA 2BALA 4AZTA 4TPTA 3F3WA 2VTJA 3TMOA 2X9FA 5IZFA 4MX9A 5CAPA 1URCA 3Q9ZA 4GK3A 4ZSGA 2GCDA 3ZC6A 3ZH8A 4CKRA 1JKSA 1Q8ZA 3EYHA 5HICA 5I9XA 3OEFX 1ZOHA 1IA8A 1OKYA 3L8VA 3SV0A 1KOAA 1T46A 3EQCA 1R3CA 4ASXA 4L68A 3EQDA 4I5PA 5JZNA 3UG2A 3MSSA 4BDEA 1UNLA 2A19B 4G5PA 4IWQA 5CU2A 1CSNA 3C13A 3UDBA 4CZTA 3PP0A 4WUNA 4EHVA 1PRYA 3RMFA 2A1AB 2X0GA 3BLRA 2I0VA 3ZFXA 4TNDA 1JWHA 4FKGA 2ERZE 4E7WA 1Q3DA 3MI9A 3TIZA 5KHXA 4DH3A 2W9FB 2JIVA 5HLPA 2OSCA 3UZRA 3GBZA 1OIRA 3HMMA 4PQNA 1H1RA 1GY3A 5F20A 3R02A 4AZEA 5KBQA 4MHAA 3VUDA 4JAIA 4RSSA 5E8TA 1U46A 3C4WA 4MBLA 5IMXA 4G3EA 1R39A 4YU2A 3BYOA 3QTWA 1OKWA 4FZ7A 4O7VA 1M17A 3NUPA 3F88A 2QLQA 1RJBA 5ETCA 4D58A 3UTOA 2YDJA 4C36A 3COIA 5ETIA 1T45A 1YWRA 3R30A 1Q8TA 4QPMA 3NAXA 3UC4A 4QMQA 3WBLA 5HZNA 3FZOA 3GP0A 4JT3A 2PZYA 5JQ5A 3C51A 3LFCA 1OMWA 2P2IA 4OTGA 4CRSA 4PDYA 2Y6OA 3H10A 3Q3BA 3VULA 3VN9A 4O2ZA 4EONA 3ML1A 3QF9A 2VX3A 5AP5A 5ACBC 4E5WA 5FD2A 5AFVA 1U54B 3AD4A 4FNZA 1S9IA 4QQCA 4FSNA 5IA4A 4EH2A 3QYWA 1NVQA 4J1RA 3JXWA 3W2OA 4ZMFA 5HNIX 2PVLA 5LCKA 3RALA 4WO5A 2R7BA 2YCQA 3LW0A 5CNNA 4FTOA 4PPAA 4XP2A 4B7TA 2F9GA 3OP5A 3FZPA 3R1SA 4GVAA 4TN6A 4YJVA 4IMYA 3RCDA 4IE9A 1O6KA 4QMXA 4Y72A 2HXLA 4HVGA 2QG5A 4BN1A 5TE0A 4QTCA 3OCTA 2YDKA 5DMZA 4GU9A 3V8SA 4KBKA 3TTIA 5K4IA 1YOLA 3SHEA 4E20A 4BWPA 2ZV2A 3ZLSA 3UYTA 5TOZA 5AUWA 4K6ZA 1VR2A 3D5WA 2UW7A 4HOKA 3EL7A 4MBJA 2OBJA 2NYAA 3DAEA 3EB0A 5AR4A 2UW9A 5DT3A 4ACDA 5LMAA 4EZ3A 5HO6A 4HVIA 3B8QA 5LCJA 3CPBA 3OW4A 5HG7A 3I7CA 3MJ2A 1WVWA 3V8WA 3VS6A 2WAJA 1DM2A 3G5DA 4L7SA 4AXAA 2WTVA 5CQWA 5JGAA 4RFYA 5I0BA 1K2PA 2XK9A 3EZVA 4ZK5A 2PE1A 3V51A 3Q04A 4XG8A 2IF8A 2BAKA 2WHBA 1XKKA 3ET7A 4IFCA 4G17A 2XNPA 3W33A 3F5XA 4FVRA 3U87A 3DNDA 3LHJA 5B2KA 4D4RA 2LGCA 4BBMA 4CT1A 2YZAA 2OZOA 4PTCA 3RNYA 2R3PA 5AR2A 5DBXA 3QQHA 5CSPA 3TACA 3ZOSA 1QPEA 4CQEA 5DVRA 2WMAA 1OI9A 4QDVA 3PDTA 4ENXA 3PRFA 1UU7A 3TV7A 2UZLA 3QD3A 4X6QC 3WE4A 4BGGA 4PTEA 3R6XA 4AXDA 3E8EA 5FDXA 5HE3A 5CEOA 3Q53A 5AP6A 5DFPA 3QZGA 4I93A 5HO8A 3EQHA 4ITHA 3G15A 4IJPA 5KMJA 4XBUA 2YCFA 3EN5A 4OAUC 3QQGA 4JXFA 4OTWA 2BRGA 1OBGA 3GU5A 4U9AA 4EBVA 1BL7A 5JFWA 3A62A 2QOKA 5L8KA 3MB6A 3KQ7A 1P5EA 1JKKA 3F5UA 3HGKA 3QTZA 3UOKA 1YXVA 3JVRA 3HRFA 3C5IA 4G6NA 4R5SA 1W84A 3ZO2A 2ETRA 3NWWA 2P4IA 4CT2A 3GU4A 2HW6A 4LI5A 3TG1A 4TY1A 2WZJA 3VWAA 2W5BA 4QRCA 4FKWA 4Z7GA 4JVGA 5AM6A 3FLYA 2UVZA 3LFAA 4F0GA 3MGYA 3E7OA 4USDA 3QKKA 4NFMA 5AX9A 4YGAA 3Q6UA 4G3CA 3POOA 4RX8A 4ITJA 1ZYCA 5T68A 4EWQA 5AX3A 5AADA 3NW6A 4YJOA 3RPSA 3ZS5A 1OL6A 2VU3A 5AV0A 5HVJA 2R7IA 3QLFA 3JY9A 3MJ1A 1ATPE 3RHKA 2XZSA 5I5ZA 4FV2A 2GNIA 2XIYA 4EJNA 3FSFA 4I23A 4I5HA 4WHZA 4BBFA 3C4EA 4JQ8A 4M68A 3BYUA 5JEBA 5KUPA 4GG5A 2C68A 1K3AA 5AUZA 4CV8A 2XIKA 2XMYA 5C01A 3BLAA 1H24A 3TJCA 2QHNA 1Q8UA 5HIBA 3DLSA 3TNWA 1EH4A 2EWAA 2VTLA 3DCVA 5CS6A 3R9RA 3ROCA 3ZLXA 4ASDA 5E7RA 3BYSA 3ZFMA 3UDZA 3Q96A 5J9ZA 4FEXA 5J9YA 3ZYAA 4A4OA 5C4KA 4DEBA 2R3OA 4FV9A 5EYCA 2VGOA 5A4TA 3UJGA 4ALUA 4AW2A 4EH5A 4NK9A 2XNOA 4KKGA 1YKRA 3BU3A 3PA3A 4OTQA 5J1VA 2A0CX 2UW6A 3HAVA 3D94A 3V5LA 4XV9A 3FZRA 5ETAA 3Q32A 2BRBA 3LMGA 5EH0A 5CEMA 3ELJA 1JNKA 4DF3A 4NSTA 3FMMA 3NX8A 2X8EA 4JR7A 5CEQA 3D7TA 4RFMA 5C9CA 3KRLA 5CVGA 4JDHA 4ZP5A 5JGBA 3VONA 1G5SA 2WMUA 3E64A 3VJNA 3PFQA 2EXEA 2YAKA 4FKJA 3OT3A 4FA2A 4M67A 5CU4A 4U41A 5AUUA 4C7TA 1WBPA 3DKFA 4FK6A 2ITPA 4QMNA 3FXXA 4NL0A 4O7SA 2C47A 3ZRMA 4R7HA 2GHMA 2UZUE 3BIZA 5AIKA 2WGJA 3NYOA 3VS7A 3VF8A 4KSPA 4FIEA 3R7UA 3HNGA 3BE9A 3WI6A 4K18A 3FXWA 5DOSA 4AZWA 5AR5A 4ZTMA 3MESA 2VTMA 3IONA 4XG4A 3WF5A 4JMQA 4AZSA 2OG8A 2QOCA 1QPCA 4KRCA 3VRYA 3SGCA 4UMTA 3KRJA 4BWKA 2GMXA 2I7QA 2E9OA 4PNIA 4OT5A 4XG7A 3LCDA 3PVWA 5KCVA 3T3VA 3QQFA 4QMVA 3MFRA 2J5FA 3W8LA 1YI6A 3BBTB 4CLIA 1GIHA 4KABA 3DBFA 1Q41A 5EW8A 3GT8A 2B0QA 3IK3A 2YISA 2YWPA 3O71A 4YO4A 4ZZOA 4NM3A 4CYJA 3NS9A 5ANKA 3NIZA 3KL8A 5A4LA 4UZHA 4IVBA 1P4OA 1CMKE 1XMMA 2H96A 3MH1A 4DH1A 3E3BX 5GJFA 4BL1A 4BIBA 4UN0C 3FMEA 4IB5A 5HORA 4CGAA 2OKRA 2QONA 1OPJA 1GIJA 3FKNA 4D5KA 3CD8A 2YM7A 3AKJA 4QYHA 2ITUA 3CY2A 3G0EA 3GUBA 3MTLA 4JL9A 2X6EA 2C30A 2VWIA 2UZWE 3LFFA 2XUUA 3ODYX 1OVEA 3U51A 2BZKB 4HGTA 2BFYA 3BGPA 2FSOX 4RZWA 3LFNA 1QPJA 1M2PA 2PVNA 3Q52A 2ITOA 5E8YA 2XYUA 4QYFA 2Q83A 4BDAA 4PY1A 5GHVA 3GI3A 3LJ0A 3T3UA 4YTIA 2F4JA 2IJMA 5HVKA 4BKJA 1FGKA 3SD0A 3UMXA 5BQ0A 2V7OA 3KGAA 4PP9A 3G6GA 3BEGA 4E6CA 5IA2A 3EWHA 5TO8A 1UWJA 3QWJA 5C8MA 1JPAA 2X1NA 3E5AA 4OR5A 5I9ZA 4XP3A 4BCGA 3QGYA 3Q4CA 5IQBA 5LVPA 2C6MA 2VWYA 4FSRA 1S9JA 4R1YA 4YTCA 2WEVA 1BL6A 4AA4A 4UMQA 3W0PA 3GQIA 4G5JA 3ULZA 2C0TA 2X4FA 4GH2A 2IW9A 4JQ7A 5C26A 3P0MA 3Q60A 4FODA 4O7YA 2IVUA 4W4VA 3S4QA 4CRLA 1ERKA 5JFVA 2XAOA 1KSWA 1OKVA 4TWOA 1YDRE 2JBPA 2IEWA 5IISA 2P0CA 2R9SA 4QP9A 5KKRB 3DXNA 4PV0A 1M7NA 1WVYA 1E1XA 1H4LA 5CAOA 3NSZA 4I3ZA 4RMZA 1FVTA 4DHJA 2QO9A 4RJ6A 2W4KA 3HA6A 4JX7A 5ANEA 1PKDA 3IOPA 4BICA 4AXFA 4NW6A 5E92A 1J1BA 2XK8A 2YM3A 2XVDA 3VUKA 3QRUA 3LFBA 4M66A 4ZXTA 3RKBA 1WMKA 4P5QA 4BKZA 3TZ8A 4TTHB 4AS0A 2ITYA 3PE1A 3GU6A 4MXXA 4M3QA 4EBWA 2DUVA 5GJGA 2A27A 4NYEA 5IQCA 4LGDA 2ZV9A 4YZCA 4AUAA 5GNKA 1V0OA 2F7EE 1PXJA 2HW7A 2YFXA 4O0XA 5AV2A 3BU5A 2CSNA 5EW9A 4BKYA 1U4DA 3C5UA 5DPVA 2PL0A 3HDNA 5TF9A 4F63A 3ZONA 4A9YA 3FQSA 3PP1A 5HG8A 4A4LA 3OEZA 4FT7A 4CEGA 3V5PA 3EFWA 3O8TA 2I0HA 4LQMA 3PZEA 5LQFA 4FUYA 4C34A 3F5GA 4E5BA 3O96A 4QMZA 4EORA 5IQHA 5H8EA 4L52A 5B2MA 2PVHA 2UW0A 4ERKA 1ST0A 1NY3A 4LV5A 3FC2A 4FT0A 4MD8E 5K9IA 3HAMA 4D4SA 3PXRA 2UV2A 3NVKI 4M13A 4ERWA 2WQNA 3VUTA 4FGRA 3THBA 2VTIA 2F7ZE 1F0QA 3F61A 4FX3A 4L43A 3MFUA 3GXLA 4FOCA 4R77A 2WELA 3HECA 3KC3A 2BKZA 3MH3A 2J9MA 3OD6X 4EK8A 4OTIA 4KBAA 5FEDA 2CKPA 1U59A 3CGFA 3ODZX 4DTAA 2CKQA 4I92A 2ZB1A 3FLWA 4FNXA 1VYWA 3WYYA 3MPTA 5HTBA 4DFUA 2WPAA 3EH9A 3EL8A 4IAIA 2C3IB 2C3LA 1H08A 1W2CA 4H39A 4J98A 1YW2A 4FSYA 3Q9XA 2B54A 2Q0NA 3PZHA 4E4LA 2IPXA 4K0YA 4FG9A 1WZYA 3AT4A 4M69B 3BRBA 1VLRA 3TUBA 3EQBA 3L9MA 5FTQA 4AGCA 4BRXA 4CLJA 5H3QA 3VBVA 4NH1A 3GCSA 2CCIA 2WMQA 1BKXA 3OWKA 4BZNA 4EOJA 1SVEA 4DE4A 2NRUA 4L3PA 4YBKA 2WD1A 2QR8A 5BVNA 5TKDA 1ZRZA 1AQ1A 1AD5A 2HIWA 4P5ZA 3RINA 4UMPA 5CQUA 3NNUA 4QP4A 4J95A 4GVJA 4W4WA 3W2RA 1QL6A 2C6OA 1BUHA 2ZAZA 2XS0A 4M15A 3W8QA 3NCGA 5ITAA 2PTKA 3PXYA 4JLCA 5C27A 2OJFE 3DPKA 3LFQA 2VN9A 1Z5MA 3UDTA 3HMNA 3ORTA 4HGLA 1GZKA 4IIRA 3G33A 3NLBA 1JQHA 4D9UA 1PJKA 4FTCA 4RFZA 3HA8A 2VGPA 3LQ8A 3NAYA 4FIGA 4RX7A