2Y6MA

Crystal structure of epha4 kinase domain
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
283
structure length
262
Chain Sequence
VREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EPHRIN TYPE-A RECEPTOR 4
publication title Crystal Structure of the Epha4 Protein Tyrosine Kinase Domain in the Apo- and Dasatinib-Bound State.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 83
structure length 262
sequence length 283
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2y6mA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2y6mA01
1M17A 3MH0A 1OUYA 1YW2A 3FLSA 5CEPA 3E7OA 3HX4A 3W2QA 3VBVA 3OP5A 3M1SA 3V5JA 4E6DA 4J97A 3O71A 3FBVA 3KMMA 4QNYA 4I6BA 4ZEGA 4EOSA 5EYCA 4F9WA 4RSSA 3KF7A 4UMTA 3ULZA 4E26A 3U6JA 2UZOA 2WMUA 2F49A 4QYYA 4JRVA 3SG9A 5AX3A 4F64A 3TNHA 4ORKA 2IVVA 3UQFA 2V22A 5IMXA 1H1RA 4NM0A 2BVAA 3AMAA 2I0EA 3GU6A 5K0XA 2VTNA 3ZM4A 5EM8A 3DJ5A 1HCKA 3JVSA 2UW9A 3PA4A 4O91A 3EN6A 2WTKB 4AGCA 3I60A 3TKUA 4CNHA 4EBVA 3B2WA 2QNJA 1Q41A 3I1AA 3FKOA 3KU2A 3KK8A 4S2ZA 1YDRE 3QRIA 3SG8A 4FV9A 1OPKA 2WTKC 3P08A 3Q4CA 3WF5A 3NSZA 5CQWA 3DPKA 3DTCA 5EI2A 5EQEA 3KCFA 3CGFA 5HD7A 4H58A 2YIRA 4TW9A 4HGSA 1DI8A 2F4JA 2JEDA 4ARKA 3PLAE 2C6IA 4XV9A 3QQKA 3EOCA 3BX5A 4GUEA 3C5IA 4FV1A 2VWZA 2WQEA 3D7ZA 5EHLA 2DYLA 2EXMA 3O96A 4R5YA 4ACCA 2A2AA 3BU3A 4YHTA 4RLLA 3QC4A 4CD0A 5CF4A 2Z7RA 4MXOA 1YHVA 3JVRA 3BWFA 2VWBA 4OT5A 5TKDA 2OFVA 5CZIA 2W05A 5KMMA 3S1HA 2R9SA 4CG9A 4FBXA 4I0SA 4E4XA 4R1VA 2CGWA 2WNTA 3ENHA 4NSTA 4QTAA 4QYEA 4BDBA 4G9RA 4W8DA 3KF4A 2BIYA 5DE2A 3FDNA 3HMNA 5B0XA 2XIZA 5BYYA 2OK1A 4BY9E 3N4TA 3OXTA 4IX4A 4HYHA 3QX2A 3IOPA 1ZYSA 5K4IA 2CNQA 3QD4A 5EH0A 2AUHA 2C3LA 3Q5IA 1W8CA 4LOQA 3P9JA 4GYIA 4IANA 1REJA 2X8DA 4IWDA 3BU6A 5DA3A 3DDQA 3ZONA 4X2NA 2X7FA 3A8XA 4YJPA 4O83A 2C6LA 3GFEA 4M8TA 3VJNA 4EH6A 3PP0A 4HOKA 4L7SA 4LGDA 4O6EA 5FLFA 4C57A 5HO6A 4DG3E 1Z5MA 3BKBA 5CU3A 5ETIA 5EW3A 4U0IA 2PK9A 5GHVA 3DXPA 3DU8A 3EKKA 3FKNA 2PZPA 3E92A 3NCZA 1P4FA 4FK6A 4MTAA 2C69A 4BWPA 3EQBA 2UW7A 4FSMA 4CLIA 5I5ZA 2XF0A 3PZEA 4JDJA 1YWRA 3OD6X 4C7TA 4F08A 5C4LA 4AF3A 3MSSA 4AACA 2CLQA 4FIGA 4ACHA 4RA4A 2JIUA 2YJSA 5AR7A 4FEQA 5HO8A 4YPDA 3QQLA 4RIXB 4WRSA 3W55A 4UX9A 2R3KA 3IKAA 1RDQE 4J95A 5AAFA 3MESA 4GSBA 4GYGA 3G2FA 2W1DA 1WBSA 1JVPP 3B8QA 4BDHA 4FNYA 4ALUA 5CAUA 3P86A 1TKIA 4HCVA 4TTHB 3ZFXA 1ZLTA 1M52A 3V8TA 5HVYA 4AS0A 2H34A 3R71A 5FP6A 4WG5A 2P3GX 2WEVA 4AZEA 3CKWA 3NUPA 4FL1A 5LWNA 2OO8X 4Z9LA 3UP2A 2E9OA 3NNVA 4V05A 5JFWA 4O7ZA 4MWHA 2CNUA 3LCTA 3KRWA 4W8EA 5LVNA 3AC8A 4PMPA 2VNYA 3PA3A 5E4HA 3HECA 4L45A 3R73A 4D5KA 2UW6A 3HKOA 4XP0A 4CMUA 2O65A 2P2IA 3A8WA 4M0YA 2FSTX 1HCLA 4ONAA 4RWKA 3ALOA 3W2RA 3BZ3A 4MKCA 5HBHA 3WF6A 2GQRA 3ZZEA 5BVKA 3ZSIA 5FDPA 3PY1A 4NM5A 3EH9A 2H96A 3UIBA 5HTCA 4Z7GA 2V7OA 3EIDA 5EFQA 2XRUA 4FTOA 3E3BX 2E2BA 1P4OA 2YLFA 4DFNA 3R22A 4FOCA 4MEDA 4O7LA 1R3CA 2UZBA 3KXNA 5K3YA 4O7VA 3C7QA 4BCJA 2IZRA 3EWHA 3FLZA 3IK3A 4F1OA 3MIYA 3B2TA 5DR9A 4HCTA 3HV7A 4J1RA 3IDPA 5BYZA 2Y6OA 1SVHA 1U5RA 4MXYA 2BMCA 4H3QA 5TR6A 3MH3A 4D1SA 3A7GA 3FLWA 4O6LA 5FRIA 4BWXA 4QMUA 3BBTB 4PRJA 2VTPA 3QTXA 2O2UA 3E88A 4L9IA 4FTAA 3Q5ZA 1Q3DA 2EUFB 3ZO2A 4QTBA 2ZMDA 2OH0E 2XB7A 4FI1A 3E87A 3IDCA 3LZBA 2R5TA 3TACA 4BWKA 4CT2A 5H3QA 5ACKA 2B9FA 2PE2A 2O64A 3AC1A 3PWYA 2ZVAA 1BMKA 4CXAA 4ZS4A 3LMHA 4R7IA 2C1AA 1WBOA 2G15A 3Q4TA 4FGBA 4TPTA 2WQBA 3A7FA 1G3NA 1OVEA 3I7BA 4ZP5A 4BDCA 2WMSA 5CNNA 3BBWA 3HMPA 3MN3A 2W4JA 3FMNA 5J8IA 5IEXA 2VX1A 2CGUA 4ZY4A 3AC4A 2J2IB 3A61A 4X6RA 4FNXA 4KNBA 4A4OA 5CNOA 2H6DA 2IZTA 3I5ZA 3IGOA 3NYVA 3ORZA 3V5LA 4QD6A 2ERKA 2WXVA 4Q9ZA 3ZO1A 2EWAA 2UW8A 4IM3A 3DNDA 4YZNA 3I81A 5EDQA 3OWPA 4YNOA 2J0LA 4KSQA 3W10A 2X81A 4MCVA 3QD3A 3PRIA 4FKJA 3R83A 4XNEA 4CZTA 4ZSEA 3UODA 2X6EA 4FIJA 3CD8A 1XBAA 2QU6A 3D7TA 2HYYA 2JKMA 4I6FA 2WIPA 4O0TA 1U54B 5C1QB 2BALA 3K5UA 1YOJA 4N70A 4AGDA 2OXYA 2PZYA 1S9JA 3F3UA 3VUTA 5IA2A 3MFUA 4EWQA 4LGHA 2BZHB 1IG1A 3ATTA 2BFYA 1WZYA 4LL5A 3E63A 4EH3A 5ETCA 3ZYAA 4O0SA 5I9UA 3FQEA 4JX3A 1O9UA 2J4ZA 3DQWA 4JQEA 4XG7A 5AIRA 4CFVA 4M66A 2PZIA 1OKZA 3QCXA 2GS7A 1ZWSA 3UTOA 5IEVA 2O0UA 3R7IA 4O0UA 4U9AA 3BQCA 5L8KA 3CBLA 1XBCA 2FSMX 4ACMA 3HV4A 4BBEA 3TZ7A 2PMIA 4BFMA 1FVRA 2WMXA 3MVJA 3L8SA 3FE3A 2YABA 4FV0A 4ZTSA 3JXWA 2ITNA 3GQIA 5TF9A 3LLAA 3TKIA 2X8IA 3UNJA 3VBYA 4GV1A 5KMNA 2XJ0A 3D4QA 3MFRA 4FT0A 4WBOA 1V0PA 4EQUA 3NR9A 4ITHA 3BYOA 1W7HA 4AAAA 4QP8A 4KUJA 3LAUA 4DGMA 3NAXA 3BLRA 3VS3A 2VTJA 4C61A 3NW5A 2GNIA 2JBPA 1PF8A 2JDSA 4RC4A 4BIBA 4DFBA 1W84A 3PY3A 3AT3A 3VQUA 1CTPE 1CMKE 4K33A 4OTPA 3UNKA 5DN3A 5LCKA 3EQFA 1GZOA 2J90A 2XIKA 3V8SA 2OJ9A 1KOAA 4U3YA 3B8RA 4D0WA 2DUVA 3DZQA 4TYIA 3RPVA 3ENMA 3QC9A 5HG5A 5CTPA 4HNIA 3BPRA 4JVGA 2WU6A 3Q9YA 5H8EA 3NVKI 3PE2A 3SRVA 3QXOA 1W0XC 4MF0A 1OIYA 4DBNA 2R3FA 5KUPA 3ZBXA 5HNBA 4O96A 2CKEA 5IQIA 2CN8A 2RSVA 4DCEA 3NX8A 5KZIA 2PVFA 3BEAA 4NL0A 2VTHA 3L8XA 3QFVA 4CMTA 4EWHA 2X0GA 4BIDA 5A14A 2W0JA 3NRMA 4RIYB 3NUAA 4KKEA 1NXKA 4C8BA 4G2FA 5HCXA 4MH7A 3GI3A 3DAEA 4JAJA 4C35A 5LVOA 2WB8A 4PQNA 3QZHA 2VWUA 1SNXA 2R3NA 4PTEA 4TXCA 4UEUA 3VW6A 5JGBA 3HAVA 3E5AA 2WQMA 5EM6A 2CMWA 4MXCA 1Y6AA 2R0UA 1ZMWA 1BI8A 2XEZA 4U7ZA 5KMOA 3UNZA 3Q9ZA 3LJ1A 4NJ3A 5JFXA 5A54A 4U3ZA 3VJOA 4C3RA 2ZJWA 3OUNB 3F61A 4FEWA 2XK4A 4FKPA 4WT6A 4G17A 3TL8A 4E1ZA 3UPZA 5GIPE 1STCE 4M15A 3WZEA 1PXJA 4QYHA 1GZNA 4BVUA 4CFNA 2GNLA 4FSZA 3GFWA 4NKSA 5HKMA 3FZ1A 3LM5A 2H9VA 2EB2A 2VTQA 3LMGA 3W2CA 4A9UA 5HIDA 4C3PA 2QOCA 3Q6WA 2OFUA 3EKNA 3MB7A 5HLPA 1KE8A 1W98A 3COHA 3G0FA 4E7WA 3EL8A 2C5NA 4N6ZA 3UZPA 3OXZA 4I21A 3HAMA 2XJ1A 3O2MA 3FMDA 4WG4A 4O38A 2H8HA 4X0MA 5IU2A 5HD4A 2GHGA 3COKA 3IW8A 2PUPA 3JR1A 2PWLA 1URCA 1SVEA 3R28A 3LOKA 4QP4A 2QLQA 3MY0A 4S30A 3ZO4A 5L8LA 1PKGA 4LG4A 1OIRA 3O8TA 3HLLA 4KB8A 2C6DA 4ZOGA 5AP6A 5KX8A 2PZ5A 3ANRA 3QRKA 3KMWA 4CFXA 4I5HA 4ANQA 5AR8A 3ODYX 3ETAA 3GT8A 3PZHA 1H0WA 3R01A 5E8VA 3WBLA 4DINA 4F65A 4HPUE 1H4LA 3ZEWA 1TQIA 2JKQA 4Y46A 4JOAA 3T9TA 1ZAOA 4RX5A 5EW8A 1YI3A 3PYYA 3D83A 4GVJA 3R8LA 5HEZA 1ZMUA 5AR3A 3DNEA 5JZNA 1OL5A 5M55A 1WVWA 2RFNA 1ZOEA 4UZHA 5CVGA 3VWAA 2PYWA 5AR4A 4RVMA 3R7YA 4RX9A 3FZPA 3VBXA 4C38A 4HZRA 4EOKA 4AX8A 1M2RA 4V0GB 4U41A 2XK8A 2YCSA 3UOKA 2VTSA 4FG8A 3ET7A 2FA2A 1F0QA 1ATPE 2PE1A 3FLQA 3II5A 3NDMA 4JXFA 4MD8E 4P90A 5DEWA 5BNJA 4F7NA 4CKJA 2OJJA 3Q04A 4C2WA 4ANOA 1YDTE 3UOHA 4IC8A 2W7XA 4FICA 2VD5A 4OBPA 2ITOA 4FT3A 4L6QA 3KXZA 4CV8A 2HZ0A 3DB6A 1T46A 4ANLA 3IS5A 4LMUA 3GXLA 4EJ7A 3FSKA 3RK5A 1NVRA 4IZYA 3ORNA 4EQCA 3VS7A 5BVFA 1KE5A 4Y5QA 4R6VA 4GK2A 5HOAA 3RM7A 4CTBA 3GVUA 3F5GA 5BUIA 1IAHA 5J1WA 3CY2A 1UA2A 2B9HA 3AT2A 3MYGA 4AT5A 5IQEA 3U51A 5JZJA 3TWJA 5GINE 3OS3A 4L3JA 4DGOA 3RI1A 5T68A 2YIQA 3UIMA 5A4EA 4R7BA 3IQ7A 2PHKA 2GQSA 3AQVA 4BDKA 3V8WA 2B52A 4JBQA 1FMKA 4Q5HA 4RWJA 4B0GA 3R9RA 5M53A 2ERZE 4NFMA 3G5DA 2ZOQA 2J0KA 1HOWA 3PDTA 2HIWA 5D12A 4EOQA 2XBJA 4F9BA 4OUCA 2C3IB 2YHVA 3F5UA 5F20A 3QGYA 4G3EA 4AA0A 5F1ZA 4CYJA 2OIBA 3CQWA 4EBWA 5IEYA 4C4GA 4XG2A 3HDMA 2R3OA 4CT1A 2BFXA 3BGZA 2XNBA 2W1GA 4L67A 2BRGA 5DOSA 2XK7A 3GUBA 4B99A 5IF1A 1NVSA 4XUFA 3RJCA 5EW9A 4DFZE 4C37A 5TO8A 2G9XA 3EFJA 3GGFA 4YJVA 5CF8A 3A7IA 3CQUA 4RT7A 4RWIA 2PVJA 4FSUA 4MXAA 4U6RA 4DEHA 3QD0A 4E3CA 3F3WA 3FY2A 5HG7A 5IQAA 2VWYA 3FI2A 5I9XA 2XIXA 5AA9A 3RPYA 3O0GA 5ITAA 4W9XA 2CPKE 2XJ2A 3GC9A 4PMTA 4O7RA 1MRUA 5HU9A 4ENYA 4BCKA 1AQ1A 4PP9A 3ULIA 1AD5A 3ZFMA 4EHVA 3GENA 4KS8A 3FC2A 3U6IA 3NYOA 1ND4A 2I1MA 3QL8A 3GCVA 1VJYA 3R9HA 4MHAA 4IACA 4K77A 3QUEA 4JAIA 4QP2A 3LFSA 3LJ2A 3GBZA 4KWPA 2HOGA 4BC6A 4A9SA 4Y73A 1OPLA 2IO6A 4NM7A 4GH2A 3PJ3A 5CSWA 1P14A 5GJGA 4M7IA 4RJ3A 2XNMA 5I4NA 3U55A 5ACBC 4BN1A 3BI6A 2QOHA 3BV2A 1R1WA 3BE2A 5EI8A 5AUUA 3D5VA 3IW7A 4FA2A 4FSYA 5LVMA 3I79A 2HZ4A 4ACDA 1KV1A 4AOTA 1XO2B 5DHJA 4ANSA 4C59A 4L3LA 1E1XA 1OUKA 4OTIA 4OTWA 3I4BA 3LXNA 5AV4A 5K9IA 2QOOA 3BLQA 4FKSA 3RGFA 5DGZA 3TNWA 4IHPA 2CCIA 2GQGA 1H28A 5BVNA 3IGGA 2QONA 5AWMA 3H3CA 4FV4A 4O7YA 4MX9A 5DMZA 2W5HA 2XNEA 3O51A 4DFYA 2KULA 2QOQA 3P7BA 3RK7A 5AIKA 4HVDA 4M67A 1WBTA 4JDIA 1H1SA 3Q9WA 1JKTA 4ZK5A 3LW0A 3CTJA 2R4BA 3PJ1A 2J50A 2UZTA 5TE0A 3DA6A 4XRJA 2E9PA 4ZTRA 2QR7A 5FXQA 3RNYA 2AC5A 5IH5A 3H9RA 1GY3A 4C4EA 1U54A 2BUJA 4IZ5A 1ZY4A 3EFKA 1XH5A 3QRTA 3FQSA 4KRDA 3G9NA 4RZVA 4F99A 3CPCA 3NWWA 4P5ZA 1GIHA 2C0OA 4FTUA 2OZOA 3QQJA 4AUAA 2WOTA 3HMMA 3HV6A 4OTFA 4R3RA 2GHMA 3DKCA 3DY7A 4UMUA 3VHEA 2OI4X 2PL0A 3JPVA 4ZLOA 4J8NA 5BVOA 4AU8A 1E1VA 3AD6A 3W32A 3F7WA 2RG6A 2OIQA 5LARA 4FKWA 1RW8A 1BL6A 2QO9A 3DLZA 2F9GA 3UVPA 4DEAA 4BKJA 1MUOA 3VVHA 3ZRLA 1U46A 1L3RE 4FIFA 1LEWA 3MW1A 4JBVA 4WIHA 5IMEA 3KKVA 2VNWA 4Y5HA 4UYAA 5HG9A 3R7EA 4XG6A 4ZTHA 4C4FA 3RAWA 3SKCA 4FUYA 2QURA 5JRQA 4FTCA 3P7AA 1JWHA 3UOLA 4UXQA 3F2RA 5IQBA 4YJUA 1PMEA 4AOJA 4NCTC 1R39A 4QMOA 5ANDA 3VAPA 5LWMA 2BCJA 2UZUE 4WO5A 3UIUA 3EZRA 2QHNA 3OY1A 4FTIA 1VEBA 2G2FA 5AUXA 2YERA 4EH9A 4OAUC 2NP8A 4NWMA 4CZYB 4XCUA 4D2VA 4EOIA 5A6OA 2O3PA 5CAVA 4DG0E 2PVLA 3RM6A 4BGHA 2X2KA 2WTWA 3CGOA 1OZ1A 2ZB0A 5DI1A 3UZTA 4G5JA 4O21A 1Z9XA 2B7AA 4Y85A 3GCPA 2XVDA 4WBBB 2RFSA 1OI9A 4XV2A 4D1ZA 3G6GA 2YCQA 5D7VA 2PUNA 5HBEA 4CSVA 5CF5A 4DEDA 5KBRA 4O84A 2OWBA 2B1PA 2ITVA 2BDWA 2VTAA 5ANKA 3FZRA 4AZWA 1LPUA 3OT8A 3VRZA 4TYJA 2I40A 4FZFB 5FWKK 2YM4A 3NW6A 4AZFA 4R7HA 4IVAA 4R77A 4RVTA 5BQ0A 5FM3A 5CSHA 4BGGA 4IADA 4AN2A 4K2RA 4IAIA 2GS2A 4BGQA 4FG7A 5CF6A 3O7LB 2UV2A 3ODZX 2JITA 4ZTNA 4CLJA 2HXQA 2C6TA 3NUYA 4RJ7A 5HCYA 3U8WA 1G8AA 4RIYA 4O81A 2HWPA 4G3FA 4DH7A 1E9HA 3MPAA 4CVAA 1K3AA 1VYWA 5C9CA 1UU9A 1YOLA 2IN6A 3E3PA 3AGLA 3I0QA 2X7GA 4FKLA 2QI8A 4YMJA 4QTCA 5BYLA 4DFLA 3H9OA 4BIEA 2WMQA 5LXMA 5EKOA 4IAKA 4IB1A 3Q6UA 4APCA 4FSWA 4J71A 3ID6C 3HUCA 3ZTXA 3ZEPA 4AZSA 1JNKA 4W4YA 3VUHA 3KVWA 1OPJA 2PVRA 3QYZA 3E8NA 4UB7A 4FTMA 4TRLA 4CGAA 2IVSA 4QOXA 3ROCA 2PVMA 5HICA 4D2TA 3QZFA 4CKRA 1J1BA 4G3DA 4BCMA 4D2SA 2QG5A 5L3AA 5EQYA 2YM7A 4Y8DA 2PVHA 3CTQA 3I6WA 2QKRA 5EHYA 5HE2A 3F66A 4JJRA 4PP7A 3PPJA 3VS0A 2G01A 4QP1A 5D11A 5A3XA 4HW7A 3BGQA 3DXQA 2PSQA 2WTCA 3MWUA 4F0IA 4F9AA 2GNHA 4KIKB 3R9NA 1PY5A 4EOJA 4QMXA 4ASEA 4DITA 3TI1A 2Y4PA 2XM9A 1AGWA 2JKOA 2PU8A 4A07A 4ERWA 3LIJA 4IWPA 4M68A 4DH8A 3PIXA 4U43A 2YACA 2RL5A 4PPAA 4EOMA 5L6OA 4O0VA 3PY0A 2YJRA 2ZDTA 3D2IA 5BVDA 3F3TA 3KXXA 4NU1A 4ID7A 5I3RA 2QG7A 3ZS5A 4DTBA 4PTCA 4FSTA 4QQJA 1OMWA 2OU7A 3GB2A 4ZY6A 3L8PA 2JBOA 4BCNA 5HX6A 2X4ZA 4XBRA 2FH9A 3R7VA 4QT1A 3ZRKA 1QPCA 2Q83A 3GC0A 4KKHA 4F6UA 4KBCA 3HA6A 2W1CA 4I41A 4ERKA 1JSVA 3EJ1A 5EOLA 1FOTA 4KBAA 5E90A 3QWKA 3UG1A 3DBFA 2V0DA 3BHHA 3R7UA 5FG8A 1APME 3KVXA 3R04A 4FIIA 3P5KA 5F95A 3FL4A 1Y57A 4YBKA 2ITXA 2GTMA 4GKHA 3FI4A 3C5UA 5KHXA 4YR8A 3CLYA 3OC1A 3AT4A 5EM5A 3H30A 3OT3A 4GW8A 2HW6A 4FTLA 4O0RA 5EYDA 2BDJA 4ZTLA 2YFXA 4JG6A 5CU4A 3R8ZA 2BR1A 4M3QA 5EQPA 5DIAA 3EMGA 2OH4A 5T6KA 4UMRA 4D2RA 4V0GA 3VULA 4I23A 3OMVA 4F6WA 1PXKA 5M4IA 3CIKA 4FKVA 3QHWA 1SZMA 1YXSA 3TZMA 2J0JA 3SXRA 4EYMA 3SLSA 4M13A 4N0SA 4CKIA 5D10A 3H0YA 5HX8A 1B38A 3OVVA 3HNGA 1LEZA 2WO6A 3CD3A 2P0CA 1CM8A 5L2SA 2V5QA 3HRCA 4RFMA 4FT7A 3M42A 4L3PA 2ZAZA 5BUEA 2Z7SA 4D58A 4U40A 4CQGA 3QZGA 5KMLA 1UNLA 2C6OA 2FO0A 3NNXA 4JRNA 2JDTA 4W9WA 1MQBA 1RQQA 3D5XA 3C4EA 3D94A 3I0OA 4D2PA 5AP2A 3WE4A 2EU9A 2RIOA 2X2LA 1OGUA 5KMJA 2C6KA 5A9UA 3MS9A 3FSFA 3WYXA 4RFZA 1ZYDA 4NFNA 4U97A 1MRVA 5DVRA 3DK7A 1OIQA 3FPQA 4PWNA 4GRBA 4W4WA 3RNIA 5GIOE 3DBDA 4B8LA 2ZM4A 4WHZA 4YP8A 5HO7A 3LCDA 4RVLA 3ACKA 1BLXA 2BZIB 3NVMB 1NT2A 1J7LA 1H01A 4E73A 3VS6A 4DTKA 5HIBA 3C4CA 5E8WA 3MJ1A 3UC3A 4G3GA 4PV0A 4QQ5A 3MBLA 1A06A 2XNPA 3Q4UA 1YVJA 2C5XA 4FV6A 2Y7JA 3MY5A 4KABA 1V0OA 3BYMA 3PG3A 5DRDA 4BDEA 4K0YA 4USFA 1BI7A 3RCJA 3OF0A 1QPDA 3FMKA 4UMPA 1URWA 3GEQA 3MVLA 4J8MA 4OR5A 2PVYA 2V7AA 2YM5A 5HG8A 3DT1A 4HYUA 4GFOA 3NMUF 3TTJA 4FNZA 5EM7A 4F1TA 3SX9A 4YZBA 4C34A 2WD1A 3R00A 2WZJA 4FT5A 4HGEA 2C47A 3FEGA 2RF9A 3OG7A 1Q8UA 4E20A 3QA8A 2PVNA 5CANA 5C4KA 3KK9A 4I20A 4I4EA 5E1EA 3F2NA 4DGLC 3PVWA 1IR3A 3QQUA 2DQ7X 3P7CA 1VZOA 3QKLA 3LM0A 3FI3A 5LQFA 4FTTA 4AN9A 1YXVA 3EQIA 4IQ6A 3RMFA 4IZAA 1DAYA 5JGDA 3U4UA 3EFWA 4DEBA 5L6WL 2B9JA 4JL9A 3A62A 5FBNC 4DTAA 4BI0A 3DBQA 4GK4A 4C4JA 3MPTA 4KA3A 5LVPA 4PPBA 4GS6A 5KMKA 4ENXA 5CSXA 4OW8A 3BQRA 1XKKA 5B2MA 3N4UA 3BHUA 5AUWA 3QTSA 2Z2WA 2FSOX 2JFLA 3S00A 5DEYA 3DFCB 3EQDA 5AUVA 4DCAA 4IJPA 2Y0AA 5D9HA 3S95A 4O22A 5H8GA 4KIPA 1Q8WA 4ZJJA 2HENA 1Z57A 2OSCA 3EQPA 4YO4A 5IUGA 4QQCA 4X2JA 4HVSA 3P1AA 3DB8A 3W1FA 4D4YA 1Q62A 3OBGA 1M7NA 2ITZA 5AAEA 4OTDA 3PXKA 5DT0A 5LOHA 3FHRA 3L9LA 4GU9A 3ZM9A 3VF9A 4BRXA 3IONA 1BKXA 4KIQA 3PXZA 3LQ3A 2C68A 2ITQA 4O86A 1QL6A 4DHFA 1A48A 2ITYA 2W99B 4NJDA 2JDOA 4HJOA 3ZXTA 2GTNA 3TZ9A 1WVYA 2REIA 1JPAA 3ZU7A 5AP3A 2G2HA 1XHAA 3KRJA 3S0OA 2VO7A 2Y8OA 1DM2A 3AC5A 4BDAA 4YBJA 4IB5A 2CKQA 4BBFA 1S9IA 5LCJA 3NYXA 4ANNA 3OW3A 4Z7HA 5HU3A 4GT4A 4IDTA 3EHAA 2R3QA 4F09A 5L2TA 2PY3A 3S2PA 1R78A 4IMYA 4GT3A 5FD2A 2OF2A 3NW7A 2GSFA 1ZMVA 4RFYA 1YRPA 4DC2A 1LR4A 4BYJA 2JIVA 1PXPA 2GMXA 5CI6A 4E5BA 2YIYA 4EONA 2YISA 2KTYA 4AT4A 4L7FA 3RK9A 5CEOA 5GNKA 2W1EA 3FKLA 2VGPA 3ZRMA 2F7XE 5G1XA 4EK3A 4FG9A 3O50A 4MVFA 4NIFA 3QQHA 4ZAUA 3CJFA 5AEPA 1WFCA 4NKAA 2B53A 1PYXA 2BIKB 3AC2A 1B6CB 3FMJA 3R7OA 3R1SA 4ZIMA 3TJCA 4DE4A 3OROA 3PPZA 2OF4A 2WU7A 5LMKA 2FB8A 2OBJA 3W2SA 3NYNA 2VTMA 3R7GA 4RX8A 4FKIA 4UV0A 2OG8A 4ACGA 3PXQA 2UW5A 2J0MB 4QNAA 2XK9A 3R1NA 4MD9E 3CXWA 4AZTA 5I9ZA 2RKUA 4BDFA 2IWIA 5E8XA 4QTEA 4NCTA 4YLKA 4FGRA 4QRCA 3E8DA 5CEMA 3QZIA 4BCIA 3VS5A 3WF9A 5F9EA 4TWOA 5IQFA 1JKLA 4ZTMA 3C4WA 3BGPA 4O2PA 3AMYA 4AP7A 1FMOE 4ZMFA 3I5NA 2JIIA 3JUHA 5A4QA 4I6QA 1OM1A 3QLGA 4AE6A 4XS2A 2VX0A 1FBNA 1KOBA 1SM2A 2FGIA 2YCFA 3KA0A 4I94A 4R5SA 3DJ7A 4F7SA 4O27B 3TDVA 4DF3A 4QP6A 4FC0A 3IG7A 5JFSA 3KULB 4G1WA 2V55A 1YHSA 5KNJA 4O1PA 2YM8A 5J7BA 2OIDA 4AWIA 4R3PA 1TQPA 4I0TA 3LCOA 4MWIA 2IPXA 2JLDA 2JAVA 3AG9A 5M56A 4FF8A 3TNPC 3FPMA 4EL9A 1UKIA 1NW1A 2LGCA 4EH5A 4NT4A 4X6QC 1PXNA 4U8ZA 4D0XA 1JQHA 5DBXA 4L68A 2P33A 5L2QA 4USEA 3D15A 2C5VA 4PDSA 4UBAA 3UO4A 3CPBA 3G0EA 2QOLA 2Z60A 1XH7A 3DGKA 3FAAA 2VWIA 2YM6A 3HGKA 3UO5A 2B0QA 3ACJA 4O7WA 5H2UA 2CLXA 3RZBA 3ZUUA 5FGKA 5CALA 4RZWA 2A1AB 3A2CA 4QO9A 2QHMA 2Q0BA 2X9FA 1Q8YA 4UXLA 4AGUA 3SXSA 3EN4A 4BYIA 2W96B 4M14A 3C9WA 4R78A 2W1HA 3QD2B 4D9TA 3QXPA 2PUUA 4GCJA 3V6RA 4YNEA 1Q5KA 4DN5A 4D4VA 1H24A 4C4HA 2NO3A 4XRLA 1ZY5A 1BYGA 2YIXA 3V04A 3VS4A 4DT8A 3VNTA 3ZCLA 4PY1A 1NA7A 3Q52A 1SNUA 5E91A 2GCDA 5DR2A 4ZSGA 3UIXA 4HCUA 4IH8A 5ANOA 5C26A 3JS2A 3WIKA 1IEPA 2F57A 3FYKX 4I3ZA 5CEQA 4YLJA 1JKSA 4NEUA 4OGRA 4PF4A 4NTSA 2W4KA 2W1ZA 3WARA 5M44A 2XCKA 4L01A 3L1SA 3DKOA 4JG7A 4JLCA 3WZJA 2XNOA 4KIKA 4CCUA 3PJCA 3F6XA 4JIAA 5HORA 4MNEB 2W5AA 2ZV7A 3BELA 2HCKA 2ETMA 4RJ8A 3MJ2A 1I09A 4UN0C 2UZWE 4TYEA 5EK7A 5IA4A 4B8MA 1YI4A 3W2OA 4F9CA 3TT0A 1YDSE 3PSBA 1J1CA 3AXWA 4NTTA 4EOLA 4ALVA 5TOZA 4D2WA 4QMNA 5CU6A 4E8AA 2XEYA 2UZVA 3FYJX 3S4QA 4AA4A 3MDYA 3PIYA 2LAVA 2UW0A 4IZ7A 2XNGA 3R9OA 3O7LD 4R1YA 1DAWA 4MXXA 2XZSA 3C0IA 3DKGA 4EJNA 3MGYA 1PXIA 3THBA 3K3IA 4IFCA 3FZSA 4EUTA 3TCPA 2ZV9A 3KRRA 2CSNA 3Q3BA 4J99A 4DAWA 4J53A 5K5XA 3FC1X 2FVDA 4XG9A 4YZCA 2C1BA 3UO6A 3DBCA 2QOBA 5C27A 1O6LA 5GZ9A 2CKPA 5L6PA 4HYSA 4G6OA 4I4FA 2VU3A 2CHLA 2Z7LA 3WOWA 4PL3A 1XBBA 3T9IA 4DYMA 5FQDC 3PUPA 4E93A 2QR8A 4EOPA 4F7JA 5HTBA 5I9VA 5IZFA 4CFMA 4CG8A 2JDRA 4HVIA 1H27A 4KD1A 2YN8A 3HRBA 3ATSA 2GU8A 4NH1A 1MP8A 2OGVA 5M08A 4NUSA 4U5JA 3VBQA 5CQUA 2NRUA 3IW4A 1ZOGA 3EN7A 5CLPA 3V51A 5IPJA 1Y8GA 1PMVA 3HRFA 5AV2A 1JSUA 3PIZA 4RIXA 3ZLWA 5CSPA 1Y6BA 4I5MA 4LOPA 2HXLA 3BEGA 4AFJA 3KXGA 2VTIA 3CJGA 3QLFA 3WI6A 1OL2A 4W4XA 3BYUA 1JAMA 5J9YA 2QD9A 4BDIA 3RBWA 3EL7A 3E64A 4J52A 1PRYA 1H25A 2BHHA 3LXLA 1FGKA 2IZSA 5KE0A 3E8EA 3SAYA 4NW5A 2XYUA 2ITPA 4C0TA 3EQHA 4X2FA 3GNIB 2UVZA 3OWLA 4J7BA 4FIEA 4YJTA 1BX6A 5HVJA 5JGAA 1UVRA 3RTPA 1W83A 5J7HA 3PE1A 3VUDA 5B2LA 5I9WA 2QOIA 4LUDA 1X8BA 3DBEA 5FEQA 3DK6A 2X6DA 2WMWA 4C3FA 3LFEA 4GMYA 4LMNA 4H36A 5GJDA 3ZH8A 4BHZA 3BHVA 2IVUA 4BDJA 1XH6A 1JOWB 5JEBA 3ANQA 3F2AA 4LL0A 2WHBA 3SD0A 4ANMA 3U9CA 5DG5A 1UV5A 2B9IA 3OY3A 4U79A 4ZSJA 3TTIA 3PTGA 4QMQA 4FVRA 1KV2A 2XA4A 4G6LA 4RIOA 5CYIA 3CTHA 4S32A 3EYHA 4FMQA 5I9YA 4YJSA 5AAGA 3U4WA 3DQXA 4AGWA 3HMOA 1WCCA 2QCSA 5J87A 2PTKA 4CEGA 5DT3A 2YWVA 2P4IA 4K18A 3UE4A 4P2KA 4GFMA 3RPOA 4YSJA 3CY3A 2ITTA 4I1ZA 4UY9A 3C51A 3R30A 1PJKA 4YZDA 1TVOA 3PG1A 2R3JA 3QU0A 5FUTA 4S31A 3GOPA 1BL7A 5I3OA 3LFCA 4I6HA 3R2BA 4F0FA 1V0BA 3OWJA 2X1NA 3C1XA 4CFUA 4FYNA 3HV3A 4O2ZA 4I5CA 2CCHA 5KCVA 3UVRA 2QO7A 3U9NA 2NRYA 4KSPA 3MPMA 4AW5A 2CN5A 3GCUA 5AV0A 2UZEA 4IWQA 1ZZLA 3DJ6A 3EN5A 2C3KA 3F3VA 3CS9A 2HK5A 1UU3A 3DK3A 1H08A 3NS9A 3RWPA 3OZ6A 4FTNA 5EG3A 5IA3A 2VTOA 3G33A 2FSLX 3LCKA 2UZLA 5CX9A 2EXEA 3LFBA 2R2PA 1QMZA 3SVVA 4OLIA 5ANEA 2ESMA 1H00A 4GKIA 2IG7A 4BZOA 4IXPA 2I6LA 2VO3A 2YWPA 5EYMA 3O23A 4P7EA 1LUFA 3TJDA 4FV5A 4XBUA 5BMSA 3OOMA 3ZLYA 5E9EA 4TZRA 3WZDA 5HZNA 1OBDA 1YQJA 4B6LA 5IA5A 2YLEA 3MTLA 4K1BA 3ZUVA 5HI2A 5FXRA 4FKUA 5E1SA 3FUPA 4BKZA 3TNIA 4G3CA 3SXFA 3KQ7A 2WMAA 5JRSA 2WAJA 3TIZA 1H1QA 3EZVA 3G6HA 3KMUA 2PMNX 4ZZOA 3QWJA 4CQEA 4LGGA 3QRUA 5BUJA 3ZO3A 4EH8A 4YJRA 5FXSA 2WTJA 3RPRA 1OECA 3KXHA 3LFAA 1V1KA 4ZZMA 2C3JA 1J3HA 4FZAB 5BX0A 3G90X 3COIA 2VGOA 4E5WA 5FTGA 4E6QA 3R02A 4IB3A 2Z7QA 3A4OX 3BU5A 1PYEA 2QVSE 3LFDA 2DWBA 2RFDA 4FKQA 1B39A 4RQKA 4U44A 4XYFA 4BBMA 5K0KA 2R7BA 2W5BA 4I24A 3W33A 4FV8A 2ETKA 4YC6A 3RCDA 2JFMA 4GUBA 2P2HA 3QTUA 4L44A 3WZKA 4YUQA 3DXNA 4H3BA 3G51A 5LMKC 4RJ6A 1QCFA 4IX5A 1O6YA 3IPHA 2BILB 4C33A 2C5OA 3ZSGA 1OKYA 3MFTA 1Q99A 4AFEA 4QPMA 1VYZA 4GEOA 3R8UA 4IVDA 4D28A 4X2GA 3VW8A 2QLUA 4HVGA 3AMBA 4TYGA 2VAGA 3QQFA 5KHWA 3UYSA 3F9NA 1UNHA 4PDYA 3PA5A 2JAMA 3CR0A 2ZB1A 4LRKA 5IG1A 2V62A 1KSWA 2WMRA 5AJQA 4A7CA 4FSRA 5J9ZA 3GU7A 1YI6A 4FE2A 2VTLA 2PMOX 4UMQA 3IW5A 4FTKA 4F1MA 5E8TA 4TL0A 1CKPA 4YC3A 4QP7A 1JSTA 3LE6A 5CI7A 3R8PA 2CKOA 2PULA 3LPBA 1A9UA 3Q96A 4YO6A 3Q53A 2R3PA 3D2KA 4APPA 3Q2MA 3OTUA 4TKSA 1PXMA 4QMPA 3KCKA 5GZ8A 3CE3A 1G8SA 5FTOA 4YZMA 3COMA 3DDPA 3KL8A 5FEDA 5IA1A 3UMWA 3MH1A 3QTQA 4WD5A 1WBWA 3VUMA 2OKRA 3ZHPC 2CGVA 4LI5A 1Q3WA 4FSQA 5J1VA 4FTRA 3CQEA 4RA5A 2C5YA 3LHJA 4JR7A 3BLHA 4IBMA 3POOA 2XMYA 5DT4A 3ZC5A 4ZTQA 5ICPA 5ANJA 5FBOA 4CRSA 5CXHA 3KULA 2WQNA 2YIWA 3FV8A 4P4CA 3LJ0A 3P4KA 5BPYA 2P55A 4IVBA 3VUIA 3PJ2A 4KKGA 5DNRA 3EQRA 5HQ0A 1Y8YA 3TM0A 4H05A 3LCSA 3U6HA 2XM8A 3C13A 4FUXA 3IO7A 5FEEA 4DFUA 2ZM3A 3GCSA 4TNBA 2WELA 3CKXA 3WILA 3FMHA 3NIZA 5AP4A 2WKMA 1ZYCA 3JY9A 2R3MA 3D9VA 4A4LA 2I0VA 2HW7A 1OBGA 3WF8A 4U80A 4BZDA 4DEGA 5IH6A 3DAJA 2IW6A 3CP9A 2JKKA 3PWDA 3F69A 2HY0A 5BVWA 3SOCA 5IDNA 2VTTA 2IZUA 4I0RA 2WMTA 4FR4A 5KO1A 2YEXA 4XG8A 4YU2A 1GIJA 2UVXA 4FYOA 1RJBA 4JX7A 1Y91A 2ONLC 3U54A 3BE9A 2AYPA 5E7RA 3N9XA 4PNKA 2WOUA 4XJ0A 4BCFA 3K5VA 4FKRA 4GIHA 1SMHA 2XS0A 1WMKA 3H4JA 3I7CA 4XP2A 1YXTA 5FM2A 3C50A 1LP4A 4CCBA 1WVXA 2NNWB 4TYHB 4RC3A 5HLWA 3HA8A 5CT0A 4YGAA 4UWBA 4DLIA 4FVQA 2XK6A 4Q2AA 5AM7A 5C8KA 3HZTA 3K54A 4CFWA 3K3JA 5M4CA 4RWLA 3SW7A 5AV1A 5EYKA 2DS1A 1FQ1B 4JIKA 4AZVA 4V01A 2RGPA 1R0PA 1XWSA 3WIGA 3DOGA 2AC3A 4RVKA 4EH4A 1SYKA 3R1QA 4RX7A 1ZYJA 1G5SA 3REPA 3ZMMA 2YM3A 3VS2A 4QMMA 5AUYA 2YAKA 4UZDA 2PE0A 4L43A 3ORTA 4O82A 5HNGA 2R3RA 3RZFA 4HGLA 3F5XA 5H9BA 4X2KA 3UMXA 3GU8A 4MNEA 4MF1A 4Y83A 4PX6A 2X9EA 5B2KA 5IQDA 4K8AA 2XUUA 3DLSA 4AN3A 2BRBA 1IA8A 2VUWA 3ERKA 3QALE 2IJMA 3R21A 3DAKA 3Q32A 4XEYA 5FDXA 1RE8A 1Q24A 4FTQA 5J5TA 1J91A 3QF9A 2B55A 4E6CA 5AFVA 4QPSA 4QYGA 4RIWB 3ORPA 3D5UA 2HZIA 3GP0A 4YTIA 4BCQA 3V5TA 3AGMA 4ITIA 2EB3A 4CTCA 3VF8A 2RFEA 4N57A 3BRBA 4IAZA 3MI9A 4QMVA 4EZ3A 2IVTA 4C2VA 2OICA 2OXXA 4L52A 3KRXA 4UWYA 2BKZA 2VO6A 4KAOA 3F5PA 1PW2A 2BRMA 3ZOSA 1OL7A 3IOKA 4EYJA 4GU6A 2C0IA 4NM3A 4QP3A 1M2PA 3AC3A 4CYIA 5B7VA 4BHNA 3DCVA 5D7AA 1OL6A 3LFQA 2YDJA 4A06A 3LFNA 4BF2A 5DLSA 5CWZA 1VR2A 3E7VA 2CJMA 3UP7A 4WNKA 4FEXA 3MB6A 4DGNA 1U5QA 5JKGA 4OBQA 5JT2A 4ASDA 5CZHA 3TUBA 4DH3A 3UZRA 4XLIA 4M84A 3QKMA 4LV5A 4YC8A 4UALA 4HNFA 1OKWA 3EQCA 3FY0A 4Y72A 5M07A 4JBPA 5E8YA 3Q4ZA 2VRXA 1UKHA 1M7QA 2HY81 3FZTA 3GC8A 3IDBA 5HVKA 3DS6A 1REKA 4GT5A 4I93A 4M0ZA 2XNNA 4Y95A 1YXUA 5EI6A 2RG5A 4FZ6A 4P5QA 3RP9A 1UWJA 3P78A 3VIDA 5C8NA 1XH9A 3ORIA 2JC6A 2Y9QA 2X2MA 3POZA 4J96A 4TNDA 4MBJA 3D5WA 4C58A 2YA9A 2BPMA 3HV5A 4KBKA 1XQZA 4GJ3A 5ANIA 3A4PA 1NVQA 2QO2A 4ZSLA 3VBWA 4ZLYA 4EHEA 3N51A 1YHWA 4U42A 3C0HA 2OLCA 4F0GA 3P0MA 4C4IA 3NNWA 2SRCA 3H10A 5J79A 4RJ4A 3FXXA 2XKCA 3F82A 4MXZA 4DG2E 5JSMA 2ZV2A 5AP0A 1GZ8A 4AQCA 3R1YA 4PDPA 3EFLA 4DLJA 4YTHA 3PVGA 4EH2A 3NUXA 1CKJA 3MV5A 5AR2A 3LMIA 4PMSA 2YDKA 3FLYA 3NGAA 2R64A 3EYGA 4DH1A 4E5AX 3IECA 4WNOA 1WBPA 3W2PA 4WNMA 4AW2A 2IW9A 1K9AA 1WBVA 2GFSA 4LOOA 4RC2A 2C6MA 3QCSA 2W1FA 3HUBA 2QODA 4K11A 4FZDB 3LXPA 4KRCA 4AT3A 2BTRA 2EXCX 3SV0A 3QGWA 5LMBA 4ZMEA 3A60A 2ITUA 3BCEA 3VRYA 5I0BA 3FHIA 2BRNA 3OCSA 3V6SA 3RINA 1F3MC 5HGIA 5CU2A 3NUSA 3VS1A 2OZAB 1FVTA 3ZLXA 3ROYA 5ETFA 3Q60A 3OFMA 4GL9A 4BI1A 1I44A 4OTQA 4EC9A 3HP5A 1OL1A 4FSNA 4WUNA 3BYSA 4WSYA 3WYYA 2J51A 3R6XA 4FV2A 3OHTA 2E9VA 2R7IA 2VN9A 4IDVA 4RBLA 3ELJA 3V5QA 2OXDA 3UYTA 1IA9A 3R0TA 2UUEA 4IEBA 1EH4A 4O0WA 4L42A 2A27A 5IH4A 3QTWA 3FXZA 3RAIA 3T3VA 4EC8A 5K4JA 5M06A 1J7IA 2UW4A 3ZDUA 5M4FA 1DS5A 4ZZNA 5AA8A 5CVFA 3S3IA 5IDPA 2QOKA 4X21A 3ORXA 4G9CA 3OEFX 4FODA 1QPJA 3V3VA 1PMUA 4M12A 4YHFA 4AE9A 2C4GA 2G2IA 1SVGA 4RG0A 3W18A 3L9MA 4FKGA 3LXKA 4WA9A 4AA5A 1PMNA 2WTDA 2JDVA 4ZXTA 2Y6MA 5HCZA 3ITZA 2WIHA 2BRHA 4LM5A 2B4SB 3QYWA 2A0CX 1UU7A 3MA6A 2BDFA 3RKBA 2J0IA 4F6SA 4M69B 5GJFA 1QPEA 2QC6A 3PPKA 5HIEA 5CVHA 4FEUA 4RQVA 4R8QA 1Q8TA 5KMIA 4YJOA 4QQTA 5CAPA 5M51A 5AR5A 4IWOA 4MQ2A 3TXOA 1FPUA 2ZYBA 1OIUA 4X7QA 1JLUE 3HP2A 3ZC6A 4D1XA 4PL5A 4TN6A 5K5NA 2VWWA 4XHKB 2NPQA 3WZUA 4TWNA 4YZ9A 4ZSAA 5H8BA 3OCBA 4YPSA 2XKFA 3R8MA 4CV9A 3E93A 4GK3A 5L8JA 5LMAA 4FKTA 4G16A 4QMYA 3V5WA 4WUAA 4UYNA 4PDOA 5IUHA 3ZDIA 4ALWA 4FOBA 5G6VA 4C62A 3OBJA 4BI2A 4RLKA 5DPVA 4MYGA 3VUGA 3F3ZA 1M2QA 3Q9XA 4JT3A 4DT9A 3PXFA 3SW4A 3PVBA 4I5PA 4ASXA 4GIIA 4Q9SA 2X4FA 3U87A 4EEVA 3FXWA 3GCQA 1YWVA 1KE9A 4XV3A 2W9FB 4YTFA 3DV3A 4BCGA 4IFGA 3ORLA 1IRKA 4X3FB 5JQ8A 3MVMA 2WTIA 2BAJA 4D5HA 3FI8A 5CAQA 3UGCA 4BR3A 2XKEA 3GU4A 1FVVA 3AD5A 4FV3A 4F7LA 4F4PA 2WTVA 4X3FC 4XOYA 4F63A 4K6ZA 3TUCA 3AOXA 4BB4A 3HMIA 5FP5A 4D55A 3FMEA 4OBOA 2UVYA 4WSQA 2J5EA 3LLTA 4BL1A 2OJIA 3KGAA 3FMLA 3TUDA 2CDZA 4QMWA 2EVAA 1GNGA 4O0YA 4YHJA 3TNQB 3WE8A 4EHZA 3PSCA 3BYVA 1ZRZA 4IX3A 3UQGA 4EZ5A 4E6AA 3CC6A 4QP9A 3C4FA 4NK9A 4OTHA 5ETAA 3VO3A 4F9YA 2YITA 2UW3A 2A4LA 2GDOA 2PVKA 3KFAA 3RAHA 3SGCA 3P79A 2W9ZB 3DZOA 4L00A 4RJ5A 4RPVA 4X3JA 2BZJA 4U45A 3W8LA 5CXZA 4BDDA 3BHYA 3SOAA 3ZXZA 5L2IA 3DFAA 5F94A 5JQ5A 1IAJA 4I22A 2GHLA 4BTJA 4BTKA 1XH4A 4FZ7A 4PMMA 2GPHA 5A46A 2R3LA 4H3PA 3A99A 4EHGA 1T45A 4QMZA 2R3IA 2YDIA 3CEKA 4JQ8A 4V04A 3T8OA 3TV7A 4EKKA 4FV7A 4L8MA 4PTGA 3UBDA 3M11A 4XG4A 2IW8A 4O7TA 3G9LX 5BMMA 4HGTA 3A7HA 3RHXA 3SDJA 2VV9A 1L8TA 4MBLA 3G15A 5AMNA 2VX3A 4JR3A 4IB0A 4PUZA 1WAKA 4RGJA 1ZYLA 2ZDUA 2ONLA 2R3HA 3GOKA 3ZLSA 5CEKA 4YJQA 3VBTA 1MRYA 4EH7A 2YZAA 3TEIA 1BUHA 4ZJVA 2XYNA 4IC7A 2YZLA 3MIAA 4IVCA 3QRJA 5AX9A 3NCGA 4AW0A 4EKLA 1J7UA 4EORA 3PXRA 3QCYA 3LQ8A 3SQQA 3V01A 4FL2A 4G6NA 4JS8A 2GNJA 5HE3A 4DEIA 4OAVB 2XBAA 5DFPA 1KE7A 2X39A 4XLVA 1H1WA 4MAOA 4E4LA 4O7SA 2ITWA 3FL5A 4TYHA 4EI4A 1IASA 2ACXA 4BCHA 5J9LA 5KZ0A 3RWQA 4BICA 2J6MA 4RMZA 3O8UA 3QX4A 3VHKA 3QAME 4IIRA 3HL7A 4ITJA 2CNVA 4M97A 3PFQA 2YAAA 4E4NA 2C6EA 1GJOA 2F7ZE 5AP1A 5EDPA 3QA0A 5IISA 3K2LA 3F88A 4ZJIA 2I0HA 4G5PA 1GZKA 3QKKA 2PZRA 3MY1A 4FK3A 5CAOA 4YJNA 5JFVA 4IE9A 5C03A 4JNWA 1JBPE 3C4ZA 3UC4A 4Z3VA 3UQCA 4PPCA 2BROA 5AADA 1O6KA 4TY1A 5HE0A 2W06A 1OB3A 5J95A 4DBXA 1P5EA 3RVGA 4ZLZA 2W17A 3Q2JA 4FEVA 3AD4A 1CDKA 5AV3A 4LRJA 4OTGA 4DH5A 4EOOA 4Z55A 2Y4IB 4XV1A 4AW1A 1CKIA 2PMLX 4LUEA 4Q5EA 3UDBA 2W4OA 3DKFA 1OKVA 5BVEA 2FUMA 3QTIA 3OEZA 1FINA 3PVUA 5KBQA 2Y4IC 4RIWA 1PXLA 3VC4A 5CU0A 4RRVA 4ANBA 3FZOA 3LVPA 1M14A 3PSDA 4H1MA 4BDGA 1KE6A 1YKRA 2E9UA 2GFCA 3R2YA 4IAYA 5A4LA 1UU8A 2F2UA 3UJGA 3VN9A 4MNFA 4D4SA 5DH3A 2X7OA 3DTWA 4MD7E 2XK3A 2ETRA 5AP7A 4BCOA 3E62A 3KXMA 4TWCA 1UWHA 2QU5A 4USDA 1PKDA 5C8MA 4GVAA 5CS6A 4IAAA 3QTZA 4YTCA 5A4TA 1U4DA 5A6NA 1TQMA 3HDNA 5IA0A 1YXXA 3OCTA 4PL4A 3ORKA 4KIOA 2HELA 3MH2A 3HVCA 5L2WA 3RPSA 3TZ8A 2R3GA 4J98A 5ANGA 3F7ZA 3PLSA 5E8UA 4GG7A 3TG1A 1H0VA 3KN6A 2WEIA 5JH6A 4W4VA 1UNGA 4G34A 4U81A 2HWOA 4HYIA 3ZFYA 1OITA 5HHWA 5FTQA 4YURA 2GS6A 3A7JA 4BZNA 4LFIA 3MTFA 5TT7A 4AXAA 4B9DA 4H39A 4OT6A 5EDRA 2B54A 4IW0A 2UZNA 3JYAA 2ZMCA 3C4XA 4JBOA 3ZUTA 3LKMA 2VWVA 4GG5A 3HEGA 3MFSA 3OXIA 4FT9A 4MBIA 3QTRA 2WMBA 3CCNA 5IQHA 3NEWA 4F70A 4Z16A 4N6YA 1FGIA 3L8VA 4IJ9A 5GZAA 5DYJA 4FIHA 2HZNA 1XR1A 3E8CA 4XOZA 4YLLA 4D4RA 4ZS0A 3EQGA 2ZV8A 3EB0A 3VUKA 2BHEA 4BCPA 5IQCA 2CGXA 2F2CB 2UZDA 5M4UA 2XIYA 2I7QA 5DRBA 4II5A 4CRLA 5E92A 3WF7A 1PHKA 4H1JA 1MQ4A 3UPXA 4CMOA 3VQHA 3PXYA 2PUIA 4NZWB 5AUTA 4XG3A 3ZSHA 1H1PA 4BKYA 3H9FA 3LFFA 4TT7A 2GNGA 4C02A 3PP1A 3O17A 5HNIX 4A9RA 4MQ1A 2WFYA 3EN9A 3OWKA 4LRMA 3NPCA 3QCQA 3SHEA 3UVQA 2JD5A 1U59A 2WMVA 4I92A 4EK8A 1H26A 5CENA 4EZ7A 3UOJA 3SA0A 4KINA 2WPAA 3RHKA 3OW4A 4DGGA 2QKWB 1Q97A 4L46A 4E4MA 4ZY5A 5JK3A 3NUUA 4GFGA 2J7TA 1DI9A 2WGJA 3FWQA 3BIZA 4FVPA 3NLBA 4G31A 4ASZA 5HESA 4QTDA 3ZZWA 4IAFA 4HZSA 3RALA 3D0EA 3KN5A 3O8PA 2JGZA 3FMMA 4QMTA 2J9MA 1ZOHA 3NZ0A 3QHRA 3QBNA 4YSMA 3W8QA 4AOIA 4A4XA 2XCHA 4O0XA 3OUKA 1K2PA 3HYHA 1GIIA 4XMOA 5CY3A 2OZAA 4FKOA 2X8EA 1H07A 4QMLA 4WKQA 4EQMA 3ZBFA 3N4VA 4WOVA 3D7TB 3TN8A 2OJGA 3GQLA 3V5PA 5AP5A 5CT7A 5LJJA 1CSNA 1WBNA 5CSVA 5E8SA 2BAKA 4S33A 4DFXE 1XJDA 3KRLA 1GOLA 2Z8CA 2XKDA 3GU5A 4N4SA 3TDWA 2XP2A 5EHOA 3ORMA 4K9YA 3T3UA 4B7TA 5L4QA 3KREA 4O7NA 5DR6A 5JMSA 3PJ8A 5D1JA 2VTRA 3NUNA 1NY3A 5T3QA 5IKWA 4IM0A 3TV4A 3W16A 2J5FA 3OOGA 2GNFA 3NIEA 2BZKB 2W1IA 3ALNA 3M2WA 5A4CA 2E9NA 4BTFA 5J5SA 3RAKA 1H8FA 4OTRA 3KY2A 3C0GA 2A19B 5C01A 2O8YA 4D9UA 2BKKA 3KB7A 5DWRA 4JI9A 5EOBA 5KKRB 4LQMA 2C0TA 3LQ5A 4HPTE 4EUUA 4FX3A 5AM6A 4XP3A 2BAQA 5IUIA 4EK6A 1PXOA 3MA3A 3D14A 5D41A 5HBJA 2FYSA 2HAKA 4KS7A 2Q0NA 3SC1A 4EK5A 5KKRC 4WG3A 3NNUA 4GJ2A 3TIYA 2ZM1A 3NAYA 3R8VA 2OJFE 4M69A 3TKHA 1ZZ2A 3JY0A 3L9NA 4NIFB 2O5KA 4PNIA 4QPAA 4DEEA 1XH8A 2QQ7A 4FNWA 1ERKA 2F7EE 3UG2A 4XX9A 4C36A 2PPQA 1KWPA 4NYEA 2XIRA 2BTSA 3QUPA 3TV6A 4L53A 4AG8A 4JQ7A 1YOMA 3IW6A 5JN2A 1Q4LA 3CSVA 3QUDA 1Q8ZA 2OW3A 4WNPA 5LVLA 3PRFA 5E8ZA 2VZ6A 3KC3A 1Q61A 2O63A 5CEIA 3BWJA 3L9PA 1KUTA 3FJQE 4A9YA 4QMSA 4R3CA 4BTMA 3P23A 5M09A 2I0YA 5M57A 3BV3A 5EKNA 4XH6A 5HTIA 4A9TA 2Z02A 2VWXA 3SRVB 3FLNC 3GC7A 4JG8A 2QOFA 2R0IA 2YCRA 4S34A 2C30A 3OCGA 3OTVA 4WRGA 5F4NA 2G1TA 1W82A 4FTJA 4EK4A 2VO0A 3R9DA 4CFFA 1GAGA 4UWCA 5AUZA 1JKKA 4LYNA 4IM2A 4JDHA 1ZARA 2WQOA 4JDKA 5CASA 1F5QA 4QYFA 4MK0A 4LV8A 4X3FA 4DA5A 5HE1A 3I6UA 4NW6A 3QQGA 4FL3A 4HVHA 3H0ZA 4B4LA 2XRWA 3FQHA 5HLNA 1ZXEA 1R0EA 2XH5A 1YWNA 1P2AA 3R63A 3MVHA 4O1OA 4IX6A 3KEXA 3BHTA 4TWPA 4CZUA 5IQGA
chains in the Genus database with same CATH superfamily
1M17A 3MH0A 1OUYA 1YW2A 3FLSA 5CEPA 3E7OA 3HX4A 3W2QA 3VBVA 3OP5A 3M1SA 3V5JA 4E6DA 4QDVA 4J97A 3O71A 3FBVA 3KMMA 4QNYA 4I6BA 4ZEGA 4EOSA 5EYCA 4F9WA 4RSSA 3KF7A 4UMTA 4O4CA 3ULZA 4E26A 3U6JA 2UZOA 2WMUA 2F49A 4QYYA 4JRVA 3SG9A 5AX3A 4F64A 3TNHA 4ORKA 2IVVA 3UQFA 2V22A 5IMXA 1H1RA 4NM0A 2IF8A 2BVAA 3AMAA 2I0EA 3GU6A 5K0XA 2VTNA 3ZM4A 5EM8A 3DJ5A 1HCKA 3JVSA 2UW9A 3PA4A 4O91A 3EN6A 2WTKB 4AGCA 3I60A 3TKUA 4CNHA 4EBVA 3B2WA 2QNJA 1Q41A 3I1AA 3FKOA 3KU2A 3KK8A 4S2ZA 1YDRE 3QRIA 3SG8A 4FV9A 1OPKA 2WTKC 3P08A 3Q4CA 3WF5A 3NSZA 5CQWA 3DPKA 3DTCA 5EI2A 5EQEA 3KCFA 3CGFA 5HD7A 4H58A 2YIRA 4TW9A 4HGSA 1DI8A 2F4JA 2JEDA 4ARKA 3PLAE 2C6IA 4XV9A 3QQKA 3EOCA 3BX5A 4GUEA 3C5IA 4FV1A 2VWZA 2WQEA 3D7ZA 5EHLA 2DYLA 2EXMA 3O96A 4R5YA 4ACCA 2A2AA 3BU3A 4YHTA 4FRFA 4RLLA 3QC4A 4CD0A 5CF4A 2Z7RA 4MXOA 2XARA 1YHVA 3JVRA 3BWFA 2VWBA 4OT5A 5TKDA 2OFVA 5CZIA 2W05A 5KMMA 3S1HA 2R9SA 4CG9A 4FBXA 4I0SA 4E4XA 4R1VA 2CGWA 2WNTA 3ENHA 4NSTA 4QTAA 4QYEA 4BDBA 4G9RA 4W8DA 3KF4A 2BIYA 5DE2A 3FDNA 3HMNA 5B0XA 2XIZA 5BYYA 2OK1A 4BY9E 3N4TA 3OXTA 4IX4A 4HYHA 3QX2A 3IOPA 1ZYSA 5K4IA 2CNQA 3QD4A 5EH0A 2AUHA 2C3LA 3Q5IA 1W8CA 4LOQA 3P9JA 4GYIA 4IANA 1REJA 2X8DA 4IWDA 3BU6A 5DA3A 3DDQA 3ZONA 4X2NA 2X7FA 3A8XA 4YJPA 4O83A 2C6LA 3GFEA 4M8TA 3VJNA 4EH6A 3PP0A 4HOKA 4L7SA 4LGDA 4O6EA 5FLFA 4C57A 5HO6A 4DG3E 1Z5MA 3BKBA 5CU3A 5ETIA 5EW3A 4U0IA 2PK9A 5GHVA 3DXPA 3DU8A 3EKKA 3FKNA 2PZPA 3E92A 3NCZA 1P4FA 4FK6A 4MTAA 2C69A 4BWPA 3EQBA 2UW7A 4FSMA 4CLIA 5I5ZA 2XF0A 3PZEA 4JDJA 1YWRA 3OD6X 4C7TA 4F08A 5C4LA 1OGYA 4AF3A 3MSSA 4AACA 2CLQA 4FIGA 4ACHA 4RA4A 2JIUA 2YJSA 5AR7A 4FEQA 5HO8A 4YPDA 3QQLA 4RIXB 4WRSA 3W55A 4UX9A 2R3KA 3IKAA 1RDQE 4J95A 5AAFA 3MESA 4GSBA 4GYGA 3G2FA 2W1DA 1WBSA 1JVPP 3B8QA 4BDHA 4FNYA 4ALUA 5CAUA 3P86A 1TKIA 4HCVA 4TTHB 3ZFXA 1ZLTA 1M52A 3V8TA 5HVYA 4AS0A 2XAOA 2H34A 3R71A 5FP6A 4WG5A 2P3GX 2WEVA 4AZEA 3CKWA 3NUPA 4FL1A 5LWNA 2OO8X 4Z9LA 3UP2A 2E9OA 3NNVA 4V05A 5JFWA 4O7ZA 4MWHA 2CNUA 3LCTA 3KRWA 4W8EA 5LVNA 3AC8A 4PMPA 2VNYA 3PA3A 5E4HA 3HECA 4L45A 3R73A 4D5KA 2UW6A 3HKOA 4XP0A 4CMUA 2O65A 2P2IA 3A8WA 4M0YA 2FSTX 1HCLA 4ONAA 4RWKA 3ALOA 3W2RA 3BZ3A 4MKCA 5HBHA 3WF6A 2GQRA 3ZZEA 5BVKA 3ZSIA 5FDPA 3PY1A 4NM5A 3EH9A 2H96A 3UIBA 5HTCA 4Z7GA 2V7OA 3EIDA 5EFQA 2XRUA 4FTOA 3E3BX 2E2BA 1P4OA 2YLFA 4DFNA 3R22A 4FOCA 4MEDA 4O7LA 1R3CA 2UZBA 3KXNA 5K3YA 4O7VA 3C7QA 4BCJA 2IZRA 3EWHA 3FLZA 3IK3A 4F1OA 3MIYA 3B2TA 5DR9A 4HCTA 3HV7A 4J1RA 3IDPA 5BYZA 2Y6OA 1SVHA 1U5RA 4MXYA 2BMCA 4H3QA 5TR6A 3MH3A 4D1SA 3A7GA 3FLWA 4O6LA 2AEGA 5FRIA 4BWXA 4QMUA 3BBTB 4PRJA 2VTPA 3QTXA 2O2UA 3E88A 4L9IA 4FTAA 3Q5ZA 1Q3DA 2EUFB 3ZO2A 4QTBA 3AKJA 2ZMDA 2OH0E 2XB7A 4FI1A 3E87A 3IDCA 3LZBA 2R5TA 3TACA 4BWKA 4CT2A 5H3QA 5ACKA 2B9FA 2PE2A 2O64A 3AC1A 3PWYA 2ZVAA 1BMKA 4CXAA 4ZS4A 3LMHA 4R7IA 2C1AA 1WBOA 2G15A 3Q4TA 4FGBA 4TPTA 2WQBA 3A7FA 1G3NA 1OVEA 3I7BA 4ZP5A 4BDCA 2WMSA 5CNNA 3BBWA 3HMPA 3MN3A 2W4JA 3FMNA 5J8IA 5IEXA 2VX1A 2CGUA 4ZY4A 3AC4A 2J2IB 3A61A 4X6RA 4FNXA 4KNBA 4A4OA 5CNOA 2H6DA 2IZTA 3I5ZA 3IGOA 3NYVA 3ORZA 3V5LA 4QD6A 2ERKA 2WXVA 4Q9ZA 3ZO1A 2EWAA 2UW8A 4IM3A 3DNDA 4YZNA 3I81A 5EDQA 3OWPA 4YNOA 2J0LA 4KSQA 3W10A 2X81A 4MCVA 3QD3A 3PRIA 4FKJA 3R83A 4XNEA 4CZTA 4ZSEA 3UODA 2X6EA 4FIJA 3CD8A 1XBAA 2QU6A 3D7TA 2HYYA 2JKMA 4I6FA 2WIPA 4O0TA 1U54B 5C1QB 2BALA 3K5UA 1YOJA 4N70A 4AGDA 2OXYA 2PZYA 1S9JA 3F3UA 3VUTA 5IA2A 3MFUA 4EWQA 4LGHA 4QEBA 2BZHB 1IG1A 3ATTA 2BFYA 1WZYA 4LL5A 3E63A 4EH3A 5ETCA 3ZYAA 4O0SA 5I9UA 3FQEA 4JX3A 1O9UA 2J4ZA 3DQWA 4JQEA 4XG7A 5AIRA 4CFVA 4M66A 2PZIA 1OKZA 3QCXA 2GS7A 1ZWSA 3UTOA 5IEVA 2O0UA 3R7IA 4O0UA 4U9AA 3BQCA 5L8KA 3CBLA 1XBCA 2FSMX 4ACMA 3HV4A 4BBEA 3TZ7A 2PMIA 4BFMA 1FVRA 2WMXA 3MVJA 3L8SA 3FE3A 2YABA 4FV0A 4ZTSA 3JXWA 2ITNA 3GQIA 5TF9A 3LLAA 3TKIA 4JMQA 2X8IA 3UNJA 3VBYA 4GV1A 5KMNA 2IEWA 2XJ0A 3D4QA 3MFRA 4FT0A 4WBOA 1V0PA 4EQUA 3NR9A 4ITHA 3BYOA 1W7HA 4AAAA 4QP8A 4KUJA 3LAUA 4DGMA 3NAXA 3BLRA 3VS3A 2VTJA 4C61A 3NW5A 2GNIA 2JBPA 1PF8A 2JDSA 4RC4A 4BIBA 4DFBA 1W84A 3PY3A 3AT3A 3VQUA 1CTPE 1CMKE 4K33A 4OTPA 3UNKA 5DN3A 5LCKA 3EQFA 1GZOA 2J90A 2XIKA 3V8SA 2OJ9A 1VLRA 1KOAA 4U3YA 3B8RA 4D0WA 2DUVA 3DZQA 4TYIA 3RPVA 3ENMA 3QC9A 5HG5A 5CTPA 4HNIA 3BPRA 4JVGA 2WU6A 3Q9YA 5H8EA 3NVKI 3PE2A 3SRVA 3QXOA 1W0XC 4MF0A 1OIYA 4DBNA 2R3FA 5KUPA 3ZBXA 5HNBA 4O96A 2CKEA 5IQIA 1XMMA 2CN8A 2RSVA 4DCEA 3NX8A 5KZIA 2PVFA 3BEAA 4NL0A 2VTHA 3L8XA 3QFVA 4CMTA 4EWHA 2X0GA 4BIDA 5A14A 2W0JA 3NRMA 4RIYB 3NUAA 4KKEA 1NXKA 4C8BA 4G2FA 5HCXA 4MH7A 3GI3A 3DAEA 4JAJA 4C35A 5LVOA 2WB8A 4PQNA 3QZHA 2VWUA 1SNXA 2R3NA 4PTEA 4TXCA 4UEUA 3VW6A 5JGBA 3HAVA 3E5AA 2WQMA 5EM6A 2CMWA 4MXCA 1Y6AA 2R0UA 1ZMWA 1BI8A 2XEZA 4U7ZA 5KMOA 3UNZA 3Q9ZA 3LJ1A 4NJ3A 5JFXA 5A54A 4AAYA 4U3ZA 3VJOA 4C3RA 2ZJWA 3OUNB 3F61A 4FEWA 2XK4A 4FKPA 4WT6A 4G17A 3TL8A 4E1ZA 3UPZA 5GIPE 1STCE 4M15A 3WZEA 1PXJA 4QYHA 1GZNA 4BVUA 4CFNA 2GNLA 4FSZA 3GFWA 4NKSA 5HKMA 3FZ1A 3LM5A 2H9VA 2EB2A 2VTQA 3LMGA 3W2CA 4A9UA 5HIDA 4C3PA 2QOCA 3Q6WA 2OFUA 3EKNA 3MB7A 5HLPA 1KE8A 1W98A 3COHA 3G0FA 4E7WA 3EL8A 2C5NA 4N6ZA 3UZPA 3OXZA 4I21A 3HAMA 2XJ1A 3O2MA 3FMDA 4WG4A 4O38A 2H8HA 4O4DA 4X0MA 5IU2A 5HD4A 2GHGA 3COKA 3IW8A 2PUPA 3JR1A 2PWLA 1URCA 1SVEA 3R28A 3LOKA 4QP4A 2QLQA 3MY0A 4S30A 3ZO4A 5L8LA 3W0RA 1PKGA 4LG4A 1OIRA 3O8TA 3HLLA 4KB8A 2C6DA 4ZOGA 5AP6A 5KX8A 4O4BB 2PZ5A 3ANRA 3QRKA 3KMWA 4CFXA 4I5HA 4ANQA 5AR8A 3ODYX 3ETAA 3GT8A 3PZHA 1H0WA 3R01A 5E8VA 3WBLA 4DINA 4F65A 4HPUE 1H4LA 3ZEWA 1TQIA 2JKQA 4Y46A 4DHJA 4JOAA 3T9TA 1ZAOA 4RX5A 5EW8A 1YI3A 3PYYA 3D83A 4GVJA 3R8LA 4O4FA 5HEZA 1ZMUA 5AR3A 3DNEA 5JZNA 4AQKA 1OL5A 5M55A 1WVWA 2RFNA 1ZOEA 4UZHA 5CVGA 3VWAA 2PYWA 5AR4A 4RVMA 3R7YA 4RX9A 3FZPA 3VBXA 4C38A 4HZRA 4EOKA 4AX8A 1M2RA 4V0GB 4U41A 3AKLA 2XK8A 2YCSA 3UOKA 3TYKA 2VTSA 4FG8A 3ET7A 2FA2A 1F0QA 1ATPE 2PE1A 3FLQA 3II5A 3NDMA 4JXFA 4MD8E 4P90A 5DEWA 5BNJA 4F7NA 4CKJA 2OJJA 3Q04A 4C2WA 4ANOA 1YDTE 3UOHA 4IC8A 2W7XA 4FICA 2VD5A 4OBPA 3UDSA 2ITOA 4FT3A 4L6QA 3KXZA 4CV8A 2HZ0A 3DB6A 1T46A 4ANLA 3IS5A 4LMUA 3GXLA 4EJ7A 3FSKA 3RK5A 1NVRA 4IZYA 3ORNA 4EQCA 3VS7A 5BVFA 1KE5A 4Y5QA 4R6VA 4GK2A 5HOAA 3RM7A 4CTBA 3GVUA 3F5GA 5BUIA 1IAHA 5J1WA 3CY2A 1UA2A 2B9HA 3AT2A 3MYGA 4AT5A 5IQEA 3U51A 5JZJA 3TWJA 5GINE 3OS3A 4L3JA 4DGOA 3RI1A 5T68A 2YIQA 3UIMA 5A4EA 4R7BA 3IQ7A 2PHKA 2GQSA 3AQVA 4BDKA 3V8WA 2B52A 4JBQA 1FMKA 4Q5HA 4RWJA 4B0GA 3R9RA 5M53A 2ERZE 4NFMA 3G5DA 2ZOQA 2J0KA 1HOWA 3PDTA 2HIWA 5D12A 4EOQA 2XBJA 4F9BA 4OUCA 2C3IB 2YHVA 3F5UA 5F20A 3QGYA 4G3EA 4AA0A 5F1ZA 4CYJA 2OIBA 3CQWA 4EBWA 5IEYA 4C4GA 4XG2A 3HDMA 2R3OA 4CT1A 2BFXA 3BGZA 2XNBA 2W1GA 4L67A 2BRGA 5DOSA 2XK7A 3GUBA 4B99A 5IF1A 1NVSA 4XUFA 3RJCA 5EW9A 2XAMA 4DFZE 4C37A 5TO8A 2G9XA 3EFJA 3GGFA 4YJVA 5CF8A 3A7IA 3CQUA 4RT7A 4RWIA 2PVJA 4FSUA 4MXAA 4U6RA 4DEHA 3QD0A 4E3CA 3F3WA 3FY2A 5HG7A 5IQAA 2VWYA 3FI2A 5I9XA 2XIXA 5AA9A 3RPYA 3O0GA 5ITAA 4W9XA 2CPKE 2XJ2A 3GC9A 4PMTA 4O7RA 1MRUA 5HU9A 4ENYA 4BCKA 1AQ1A 4PP9A 3ULIA 1AD5A 3ZFMA 4EHVA 3GENA 4KS8A 3FC2A 3U6IA 3NYOA 1ND4A 2I1MA 3QL8A 3GCVA 1VJYA 3R9HA 4MHAA 4IACA 4K77A 3QUEA 4JAIA 4QP2A 3LFSA 3LJ2A 3GBZA 4KWPA 2HOGA 4BC6A 4A9SA 4Y73A 1OPLA 2IO6A 4NM7A 4GH2A 3PJ3A 5CSWA 1P14A 5GJGA 4M7IA 4RJ3A 2XNMA 5I4NA 3U55A 5ACBC 4BN1A 3BI6A 2QOHA 3BV2A 1R1WA 3BE2A 5EI8A 5AUUA 3D5VA 3IW7A 4FA2A 4FSYA 5LVMA 3I79A 3NFGB 2HZ4A 4ACDA 1KV1A 4AOTA 1XO2B 5DHJA 4ANSA 4C59A 4L3LA 1E1XA 1OUKA 4OTIA 4OTWA 3I4BA 3LXNA 5AV4A 5K9IA 2QOOA 3BLQA 4FKSA 3RGFA 5DGZA 3TNWA 4IHPA 2CCIA 2GQGA 1H28A 5BVNA 3IGGA 2QONA 5AWMA 3H3CA 4FV4A 4O7YA 4MX9A 5DMZA 2W5HA 2XNEA 3O51A 4DFYA 2KULA 2QOQA 3P7BA 3RK7A 5AIKA 4HVDA 4M67A 1WBTA 4JDIA 1H1SA 3Q9WA 1JKTA 4ZK5A 3LW0A 3CTJA 2R4BA 3PJ1A 2J50A 2UZTA 5TE0A 3DA6A 4XRJA 2E9PA 4ZTRA 2QR7A 5FXQA 3RNYA 2AC5A 5IH5A 3H9RA 1GY3A 4C4EA 1U54A 1ST4A 2BUJA 4IZ5A 1ZY4A 3EFKA 1XH5A 3QRTA 3FQSA 4KRDA 3G9NA 4RZVA 4F99A 3CPCA 3NWWA 4P5ZA 1GIHA 2C0OA 4FTUA 2OZOA 3QQJA 4AUAA 2WOTA 3HMMA 3HV6A 4OTFA 4R3RA 2GHMA 3DKCA 3DY7A 4UMUA 3VHEA 2OI4X 2PL0A 3JPVA 4ZLOA 4J8NA 5BVOA 4AU8A 1E1VA 3AD6A 3W32A 3F7WA 2RG6A 2OIQA 5LARA 4FKWA 4DDGA 1RW8A 1BL6A 2QO9A 3DLZA 2F9GA 3UVPA 4DEAA 4BKJA 1MUOA 3VVHA 3ZRLA 1U46A 1L3RE 4FIFA 1LEWA 3MW1A 4JBVA 4WIHA 5IMEA 3KKVA 2VNWA 4Y5HA 4UYAA 5HG9A 3R7EA 4XG6A 4ZTHA 4C4FA 3RAWA 3SKCA 4FUYA 2QURA 5JRQA 4FTCA 3P7AA 1JWHA 3UOLA 4UXQA 3F2RA 5IQBA 4YJUA 1PMEA 4AOJA 4NCTC 1R39A 4QMOA 5ANDA 3VAPA 5LWMA 2BCJA 2UZUE 4WO5A 3UIUA 3EZRA 2QHNA 3OY1A 4FTIA 1VEBA 2G2FA 5AUXA 2YERA 4EH9A 4OAUC 2NP8A 4NWMA 4QDEA 4CZYB 4XCUA 4D2VA 4EOIA 5A6OA 2O3PA 5CAVA 4DG0E 2PVLA 3RM6A 4BGHA 2X2KA 2WTWA 3CGOA 1OZ1A 2ZB0A 5DI1A 3UZTA 4G5JA 4O21A 1Z9XA 2B7AA 4Y85A 3GCPA 2XVDA 4WBBB 2RFSA 1OI9A 4XV2A 4D1ZA 3G6GA 2YCQA 5D7VA 2PUNA 5HBEA 4CSVA 5CF5A 4DEDA 5KBRA 4O84A 2OWBA 2B1PA 2ITVA 2BDWA 2VTAA 5ANKA 3FZRA 4AZWA 1LPUA 3OT8A 3VRZA 4TYJA 2I40A 4FZFB 5FWKK 2YM4A 3NW6A 4AZFA 4R7HA 4IVAA 4R77A 4RVTA 5BQ0A 5FM3A 5CSHA 4BGGA 4IADA 4AN2A 4K2RA 4IAIA 2GS2A 4BGQA 4FG7A 5CF6A 3O7LB 2UV2A 3ODZX 2JITA 4ZTNA 4CLJA 2HXQA 2C6TA 3NUYA 4RJ7A 5HCYA 3U8WA 1G8AA 4RIYA 4O81A 2HWPA 4G3FA 4DH7A 1E9HA 3MPAA 4CVAA 1K3AA 1VYWA 5C9CA 1UU9A 1YOLA 2IN6A 3E3PA 3AGLA 3I0QA 2X7GA 4FKLA 2QI8A 4YMJA 4QTCA 5BYLA 4DFLA 3H9OA 4BIEA 2WMQA 5LXMA 5EKOA 4IAKA 4IB1A 3Q6UA 4APCA 4FSWA 4J71A 3ID6C 3HUCA 3ZTXA 4DHIB 3ZEPA 4AZSA 1JNKA 4W4YA 3VUHA 3KVWA 1OPJA 2PVRA 3QYZA 3E8NA 4UB7A 4FTMA 4TRLA 4CGAA 2IVSA 4QOXA 3ROCA 2PVMA 5HICA 4D2TA 3QZFA 4CKRA 1J1BA 4G3DA 4BCMA 4D2SA 2QG5A 5L3AA 5EQYA 2YM7A 4Y8DA 2PVHA 3CTQA 3I6WA 2QKRA 5EHYA 5HE2A 3F66A 4JJRA 4PP7A 3PPJA 3VS0A 2G01A 4QP1A 5D11A 5A3XA 4HW7A 3BGQA 3DXQA 2PSQA 2WTCA 3MWUA 4F0IA 4F9AA 2GNHA 4KIKB 3R9NA 1PY5A 4EOJA 4QMXA 4ASEA 4DITA 3TI1A 2Y4PA 2XM9A 1AGWA 2JKOA 2PU8A 4A07A 4ERWA 3LIJA 4IWPA 4M68A 4DH8A 3PIXA 4U43A 2YACA 2RL5A 4PPAA 4EOMA 5L6OA 4O0VA 3PY0A 2YJRA 2ZDTA 3D2IA 5BVDA 3F3TA 3KXXA 4NU1A 4ID7A 5I3RA 2QG7A 3ZS5A 4DTBA 4PTCA 4FSTA 4QQJA 1OMWA 2OU7A 3GB2A 4ZY6A 3L8PA 2JBOA 4BCNA 5HX6A 2X4ZA 4XBRA 2FH9A 3R7VA 4QT1A 3ZRKA 1QPCA 2Q83A 3GC0A 4KKHA 4F6UA 4KBCA 2ZFYA 3VONA 3HA6A 2W1CA 4I41A 4ERKA 1JSVA 3EJ1A 5EOLA 1FOTA 4KBAA 5E90A 3QWKA 3UG1A 3DBFA 2V0DA 3BHHA 3R7UA 5FG8A 1APME 3KVXA 3R04A 4FIIA 3P5KA 5F95A 3FL4A 1Y57A 4YBKA 2ITXA 2GTMA 1ST0A 4GKHA 3FI4A 3C5UA 5KHXA 3BLAA 4YR8A 3CLYA 3OC1A 3AT4A 5EM5A 3H30A 3OT3A 4GW8A 2HW6A 4FTLA 4O0RA 5EYDA 2BDJA 4ZTLA 2YFXA 4JG6A 5CU4A 3R8ZA 2BR1A 4M3QA 5EQPA 5DIAA 3EMGA 2OH4A 5T6KA 4UMRA 4D2RA 4V0GA 3VULA 4I23A 3OMVA 4F6WA 1PXKA 5M4IA 3CIKA 4FKVA 3QHWA 1SZMA 1YXSA 3TZMA 2J0JA 3SXRA 4EYMA 3SLSA 4M13A 4N0SA 4CKIA 5D10A 3H0YA 5HX8A 1B38A 3OVVA 3HNGA 1LEZA 2WO6A 3CD3A 2P0CA 1CM8A 5L2SA 2V5QA 3HRCA 4RFMA 4FT7A 3M42A 4L3PA 2ZAZA 5BUEA 2Z7SA 4D58A 4U40A 4CQGA 3QZGA 5KMLA 1UNLA 2C6OA 2FO0A 3NNXA 4JRNA 2JDTA 4W9WA 1MQBA 1RQQA 3D5XA 3C4EA 3D94A 3I0OA 4D2PA 5AP2A 3WE4A 2EU9A 2RIOA 2X2LA 1OGUA 5KMJA 2C6KA 5A9UA 1TFFA 3MS9A 3FSFA 3WYXA 4RFZA 1ZYDA 4NFNA 4U97A 1MRVA 5DVRA 3DK7A 1OIQA 3FPQA 4PWNA 4GRBA 4W4WA 3RNIA 5GIOE 3DBDA 4B8LA 2ZM4A 4WHZA 4YP8A 5HO7A 3LCDA 4RVLA 3ACKA 1BLXA 2BZIB 3ML1A 3NVMB 1NT2A 1J7LA 1H01A 4E73A 3VS6A 4DTKA 5HIBA 3C4CA 5E8WA 3MJ1A 3UC3A 4G3GA 4PV0A 4QQ5A 3MBLA 1A06A 2XNPA 3Q4UA 1YVJA 2C5XA 4FV6A 2Y7JA 3MY5A 4KABA 1V0OA 3BYMA 3PG3A 5DRDA 4BDEA 4K0YA 4USFA 1BI7A 3RCJA 3OF0A 1QPDA 3FMKA 4UMPA 1URWA 3GEQA 3MVLA 4J8MA 4OR5A 2PVYA 2V7AA 2YM5A 5HG8A 3DT1A 4HYUA 4GFOA 3NMUF 3TTJA 4FNZA 5EM7A 4F1TA 3SX9A 4YZBA 4C34A 2WD1A 3R00A 2WZJA 4FT5A 4HGEA 2C47A 3FEGA 2RF9A 3OG7A 1Q8UA 4E20A 3QA8A 2PVNA 5CANA 5C4KA 3KK9A 4I20A 4I4EA 5E1EA 3F2NA 4DGLC 3PVWA 1IR3A 3QQUA 4MUQA 2DQ7X 3P7CA 1VZOA 3QKLA 3LM0A 3FI3A 5LQFA 4FTTA 4AN9A 1YXVA 3EQIA 4IQ6A 3RMFA 4IZAA 1DAYA 5JGDA 3U4UA 3EFWA 1W2FA 4DEBA 5L6WL 2B9JA 4JL9A 3A62A 5FBNC 4DTAA 4BI0A 3DBQA 4GK4A 4C4JA 3MPTA 4KA3A 5LVPA 4PPBA 4GS6A 5KMKA 4ENXA 5CSXA 4OW8A 3BQRA 1XKKA 5B2MA 3N4UA 3BHUA 5AUWA 3QTSA 2Z2WA 2FSOX 2JFLA 3S00A 5DEYA 3DFCB 3EQDA 5AUVA 4DCAA 4IJPA 2Y0AA 5D9HA 3S95A 4O22A 5H8GA 4KIPA 1Q8WA 4ZJJA 2HENA 4F78A 1Z57A 2OSCA 3EQPA 4YO4A 5IUGA 4QQCA 4X2JA 4HVSA 3P1AA 3DB8A 3W1FA 4D4YA 1Q62A 3OBGA 1M7NA 2ITZA 5AAEA 4OTDA 3PXKA 5DT0A 5LOHA 3FHRA 3L9LA 4GU9A 3ZM9A 3VF9A 4BRXA 3IONA 1BKXA 4KIQA 3PXZA 3LQ3A 2C68A 2ITQA 4O86A 1QL6A 4DHFA 1A48A 2ITYA 2W99B 4NJDA 2JDOA 4HJOA 3ZXTA 2GTNA 3TZ9A 1WVYA 2REIA 1JPAA 3ZU7A 5AP3A 2G2HA 1XHAA 3KRJA 3S0OA 2VO7A 2Y8OA 1DM2A 3AC5A 4BDAA 4YBJA 4IB5A 2CKQA 4BBFA 1S9IA 5LCJA 3NYXA 4ANNA 3OW3A 4Z7HA 5HU3A 4GT4A 4IDTA 3EHAA 2R3QA 4F09A 5L2TA 2PY3A 3S2PA 1R78A 4IMYA 4GT3A 5FD2A 2OF2A 3NW7A 2GSFA 1ZMVA 4RFYA 1YRPA 4DC2A 1LR4A 4BYJA 2JIVA 1PXPA 2GMXA 5CI6A 4E5BA 3UDZA 2YIYA 4EONA 2YISA 2KTYA 4AT4A 4L7FA 3RK9A 5CEOA 5GNKA 2W1EA 3FKLA 2VGPA 3ZRMA 4FJVA 2F7XE 5G1XA 4EK3A 4FG9A 3O50A 4MVFA 4NIFA 3QQHA 4ZAUA 3CJFA 5AEPA 1WFCA 4NKAA 2B53A 1PYXA 2BIKB 3AC2A 1B6CB 3FMJA 3R7OA 3R1SA 4ZIMA 3TJCA 4DE4A 3OROA 3PPZA 2OF4A 2WU7A 5LMKA 2FB8A 2OBJA 3W2SA 3NYNA 2VTMA 3R7GA 4RX8A 4FKIA 4UV0A 2OG8A 4ACGA 3PXQA 2UW5A 2J0MB 4QNAA 2XK9A 3R1NA 4MD9E 3CXWA 4AZTA 5I9ZA 2RKUA 4BDFA 2IWIA 5E8XA 4QTEA 4NCTA 4YLKA 4FGRA 4QRCA 3E8DA 5CEMA 3QZIA 4BCIA 3VS5A 3WF9A 5F9EA 4TWOA 5IQFA 1JKLA 4ZTMA 3C4WA 3BGPA 4O2PA 3AMYA 4AP7A 1FMOE 4ZMFA 3I5NA 2JIIA 3JUHA 5A4QA 4I6QA 1OM1A 3QLGA 4AE6A 4XS2A 2VX0A 1FBNA 1KOBA 1SM2A 2FGIA 2YCFA 3KA0A 4I94A 4R5SA 3DJ7A 4F7SA 4O27B 3TDVA 4DF3A 4QP6A 4FC0A 3IG7A 5JFSA 3KULB 4G1WA 2V55A 1YHSA 5KNJA 4O1PA 2YM8A 5J7BA 2OIDA 4AWIA 4R3PA 1TQPA 4I0TA 3LCOA 4MWIA 2IPXA 2JLDA 2JAVA 3AG9A 5M56A 4FF8A 3TNPC 3FPMA 4EL9A 1UKIA 1NW1A 2LGCA 4EH5A 4DDIA 4NT4A 4X6QC 1PXNA 4U8ZA 4D0XA 1JQHA 5DBXA 4L68A 2P33A 5L2QA 4USEA 3D15A 2C5VA 4PDSA 4UBAA 3UO4A 3CPBA 3G0EA 2QOLA 2Z60A 1XH7A 3DGKA 3FAAA 2VWIA 2YM6A 3HGKA 3UO5A 2B0QA 3ACJA 4O7WA 5H2UA