3LFAA

Human p38 map kinase in complex with dasatinib
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
350
structure length
333
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Development of novel thiazole-urea compounds which stabalize the inactive conformation of p38 alpha
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 107
structure length 333
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lfaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lfaA01
2IW6A 4I4FA 4BCOA 5AR4A 2VX0A 2W1FA 4ZSGA 5TF9A 3I4BA 1WBOA 4I23A 3CTHA 3QQGA 2ZYBA 4NCTC 2GTNA 3C0IA 2DUVA 3GI3A 1CDKA 2HY0A 2Q0BA 1KE9A 3HLLA 4J96A 4NCTA 4TY1A 4EHZA 2WQNA 3OY1A 4BCFA 2W0JA 4IWPA 3DA6A 4X2KA 3E87A 5C1QB 5C8NA 2O63A 1A06A 4KINA 2FGIA 2R3PA 2XIYA 4TYJA 5FBNC 2HY81 3KMMA 4XV2A 5BUEA 4O0UA 2WTDA 4CV9A 4DH3A 4IVCA 2WTIA 3KN6A 4DEAA 2E9UA 3MVHA 4R7IA 2CLQA 4YZ9A 5IQDA 3FKNA 2UW6A 4EH6A 3IGOA 2R3FA 3CCNA 4IC7A 4WUNA 3BI6A 2AUHA 4FNYA 3ZC6A 3PJCA 4MK0A 4M66A 5CQWA 4RFYA 4FKIA 4I5MA 2C3JA 3IW6A 1T46A 4FKQA 3KVWA 4F4PA 5DT0A 3Q5IA 4HCVA 5KX8A 1OKWA 3DBDA 4RVTA 5A6NA 3C4EA 3OOGA 3F5XA 4CTCA 5KUPA 1XO2B 4WG4A 3ORKA 2VTRA 1YXTA 5EYCA 4CZTA 4NYEA 4W4XA 4IFGA 3HL7A 3AC2A 5JN2A 3QCQA 5JFSA 2JIUA 5BYLA 3IOKA 3QTXA 3MYGA 3UVPA 2PE2A 1IA9A 4YHTA 4D1XA 1ZYJA 5HNBA 4XCUA 1F3MC 2WQBA 4FR4A 3DK7A 3RHXA 4IHPA 3C4FA 4O91A 1ZARA 4AA5A 4CVAA 4XBRA 5AP1A 3W1FA 4R1YA 2W9ZB 5AV4A 5I3RA 2C3IB 3KB7A 3ZUVA 3FEGA 3F5UA 3PXZA 3MN3A 4RJ4A 3ROYA 1VYWA 4CRLA 4IB1A 2PWLA 1JKKA 4L46A 3ORZA 5EM5A 2C6OA 1IA8A 3O2MA 2OFVA 2P3GX 3GVUA 4QP8A 3SDJA 4U8ZA 4G3GA 2A27A 2A4LA 2B9HA 2ERZE 3MPAA 3LFCA 5FEEA 4DLIA 4ENYA 2YIYA 3NUNA 3LCKA 5JT2A 1VJYA 3NNVA 5K4IA 4ASZA 1WBTA 3QX4A 4K0YA 2XCKA 3FV8A 4G3FA 3C13A 5GZAA 3ORNA 4JIKA 5IUGA 1FVRA 3KC3A 3D83A 4KIPA 1XH9A 1WBVA 1URWA 2XS0A 4G6OA 4YLJA 3VW8A 3DY7A 5D41A 5KBRA 3UG2A 5BPYA 3QA0A 1ZY5A 4AF3A 4MBJA 3GU7A 4Y85A 2R3JA 5HIBA 2R64A 3Q4TA 4QTBA 3RPSA 4FVQA 1WVYA 4ZTMA 4NEUA 5K3YA 1JKTA 3Q04A 4FSRA 5TOZA 2PZRA 3TV7A 3UOJA 4AN2A 2DS1A 2C5OA 4U7ZA 3VBQA 1P5EA 2VGOA 3BKBA 3FHIA 4V0GA 4KNBA 1P4OA 3RWQA 1KWPA 2IG7A 2H9VA 3A7HA 2IZTA 1XBBA 4GL9A 4ITIA 4KKEA 4EH9A 4DGGA 3ZM9A 2KTYA 1ZYLA 4GYGA 4RZWA 5L3AA 1H1SA 4G6NA 3ZRMA 4DFUA 4ZJIA 3GU8A 1UU7A 4KUJA 5E8WA 3KU2A 4C2VA 3DZOA 4L8MA 2OIBA 4PP9A 4J8MA 4W4YA 3TN8A 3P1AA 4MQ1A 4FNXA 3PIYA 3DJ5A 3F7WA 3NWWA 3ZS5A 4FTNA 3OW4A 3Q5ZA 3UPXA 4RVLA 4BDDA 4XV9A 4PP7A 2YM4A 4I20A 2WMTA 4OGRA 4U5JA 4KSPA 4HZRA 5CSPA 3D5UA 4O0SA 5HKMA 4RX7A 5C27A 4M13A 3CY2A 3ZZWA 1MQBA 3NUPA 4DCEA 4MKCA 4FTAA 3QU0A 4W4VA 2JFMA 2WNTA 1XBAA 2PVLA 2QO9A 3DAEA 3HV7A 3ORIA 3SLSA 4DFLA 4NWMA 5TO8A 3OWPA 4E93A 3COHA 4C4GA 5ANGA 5M53A 5LVLA 1WAKA 3PSBA 2RKUA 3OHTA 4JBVA 3NEWA 1OL6A 5CWZA 3UDBA 3SW4A 1OUKA 3ERKA 3WF6A 3NLBA 4DA5A 4QMLA 2RG5A 3OXZA 4F0FA 4ZTLA 1NA7A 3TEIA 3PA5A 3RMFA 2QR7A 4EQMA 4YUQA 4RRVA 2BTRA 5DMZA 4AT5A 2R0IA 4O96A 3W2SA 3FMKA 4GCJA 4I92A 4K77A 5AWMA 4BY9E 5J87A 5AP7A 1RQQA 2IZRA 4FT3A 4C62A 4AX8A 1H07A 4O86A 3DKGA 3WZUA 4XG8A 5HX8A 4PQNA 3F5PA 4OT5A 1PMVA 3GC7A 3OT3A 5B0XA 3LFNA 5E1EA 3W8LA 3HX4A 4B6LA 4FI1A 4MNEA 4YZMA 2PVHA 4C61A 2RFEA 1FMKA 4E6QA 2QOQA 4EOKA 2V7AA 5A54A 1A48A 4I22A 3SA0A 4YC6A 4F08A 2NO3A 4TPTA 3E7OA 4AAAA 5GJDA 5GZ9A 4MYGA 2R7BA 2C4GA 4OW8A 4X2JA 3SV0A 5DRBA 5CAVA 3R73A 1R0PA 2VRXA 3C50A 4I5PA 4YBJA 3GCVA 3VHEA 4OUCA 5M51A 1R3CA 4EH7A 1KE5A 5CU3A 4FGRA 2PULA 2WIPA 3QXPA 4RFZA 3DK3A 3GC9A 2HZ0A 3R7OA 2QCSA 4ANQA 3NUAA 4X3FB 5IQFA 3QQLA 3MH1A 4HPUE 2ITWA 5ANDA 4ACDA 4IAAA 4D2RA 3EOCA 5TT7A 4EKKA 1BLXA 1BX6A 2W4JA 2YAKA 4E7WA 4IB5A 4YZCA 1PKGA 4EC8A 1J91A 3TNPC 4G3DA 3FPMA 2Q0NA 1FVTA 2Z02A 3A62A 1VYZA 2X8IA 5ANOA 5AMNA 5JRQA 5CZIA 4Q2AA 4QMTA 1DM2A 4D2VA 3P7AA 1K2PA 3QTQA 3HMNA 4I4EA 2BZKB 4JDIA 3FI2A 3PXQA 5AUXA 4BDHA 5CEMA 2PUNA 1OKZA 1KV1A 5AAGA 3UNKA 3Q96A 2HENA 2PZPA 2GS2A 4DF3A 2ETKA 2I0HA 2ZM1A 3VS0A 3MB7A 5L2WA 1L8TA 5TE0A 4C38A 2WFYA 2CKEA 3GOPA 2JIIA 3QQJA 2Z7SA 3IDBA 4PWNA 3ACKA 1PW2A 4UZHA 3RK9A 1H24A 3F2AA 3VF8A 4ZTSA 4F9BA 2CSNA 4C36A 3IPHA 1YW2A 3KCKA 3BBTB 3F82A 2YEXA 3ORLA 4FKSA 3F69A 4B8LA 1CM8A 3PWYA 4X3FC 2C0OA 4XP3A 3LFEA 1SZMA 4X3FA 4B9DA 4D9TA 1TKIA 1ZOGA 5F95A 5E8UA 3G0EA 2XK7A 4CFVA 3R9DA 5CXZA 4EORA 2ZB1A 4EH4A 4GG7A 4GVAA 3E3BX 4QTAA 2QOOA 1W7HA 2W99B 3VULA 1FINA 2J2IB 4F6SA 5KMNA 4BRXA 3RPRA 5LOHA 1SVEA 2IW9A 5IDNA 2OJGA 2ERKA 1W8CA 3PP0A 3ZM4A 4ARKA 4BWXA 4I24A 2UW4A 3G90X 3G33A 3HMPA 4MD8E 3F7ZA 5CNOA 4BDIA 1OM1A 3CGOA 3P9JA 4E5BA 2B1PA 2WPAA 4D4RA 2VX1A 4O27B 5GJGA 4CCBA 4LRKA 3UC3A 5JEBA 3SW7A 4BDBA 2YM6A 1ZRZA 4XH6A 4OTRA 4FL3A 4D5HA 3MH3A 5F9EA 1GOLA 4RIXB 4DBXA 5EHOA 3LCDA 3NYXA 4Z55A 5CALA 1XH7A 3RAIA 2QHMA 2JEDA 2XK4A 3I0QA 4RIOA 3TIYA 3UOKA 1XH5A 3HNGA 2OO8X 1GY3A 3JVRA 3PZEA 3TJCA 1ZOHA 2WTKC 3NR9A 4H1MA 5HLNA 2YIWA 4TNDA 4DGLC 3PA3A 2ZM3A 5DWRA 5JH6A 1BYGA 5ETFA 4B99A 3U55A 1Y91A 2VU3A 4HVSA 2F2CB 4UWBA 2XIRA 4YPSA 2CGXA 2OZOA 5EI8A 5HESA 4CMTA 5KHWA 3HRCA 4QMUA 1GZNA 4X3JA 2YN8A 4RBLA 5KZ0A 4O7SA 4GK3A 3ORTA 2PMIA 1B38A 3EZRA 3CEKA 3U8WA 5IQBA 1BKXA 3RM6A 3PXKA 5HTIA 1QPCA 5D9HA 2R3IA 3I1AA 4HNIA 3HV3A 4M67A 2PYWA 4IDVA 4I0RA 5CNNA 4A9UA 4CFMA 2CJMA 4RIYA 2C6IA 3CPBA 3VBXA 3OXTA 4LYNA 2C6EA 5DPVA 4I3ZA 3JUHA 4JX7A 4HGEA 4ZJJA 2C30A 2EB2A 2X8DA 5AV2A 3Q9YA 2X2LA 4QT1A 4A4XA 4UMRA 2JDSA 4O82A 3OD6X 2YAAA 4DG2E 4PDPA 2VWXA 3CC6A 3PUPA 4K18A 2O64A 5EHYA 4DTBA 5AV0A 4L42A 2BDWA 2Y6OA 2ITXA 2VWVA 4L7SA 3RZFA 4YO4A 4XG4A 2XMYA 3GNIB 4ORKA 1YWVA 3VAPA 5J5TA 3H9RA 5IISA 3EL7A 4EC9A 4YLKA 4EUUA 2XNMA 3RNYA 4FG8A 3C5IA 4U43A 4U97A 3TZMA 3PJ3A 3DKOA 3FI3A 3QRKA 3LMHA 5M4FA 2ZB0A 4G16A 4YJQA 3HRFA 3O0GA 3KRRA 4FSNA 3FKLA 3CTJA 2ZV2A 1UWHA 2BZJA 3RAHA 2BTSA 3NAYA 4BYJA 1R0EA 3EJ1A 2E9VA 3TM0A 3SXSA 3EIDA 5L8KA 2BVAA 5I3OA 4I6HA 3DS6A 2HWOA 3CS9A 3E64A 4DC2A 4JDHA 3H10A 1JSUA 3IECA 2PUUA 3R01A 3FC2A 3HMMA 3I6WA 3MVMA 2Y8OA 3U9CA 3GEQA 4F70A 5KNJA 5FXQA 3NX8A 2VWBA 4IANA 4JRNA 3UBDA 5T68A 5HG8A 4DH7A 2FVDA 2BR1A 2OU7A 3KMUA 4CFNA 5HTCA 3UYSA 5AUUA 3VQUA 5DT3A 2BAKA 4TTHB 4FIJA 2QOHA 3KY2A 3PP1A 5CEKA 1EH4A 4BCJA 3R2YA 3W2OA 3K2LA 2BZHB 3FL5A 4AZTA 5IEYA 2V7OA 4FV8A 4E26A 4ZIMA 3R7IA 2E9OA 5EG3A 4F1OA 2PSQA 3NYOA 3PG3A 2JKQA 5E8YA 5HIEA 4CXAA 2ZV7A 2BRBA 3A61A 4FTKA 5CU0A 4QQCA 3IONA 4FUYA 4F1MA 2YDKA 2XNPA 4RJ5A 3A7FA 4O81A 4GIHA 5DEYA 4FTMA 2QO7A 3BCEA 3QTZA 5HE2A 4UMUA 2VWYA 1BL7A 4FSQA 5JSMA 1G8SA 4AW5A 4O0RA 4BCNA 1J1BA 3SRVB 3ZTXA 2R3LA 2HIWA 4O1OA 4PRJA 4IM2A 2YZAA 3D2IA 3UIBA 1OITA 4F64A 4BZNA 2NPQA 4KIQA 1GNGA 3FZ1A 4HCUA 3QRUA 4U40A 4QMVA 4USDA 4CFWA 2XJ0A 3QLFA 4LOOA 1H28A 5D7AA 2CLXA 4G3EA 4HNFA 4IACA 1VZOA 2QONA 2NNWB 2Z2WA 3KXGA 4FF8A 5E8XA 2ESMA 5JFWA 3G9NA 3MFRA 3BPRA 1APME 4WSQA 3LFDA 4ZLZA 4LOPA 4R7HA 5I4NA 1K3AA 2HOGA 3TNHA 3BX5A 3QZGA 4WT6A 5AX9A 3QHRA 4FEQA 4OBQA 4QMSA 5B2LA 3HUCA 5I9YA 3QFVA 4FKTA 4RWJA 5FM3A 5LVNA 4O83A 1X8BA 4ZK5A 5ETAA 4IAZA 3QTWA 3U9NA 4ZLOA 1DAYA 3QD3A 4WUAA 1KSWA 1DAWA 2XNGA 3AMYA 3LJ1A 3OOMA 3GU4A 2OSCA 3QZIA 4D4SA 1V0PA 4I6QA 3IDCA 4IVAA 3VHKA 5KMMA 3UQFA 4ZY5A 3SG9A 3LQ5A 1Z9XA 3EQDA 5FP5A 2JAVA 2BHHA 3R22A 4FTOA 4ASEA 1Y6AA 5EYKA 5KMIA 5GIOE 5DA3A 4P5ZA 1U54B 5K9IA 1GIHA 1WBWA 3QRTA 5CXHA 3CTQA 5ACKA 2IVTA 3MH2A 4R3CA 4UB7A 2BAQA 3OMVA 2CPKE 3ZEPA 1H0WA 1O6YA 4FSWA 3D5WA 5AR5A 4M68A 4BKJA 4LL0A 4LV8A 4BCGA 4AFJA 2BRNA 4M12A 2UW5A 2V22A 5I9UA 3LCOA 4KS8A 3BU6A 3ITZA 4M69A 4QMQA 2OZAB 3S2PA 4BVUA 4QMMA 5DVRA 4DG0E 2J0MB 2RFDA 4R6VA 2IJMA 3QCSA 5CVGA 2W9FB 5HO7A 4C37A 4EUTA 3PSDA 4QD6A 4PTGA 3QX2A 4PF4A 4NM0A 5HO8A 4OTPA 3QTSA 5CASA 3GOKA 3D5VA 4E5AX 4RMZA 1RJBA 5CVHA 3BLQA 4J99A 3S4QA 2XIKA 4DTAA 3LMGA 3FMLA 2Y4PA 2CKPA 1PXKA 1LEWA 3E8DA 2YJSA 1JAMA 3ZBXA 4FTTA 5HG7A 4YP8A 4XMOA 2ZAZA 2VTLA 3L9NA 1FBNA 2F7ZE 1U4DA 1U54A 4IEBA 3VW6A 2R4BA 2QI8A 4D9UA 4Y83A 3P23A 4IE9A 4UMQA 1YRPA 4MF1A 2C3LA 4AN9A 4AZEA 3MESA 3ZRLA 4O0TA 4ACCA 2UV2A 4LGDA 3WF9A 4KABA 2YCFA 3I79A 2YWVA 3OUNB 2ITVA 4CZYB 5CTPA 4JAIA 3PZHA 4O7VA 3MSSA 3I6UA 3LCTA 3ULZA 3DV3A 3G2FA 3ANRA 4DINA 3SOAA 4BI2A 4D2WA 3FLZA 1YKRA 4J53A 5EQPA 1SM2A 4X21A 4O0XA 4ZEGA 2EXCX 1B6CB 3QBNA 4YJSA 2J0KA 3ZFXA 4AUAA 3R1YA 3NAXA 4Q9ZA 3LFAA 4GJ3A 3W18A 4P2KA 2WAJA 4EZ7A 4MXZA 4FICA 1ZWSA 4C2WA 4C58A 3NIZA 1AGWA 1O9UA 5FBOA 4F9AA 4MXOA 1BI7A 4JG6A 4DGMA 3VRYA 4O7RA 4IX4A 3GUBA 5AM6A 5L6WL 1FPUA 2BFXA 3H0YA 4O84A 2CCHA 5AM7A 5DR9A 2X1NA 2WTWA 1O6LA 3KN5A 4C02A 2RFSA 3BU5A 1LP4A 4UX9A 3CR0A 4C4EA 3BGQA 4IWQA 4GK2A 1OMWA 2GNJA 3C5UA 3DCVA 4ITJA 1MRUA 2UW3A 4QP2A 4JL9A 3UZTA 4FIIA 1UU8A 2UVZA 5IQCA 3JR1A 4RLKA 4WRGA 4XBUA 2OJ9A 3VUKA 4BTMA 3RPVA 1YI6A 3RZBA 2YIXA 3NYNA 4EK8A 2JDRA 4WG5A 3NVMB 2VTOA 1A9UA 4QP7A 2BRGA 2O65A 4H3PA 4QMNA 4Q5HA 4GFOA 4BYIA 2QLQA 3L9PA 2BAJA 4IIRA 3RPYA 4ALUA 4YSMA 1OKYA 5EYMA 3VBVA 3Q4CA 5EW8A 5FRIA 5EQEA 4P5QA 4DEBA 3B8RA 2QOFA 5E9EA 3OS3A 4XYFA 3QGYA 5IMXA 5AP2A 4JX3A 3RGFA 1U5QA 3D7ZA 3ZSGA 3EKKA 4IJ9A 5I5ZA 1I44A 1SYKA 2BHEA 4PPAA 2C6LA 4U6RA 3ZOSA 2I0VA 2J50A 2C3KA 2PVNA 2A1AB 3A4PA 3QD4A 2QHNA 4ALWA 4IB0A 3ULIA 2CKOA 4FKPA 4ASDA 4PTCA 4CLIA 5I9WA 3LOKA 3KEXA 3ZRKA 4QYFA 4GU6A 3DJ7A 1ZYSA 4OLIA 3Q2JA 1NY3A 2YLFA 4TT7A 2XK9A 3SAYA 2BZIB 2OK1A 4AW2A 1TQIA 3O96A 4AW1A 2RL5A 3L8XA 1RDQE 1ZAOA 1GIJA 1Q4LA 2YLEA 1F5QA 4G5JA 4ZS4A 2ZMDA 3JY0A 4K11A 1JWHA 2XEZA 2XF0A 3EN4A 4YJTA 4EH3A 4E3CA 2EUFB 4FYNA 1Q8WA 4YURA 5DE2A 3CSVA 4NIFA 3EFJA 3UIMA 3AD4A 3AMAA 4ZZMA 1WCCA 1ATPE 4QPMA 5M4CA 4FIGA 3TUDA 2YA9A 5EDRA 2I1MA 2WEVA 3HA6A 4OTGA 3QD2B 5LCKA 3NPCA 3TDWA 3R7UA 5IUHA 2OBJA 4FYOA 5H8GA 5HNGA 4RC2A 3T9IA 4FT0A 5G6VA 4FK3A 4EJNA 2C6MA 4FKGA 3SOCA 2C6DA 2UZTA 2WIHA 4E6CA 1M2RA 2XNNA 4PTEA 4Y5QA 3H4JA 4ZZNA 2QOIA 2WTCA 4QYGA 3LQ8A 2B53A 3FKOA 3KK9A 4R3PA 4U3YA 3PRIA 2QQ7A 2PPQA 3SQQA 5B2KA 3V51A 3ZH8A 5FDPA 2R3MA 5DHJA 3MPMA 5C4LA 3CIKA 4IQ6A 2O8YA 2GHMA 2YDJA 3D2KA 4FBXA 4JG8A 4D55A 4H1JA 4O7YA 3A8WA 3LJ2A 5J8IA 2GHGA 3NNUA 2QG5A 2VTHA 2YIRA 2WMAA 5EM7A 5LMAA 3A4OX 3V04A 4BL1A 2PVYA 5M4IA 1UNGA 4E4MA 4DGOA 4LMNA 4D2SA 4NM3A 3EZVA 5K5XA 5LQFA 2XBJA 1WMKA 2BIKB 1SMHA 2BDJA 4BFMA 5KBQA 2XVDA 4RX5A 4MBLA 4ZTNA 3WF5A 4F7SA 5FTQA 3F9NA 5IQHA 4PDYA 5HU3A 4BHNA 4ZTRA 4YTCA 3AC1A 4LRJA 3MA3A 3RPOA 2BMCA 2QR8A 3VJOA 4EHVA 3R8UA 1YOMA 3LXNA 4NUSA 5HLPA 5AA9A 2VTPA 1QPJA 3PFQA 3PYYA 3RCJA 4EI4A 4PPCA 4AE6A 4FEWA 5LMBA 5E92A 2P33A 3H9FA 5K4JA 5IEXA 4NJDA 4ZTHA 3WI6A 2WTVA 1DI9A 4IVBA 4LUDA 3R63A 2F57A 4C34A 1S9JA 4L43A 4N6ZA 3NVKI 3GU5A 2WD1A 4YBKA 1KE7A 3CJFA 2GFSA 4U81A 3EL8A 3QUDA 2W1GA 4FZAB 2KULA 3VS2A 1MUOA 4LUEA 4EHEA 4G9RA 3Q52A 3QHWA 4IZAA 3R9NA 4CV8A 3VBWA 4NTSA 5JQ5A 3ODYX 4C3FA 3R8VA 2RF9A 4XV1A 2FO0A 4DTKA 1JSVA 3ZEWA 4BKYA 5HEZA 1FGKA 3WIKA 4ANNA 3QYWA 4G17A 4X2GA 4YPDA 4MXYA 3F2RA 5BVFA 4H05A 3FZTA 3ZO1A 1ZYCA 5L4QA 3C51A 4ZMEA 3COIA 1YXUA 1KE6A 1YWRA 3C0HA 4ITHA 4KB8A 4NFNA 5LVOA 3FWQA 2CNUA 4B4LA 4H58A 2XJ2A 5CANA 2C6KA 3HZTA 2Z8CA 3VUTA 2WTJA 3I0OA 3SHEA 3LXPA 3TV6A 4LRMA 3R1NA 2ZM4A 3Q6WA 3UGCA 2ITZA 2AC3A 2WQEA 4AA0A 5C4KA 1W0XC 1M2QA 4QMPA 5CU2A 5E91A 2C5YA 4A4LA 4AU8A 4BC6A 4IWOA 4F6WA 1PMUA 4AFEA 4D2PA 2C69A 4J98A 4YGAA 4KBCA 3NGAA 2P2IA 4EQUA 5L6OA 2UZNA 2X0GA 3GFWA 3O7LB 1H08A 4WD5A 4F7JA 5LWNA 3Q9XA 1PJKA 3ZDIA 4XOZA 1URCA 4QQJA 4ZMFA 2SRCA 3CKWA 2VZ6A 1OIRA 2Y4IB 3EN7A 2EXEA 3DKFA 4HYUA 2PMLX 5H2UA 3U4UA 3BYSA 4GT5A 5ETCA 3FZRA 4IC8A 2R0UA 5DEWA 3DTCA 4ENXA 5K0XA 4O7ZA 4X6QC 3D7TB 4IAFA 2PZ5A 5HVJA 3DQXA 3R8MA 4ANBA 1H00A 3A99A 4YJRA 4MNFA 3K5VA 3WF8A 4C7TA 3COKA 2C5XA 4BCMA 3LFQA 1FQ1B 2YWPA 4IADA 3IGGA 4AT3A 4GG5A 4WIHA 3F66A 3AC5A 3CD8A 4EZ3A 2XM9A 2HCKA 3HV6A 3ROCA 4TYHB 5ETIA 2XNEA 4PMPA 4FZ7A 4N4SA 4RIWB 3TNQB 3M2WA 4XEYA 4ERKA 3RBWA 4E4LA 3V5QA 3O17A 3TTIA 4X7QA 4J1RA 5CU4A 4CKIA 4O6LA 3NZ0A 5DN3A 4X6RA 4CRSA 2QO2A 2ITOA 2C5VA 1L3RE 5HBHA 3DOGA 1AD5A 5AUTA 5L8JA 1UV5A 3FY0A 4IJPA 5ICPA 3L1SA 2Y4IC 3DFCB 4F9YA 2PVMA 2XEYA 4I5CA 1OPLA 1XR1A 4HVIA 3QRIA 4I41A 3QKLA 4WO5A 4YR8A 3PVGA 3UNZA 1W98A 3D7TA 4FSZA 3P7BA 4IMYA 4W9XA 3PIZA 1OIYA 2XH5A 2E2BA 3FAAA 2VO7A 4FX3A 4GKHA 5BNJA 2GHLA 3VN9A 2H34A 2GNLA 5A4LA 5FQDC 3P79A 4CQEA 2CN5A 1Z5MA 2QOKA 2XKFA 4DFXE 4Y95A 1V0BA 2FSTX 4HOKA 3OCSA 3MPTA 1BI8A 3QA8A 5JZJA 4AA4A 4DH5A 3B8QA 4YZDA 4RG0A 3FXZA 4CGAA 3E88A 5LVPA 1IEPA 2V5QA 3NW5A 5E90A 4A9RA 5BMMA 1GZKA 3QTIA 2F49A 4H39A 1TQPA 5F1ZA 4R5YA 2CN8A 2J4ZA 3BGPA 2ITNA 3GU6A 4R7BA 1REJA 5IA2A 5HVYA 3LCSA 1U59A 4WBOA 4LGGA 1PXJA 2VO6A 2JC6A 3QXOA 2X4ZA 2XKEA 4K2RA 4RLLA 5EYDA 4C4FA 4FT5A 4UYAA 1ND4A 4CTBA 2C6TA 1PYEA 4EOMA 3GC0A 3TNIA 4KA3A 4E1ZA 4APCA 2QKWB 4FV3A 5CY3A 4YTHA 3WE8A 4OR5A 5HD4A 1XHAA 4BIEA 2YACA 3EQIA 3JY9A 5CSXA 4KIKB 4B8MA 1YWNA 4C4JA 4CLJA 3E92A 3G5DA 4IM3A 4HCTA 2Y0AA 3DDQA 5GINE 4MD9E 1V0OA 1M7NA 1OL5A 5CEIA 5KKRB 3A60A 2OKRA 3QYZA 3C1XA 3DDPA 4BTJA 2VTAA 4R78A 2IPXA 1PXIA 4AZFA 2V62A 2VAGA 1J7LA 4KSQA 3CXWA 4FEUA 3RINA 2PK9A 1OVEA 2CMWA 2GCDA 4XV3A 5HNIX 4II5A 4EK3A 3DAKA 1H27A 4NK9A 5J95A 1AQ1A 2PY3A 3VS3A 4TYIA 5KE0A 4NM5A 2WKMA 3L8PA 3SXFA 1W82A 3HECA 4IX5A 1PKDA 3DLSA 3QUPA 4BCPA 1CKJA 3AT4A 1YXVA 4QP4A 4F6UA 4I6BA 4AP7A 3VUIA 3IK3A 4EL9A 1Y57A 1YHVA 2HYYA 4JDKA 3TCPA 5IU2A 3E7VA 3C0GA 4L44A 4N6YA 4QOXA 3QD0A 4PDOA 3FQEA 4V05A 5F94A 3G51A 4JXFA 5G1XA 3PY0A 5TR6A 3OCTA 3IW7A 4AZSA 4KKHA 5DNRA 3ZONA 4IWDA 3ET7A 3ZSIA 2YABA 4BDKA 3CGFA 4X0MA 3UVRA 2DYLA 4NT4A 5HE1A 5DR2A 3NS9A 4GSBA 4MHAA 4BCQA 3LZBA 3MVLA 5HCZA 2HXLA 2ITUA 4Y72A 4EHGA 2PMOX 3TUCA 3UQGA 2PE1A 5LXMA 2PUIA 3I7BA 4CCUA 2PTKA 4KD1A 3RM7A 3UJGA 4EYMA 4LOQA 1NVSA 1VEBA 2NRYA 3EFWA 4RIXA 4E4XA 4MD7E 2HZNA 4OAVB 3FDNA 3AGMA 4WRSA 2EWAA 2HZ4A 2VWIA 2CCIA 3QCXA 3ZO2A 4M0YA 4R3RA 3ZDUA 1ZZLA 4GUEA 5AUYA 4AZWA 5HTBA 5E8VA 1H01A 3DJ6A 2VN9A 4NU1A 3V6SA 2QG7A 2JITA 2H8HA 3F2NA 4I0TA 4NW5A 3CQUA 3E93A 3FSFA 2XK3A 3D0EA 3QC9A 1PXPA 3CLYA 1Q3WA 2W96B 4OBOA 3CE3A 4OTQA 5CSWA 5FEDA 3PPZA 5HOAA 3DQWA 4ERWA 4ZY4A 3UO5A 2YIQA 4FV2A 2RFNA 4YTIA 1YDRE 5AR7A 3QGWA 4CFUA 4A06A 5IH4A 4JRVA 1OI9A 4XRLA 3UOHA 4ZSAA 5JFXA 2OH0E 2GDOA 3OWLA 5AR2A 4DEGA 2HWPA 3BEAA 1QMZA 4FTLA 4XG9A 2WU6A 4BIDA 3ODZX 4EK4A 4S34A 4ZOGA 3ZYAA 5I9VA 1ZOEA 2IZSA 3JS2A 4B0GA 3MY5A 4J97A 4W8DA 5CS6A 3WBLA 4IH8A 4GIIA 4RQKA 4F0GA 2VO3A 3DTWA 4TWPA 4FV5A 5JRSA 3LE6A 3I7CA 3N9XA 4CD0A 4YU2A 5A46A 1OBGA 4FE2A 2HZIA 3P78A 4MEDA 3R8ZA 3UZRA 3HUBA 3P5KA 3RVGA 3I81A 1Q8YA 1M2PA 3R30A 5CI6A 5FXSA 3FLWA 1KV2A 3MIYA 2CNQA 1UA2A 4ALVA 2UVYA 4AQCA 2CKQA 4NL0A 5BVNA 3OG7A 4F9CA 5CYIA 5DRDA 5JGDA 2ITPA 5IA1A 4WNOA 3ZCLA 4D0WA 3NW6A 5HX6A 3HV4A 4J52A 3R9OA 5FUTA 4NKSA 3R0TA 3GQIA 1Q8UA 4FZDB 3DBQA 4GYIA 3OT8A 1PXLA 2YCQA 4W9WA 5C8KA 3R1SA 1HOWA 3QC4A 4N0SA 4TWNA 2QVSE 1CTPE 5F20A 4A4OA 4IZ5A 4ACMA 4BKZA 4DN5A 5FEQA 4DITA 3D5XA 4BWKA 2J5EA 3HKOA 3Q2MA 3QQHA 4QNYA 1JPAA 4QYHA 4D1ZA 4L9IA 4DH8A 2HK5A 2B52A 4L3JA 3GQLA 3ZXZA 3LVPA 3HP5A 3DXQA 5IG1A 4XG7A 4O7LA 3A7IA 4QRCA 3KULB 2A0CX 2IW8A 4GW8A 4EBVA 3ZLYA 3D94A 3FL4A 1G5SA 4BDAA 4F7LA 5T6KA 4EEVA 4KRDA 4CG8A 3KMWA 1U46A 1XWSA 3QALE 4DT9A 3E8NA 3IOPA 5HZNA 4YLLA 5B2MA 3NRMA 3MA6A 3BWJA 5AX3A 3ATTA 2B0QA 3DBCA 2JDTA 3MTFA 3DB8A 4FV0A 4HYSA 3BGZA 1Q8TA 4ZY6A 2E9PA 3RALA 3F3TA 1Q99A 3I60A 3UO6A 4MXAA 3V8SA 5IA4A 3FZOA 3V01A 3GCUA 1OECA 4FIEA 2B7AA 4MTAA 4PNIA 4C0TA 4FSTA 2XJ1A 4PMSA 5C8MA 3U4WA 3VUGA 1NXKA 3QKKA 1WVXA 3TZ9A 3SG8A 1Q41A 2OJIA 3T9TA 3EYGA 3IO7A 1GJOA 5GJFA 4BDJA 4BCIA 5FGKA 1RW8A 4EH8A 1SVGA 3R8PA 2Q83A 3KF7A 2OIDA 4FL1A 2UW9A 5K0KA 3TG1A 3KKVA 3V8TA 3S3IA 2WEIA 4RVMA 1YOLA 5IEVA 3TUBA 4JI9A 4IX3A 4AW0A 3MFTA 5M4UA 2QOBA 2YM7A 4BGQA 2PZIA 3MI9A 5ANKA 5D10A 2B9IA 3BIZA 3ELJA 3LFSA 3RK7A 4PMMA 3SRVA 4GEOA 4YJPA 3F88A 3VJNA 4XOYA 3MS9A 3MV5A 3DU8A 1ZXEA 4OTWA 3EQGA 3BZ3A 4O2ZA 4WSYA 5BVOA 4IM0A 3WILA 1KUTA 1WZYA 3Q4ZA 1M52A 4TL0A 4U3ZA 2R3KA 5GHVA 3MWUA 1J1CA 4S33A 3VS6A 1DI8A 1H1WA 3D14A 5CT7A 4BIBA 2BRHA 3BYUA 3FLQA 4FMQA 4PDSA 3TT0A 2B54A 5TKDA 2YM3A 2C68A 2DWBA 3VS4A 2XP2A 1IAHA 3UC4A 3EQCA 4RPVA 4RX8A 5IZFA 3VS7A 4DEEA 3LXKA 5AP0A 2GS7A 2XA4A 3C9WA 3I5NA 5FP6A 4BF2A 5IPJA 5L6PA 2WQMA 4ACHA 1GIIA 4BWPA 3S1HA 3WE4A 3KK8A 4HYHA 3NSZA 5D12A 1Q24A 2BIYA 3UIUA 2WOUA 2F7EE 5IUIA 4E6DA 3O50A 4GT4A 5J9LA 3KRXA 2X4FA 3N4VA 3NNWA 3SVVA 5EW9A 2VWUA 4QNAA 4QQTA 4AOIA 3MW1A 3D9VA 1Y6BA 4OTIA 4WG3A 2X6EA 2Z7QA 4EOIA 3VQHA 3EN9A 5IQGA 3NNXA 2WO6A 4XG6A 5AP3A 4ANLA 5AADA 4JJRA 2R3GA 4B7TA 2IVUA 5HG9A 3RHKA 5EM6A 4EWQA 4FSYA 5C9CA 4FOBA 3REPA 4PL5A 3PE1A 5CSVA 3FLNC 3GB2A 2VTSA 4BDFA 5C03A 3DNEA 5M09A 4YJNA 5HHWA 2WELA 4D4YA 3OXIA 4S32A 5AUZA 1OL2A 4JBPA 4FODA 3OC1A 3V6RA 4QMXA 4A9SA 2WMWA 4YJOA 3E3PA 2RSVA 2J6MA 3EQRA 3FQSA 3MFSA 2WZJA 4FGBA 5EHLA 5I9ZA 4OAUC 2YJRA 3OBGA 4Y46A 4C4HA 4MX9A 3LJ0A 2OZAA 3AD6A 2GQGA 3RP9A 3TZ8A 3POZA 2R9SA 5L2SA 3UG1A 3C7QA 3PXFA 1WVWA 4K6ZA 3D4QA 4L3LA 4DFYA 4XG3A 4KWPA 2WMXA 5KCVA 1NT2A 3O71A 4DE4A 3K54A 4FC0A 4U44A 1REKA 2XNBA 4JIAA 1FOTA 5A4CA 3TDVA 3L8SA 2V55A 3DK6A 4EOOA 3POOA 4PV0A 1YVJA 2FB8A 2R5TA 4IXPA 5FTOA 3QWJA 4O7NA 2FA2A 1PF8A 3EWHA 3OBJA 4QPAA 1UU9A 1G3NA 2UZWE 3M42A 2F7XE 3TXOA 3ZFMA 3P4KA 3TI1A 3GBZA 2Y9QA 2B55A 2Z60A 3K3JA 4WKQA 3KXHA 1ZMVA 4ONAA 3UQCA 4BI0A 2ETRA 4IZ7A 2I40A 3UP2A 1XJDA 3W8QA 3FXXA 5BVDA 4JQ8A 1LEZA 4ANSA 1PHKA 2UZDA 3QQKA 3GENA 4S30A 3KGAA 3OFMA 4UXQA 4QP9A 3F3VA 3ZUUA 2VTQA 5BUIA 1MQ4A 3NUXA 3IW4A 2XKCA 2XK6A 3V5PA 5IQEA 4UBAA 2H96A 2O2UA 3AC4A 3HV5A 3NCGA 5E1SA 5EM8A 4RC4A 3GP0A 2GQSA 4QTCA 3A2CA 3NUYA 4ANOA 3GGFA 3LPBA 4ZS0A 3S95A 4CQGA 3BU3A 1H4LA 4QQ5A 5A3XA 3UIXA 4EKLA 3RAWA 1W83A 2UZBA 3T3UA 1OB3A 2JBOA 4D0XA 2F9GA 1QPEA 3HMOA 4BTKA 2QU5A 3PPKA 1E1XA 3VNTA 5AAFA 4IFCA 4MH7A 5EDPA 5F4NA 4CFFA 4BZDA 4I0SA 3AT2A 4WNPA 3QF9A 2UZEA 3PRFA 1QL6A 5CF5A 4O7WA 5FWKK 4DBNA 4RC3A 4R5SA 2PVFA 3KXNA 5BX0A 2HXQA 4FZ6A 2W1HA 5C26A 3UP7A 3NIEA 4HGTA 4O21A 1YXSA 3HP2A 4J71A 3SC1A 5DG5A 1IAJA 4O0WA 5HD7A 1OL7A 3DLZA 2X8EA 3EHAA 2FYSA 3QZHA 3UOLA 2P55A 3GT8A 1XH8A 4F7NA 4PNKA 2JAMA 3ZZEA 4XJ0A 2CDZA 3V5LA 4NFMA 1SVHA 1FGIA 2UVXA 3G6GA 4FV7A 2GFCA 2VTMA 5DT4A 1R78A 1P4FA 3R00A 2EB3A 2BALA 3R71A 3QTUA 5IF1A 1XH6A 4JG7A 3A7GA 2GQRA 2W7XA 3PLSA 3EFLA 4L6QA 1OL1A 4MWIA 1LR4A 3WZKA 4QPSA 3DXPA 2OWBA 1H1PA 5CEQA 5DR6A 4NH1A 5CLPA 5JMSA 4FKRA 3PG1A 3U54A 2OJFE 1O6KA 1SNUA 3UMXA 5A4EA 4U0IA 4EK6A 5IQAA 4EOPA 4ZSJA 3TWJA 2ZOQA 3ENMA 2QC6A 3BRBA 3JXWA 3OCGA 3R83A 3UNJA 2VTNA 1HCKA 4USEA 1PXOA 3MGYA 5L2TA 1UNLA 2P0CA 3SXRA 4TWCA 3EN6A 4BGGA 2IVVA 3F6XA 4LMUA 1M17A 5E4HA 2WMBA 3WYYA 4YSJA 3H3CA 2Y6MA 3OROA 4RWLA 5AJQA 2QLUA 3F5GA 5FG8A 4FT7A 4D28A 2XIZA 3EH9A 1UVRA 4JDJA 5FD2A 5B7VA 1BUHA 4EOJA 3W10A 4IBMA 3S0OA 4F09A 4WA9A 5HI2A 3ATSA 5CQUA 4GV1A 5AV3A 2WMUA 3F3ZA 3SD0A 3UYTA 4FV6A 2PVJA 1PRYA 1ZMUA 3BHHA 4DFNA 1Y8GA 2FH9A 3QCYA 4U80A 3G0FA 3JVSA 4FKLA 2BUJA 3VS5A 1KE8A 1CKIA 4ZZOA 3BLHA 3OEFX 1FVVA 2J0IA 2OI4X 2ZV8A 3KFAA 4AZVA 2PUPA 1XQZA 4AXAA 4A7CA 3QL8A 4J8NA 3SX9A 1P14A 4C57A 4L45A 5H8BA 2GU8A 3KL8A 3FLSA 4V0GB 3QZFA 2X2MA 5AR8A 2WQOA 4YO6A 2J90A 5EI6A 4AG8A 3HVCA 4EBWA 4UWYA 3G6HA 1GZOA 3PJ1A 4FT9A 4LM5A 3V5JA 2PE0A 5J9YA 4XX9A 2HELA 1Z57A 4KBAA 2G1TA 5D1JA 5JQ8A 4CYJA 1OKVA 5E7RA 4DFZE 1JKSA 3PTGA 4HYIA 4PUZA 4CT2A 4IX6A 3AXWA 3CP9A 3AC3A 3NUSA 2UW0A 1CKPA 5EKOA 3FSKA 2GS6A 3LFFA 3ZSHA 4M97A 4BICA 2YERA 5CENA 4I21A 3T3VA 4BZOA 1ZYDA 3HGKA 5CF6A 5HG5A 1YHWA 4HVHA 1GAGA 4H3QA 4RQVA 4O0VA 5LMKC 1NW1A 5LMKA 4FKOA 3FE3A 1PXNA 4CMUA 5J79A 4LGHA 4ASXA 4JLCA 5AEPA 2HW7A 5CU6A 3MJ1A 3P86A 3TV4A 2OW3A 4K8AA 4P4CA 2I6LA 2YM8A 4CYIA 3DNDA 3FMDA 4L67A 4DH1A 1E1VA 4YMJA 4QTDA 4A07A 3E5AA 5LJJA 2GNHA 5C01A 4BDGA 4AACA 5GZ8A 1OPJA 2C1BA 4KBKA 2XBAA 3KF4A 5KHXA 2PHKA 3B2TA 3RTPA 3MVJA 2A2AA 3GCQA 4AE9A 3IW5A 2W1IA 2WB8A 4IAKA 4FK6A 4RWIA 4XNEA 3FY2A 2VWZA 2ZDUA 4APPA 3L8VA 1H1QA 3EKNA 4C3PA 4FEXA 3UTOA 2QOLA 4GJ2A 3AGLA 2XZSA 2AC5A 3KXMA 3F61A 4QO9A 4W4WA 1H0VA 4QMZA 4TYEA 4DCAA 3F3WA 1W84A 4UWCA 4LL5A 4D4VA 3RJCA 1G8AA 1XH4A 2VNYA 2VTIA 2OG8A 2JDOA 4KS7A 3ID6C 4OT6A 2GNFA 4H36A 5FDXA 3RAKA 4BBMA 3W16A 4EH2A 2ONLC 2QKRA 2ONLA 5D11A 5ANIA 3PY3A 5LWMA 3OTVA 3EB0A 2OJJA 4MNEB 4TKSA 1PMEA 2VTTA 2YFXA 3IW8A 3W2QA 4FVPA 3VUHA 2RIOA 5M06A 3PLAE 1PXMA 4Q5EA 1MRVA 4K1BA 4IDTA 3FZPA 4DEIA 2B9JA 4M15A 5J7BA 3V5TA 1ZLTA 4D2TA 3IDPA 2XYNA 4YHFA 3DT1A 3H9OA 3WYXA 2CGWA 1H26A 3LW0A 4BDCA 4EYJA 2QD9A 4H3BA 2ITQA 5M56A 4HJOA 3MJ2A 3E8CA 4EK5A 2OIQA 5HBEA 4BBFA 4BR3A 2G01A 4MVFA 1JKLA 4XP0A 1J3HA 2GSFA 2X2KA 3NYVA 3W2PA 3ALOA 4G6LA 5EKNA 3EFKA 1B39A 4E73A 3LM5A 4MAOA 4UEUA 3PXYA 3KXZA 3R7YA 4DAWA 1JBPE 3TJDA 3FC1X 3QAME 4AN3A 2EU9A 4DGNA 4HGLA 2OXXA 4I6FA 4NTTA 3PDTA 1GZ8A 3U6IA 1UWJA 2W17A 3R2BA 4FG7A 4TXCA 4OTHA 4TN6A 3THBA 4EONA 5IQIA 4XG2A 4G9CA 3ORXA 4JVGA 2FUMA 4EH5A 3I5ZA 4Z7GA 4W8EA 2BPMA 3BYMA 4RT7A 5IA3A 4FEVA 4PPBA 4Q9SA 5AP4A 4YJVA 5LCJA 4GFGA 4A9TA 4O38A 4D1SA 5BVEA 4FG9A 1IR3A 4JT3A 4RA5A 4AGUA 4LV5A 2W5BA 5HE3A 4ANMA 4F1TA 4ACGA 2OXYA 5KO1A 4GT3A 2JLDA 3C4WA 4I94A 3BEGA 4I5HA 1IASA 4RJ8A 4UMTA 5AP5A 3FMJA 3ZBFA 3R6XA 4J7BA 4OTDA 3U51A 3AT3A 4JQEA 5IH5A 4HGSA 5HBJA 3BELA 5L8LA 3LLAA 4FKJA 4JBQA 2OFUA 2C0TA 4RX9A 3U6JA 5CX9A 5DFPA 2PZYA 3GCSA 3MY0A 1OBDA 4TYHA 3NMUF 1Q5KA 2V0DA 3IQ7A 4RIWA 3ZLXA 5AFVA 2QU6A 2X9FA 4MBIA 4DT8A 4I1ZA 2IWIA 2BCJA 3RWPA 4FNZA 2OLCA 2UZLA 1R1WA 2OXDA 1ZZ2A 3ZMMA 2C0IA 4PL3A 1E9HA 3FUPA 4L3PA 2GNIA 4M7IA 1ERKA 2JGZA 2X7OA 3QRJA 4RFMA 3Q4UA 3ANQA 2HW6A 2QODA 3BE9A 3MIAA 3IG7A 3UODA 5AA8A 2J0JA 5A4QA 4TRLA 2NRUA 1NVQA 3FQHA 4P7EA 2W5AA 5E8SA 5EK7A 5ACBC 5IDPA 3GC8A 1JVPP 3VRZA 4GRBA 2QOCA 2IZUA 4LI5A 3V5WA 1CSNA 2QURA 1UNHA 3IKAA 5AV1A 4ZXTA 5AIKA 3QWKA 1IG1A 4MCVA 4GU9A 2OF4A 4FZFB 4FV1A 5AUWA 3ZHPC 4FA2A 1IRKA 3EYHA 4FTCA 4HW7A 5M08A 5J7HA 2YCSA 2J0LA 4JR3A 3RNIA 4X2NA 4JBOA 3AMBA 4U9AA 2F4JA 1H1RA 1YI3A 4KKGA 4QP6A 4L01A 2WTKB 3BYVA 4MQ2A 5HO6A 3BYOA 3LHJA 3ZFYA 5FTGA 2XIXA 4G31A 2O5KA 1LUFA 3BBWA 1YDSE 4G3CA 1U5RA 3AOXA 5H3QA 3QKMA 2LAVA 2IN6A 4TW9A 4BDEA 2X9EA 4FIHA 3VBTA 2R7IA 3CD3A 3ZU7A 3PWDA 3FMHA 3O7LD 3QTRA 2W4OA 1JOWB 2BDFA 4CKRA 1SNXA 4HVGA 4C4IA 3K3IA 2H6DA 4NJ3A 4AS0A 3PVUA 3OVVA 4CZUA 3TTJA 3WZEA 1QPDA 3VS1A 4PX6A 5EH0A 4G2FA 5DOSA 1HCLA 5CAOA 4E20A 4IAYA 4YJUA 5DYJA 3N51A 3FHRA 1RE8A 4QP3A 4Z7HA 4Y73A 2WMSA 4FTIA 4U79A 4V04A 4RIYB 3V8WA 3DBFA 4E6AA 4USFA 4FKWA 2J9MA 4EQCA 1YI4A 3HAMA 4O2PA 3HYHA 5HCYA 4FSUA 1JSTA 2O0UA 2X7GA 3R7VA 5AP6A 3W55A 4FV9A 4YNEA 3VIDA 2ZV9A 4WNMA 3CJGA 3ETAA 3ZC5A 2VNWA 3KRJA 4KIKA 3JYAA 4RA4A 2CGUA 4ZSLA 4IB3A 4BGHA 4L00A 4GUBA 4CMOA 4EOQA 2IVSA 3W33A 5H9BA 5KKRC 4HVDA 5DI1A 4WOVA 5BYZA 3VWAA 3QUEA 3AQVA 2JBPA 3RI1A 3PIXA 3A7JA 5BUJA 2W1ZA 3OTUA 5DBXA 5FLFA 2Z7RA 3WZDA 4AOJA 3OWJA 1PYXA 3RCDA 4KAOA 4OBPA 5ANJA 2C47A 1MRYA 2XRWA 2YITA 4ZJVA 1H8FA 2G2IA 2ZMCA 3KA0A 2JKOA 3JPVA 4F0IA 5BQ0A 4WHZA 4CKJA 4NZWB 5AUVA 5CVFA 3TKIA 4E8AA 1VR2A 5AR3A 2I7QA 3E62A 5JKGA 4RVKA 4JR7A 4RSSA 2F2UA 3O8UA 4AGCA 3N4UA 4M14A 4YZNA 4XLVA 4RJ3A 2HAKA 4U45A 4BCKA 3AG9A 4FL2A 2VO0A 4BHZA 2XUUA 2REIA 3HMIA 1Q97A 3UE4A 1FMOE 2JDVA 4CFXA 4CG9A 3BQRA 3TNWA 1OIQA 3CQWA 2JD5A 3ACJA 5L2QA 3V3VA 4L7FA 5JK3A 4XS2A 4S2ZA 2VD5A 1KOBA 3MDYA 4U41A 4C59A 2XCHA 3SGCA 3VC4A 2W5HA 3OF0A 5CI7A 3OUKA 2YM5A 4LFIA 2XB7A 4PL4A 2YHVA 4G1WA 3PXRA 4O1PA 1MP8A 2ITTA 2OF2A 1QCFA 2WMQA 3KVXA 3Q6UA 4O6EA 4UZDA 5CT0A 3BWFA 3U87A 2X6DA 1WFCA 3KRLA 2R3HA 1PY5A 2IO6A 4RGJA 4UMPA 5KMOA 3BHUA 2J51A 4RZVA 2R2PA 1Y8YA 3NCZA 4J95A 4LQMA 5DIAA 2YISA 4N70A 4ZTQA 2X81A 5HLWA 2OGVA 2PVKA 4MXCA 4NM7A 4UY9A 5IMEA 3RK5A 5CF4A 4MWHA 4AT4A 3PVBA 3FLYA 4DEDA 3TZ7A 1OIUA 1OGUA 4FTRA 5KMLA 2YZLA 3K5UA 3BV3A 4QMOA 3B2WA 3Q32A 5L2IA 1OUYA 2FSLX 3TKHA 3ENHA 3NDMA 4V01A 4XHKB 1Q62A 3KCFA 4ZSEA 4BCHA 5M57A 4FNWA 4DG3E 3EQFA 3FMEA 4L53A 1STCE 4Y8DA 3HA8A 4AWIA 5CAUA 3UPZA 2XKDA 2VV9A 2XM8A 4PMTA 4NW6A 1JNKA 3Q9WA 5J9ZA 2RGPA 4Z3VA 1J7IA 5I0BA 4IW0A 4I93A 5A6OA 3FI8A 4DHFA 5CSHA 3TIZA 3ZO4A 5KMJA 4O0YA 4WNKA 3VF9A 4WBBB 3VO3A 1WBNA 2AYPA 2PMNX 1CMKE 2VTJA 4JS8A 4S31A 1M14A 2WHBA 3U6HA 4GK4A 4FTJA 4FV4A 3HDMA 4C33A 5HORA 1NVRA 1OPKA 3ORMA 3QLGA 2ZDTA 4M3QA 4FKUA 1BMKA 2WGJA 2ETMA 3LFBA 4GVJA 3DXNA 3A8XA 4TZRA 2BKKA 2G2FA 3SKCA 4Z9LA 3FMMA 5IKWA 4EZ5A 4G34A 1YDTE 3R9HA 3TL8A 4DYMA 4UXLA 5EDQA 2JFLA 4BTFA 3G15A 3KRWA 2X39A 3FYJX 1R39A 3UMWA 4BI1A 4HZSA 1UKIA 3OCBA 4G5PA 1ZMWA 1Q61A 3HDNA 4KRCA 4XRJA 2XNOA 3O51A 4BBEA 2WOTA 5D7VA 1V1KA 4FSMA 5EW3A 3P0MA 4RWKA 3MB6A 4GH2A 2B9FA 3BE2A 3AC8A 5IH6A 2BROA 4M84A 5CEPA 3S00A 3UVQA 5BMSA 5BYYA 4M8TA 1DS5A 4M0ZA 5A4TA 1UKHA 3EQBA 2DQ7X 3HRBA 2BRMA 5CEOA 4RJ6A 5T3QA 5KMKA 3L9LA 4JQ7A 2BFYA 5EQYA 3KULA 2WXVA 3PJ8A 4XP2A 2UW7A 3BLRA 5FM2A 5FXRA 3O8TA 3WZJA 3C4ZA 2FSMX 1WBSA 5LVMA 2UZVA 4N57A 3TACA 3R1QA 4YHJA 1ZY4A 2YDIA 4NSTA 3ZLSA 5M55A 3WIGA 4YTFA 3HEGA 5DLSA 4IZYA 5DGZA 2YCRA 3PVWA 4M69B 1BL6A 1P2AA 4D58A 2GTMA 4FVRA 5ANEA 3D15A 5EOLA 5JZNA 2JIVA 3R21A 3MY1A 4YNOA 4GKIA 4IAIA 4YC8A 2UW8A 3O8PA 2R3OA 5HE0A 5HIDA 3II5A 3LLTA 1JLUE 2ZJWA 4QYYA 2VWWA 5CAPA 2R3NA 4L68A 1KOAA 2OICA 1Q3DA 5LARA 3BHTA 3PY1A 5CF8A 3PE2A 3OEZA 2J5FA 4YZBA 1K9AA 3R9RA 3DFAA 3NW7A 3GCPA 3FMNA 3P7CA 5DH3A 4F99A 3NUUA 3R8LA 2W1EA 4AGDA 4D5KA 1T45A 4DEHA 4AGWA 2XRUA 2ZVAA 1Q8ZA 3Q60A 4FOCA 2P2HA 3FXWA 4KIOA 4C35A 4DFBA 2BKZA 4CEGA 4QYEA 3KQ7A 4CSVA 4R1VA 3R7EA 5HGIA 3R04A 4AOTA 2JKKA 5HVKA 3PJ2A 2UZUE 2E9NA 1I09A 3MFUA 2PL0A 4PY1A 4QMWA 3W32A 1S9IA 4BB4A 2PU8A 3ORPA 3G9LX 4HPTE 4TWOA 4O7TA 5GNKA 4X2FA 5E8TA 5A14A 4FTUA 3W2CA 2I0YA 3MH0A 4JNWA 5EOBA 2W1CA 2ITYA 2UZOA 3E63A 5HQ0A 5CZHA 3W2RA 3VUMA 2UUEA 2VX3A 3Q53A 3R02A 2GPHA 4ID7A 3R7GA 4XUFA 2W1DA 3R28A 3LKMA 3VBYA 2C5NA 3FZSA 3PPJA 2EXMA 4K33A 3UO4A 5JGAA 5IA0A 4CT1A 3DAJA 2P4IA 4FTQA 2JKMA 2PVRA 4TNBA 5KZIA 2Y7JA 4UV0A 3EQHA 1YXXA 2CNVA 3CQEA 3L9MA 3WARA 4EWHA 4GMYA 3QQUA 3F3UA 5BVKA 3CKXA 2LGCA 3CPCA 1TQMA 3LXLA 1F0QA 2FSOX 3AD5A 5CAQA 3FPQA 4FUXA 5HICA 1LPUA 4EOLA 2RG6A 4UALA 2QNJA 5EFQA 5HCXA 3ZUTA 4UYNA 4EJ7A 2GMXA 3H0ZA 2O3PA 3LAUA 3CBLA 3GXLA 5J5SA 2CHLA 2CGVA 4JAJA 5AIRA 4ZAUA 2GNGA 3Q9ZA 5A9UA 1OZ1A 3P08A 3VUDA 4RJ7A 3DKCA 2ACXA 5ITAA 2G15A 3DBEA 3EN5A 1M7QA 4R77A 2OH4A 2G9XA 3DGKA 3QQFA 4E5WA 2X7FA 1JQHA 3BQCA 4FKVA 1UU3A 1PMNA 4L52A 4NKAA 3T8OA 5M07A 4Y5HA 2J7TA 3BV2A 3OY3A 4IVDA 4P90A 4XLIA 3DB6A 3VVHA 2Z7LA 4OTFA 5EI2A 2BILB 3FI4A 3OZ6A 4GS6A 5E8ZA 4BN1A 4C8BA 3KXXA 2WMVA 1J7UA 3FJQE 1XBCA 3HAVA 4CNHA 3KREA 3ZLWA 3MBLA 5J1VA 3COMA 4JOAA 2NP8A 3N4TA 2R3RA 3CY3A 1XKKA 4FIFA 4R8QA 2G2HA 4C3RA 3MTLA 5JFVA 3OWKA 4Z16A 4QTEA 3OP5A 3PSCA 2A19B 4MXXA 4QP1A 3WF7A 4LG4A 1YOJA 5GIPE 3OW3A 2I0EA 4UN0C 3Q3BA 1WBPA 3GFEA 1YHSA 3UZPA 5I9XA 4F65A 4TYGA 1TVOA 3PA4A 2W05A 2XYUA 3EQPA 4O22A 4ZP5A 3LM0A 3ZXTA 5IA5A 3LQ3A 5HU9A 3H30A 5BVWA 3FBVA 1YQJA 3C4CA 5JGBA 5H8EA 2W4KA 2EVAA 3EMGA 4K9YA 4ZLYA 3BHYA 5AAEA 2W06A 4F9WA 2XK8A 4U42A 5M44A 3BHVA 2VGPA 4EOSA 2B4SB 3FYKX 2R3QA 4E4NA 3O23A 3C4XA 3DZQA 3LIJA 3M1SA 4GFMA 4MF0A 4F63A 3WOWA 3LMIA 3IS5A 4QMYA 5K5NA 2VUWA 3E8EA 3TKUA 4YC3A 4NIFB 2C1AA 3RKBA 4A9YA 1H25A 3ALNA 3DPKA 2WU7A 3M11A 5J1WA 3ZO3A 4DLJA 2WMRA
chains in the Genus database with same CATH superfamily
2IW6A 4I4FA 4BCOA 5AR4A 2VX0A 2W1FA 4ZSGA 5TF9A 3I4BA 1WBOA 4I23A 3CTHA 3QQGA 2ZYBA 4NCTC 2GTNA 3C0IA 2DUVA 3GI3A 1CDKA 2HY0A 2Q0BA 1KE9A 3HLLA 4J96A 4NCTA 4TY1A 4EHZA 2WQNA 3OY1A 4BCFA 2W0JA 4IWPA 3DA6A 4X2KA 3E87A 5C1QB 5C8NA 2O63A 1A06A 4KINA 2FGIA 2R3PA 2XIYA 4TYJA 5FBNC 2HY81 3KMMA 4XV2A 5BUEA 4O0UA 2WTDA 4CV9A 4DH3A 4IVCA 2WTIA 3KN6A 4DEAA 2E9UA 3MVHA 4R7IA 2CLQA 4YZ9A 5IQDA 3FKNA 2UW6A 4EH6A 3IGOA 2R3FA 3CCNA 4IC7A 4WUNA 3BI6A 2AUHA 4FNYA 3ZC6A 3PJCA 4MK0A 4M66A 5CQWA 4RFYA 4FKIA 4I5MA 2C3JA 3IW6A 1T46A 4FKQA 3KVWA 4F4PA 5DT0A 3Q5IA 4HCVA 5KX8A 1OKWA 3DBDA 4RVTA 5A6NA 3C4EA 3OOGA 3F5XA 4CTCA 5KUPA 1XO2B 4WG4A 3ORKA 2VTRA 1YXTA 5EYCA 4CZTA 4NYEA 4W4XA 4IFGA 3HL7A 3AC2A 5JN2A 3QCQA 5JFSA 2JIUA 5BYLA 1XMMA 3IOKA 3QTXA 3MYGA 3UVPA 2PE2A 1IA9A 4YHTA 4D1XA 1ZYJA 5HNBA 4XCUA 1F3MC 2WQBA 4FR4A 3DK7A 3RHXA 4IHPA 3C4FA 4O91A 1ZARA 4AA5A 4CVAA 4XBRA 5AP1A 3W1FA 4R1YA 2W9ZB 5AV4A 5I3RA 2C3IB 3KB7A 3ZUVA 3FEGA 3F5UA 3PXZA 3MN3A 4RJ4A 3ROYA 1VYWA 4CRLA 4IB1A 2PWLA 1JKKA 4L46A 3ORZA 5EM5A 2C6OA 1IA8A 3O2MA 2OFVA 2P3GX 3GVUA 4QP8A 3SDJA 4U8ZA 4G3GA 2A27A 2A4LA 2B9HA 2ERZE 3MPAA 3LFCA 5FEEA 4DLIA 4ENYA 2YIYA 3NUNA 3LCKA 5JT2A 1VJYA 3NNVA 5K4IA 4ASZA 1WBTA 3QX4A 4K0YA 2XCKA 3FV8A 4G3FA 3C13A 5GZAA 3ORNA 4JIKA 5IUGA 1FVRA 3KC3A 3D83A 4KIPA 1XH9A 1WBVA 1URWA 2XS0A 4G6OA 4YLJA 3VW8A 3DY7A 5D41A 5KBRA 3UG2A 5BPYA 3QA0A 1ZY5A 4AF3A 4MBJA 3GU7A 4Y85A 2R3JA 5HIBA 2R64A 3Q4TA 4QTBA 3RPSA 4FVQA 1WVYA 4ZTMA 4NEUA 5K3YA 1JKTA 3Q04A 4FSRA 5TOZA 2PZRA 3TV7A 3UOJA 4AN2A 2DS1A 2C5OA 4U7ZA 3VBQA 1P5EA 2VGOA 3BKBA 3FHIA 4V0GA 4KNBA 1P4OA 3RWQA 1KWPA 2IG7A 2H9VA 3A7HA 2IZTA 1XBBA 4GL9A 4ITIA 4KKEA 4EH9A 4DGGA 3ZM9A 2KTYA 1ZYLA 4GYGA 4RZWA 5L3AA 1H1SA 4G6NA 3ZRMA 4DFUA 4ZJIA 3GU8A 1UU7A 4KUJA 5E8WA 3AKLA 3KU2A 4C2VA 3DZOA 4L8MA 2OIBA 4PP9A 4J8MA 4W4YA 3TN8A 3P1AA 4MQ1A 4FNXA 3PIYA 3DJ5A 3F7WA 3NWWA 3O5AA 3ZS5A 4FTNA 3OW4A 3Q5ZA 3UPXA 4RVLA 4BDDA 4XV9A 4PP7A 2YM4A 4I20A 2WMTA 4OGRA 4U5JA 4KSPA 4HZRA 5CSPA 3D5UA 4O0SA 5HKMA 4RX7A 5C27A 4M13A 4F78A 3CY2A 3ZZWA 1MQBA 3NUPA 4DCEA 4MKCA 4FTAA 3QU0A 4W4VA 2JFMA 2WNTA 1XBAA 2PVLA 2QO9A 3DAEA 3HV7A 3ORIA 3SLSA 4DFLA 4NWMA 5TO8A 3OWPA 4E93A 3COHA 4C4GA 5ANGA 5M53A 5LVLA 1WAKA 3PSBA 2RKUA 3OHTA 4JBVA 3NEWA 1OL6A 5CWZA 3UDBA 3SW4A 1OUKA 3ERKA 3WF6A 3NLBA 4DA5A 4QMLA 2RG5A 3OXZA 4F0FA 4ZTLA 1NA7A 3TEIA 3PA5A 3RMFA 2QR7A 4EQMA 4YUQA 4RRVA 2BTRA 5DMZA 4AT5A 2R0IA 4O96A 3W2SA 3FMKA 4GCJA 4I92A 4K77A 5AWMA 4BY9E 5J87A 5AP7A 1RQQA 2IZRA 4FT3A 4C62A 4AX8A 1H07A 4O86A 3DKGA 3WZUA 4XG8A 5HX8A 4PQNA 3F5PA 4OT5A 1PMVA 3GC7A 3OT3A 5B0XA 3LFNA 5E1EA 3W8LA 3HX4A 4B6LA 4FI1A 4MNEA 4YZMA 2PVHA 4C61A 2RFEA 1FMKA 4E6QA 2QOQA 4EOKA 2V7AA 5A54A 1A48A 3PUFC 4I22A 3SA0A 4YC6A 4F08A 2NO3A 4TPTA 3E7OA 4AAAA 5GJDA 5GZ9A 4MYGA 2R7BA 2C4GA 4OW8A 4X2JA 3SV0A 5DRBA 5CAVA 3R73A 1R0PA 2VRXA 3C50A 4I5PA 4YBJA 3GCVA 3VHEA 4OUCA 5M51A 1R3CA 4EH7A 1KE5A 5CU3A 4FGRA 2PULA 2WIPA 3QXPA 4RFZA 3DK3A 3GC9A 2HZ0A 3R7OA 2QCSA 4ANQA 3NUAA 4X3FB 5IQFA 3QQLA 3MH1A 4HPUE 2ITWA 5ANDA 4ACDA 4IAAA 4D2RA 3EOCA 5TT7A 4EKKA 1BLXA 1BX6A 2W4JA 2YAKA 4E7WA 4IB5A 4YZCA 1PKGA 4EC8A 1J91A 3TNPC 4G3DA 3FPMA 2Q0NA 1FVTA 2Z02A 3A62A 1VYZA 2X8IA 5ANOA 2AQXA 5AMNA 5JRQA 5CZIA 4Q2AA 4QMTA 1DM2A 4D2VA 3P7AA 1K2PA 3QTQA 3HMNA 4I4EA 2BZKB 4JDIA 3FI2A 3PXQA 5AUXA 4BDHA 5CEMA 2PUNA 1OKZA 1KV1A 5AAGA 3UNKA 3Q96A 3W0PA 2HENA 2PZPA 2GS2A 4DF3A 2ETKA 2I0HA 2ZM1A 3VS0A 3MB7A 5L2WA 1L8TA 5TE0A 4C38A 2WFYA 2CKEA 3GOPA 2JIIA 3QQJA 2Z7SA 3IDBA 4PWNA 3ACKA 1PW2A 4UZHA 3RK9A 1H24A 3F2AA 3VF8A 4ZTSA 4F9BA 2CSNA 4C36A 3IPHA 1YW2A 3KCKA 3BBTB 3F82A 2YEXA 3ORLA 4FKSA 3F69A 4B8LA 1CM8A 3PWYA 4X3FC 2C0OA 4XP3A 3LFEA 1SZMA 4X3FA 4B9DA 4D9TA 1TKIA 1ZOGA 5F95A 5E8UA 3G0EA 2XK7A 4CFVA 3R9DA 5CXZA 4EORA 2ZB1A 4EH4A 4GG7A 4GVAA 3E3BX 4QTAA 2QOOA 1W7HA 2W99B 3VULA 3AKJA 1FINA 2J2IB 4F6SA 5KMNA 4BRXA 3RPRA 5LOHA 1SVEA 2IW9A 5IDNA 2OJGA 2ERKA 1W8CA 3PP0A 3ZM4A 4ARKA 4BWXA 4I24A 2UW4A 3G90X 3G33A 3HMPA 4MD8E 3F7ZA 5CNOA 4BDIA 1OM1A 3CGOA 3P9JA 4E5BA 2B1PA 2WPAA 4D4RA 2VX1A 4O27B 5GJGA 4AXDA 4CCBA 4LRKA 3UC3A 5JEBA 3SW7A 4BDBA 2YM6A 1ZRZA 4XH6A 4OTRA 4FL3A 4D5HA 3MH3A 5F9EA 1GOLA 4RIXB 4DBXA 5EHOA 3LCDA 3NYXA 4Z55A 5CALA 1XH7A 3RAIA 2QHMA 2JEDA 2XK4A 3I0QA 4RIOA 3TIYA 3UOKA 1XH5A 3HNGA 4AXEA 2OO8X 1GY3A 3JVRA 3PZEA 3TJCA 1ZOHA 2WTKC 3NR9A 4H1MA 5HLNA 2YIWA 4TNDA 4DGLC 3PA3A 2ZM3A 5DWRA 5JH6A 1BYGA 5ETFA 4B99A 3U55A 1Y91A 2VU3A 4HVSA 2F2CB 4UWBA 2XIRA 4YPSA 2CGXA 2OZOA 5EI8A 5HESA 4CMTA 5KHWA 3HRCA 4QMUA 1GZNA 4X3JA 2YN8A 4RBLA 5KZ0A 4O7SA 4GK3A 3ORTA 2PMIA 1B38A 3EZRA 3CEKA 3U8WA 5IQBA 1BKXA 3RM6A 3PXKA 5HTIA 1QPCA 5D9HA 2R3IA 3I1AA 4HNIA 3HV3A 4M67A 2PYWA 4IDVA 4I0RA 5CNNA 4A9UA 4CFMA 2CJMA 4RIYA 2C6IA 3CPBA 3VBXA 3W0OA 3OXTA 4LYNA 2C6EA 5DPVA 4I3ZA 3JUHA 4JX7A 4HGEA 4ZJJA 2C30A 2EB2A 2X8DA 5AV2A 3Q9YA 2X2LA 4QT1A 4A4XA 4UMRA 2JDSA 4O82A 3OD6X 2YAAA 4DG2E 4PDPA 2VWXA 3CC6A 3PUPA 4K18A 2O64A 5EHYA 4DTBA 5AV0A 4L42A 2BDWA 2Y6OA 2ITXA 2VWVA 4L7SA 3RZFA 4YO4A 4XG4A 2XMYA 3GNIB 4ORKA 1YWVA 3VAPA 5J5TA 3H9RA 5IISA 3EL7A 4EC9A 4YLKA 4EUUA 2XNMA 3RNYA 4FG8A 3C5IA 4U43A 4U97A 3TZMA 3PJ3A 3DKOA 3FI3A 3QRKA 3LMHA 5M4FA 2ZB0A 4G16A 4YJQA 3HRFA 3O0GA 3KRRA 4FSNA 3FKLA 3CTJA 2ZV2A 1UWHA 2BZJA 3RAHA 2BTSA 3NAYA 4BYJA 1R0EA 3EJ1A 2E9VA 3TM0A 3SXSA 3EIDA 5L8KA 2BVAA 5I3OA 2A98A 4I6HA 3DS6A 2HWOA 3CS9A 3E64A 4DC2A 4JDHA 3H10A 1JSUA 1ST0A 3IECA 2PUUA 3R01A 3FC2A 3HMMA 3I6WA 3MVMA 2Y8OA 3U9CA 3GEQA 4F70A 5KNJA 5FXQA 3NX8A 2VWBA 4IANA 4JRNA 3UBDA 5T68A 5HG8A 4DH7A 2FVDA 2BR1A 2OU7A 3KMUA 4CFNA 5HTCA 3UYSA 5AUUA 3VQUA 5DT3A 2BAKA 4TTHB 4FIJA 2QOHA 3KY2A 3PP1A 2X0OA 1EH4A 5CEKA 4BCJA 3R2YA 3W2OA 3K2LA 2BZHB 3FL5A 4AZTA 5IEYA 2V7OA 4FV8A 4E26A 4ZIMA 3R7IA 2E9OA 5EG3A 4F1OA 2PSQA 3NYOA 3PG3A 2JKQA 5E8YA 5HIEA 4CXAA 2ZV7A 2BRBA 3A61A 4FTKA 5CU0A 4QQCA 3IONA 4FUYA 4F1MA 2YDKA 2XNPA 4RJ5A 3A7FA 4O81A 4GIHA 5DEYA 4FTMA 2QO7A 3BCEA 3QTZA 5HE2A 4UMUA 2VWYA 1BL7A 4FSQA 5JSMA 1G8SA 4AW5A 4O0RA 4BCNA 1J1BA 3SRVB 3ZTXA 2R3LA 2HIWA 4O1OA 4PRJA 4IM2A 2YZAA 3D2IA 3UIBA 1OITA 4F64A 4BZNA 2NPQA 4KIQA 1GNGA 3FZ1A 4HCUA 3QRUA 4U40A 2ZFYA 4QMVA 4USDA 4CFWA 2XJ0A 3QLFA 4LOOA 1H28A 5D7AA 2CLXA 4G3EA 4HNFA 4IACA 1VZOA 2IF8A 2QONA 2Z2WA 3KXGA 2NNWB 4FF8A 5E8XA 2ESMA 5JFWA 3G9NA 3MFRA 3BPRA 1APME 4WSQA 3LFDA 4ZLZA 4LOPA 4R7HA 5I4NA 1K3AA 2HOGA 3TNHA 3BX5A 3QZGA 4WT6A 5AX9A 3QHRA 4FEQA 4OBQA 4QMSA 5B2LA 3HUCA 5I9YA 3QFVA 4FKTA 4RWJA 5FM3A 5LVNA 4O83A 1X8BA 4ZK5A 5ETAA 4IAZA 3QTWA 3U9NA 4ZLOA 1DAYA 3QD3A 4WUAA 1KSWA 1DAWA 2XNGA 3AMYA 3LJ1A 3OOMA 2IEWA 2OSCA 3GU4A 3QZIA 1V0PA 4I6QA 3IDCA 4IVAA 3VHKA 4D4SA 3UQFA 4ZY5A 3SG9A 3LQ5A 2XANA 1Z9XA 3EQDA 5FP5A 2JAVA 2BHHA 3R22A 4FTOA 4ASEA 1Y6AA 5EYKA 5KMIA 5GIOE 5DA3A 4P5ZA 1U54B 5K9IA 1GIHA 1WBWA 3QRTA 5CXHA 3CTQA 5ACKA 2IVTA 3MH2A 4R3CA 4UB7A 2BAQA 3OMVA 2CPKE 3ZEPA 1H0WA 4DHJA 1O6YA 4FSWA 3D5WA 5AR5A 4M68A 4BKJA 4LL0A 4LV8A 4BCGA 4AFJA 2BRNA 4M12A 2UW5A 2V22A 5I9UA 3LCOA 4KS8A 3BU6A 3ITZA 4M69A 4QMQA 2OZAB 3S2PA 4BVUA 4QMMA 5DVRA 4DG0E 2J0MB 2RFDA 4R6VA 2IJMA 3QCSA 5CVGA 2W9FB 5HO7A 4C37A 4EUTA 3PSDA 4QD6A 4PTGA 3QX2A 4PF4A 4NM0A 5HO8A 4OTPA 3QTSA 5CASA 3GOKA 3D5VA 4E5AX 4RMZA 1RJBA 5CVHA 3BLQA 4J99A 3S4QA 2XIKA 4DTAA 3LMGA 3FMLA 2Y4PA 2CKPA 1PXKA 1LEWA 3E8DA 2YJSA 1JAMA 3ZBXA 4FTTA 4MUQA 5HG7A 4YP8A 4XMOA 2ZAZA 2VTLA 3L9NA 1FBNA 2F7ZE 1U4DA 1U54A 4IEBA 3VW6A 2R4BA 2QI8A 4D9UA 4Y83A 3P23A 4IE9A 4UMQA 1YRPA 4MF1A 2C3LA 4AN9A 4AZEA 3MESA 3ZRLA 4O0TA 4ACCA 2UV2A 4LGDA 3WF9A 4KABA 2YCFA 3I79A 2YWVA 3OUNB 2ITVA 4CZYB 5CTPA 4JAIA 3PZHA 4O7VA 3MSSA 3I6UA 3LCTA 3ULZA 3DV3A 3G2FA 3ANRA 4DINA 4FRFA 3SOAA 4BI2A 4D2WA 3FLZA 1YKRA 4J53A 5EQPA 1SM2A 4X21A 4O0XA 4ZEGA 2EXCX 1B6CB 3QBNA 4YJSA 2J0KA 3ZFXA 4AUAA 3R1YA 3NAXA 4Q9ZA 3LFAA 4GJ3A 3W18A 4P2KA 2WAJA 4EZ7A 4MXZA 4FICA 1ZWSA 4C2WA 4C58A 3NIZA 1AGWA 1O9UA 5FBOA 4F9AA 4MXOA 1BI7A 4JG6A 4DGMA 3VRYA 4O7RA 4IX4A 3GUBA 5AM6A 5L6WL 1FPUA 2BFXA 3H0YA 4O84A 2CCHA 5AM7A 5DR9A 2X1NA 4O4EA 2WTWA 1O6LA 3KN5A 4C02A 2RFSA 3BU5A 1LP4A 4UX9A 3CR0A 4C4EA 3BGQA 4IWQA 3W0SA 4GK2A 1OMWA 2GNJA 3C5UA 3DCVA 4ITJA 1MRUA 2UW3A 4QP2A 4JL9A 3UZTA 4FIIA 1UU8A 2UVZA 5IQCA 3W0NA 3JR1A 4RLKA 4WRGA 4XBUA 2OJ9A 3VUKA 4BTMA 3RPVA 1YI6A 3RZBA 2YIXA 3NYNA 4EK8A 2JDRA 4WG5A 3NVMB 2VTOA 1A9UA 4QP7A 2BRGA 2O65A 4H3PA 4QMNA 4Q5HA 4GFOA 4BYIA 2QLQA 3L9PA 2BAJA 4IIRA 3RPYA 4ALUA 4YSMA 1OKYA 5EYMA 3VBVA 3Q4CA 5EW8A 5FRIA 5EQEA 4P5QA 4DEBA 3B8RA 2QOFA 5E9EA 3OS3A 4XYFA 3QGYA 5IMXA 5AP2A 4JX3A 3RGFA 1U5QA 3D7ZA 3ZSGA 3EKKA 4IJ9A 5I5ZA 1I44A 1SYKA 2BHEA 4PPAA 2C6LA 4U6RA 3ZOSA 2I0VA 2J50A 2C3KA 2PVNA 2A1AB 3A4PA 3QD4A 2QHNA 4ALWA 4IB0A 3ULIA 2CKOA 4FKPA 4ASDA 4PTCA 4CLIA 5I9WA 3LOKA 3KEXA 3ZRKA 4QYFA 4GU6A 3DJ7A 1ZYSA 4OLIA 3Q2JA 1NY3A 2YLFA 4TT7A 2XK9A 3SAYA 2BZIB 2OK1A 4AW2A 1TQIA 3O96A 4AW1A 2RL5A 3L8XA 1RDQE 1ZAOA 1GIJA 1Q4LA 2YLEA 1F5QA 4G5JA 4FJVA 4ZS4A 2ZMDA 3JY0A 4K11A 1JWHA 2XEZA 2XF0A 3EN4A 4YJTA 4EH3A 4E3CA 2EUFB 4FYNA 1Q8WA 4YURA 5DE2A 2XALA 3CSVA 4NIFA 3EFJA 3UIMA 3AD4A 3AMAA 4ZZMA 1WCCA 1ATPE 4QPMA 5M4CA 4FIGA 3TUDA 2YA9A 5EDRA 2I1MA 2WEVA 3HA6A 4OTGA 3QD2B 5LCKA 3NPCA 3TDWA 3R7UA 5IUHA 2OBJA 4FYOA 5H8GA 5HNGA 4RC2A 3T9IA 4FT0A 5G6VA 4FK3A 4EJNA 2C6MA 4FKGA 3SOCA 2C6DA 2UZTA 2WIHA 4E6CA 1M2RA 2XNNA 4PTEA 4Y5QA 3H4JA 4ZZNA 2QOIA 2WTCA 4QYGA 3LQ8A 2B53A 3FKOA 3KK9A 4R3PA 4U3YA 3PRIA 2QQ7A 2PPQA 3SQQA 5B2KA 3V51A 3ZH8A 5FDPA 2R3MA 5DHJA 3MPMA 2XARA 5C4LA 3CIKA 4IQ6A 2O8YA 2GHMA 2YDJA 3D2KA 4FBXA 4JG8A 4D55A 4H1JA 4O7YA 3A8WA 3LJ2A 1W2FA 5J8IA 2GHGA 3NNUA 2QG5A 2VTHA 2YIRA 2WMAA 5EM7A 5LMAA 3A4OX 3V04A 4BL1A 2PVYA 5M4IA 1UNGA 4E4MA 4DGOA 4LMNA 4D2SA 4NM3A 3EZVA 5K5XA 5LQFA 2XBJA 1WMKA 2BIKB 1SMHA 2BDJA 4BFMA 5KBQA 2XVDA 4RX5A 4MBLA 4ZTNA 3WF5A 4F7SA 5FTQA 3F9NA 5IQHA 4PDYA 5HU3A 4BHNA 4ZTRA 4YTCA 3AC1A 4LRJA 3MA3A 3RPOA 2BMCA 2QR8A 3VJOA 4EHVA 3R8UA 1YOMA 3LXNA 4NUSA 5HLPA 5AA9A 2VTPA 1QPJA 3PFQA 3PYYA 3RCJA 4EI4A 4PPCA 4AE6A 4FEWA 5LMBA 5E92A 2P33A 3H9FA 5K4JA 5IEXA 4NJDA 4ZTHA 3WI6A 2WTVA 1DI9A 4IVBA 4O4CA 4LUDA 3R63A 2F57A 4C34A 1S9JA 4L43A 4N6ZA 3NVKI 3GU5A 2WD1A 4YBKA 1KE7A 3CJFA 2GFSA 4U81A 3EL8A 3QUDA 2W1GA 4FZAB 2KULA 3VS2A 1MUOA 4LUEA 4EHEA 4G9RA 3Q52A 3QHWA 4IZAA 3R9NA 4CV8A 3VBWA 4NTSA 5JQ5A 3ODYX 4C3FA 3R8VA 2RF9A 4XV1A 2FO0A 4DTKA 1JSVA 3ZEWA 4BKYA 5HEZA 1FGKA 3WIKA 1TFFA 4ANNA 3QYWA 4G17A 4X2GA 4YPDA 4MXYA 3F2RA 5BVFA 4H05A 3FZTA 3ZO1A 1ZYCA 5L4QA 3C51A 4ZMEA 3COIA 1YXUA 1KE6A 1YWRA 3C0HA 4ITHA 4KB8A 4NFNA 5LVOA 3FWQA 2CNUA 4B4LA 4H58A 2XJ2A 5CANA 2C6KA 3HZTA 2Z8CA 3VUTA 2WTJA 3I0OA 3SHEA 3LXPA 3TV6A 4LRMA 3R1NA 2ZM4A 3Q6WA 3UGCA 2ITZA 2AC3A 2WQEA 4AA0A 4LDTA 5C4KA 1W0XC 1M2QA 4QMPA 5CU2A 5E91A 2C5YA 4A4LA 4AU8A 4BC6A 4IWOA 4F6WA 1PMUA 4AFEA 4D2PA 2C69A 4J98A 4YGAA 4KBCA 3NGAA 2P2IA 4EQUA 5L6OA 2UZNA 2X0GA 3GFWA 3O7LB 1H08A 4WD5A 4F7JA 5LWNA 3Q9XA 1PJKA 3ZDIA 4XOZA 1URCA 4QQJA 4ZMFA 2SRCA 3CKWA 2VZ6A 1OIRA 2Y4IB 3EN7A 2EXEA 3DKFA 4HYUA 2PMLX 5H2UA 3U4UA 3BYSA 4GT5A 5ETCA 3FZRA 4IC8A 2R0UA 5DEWA 3DTCA 4ENXA 5K0XA 4O7ZA 4X6QC 3D7TB 4IAFA 2PZ5A 5HVJA 3DQXA 3R8MA 4ANBA 1H00A 3BLAA 3A99A 4YJRA 4MNFA 3K5VA 3WF8A 4C7TA 3COKA 2C5XA 4BCMA 3LFQA 1FQ1B 2YWPA 4IADA 3IGGA 4AT3A 4GG5A 4WIHA 3F66A 3AC5A 3CD8A 4EZ3A 2XM9A 2HCKA 3HV6A 3ROCA 4TYHB 5ETIA 2XNEA 4PMPA 4FZ7A 4N4SA 4RIWB 3TNQB 3M2WA 4XEYA 4ERKA 3RBWA 4E4LA 3V5QA 3O17A 3TTIA 4X7QA 4J1RA 5CU4A 4CKIA 4O6LA 3NZ0A 5DN3A 4X6RA 4CRSA 2QO2A 2ITOA 2C5VA 1L3RE 5HBHA 3DOGA 1AD5A 5AUTA 5L8JA 1UV5A 3FY0A 4IJPA 5ICPA 3L1SA 2Y4IC 3DFCB 4F9YA 2PVMA 2XEYA 4I5CA 1OPLA 1XR1A 4HVIA 3QRIA 4I41A 3QKLA 4WO5A 4YR8A 3PVGA 3UNZA 1W98A 3D7TA 4FSZA 3P7BA 4IMYA 4W9XA 3PIZA 1OIYA 2XH5A 2E2BA 3FAAA 2VO7A 4FX3A 4GKHA 5BNJA 2GHLA 3VN9A 2H34A 2GNLA 5A4LA 5FQDC 3P79A 4CQEA 2CN5A 1Z5MA 2QOKA 2XKFA 4DFXE 4Y95A 4LV7A 1V0BA 2FSTX 4HOKA 3OCSA 3MPTA 1BI8A 3QA8A 5JZJA 4AA4A 4DH5A 3B8QA 4YZDA 4RG0A 3FXZA 4CGAA 3E88A 5LVPA 1IEPA 2V5QA 3NW5A 5E90A 4A9RA 5BMMA 1GZKA 3QTIA 2F49A 4H39A 1TQPA 5F1ZA 4R5YA 2CN8A 2J4ZA 3BGPA 2ITNA 3GU6A 4R7BA 1G8JA 1REJA 5IA2A 5HVYA 3LCSA 1U59A 4WBOA 4LGGA 1PXJA 2VO6A 2JC6A 3QXOA 2X4ZA 2XKEA 4K2RA 4RLLA 5EYDA 4C4FA 4FT5A 4UYAA 1ND4A 4CTBA 2C6TA 1PYEA 4EOMA 3GC0A 3TNIA 4KA3A 4E1ZA 4APCA 2QKWB 4FV3A 5CY3A 4YTHA 3WE8A 4OR5A 5HD4A 1XHAA 4BIEA 4O4FA 2YACA 3EQIA 3JY9A 5CSXA 4KIKB 4B8MA 1YWNA 4C4JA 4CLJA 3E92A 3G5DA 4IM3A 4HCTA 2Y0AA 3DDQA 5GINE 4MD9E 1V0OA 1M7NA 1OL5A 5CEIA 5KKRB 3A60A 2OKRA 3QYZA 3C1XA 3DDPA 4BTJA 2VTAA 4R78A 2IPXA 1PXIA 4AZFA 2V62A 2VAGA 1J7LA 4KSQA 3CXWA 4FEUA 3RINA 2PK9A 1OVEA 2CMWA 2GCDA 4XV3A 5HNIX 4II5A 4EK3A 3DAKA 1H27A 4NK9A 5J95A 3BL9A 1AQ1A 2PY3A 3VS3A 4TYIA 5KE0A 4NM5A 2WKMA 3L8PA 3SXFA 1W82A 3HECA 4IX5A 1PKDA 3DLSA 3QUPA 4BCPA 1CKJA 3AT4A 1YXVA 4QP4A 4F6UA 4I6BA 4AP7A 3VUIA 3IK3A 4EL9A 1Y57A 1YHVA 2HYYA 4JDKA 3TCPA 5IU2A 1VLRA 3E7VA 3C0GA 4L44A 4N6YA 4QOXA 3QD0A 4PDOA 3FQEA 4V05A 5F94A 3G51A 4JXFA 5G1XA 3PY0A 5TR6A 3OCTA 3IW7A 4AZSA 4KKHA 5DNRA 3ZONA 4IWDA 3ET7A 3ZSIA 2YABA 4BDKA 3CGFA 4X0MA 3UVRA 2DYLA 4NT4A 5HE1A 5DR2A 3NS9A 4GSBA 4MHAA 4BCQA 3LZBA 3MVLA 5HCZA 2HXLA 2ITUA 4Y72A 4EHGA 2PMOX 3TUCA 3ML1A 3UQGA 2PE1A 5LXMA 2PUIA 3I7BA 4CCUA 2PTKA 4KD1A 3RM7A 3UJGA 4EYMA 4LOQA 1NVSA 1VEBA 2NRYA 3EFWA 4RIXA 4E4XA 4MD7E 2HZNA 4OAVB 3FDNA 3AGMA 4WRSA 2EWAA 2HZ4A 2VWIA 2CCIA 3QCXA 3ZO2A 4M0YA 4R3RA 3ZDUA 1ZZLA 4GUEA 5AUYA 4AZWA 5HTBA 5E8VA 1H01A 3DJ6A 2VN9A 4NU1A 3V6SA 2QG7A 2JITA 2H8HA 3F2NA 4I0TA 4NW5A 3CQUA 3E93A 3FSFA 2XK3A 3D0EA 3QC9A 1PXPA 3CLYA 1Q3WA 2W96B 4OBOA 3CE3A 4OTQA 5CSWA 5FEDA 3PPZA 5HOAA 3DQWA 4ERWA 4ZY4A 3UO5A 2YIQA 4FV2A 2RFNA 4YTIA 1YDRE 5AR7A 3QGWA 4CFUA 4A06A 5IH4A 4JRVA 1OI9A 4XRLA 3UOHA 4ZSAA 5JFXA 2OH0E 2GDOA 3OWLA 5AR2A 4DEGA