3LFAA

Human p38 map kinase in complex with dasatinib
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
350
structure length
333
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Development of novel thiazole-urea compounds which stabalize the inactive conformation of p38 alpha
rcsb
source organism Homo sapiens
total genus 107
structure length 333
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lfaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lfaA01
3OWJA 3FV8A 4KBKA 4C37A 2R3GA 3AT2A 2JD5A 3CIKA 4OAVB 4AAAA 4GYIA 3Q32A 1UU9A 2B55A 3NUXA 5FQDC 3WZJA 3CP9A 3NUUA 1YXTA 3F5PA 5EDPA 1A06A 2YAAA 3CC6A 3HV7A 4X6RA 5F20A 4KS7A 1H0WA 2E9OA 2QHNA 3PWYA 4FYOA 2FYSA 5AUYA 1UNGA 4MF0A 3FYKX 3PZEA 4Y5QA 2VTAA 3S00A 3AC2A 5EOLA 3CY2A 5AP2A 1E9HA 4J98A 5BYLA 5EH0A 2AC5A 2I1MA 3A99A 2OXXA 3CJFA 4HVDA 4H05A 3HNGA 1APME 4JRNA 3FLSA 2A2AA 4HNIA 4BDFA 5DOSA 3V8TA 4LGDA 5K0XA 3DQWA 4CFFA 3HV5A 3BLQA 4QYGA 3BEAA 1ZRZA 4LGGA 4AZTA 2R3NA 3GU7A 2IZSA 5LMBA 1IAHA 3A7FA 4I5HA 2F7EE 5DNRA 4IVBA 1MUOA 4APPA 3QAME 4YMJA 4AA0A 4GH2A 4FOBA 5J5SA 4FKLA 4HGTA 4LMNA 3GEQA 4NW5A 4MCVA 1PXMA 3MV5A 3H9RA 3SRVB 1JAMA 5DGZA 5CALA 3L8SA 1H24A 2OH0E 3NSZA 1REJA 3QTWA 4OBOA 5IH6A 4CG9A 2QOHA 4IAAA 4ENXA 3N4VA 2PE2A 1PW2A 1STCE 3SXSA 2YIQA 3VS5A 5ITAA 1UKIA 1GJOA 4PDYA 2C5NA 2WEIA 4QTAA 4A9YA 3EYGA 3IPHA 4KIKB 1Z9XA 2R7IA 4YO4A 5CYIA 3ERKA 1L3RE 3DDQA 4WD5A 2RKUA 3R8LA 4EOQA 2Y4IB 3NX8A 4D9UA 1OL2A 4DAWA 2ITNA 1GIHA 2FSLX 2QO7A 3QCYA 4EONA 2PHKA 3RHKA 1IA8A 3ZBFA 3EN6A 1WBVA 3PLAE 4FL2A 3LIJA 1JQHA 2R64A 3ORMA 4X7QA 5JN2A 2XKFA 2YCQA 5JFXA 2UUEA 2VO7A 4RA5A 3UP2A 4D55A 3KXZA 3UP7A 1K3AA 5L2QA 3HKOA 3UZRA 4Y83A 1H28A 4EH4A 3CQEA 4BI1A 1YI6A 4PMSA 2YM7A 3COHA 4CQGA 2QLUA 3L8VA 1O6LA 3QTXA 4IC8A 3WF8A 5L2SA 1M2QA 4YTIA 2VWIA 3FKLA 3FE3A 3KRWA 3AGLA 4MBJA 3Q9ZA 5AM6A 3UNJA 3DTWA 2OKRA 4DC2A 4F0GA 2VV9A 3VS6A 3WF5A 5IQAA 4QMVA 4BYJA 5CXZA 1OGUA 2SRCA 3H30A 2PUNA 4ZOGA 3E7OA 5IMXA 4FT7A 4FICA 4O7ZA 2BDFA 3V04A 4QMWA 3PJ1A 3QFVA 4D4YA 1QL6A 2JDSA 4JQEA 2UZBA 2ZYBA 1BL7A 2YIWA 3TJDA 3GXLA 3QA0A 4ZSEA 1BMKA 2C68A 5CLPA 3UZPA 1J91A 3SHEA 4S2ZA 5FP6A 5LVPA 3ULIA 3O50A 5IQBA 2A4LA 5KMJA 3ZO2A 5K0KA 1V0BA 3EQFA 4QTBA 5D7AA 2BMCA 5HD4A 3R04A 4BGGA 3Q5IA 1GZKA 4CFUA 1OIUA 4C2VA 4CKRA 2CLQA 3OT3A 4XG2A 4FT5A 4IZYA 5HU3A 4B7TA 2A19B 3F66A 4QPSA 2UW3A 2WTKB 5AX3A 1NY3A 4DLJA 2WGJA 3E87A 4U7ZA 5CEKA 3LMHA 4NUSA 1Y8YA 5JH6A 2GHGA 1JKKA 4WUAA 4YURA 3PRIA 3EQCA 2GS7A 4IVDA 2GNJA 2XA4A 4UXLA 5AP5A 1KE7A 3FBVA 1OIQA 4XV2A 3AMYA 4L44A 4AWIA 3ZUUA 4EI4A 4EOKA 3TV4A 5AMNA 5C26A 3MPAA 3Q04A 4EJ7A 4FIEA 4YSJA 3TM0A 4DGOA 2JDVA 3IO7A 3PE2A 3UG1A 2R3OA 4G3EA 3IONA 3C4ZA 2HXQA 3BHUA 3TEIA 3C9WA 2XNBA 1OMWA 4W8EA 4BRXA 3OBGA 4FTAA 3NCGA 4ACCA 2EVAA 2WKMA 4YZDA 4IVAA 3SW4A 3TACA 5AP4A 2VO0A 4QP7A 1YXSA 4FNYA 4OTQA 5A6OA 5CU0A 5M44A 4O7TA 5ETFA 1P4FA 3NYNA 4XV3A 3NYVA 3C7QA 5HTBA 3QUEA 5I9VA 3EN4A 4YJNA 2YABA 3F3ZA 3ZC6A 3FI2A 1ZXEA 3G90X 5JZJA 3VVHA 2VNWA 1M7QA 4MKCA 2DWBA 3QRUA 2VTSA 3V5JA 3EOCA 4CFVA 4F9BA 5CY3A 4IW0A 5HD7A 4GKIA 5H8GA 3CD8A 3LFAA 2C6DA 4ZLZA 3W1FA 4MXYA 3ZLSA 5CEQA 2WTCA 4MNEA 3R7YA 2YLFA 1Y6BA 5HI2A 5IA0A 3I0OA 4ZIMA 4NM3A 2VGPA 3EIDA 5DN3A 3RNYA 4O83A 1H1WA 2H6DA 4IC7A 2ZV8A 5AR2A 2Z02A 4D1SA 2W1CA 5GZ8A 3GOPA 3TUBA 3ANQA 3GU6A 4FKIA 4MHAA 4BBEA 3PXFA 2QKWB 4E26A 4EK6A 2EXCX 4TY1A 3QWJA 3D9VA 4AZVA 4EYJA 2JBOA 3A7IA 3MN3A 3EQRA 3R73A 4JBQA 5DEWA 4AT5A 3FMJA 2ZB1A 5EHOA 2V55A 4RWIA 5J95A 3N51A 2WQOA 4JDIA 2JKQA 3F6XA 2XJ2A 4PMMA 4CRLA 4J8NA 4YJUA 5AAEA 1W8CA 3O96A 5KZIA 5L2TA 5JKGA 3FHIA 4TWNA 1BYGA 1W83A 4D9TA 3G0EA 4FTIA 3AC3A 5DH3A 3CY3A 4D5KA 1UU7A 2XNEA 3PWDA 3QKLA 2JLDA 5K3YA 3F2RA 4CTBA 3JR1A 4XNEA 3W2CA 2GMXA 2R3LA 4TN6A 5AUWA 2C6TA 4J1RA 3QQFA 4GG5A 4WNMA 1V1KA 1YOJA 2YERA 2YWPA 1UWHA 5KHXA 4RC3A 3OWKA 1VYWA 1LPUA 2YZAA 3BYUA 1JBPE 3DPKA 2R0UA 3DB6A 4IX4A 2UW5A 4PL3A 3NR9A 4AXAA 4L00A 5BUIA 3IW7A 5CANA 5EI6A 2C6OA 2O64A 5BMSA 1URWA 5FM3A 4EORA 2RF9A 3POOA 1TVOA 3MY5A 4TXCA 2J2IB 5JT2A 2BZHB 4FV7A 3SDJA 4I4FA 4HVIA 3KGAA 3EFKA 3R22A 2QOQA 3RVGA 4K11A 4KBCA 2ITXA 4LFIA 4E4XA 4YTCA 4ZS4A 2QCSA 3L9NA 4W8DA 3MJ1A 5J9ZA 3ZO3A 4KIQA 4N6YA 4ACHA 5HHWA 2VTIA 2EB2A 3I6WA 4E73A 4Y72A 4HGLA 2XM8A 4QMPA 2OWBA 5IU2A 5JFVA 2X2LA 5L8LA 1Q61A 2J4ZA 3CKXA 3FWQA 3OCGA 3E8EA 3AMAA 3HDMA 4ZSAA 4CFXA 4F9AA 2X2KA 3LHJA 5HORA 4RIWA 2ERZE 4IEBA 3FMHA 3QTIA 3LFCA 3LFNA 3N9XA 4I1ZA 4IM3A 4RX7A 4C3RA 3TKHA 2WTWA 4NTTA 5DR6A 1FOTA 5IH5A 4ZY6A 1W7HA 4A07A 5B2MA 4FSQA 1H25A 3V5PA 3R1YA 3HAVA 4XHKB 2CCIA 3FQHA 4EHVA 1PHKA 2H34A 2H8HA 4YLLA 2CKEA 2CCHA 5LOHA 4BKZA 4UMTA 4F1OA 4PDSA 4MBLA 3OY3A 4ANMA 3KF4A 4CZUA 5DR2A 3SD0A 3SOAA 2JKKA 4I21A 4BF2A 5A54A 3C4FA 3VBYA 4MXOA 5CS6A 1O9UA 5EI8A 3B8RA 3ORIA 4KUJA 2FSMX 3VNTA 4RJ4A 5IQGA 3IQ7A 4ZSLA 2V0DA 4BHNA 3PY3A 4FIFA 5HLPA 4FL3A 3ZM4A 4DEEA 2X7GA 2UZOA 3KRLA 4O27B 3UG2A 4QTDA 4AN2A 3VS3A 4ALWA 1PYXA 3MW1A 1O6KA 4QRCA 5DI1A 2WFYA 3MDYA 5JRQA 4ZSGA 3U87A 4KBAA 4UBAA 5I3OA 2ITTA 3ZRMA 1VZOA 3TZ9A 4EZ7A 5KMLA 3H3CA 3SG8A 4IADA 1MRYA 2W1EA 3UE4A 4ONAA 4AP7A 3UBDA 2QO2A 2PZPA 3P08A 3QQJA 5IISA 2CN8A 4AFEA 3UZTA 4O7VA 4ZXTA 3WOWA 3I81A 2F7ZE 4CMUA 1TQIA 3MTFA 4I4EA 4ACDA 1ZAOA 4PNKA 2FSTX 4GFOA 3VF9A 2Q0NA 4FSWA 2PZIA 4IZ7A 3VHKA 4PP9A 3HMNA 3T8OA 2XK9A 3ULZA 3LCKA 4XG4A 1MP8A 4EUUA 4ZLOA 3OVVA 2C0TA 4RFMA 4YP8A 1BL6A 1ZOGA 5DFPA 4EK5A 4F7NA 1YWNA 4RLLA 2PULA 1DI8A 4I23A 4RIOA 4BBMA 3OTUA 4H39A 3FUPA 3Q5ZA 3GCSA 4M97A 4R5SA 5AEPA 2AUHA 3PSCA 3UPZA 2PMIA 3D2KA 4GFMA 5GHVA 5CASA 4U43A 2CKOA 2QURA 2WMQA 3KKVA 4FEXA 3G9NA 5BVKA 3FL5A 4TYJA 3BYOA 3DAJA 1PMEA 4IXPA 2J0LA 5HTCA 2YM6A 4PL4A 3CCNA 2PVNA 3PG1A 3GC8A 4RG0A 5CX9A 4IB5A 4B0GA 3L9MA 2F4JA 3BPRA 2JAVA 4EH3A 4V04A 3NS9A 5J7HA 4QYYA 3Q53A 3R7VA 2X0GA 2C1BA 5ETIA 3R00A 1ZLTA 4RIXB 5LCKA 4QMXA 4DG0E 3V5LA 5JGBA 3COKA 3R0TA 4FSNA 5CU2A 3HYHA 3ITZA 2F57A 4X3JA 4AGWA 3ZOSA 4FK3A 1H1RA 3LMGA 2WEVA 3U54A 2P3GX 4II5A 5JFWA 2XEZA 4LRMA 3AGMA 4U6RA 2GHMA 4YJPA 5GJDA 3MGYA 2EWAA 4ZJIA 1MQ4A 3DLSA 2XZSA 4XOZA 3ZO1A 3EQHA 3FL4A 1Y8GA 2I0VA 4QMSA 3HRFA 3PIZA 3GCUA 3H0ZA 3U4UA 4AQCA 4CKJA 3OBJA 4XV9A 1H07A 5KUPA 4XCUA 4GKHA 3DJ6A 4L45A 3F3TA 3UO4A 4U42A 4L3JA 4NM0A 3SOCA 1DM2A 1BLXA 3ORXA 4OTRA 2OFVA 4AS0A 2GTMA 2YEXA 3RHXA 3WZUA 4JRVA 2F2UA 2IZRA 2WQBA 4BGQA 5DE2A 2Z60A 2OBJA 4M13A 2VTPA 2CHLA 2CJMA 2HY0A 4N0SA 4TNBA 3PP1A 1KE9A 1ZYJA 4OBQA 4EK3A 2ITWA 3FY0A 2ZDTA 3HMOA 4U41A 5AP1A 4D1ZA 1JSUA 3IW5A 5AIKA 5IUHA 2WIHA 2I6LA 3DLZA 3EKNA 3QD3A 3SW7A 2ZB0A 4DCAA 3LPBA 5HG9A 3TKUA 4FSUA 3ZUVA 3TUDA 3SC1A 4CD0A 2OGVA 3CD3A 4CZTA 3VS1A 4JLCA 4ITJA 5FWKK 4DH1A 5M07A 4R77A 4IWPA 3PY1A 4E1ZA 4DT8A 4YLKA 1YQJA 2VRXA 4U80A 1H27A 3GP0A 4KD1A 3I79A 3GC7A 4RJ6A 3GGFA 1JOWB 3LZBA 2C5OA 4KAOA 3MVMA 3NZ0A 3U55A 5DT4A 2BUJA 2VAGA 3ID6C 2YJRA 2YM3A 4IFGA 4QMTA 4BDKA 1Q3WA 4O0SA 2OJFE 3ZRKA 1NT2A 2GU8A 3KL8A 4DTBA 3P86A 4D28A 2J90A 2WELA 2BRNA 3TV6A 3VUDA 4BCJA 3LFBA 1ERKA 1GZ8A 3GC9A 4B8LA 3QALE 4EH7A 4C61A 5EW9A 2VWUA 5A3XA 4EBWA 4D2VA 2BZJA 2VTMA 4AGDA 2C0OA 2X8EA 4RC2A 4XG7A 3HV6A 3R8MA 2VUWA 2VN9A 4PV0A 1TKIA 3KRXA 4FKQA 4UALA 4XYFA 3PJCA 3DQXA 4F09A 1I09A 4EOJA 4TYEA 3RAHA 3PSBA 5ANIA 3OD6X 3WIKA 3UQFA 1UVRA 1WBSA 2WMXA 1XH9A 3CXWA 4ZMFA 3KCFA 2IWIA 3SRVA 4K33A 3UNKA 4OTGA 3EL7A 4H1JA 2WQNA 4OGRA 2BPMA 5HX8A 4WSQA 5HICA 2OXDA 2CGWA 3ZFXA 4XP3A 3IECA 4OT6A 1CSNA 3QF9A 4GU9A 1IA9A 3HV4A 4KKHA 5LQFA 4MYGA 3W2RA 4KIKA 3UDBA 2QNJA 2ITVA 5HVKA 4U79A 2QOIA 2C30A 4FOCA 3C5IA 3NYXA 5CU4A 3QD0A 4RVMA 3WF9A 3RK7A 1PXNA 4Q5HA 2YAKA 4DG3E 4ASDA 4D0WA 2QOKA 2W1DA 3Q52A 3QUDA 1OZ1A 1ZMUA 5CVHA 1PXIA 1ZWSA 3R8PA 3RPSA 1XH4A 1AQ1A 2OZAB 3LFEA 4FT3A 3TNQB 4CFNA 5JSMA 1PKDA 3L8PA 1KE8A 4TWCA 3BGPA 3LCDA 5E8ZA 4D2WA 4EJNA 3DK7A 3EN9A 2OSCA 4I94A 1NVQA 1UU8A 1O6YA 1WVXA 2XRWA 4K2RA 4ZLYA 3PXRA 2QD9A 2XRUA 4PDOA 1JPAA 4FV0A 5BVWA 3TDWA 3SXFA 4QP3A 3A7JA 3OROA 3MFTA 5BNJA 4A4OA 3JVRA 1J1CA 3NUNA 4O1PA 5J1VA 1OL1A 4M0ZA 4EYMA 2B4SB 3LM0A 4G31A 4I93A 3ZO4A 5HZNA 3QCSA 3DCVA 3N4TA 1H0VA 2UZDA 3UNZA 2XKEA 2B54A 5AR8A 4OLIA 1UNLA 3QC4A 3TT0A 3DZQA 4IBMA 4MD7E 4AU8A 4BI2A 4IMYA 4F7LA 5ETCA 1PXLA 4C62A 1Q3DA 2Y8OA 4X21A 4B4LA 3MIAA 3AD6A 5ANKA 2G2FA 1XHAA 3D7TB 3CPBA 3R7GA 3OFMA 4I22A 2GHLA 4O7NA 1J3HA 2JITA 4A9UA 1WBPA 3L9PA 3P7BA 5J1WA 3KFAA 4LRKA 2BCJA 3G6GA 4PY1A 4QP2A 3DKFA 5HG8A 4CMTA 1B6CB 2RIOA 2OF2A 5I0BA 5CXHA 2BTRA 3HMIA 3MY0A 3VIDA 1YOMA 5EHYA 2UZWE 2GQRA 4DBNA 4DEIA 3BE9A 1G5SA 3LW0A 5HCYA 5B2KA 2VWZA 2W7XA 4ZTMA 2QONA 2C0IA 3O7LD 5CSWA 5F94A 4C4EA 4G9CA 4PTCA 4Q5EA 4C02A 2XUUA 1FVVA 3LQ8A 2BAQA 3MSSA 3UVRA 2JKMA 5C27A 2QOFA 3F61A 3ZTXA 3OG7A 4RWJA 3QQHA 4BB4A 1U4DA 4BR3A 4FIGA 3ZFMA 3MYGA 4P2KA 3QBNA 4JDJA 2UW4A 5ANJA 5IEYA 2C69A 2Z7QA 5DWRA 4QYHA 1H1PA 2QOBA 5E1EA 5BYYA 3C4EA 4FT0A 2HZIA 4WRGA 3QTZA 3I1AA 4HPTE 5JQ5A 1WVYA 4X0MA 4YJQA 3VUMA 2R3RA 1ZYSA 3KU2A 2W1IA 2PTKA 4YZBA 5AADA 4E20A 4BDHA 1Q8YA 4GJ3A 3OT8A 1QPDA 5L2WA 2PUUA 4XBRA 2UVYA 4ZS0A 3QLFA 4HPUE 4YNEA 2JIIA 2OJIA 2X6EA 4JT3A 4CV9A 4ZTHA 2QC6A 3CGOA 2RSVA 4MXZA 3NEWA 1P2AA 4Z7GA 3H9OA 4LOOA 5IEXA 4RWKA 1P4OA 4IHPA 2WPAA 4JVGA 1OKVA 3F88A 4QTEA 3LKMA 3F5XA 2BHHA 3PVGA 3JVSA 4FZFB 4L3LA 1Q8UA 5CENA 3DJ5A 3RINA 2J6MA 4S31A 4LUEA 4GT5A 2RG5A 5EOBA 4G16A 4A06A 3ORNA 4K8AA 5E1SA 4C34A 4EZ3A 4JBOA 4N70A 4NSTA 2DUVA 5IG1A 4CSVA 2HCKA 1NVRA 3ZSHA 4AOTA 2BVAA 4M67A 1OUYA 3UIBA 4BWPA 4IB0A 5EKNA 3FXZA 2O2UA 2IVVA 2PMNX 3ALOA 1UU3A 2W06A 2RGPA 5EM5A 1IG1A 3GC0A 4J7BA 3EL8A 3ZFYA 3DKCA 3LFSA 2X1NA 5EYKA 4ANNA 4HCUA 1ZYCA 3HUCA 4LOQA 2WQEA 4U45A 2YWVA 4M0YA 3D5WA 3SG9A 3PA3A 1QPCA 1GOLA 5CNNA 4ZZOA 4GG7A 2NRYA 1M52A 3EKKA 3JY9A 4GYGA 3UO6A 3RP9A 5CF6A 4KS8A 3JXWA 4M66A 5LWNA 4DH8A 4A4XA 4LYNA 5CU3A 3TIZA 5DMZA 1KV2A 2HW7A 4WG4A 5JK3A 3OS3A 4O21A 3AD5A 2DYLA 3CS9A 3BHYA 4WBBB 4M84A 1IRKA 4WSYA 4Y73A 2R3FA 3RALA 4ZY4A 5BUEA 5IF1A 4HCVA 5LVMA 1KUTA 3MH0A 5KNJA 2A27A 1B39A 2ETKA 4S34A 4EEVA 2FUMA 2PVHA 2BILB 4JDKA 4IIRA 5IQDA 1FGIA 3PY0A 2ZV2A 2G01A 3QXOA 5M4CA 1NXKA 5HEZA 3L8XA 3VUKA 2BDWA 3ZZEA 1VYZA 1OPLA 5ICPA 2IG7A 3R9RA 4FZ7A 2I40A 2ZOQA 3VBQA 2OXYA 4L7FA 5AUXA 4ASEA 3LM5A 3VUHA 5CAVA 3F3VA 5HBHA 3ZEWA 3KK9A 4AZFA 5M4UA 4KRDA 4U0IA 4X2KA 3OP5A 3DK3A 2PVMA 4O7SA 2IZTA 1PRYA 3TTJA 5KZ0A 4AA5A 5BUJA 2QOLA 1TQMA 3I7CA 2NP8A 3RCDA 3LFDA 4FGBA 4TZRA 2VTJA 3QZIA 4UWCA 3UIUA 4CXAA 3U6IA 1VR2A 2UZUE 5CWZA 4PPAA 3HUBA 1B38A 3KC3A 5D7VA 5FD2A 1YXVA 3TDVA 2GTNA 3M42A 4DTKA 5A46A 2YCSA 4KA3A 2ONLA 3CLYA 3FLYA 3ATSA 3FMDA 5CEOA 4E5AX 2EU9A 4JX7A 5TOZA 2F2CB 3VJNA 2VZ6A 4BZOA 1H4LA 3P4KA 4ZY5A 2C47A 5HG7A 2WMUA 1NVSA 5T3QA 4PTEA 3VW8A 5A6NA 3JUHA 1Q99A 1RQQA 5KHWA 2C5YA 5LWMA 1YWRA 1BUHA 3KMWA 2R3HA 5FDPA 3BEGA 5HLWA 4IAYA 4IZ5A 3HZTA 5CZIA 1P5EA 4BKYA 4IWQA 2WB8A 1PMNA 2I0YA 5BVEA 2CDZA 5ACKA 2OJJA 4ASZA 4EQMA 5CEPA 4CGAA 5J9YA 4I0TA 4DBXA 3BI6A 4OTFA 1VEBA 5IMEA 4I5CA 4O1OA 4X3FB 2Q0BA 3LMIA 3FLQA 2VO3A 4G6LA 4RRVA 2P0CA 2R4BA 3V8SA 4QMOA 2PPQA 4RC4A 4FTKA 3QTUA 4O0TA 1CKPA 1K2PA 4FSYA 2Z8CA 4W4YA 4F0IA 3GUBA 4FIJA 2F7XE 4FYNA 2UZVA 3BU5A 4DFXE 5GJFA 2G2HA 3R9HA 3TKIA 3P79A 4XS2A 5CT0A 4GU6A 4A4LA 3AC1A 4YNOA 4FIHA 2BIYA 5BMMA 4JG7A 2JFMA 1CDKA 3M2WA 4JNWA 5EI2A 4DFUA 2IO6A 1YRPA 4FF8A 3MPMA 3LAUA 2VU3A 5FUTA 2G15A 3QXPA 2LAVA 4CTCA 4QQJA 4EK8A 1H01A 3FSFA 5I4NA 3E62A 4ORKA 2B0QA 1XH8A 1WAKA 5IA1A 1X8BA 5FEQA 4ALUA 3NCZA 4JQ8A 4F70A 3QZFA 4QQ5A 2F9GA 3BGZA 1FVTA 3BU6A 3VBWA 5HNGA 2W1FA 3PG3A 2W4OA 2E9UA 2QLQA 2Y7JA 5D41A 1G3NA 4FV8A 3UVPA 1Q8WA 5FXRA 5KMKA 3CSVA 1JSTA 1CMKE 5TT7A 3E3BX 5I9YA 5LMKC 4FEVA 5ANEA 4L42A 4L8MA 3CQWA 5FG8A 3ZLYA 4KNBA 3AD4A 4GL9A 3UOLA 4PPBA 3UGCA 1RE8A 4UZHA 2HK5A 4KRCA 3ROCA 4ITHA 2XJ0A 3ZONA 4ALVA 3PJ3A 3TTIA 3GI3A 5CAPA 1E1VA 2ZV7A 3PZHA 4FKPA 1R0EA 3FC1X 3DBDA 3WYXA 5EYMA 4O0WA 4I92A 2QI8A 2WTKC 2VX3A 1R39A 3EQIA 4XRJA 2HWPA 4EZ5A 4MF1A 3VHEA 2R3KA 3H0YA 4C4FA 3FAAA 2IJMA 3MWUA 1YDRE 2BAJA 3VC4A 4DGMA 2OU7A 4FTQA 3QCXA 3Q3BA 4OTHA 4FTRA 2CSNA 5KKRB 5I9UA 3VRZA 4D1XA 4PNIA 5AM7A 3GU5A 5GIPE 2C1AA 2WU7A 4Q9SA 4BDJA 2VTHA 3ZDIA 3A62A 4WBOA 4F6SA 3HMPA 4E5BA 5TR6A 2XYUA 5CVFA 3F3UA 1KE5A 5CSPA 2IW6A 2B9IA 2HENA 5EM7A 2VTNA 3VS4A 4Y46A 2WMWA 1SVGA 4L9IA 5HGIA 4BI0A 5AV4A 1SNXA 3K3JA 3NW7A 2XNNA 2XK6A 2XIXA 2X81A 1WFCA 2R3IA 3W10A 3BHTA 2QQ7A 4FV2A 2C3LA 4QMUA 5CSXA 3TNIA 2PL0A 3KXHA 4GRBA 3FPMA 3VBVA 4B6LA 4E4LA 2LGCA 3JYAA 1FQ1B 2C3IB 2VTRA 4BL1A 3W8LA 3GCVA 2WMAA 3RZBA 3FZRA 2GQGA 1U59A 4Y5HA 5CI7A 2B9HA 3FZPA 3PTGA 2YM5A 5EM8A 1LUFA 5KBQA 3GFWA 4R3PA 3RTPA 3FDNA 2HWOA 3SLSA 3R1SA 5TF9A 3V5TA 5EQPA 5IQHA 2XF0A 5E8YA 4F7JA 3FZ1A 3G5DA 3G9LX 3W32A 4GK2A 3WZEA 4F9WA 3R8VA 5IA2A 3P9JA 4C57A 4TNDA 1IEPA 4WNKA 2PMLX 5KMOA 4YPDA 5AX9A 1XBCA 4R7BA 1RJBA 3QLGA 1YVJA 3OOMA 4ZZNA 4FGRA 1XBAA 3QCQA 4CQEA 4HZRA 3C51A 4FL1A 3NDMA 4JIKA 3RWPA 4A9TA 4FA2A 4LQMA 1QCFA 2E2BA 2Z7LA 3LQ3A 2UZTA 5J79A 5HO6A 4E6CA 2PYWA 5HIDA 3W55A 5KMNA 2G9XA 4TTHB 5K4JA 3OCSA 4FV4A 4CCBA 3IW8A 4ACMA 2GPHA 3BBTB 4YHFA 4D4VA 3E88A 2CGVA 4J97A 4XV1A 2V7AA 4NM5A 4RX9A 3K2LA 4P5QA 1GIIA 2XB7A 3R1NA 4ERWA 2QKRA 3I6UA 4KKGA 4ACGA 3GB2A 4F63A 4L53A 3HA8A 5FTOA 1WBNA 2G1TA 4GCJA 3DK6A 4EH8A 2IW8A 3SGCA 2YN8A 4FI1A 2YFXA 3PDTA 3I5NA 3FMNA 1M17A 3DFAA 3Q4UA 3UOHA 5IUGA 1DS5A 2WU6A 3PFQA 4JG8A 2GNIA 3FPQA 3U9CA 4WKQA 5EYCA 3COIA 3NNVA 4D2RA 4IE9A 2J5FA 1LEWA 4IDVA 2PVFA 2XP2A 4FZAB 5T6KA 5L3AA 3OZ6A 2ITQA 1YI3A 3UPXA 5FBNC 1P14A 2ZVAA 5FDXA 3ZM9A 4DFLA 2NO3A 5LARA 2P2HA 4TT7A 4AG8A 2R9SA 3PUPA 3WZKA 4LI5A 1PMUA 3NRMA 3ZDUA 3EFWA 2WTJA 4G3DA 3A7HA 4RQKA 4EOOA 4LUDA 4BCNA 2YJSA 4WRSA 4BGHA 2QR8A 1FINA 4RZWA 3T9IA 1FBNA 2VX0A 3OXIA 4TYHB 3UMWA 3MJ2A 4R6VA 2GDOA 3JPVA 2V7OA 2C3KA 3ORKA 2BDJA 4U97A 4HYSA 2ITYA 4FTMA 3RGFA 3F82A 5KE0A 2W9FB 4G6OA 5H8EA 4IM2A 5IA5A 4RFYA 2OZAA 3RMFA 5H3QA 3KEXA 4L68A 4ZTLA 3F5UA 4FTCA 4KKEA 1CKJA 3G51A 4OTWA 4NKAA 4D4RA 3KXMA 2ONLC 4DE4A 4YJSA 1ZY4A 2C6LA 3ETAA 3BU3A 2CNQA 1ZOHA 4FV9A 2P33A 5ANGA 3FZSA 3F5GA 1LEZA 4I24A 2G2IA 4MXAA 4QNYA 4GUEA 3R71A 3W8QA 1YXUA 4ZTNA 5DYJA 3QA8A 3QUPA 4CKIA 3Q6WA 4FBXA 4MD8E 4BDBA 5HNIX 3MH3A 4TWOA 4C3PA 1AD5A 5IKWA 1Q4LA 2R0IA 3D7ZA 1DAWA 2J51A 3CEKA 4LM5A 4H3BA 1R78A 2GS2A 1F5QA 3FLWA 5KBRA 4F6UA 3FI4A 3DAEA 4DG2E 2ITPA 3ZMMA 4L7SA 1H1QA 3CGFA 5M57A 3QZHA 3S1HA 3LFQA 1W82A 5IEVA 3PPZA 2CNUA 3OUKA 3FQSA 3RAKA 3R8ZA 4I5MA 4YZ9A 5A4QA 3DV3A 4U3YA 2QOCA 3RZFA 4HOKA 3VQUA 3ZC5A 2IVUA 2W4KA 4IACA 4XUFA 2JFLA 2O5KA 3SAYA 3BZ3A 3LLAA 3GVUA 2QU6A 5G6VA 4IAFA 4I20A 2J7TA 4B9DA 3PA5A 3GU4A 4FKSA 4NL0A 4S33A 2JKOA 2WMSA 2XMYA 4TRLA 4M68A 4WOVA 3WI6A 4EH5A 4R78A 4EWHA 1OL5A 2W9ZB 4QMMA 4E6AA 4HNFA 3C1XA 2FSOX 5FXSA 3BX5A 3OW3A 3A7GA 2X9FA 4X2NA 5E91A 3DNDA 4HVHA 4G5PA 5A4LA 4PX6A 5AWMA 3ORTA 2W1GA 4F1MA 1YI4A 3FMEA 4TWPA 1GZOA 3KMMA 3MH2A 1XH5A 3UQCA 3NIEA 4U8ZA 2JIUA 1M7NA 3CTQA 2BTSA 3KCKA 4QT1A 4BCHA 4CMOA 3ZEPA 3ZS5A 3UOJA 2A1AB 4C4GA 1R3CA 2WXVA 4PRJA 3R01A 4YBJA 1KOAA 3DB8A 4GJ2A 5CSVA 2PSQA 3OCBA 3GFEA 5J9LA 1ZMVA 4DT9A 4XH6A 3C0HA 3OY1A 2OLCA 4G9RA 3PVWA 4AA4A 2P55A 3TIYA 4O96A 1BI8A 4GUBA 4C35A 5E8TA 3VAPA 4L52A 4E6QA 5AR7A 4XOYA 3DA6A 5BVNA 1Q8TA 2DQ7X 4U5JA 3ATTA 4O0UA 1OIRA 2B1PA 3ZXZA 5HVYA 3ANRA 3DBFA 5HIEA 3FXWA 4AX8A 1HCLA 3LLTA 4PUZA 4RFZA 5AP0A 1MRUA 5HLNA 4GFGA 3E63A 1GZNA 4NT4A 4AN3A 3MI9A 3E8DA 3ZSIA 5K9IA 5KO1A 3WBLA 2F49A 3TZ7A 3E64A 4C8BA 2EXMA 2WHBA 1G8AA 4AFJA 2BHEA 4L6QA 4O7RA 2OH4A 2HXLA 4JJRA 5GZ9A 4AF3A 5AV2A 2BRGA 2E9NA 1QMZA 5J5TA 4GT3A 4FV1A 2OI4X 4L67A 1TQPA 4MWIA 3F7WA 4FKUA 3U8WA 2HELA 3UC4A 4JOAA 2OW3A 2RFNA 3V51A 5M56A 2I7QA 3M1SA 4H3PA 4F64A 5EQYA 2ZJWA 1H00A 1UWJA 2B9FA 4QPMA 1UKHA 4BDAA 4FTOA 3DFCB 2ITOA 4UWBA 5HCXA 3PVUA 3LXKA 1OECA 2UW6A 3D14A 4DEBA 3JY0A 3NAXA 4MVFA 4NCTA 1H26A 5HE0A 3D15A 4FV3A 4BDIA 4Q9ZA 1YDTE 3D83A 2VTLA 2UZEA 4I6FA 2ETMA 3KN6A 3DAKA 4IWOA 3Q9YA 2HZ4A 3VRYA 1H8FA 1YWVA 3U6JA 3U6HA 4BY9E 5FGKA 3C5UA 4BTKA 4EOIA 2IVTA 2V22A 3QRIA 4BFMA 3MB6A 3G6HA 4LL5A 1OL7A 1MRVA 2BFYA 3DKOA 2XM9A 1U5QA 4O0VA 4WHZA 5C4LA 5FP5A 3SX9A 4YJOA 1Q62A 4FEWA 1A48A 4M15A 3BYVA 2BRMA 4HJOA 5AV3A 4MXCA 1M2RA 2BAKA 2AC3A 2IZUA 3FLNC 3HRCA 5AAFA 3TI1A 2XH5A 3ACJA 4OUCA 5FM2A 4AZWA 4F9YA 1OB3A 4JI9A 4Z16A 4DGNA 2B53A 5IDNA 5ANDA 4HVGA 4UMUA 4TYGA 3ZUTA 3R7EA 2YM8A 3DGKA 2QODA 1T46A 2VWYA 4XLVA 2XNGA 3HMMA 5E8WA 5EDQA 4O84A 1SYKA 5LVOA 4OT5A 4L43A 3RI1A 2UW9A 2QVSE 4XEYA 3I5ZA 4IX5A 4ZSJA 4AZSA 1U5RA 3IW6A 4YC3A 3LJ2A 2HOGA 5CAQA 5L6PA 3P7AA 1JKTA 3KXGA 3PIXA 4DEHA 3ZZWA 3VW6A 3THBA 3NWWA 3KULB 5AUUA 4DA5A 3FKOA 1Q97A 4HGEA 1SNUA 2WMRA 4QMLA 5C4KA 4JR7A 1ZYLA 4QD6A 2C6MA 5IH4A 3QD4A 4V0GB 5ETAA 5I9WA 1BI7A 4JL9A 2VO6A 3O8PA 4FNXA 3WILA 4I5PA 5C1QB 5LMKA 4X6QC 1JVPP 2X4ZA 4DGLC 2WTVA 4LV5A 4WIHA 3DBCA 4BC6A 4JBVA 3NVKI 1IASA 4BCPA 5M08A 5EQEA 3ORPA 3PP0A 2XNPA 1OBGA 4YR8A 4DYMA 1W98A 1OPJA 4X3FA 1W0XC 5DR9A 5DT0A 4C4JA 4N57A 3BV3A 3QQKA 4PDPA 1YXXA 2C6IA 5HKMA 4UYNA 3QTSA 1PKGA 5IUIA 3FMKA 4D2PA 4BIDA 5E9EA 4PQNA 3IGGA 3QRKA 3K54A 4KABA 3A8XA 4FKGA 4JG6A 4P7EA 1XBBA 4BWXA 1FMKA 5EW3A 3CR0A 5HIBA 5AUZA 1S9IA 1URCA 4J71A 3QYWA 5HO7A 2C3JA 3HV3A 2JC6A 4FKOA 4Y95A 3BELA 4FUYA 4M8TA 4AW2A 4DN5A 4O38A 1DAYA 1J7LA 1XR1A 4MK0A 3FKNA 3OWPA 4QYEA 4R1YA 2Y6OA 1ZYDA 1BX6A 1KOBA 2KULA 2DS1A 3GNIB 4G17A 3DJ7A 2BKKA 1WZYA 3O8TA 3MB7A 3RK9A 2OIBA 3DT1A 4RJ7A 3TNPC 4DH3A 3IG7A 5HCZA 3BQRA 5B7VA 2WNTA 4GV1A 1UV5A 3ORZA 1XH6A 2R7BA 3BCEA 3R83A 4D2TA 4DHFA 2IPXA 3TZMA 2PZYA 2C6KA 4DFZE 4BIBA 2PZRA 1XWSA 3QKMA 1WBWA 4GIHA 5DHJA 1E1XA 4E93A 1W84A 2VNYA 1LP4A 3AC8A 3QRTA 2OZOA 1ZZLA 2WOTA 2PVLA 4NKSA 3Q60A 2B9JA 3Q96A 4GVJA 2PK9A 2BR1A 4R8QA 4UV0A 4X2JA 5CAUA 3DXQA 5I9XA 5F95A 3UIXA 4BCMA 5M4IA 2CPKE 2YZLA 2CGXA 3D5XA 3R7IA 2XYNA 4GIIA 5IPJA 4HVSA 3WYYA 3UODA 4NYEA 2XNOA 4DEGA 2ITZA 2JAMA 4DFYA 2FA2A 4C2WA 1ZOEA 4YUQA 5A4EA 2GCDA 5IZFA 5LCJA 3DZOA 4FKVA 3NVMB 3NPCA 4XG8A 1GAGA 3ZHPC 2PE1A 2BROA 3E92A 3FXXA 4C0TA 3U9NA 4EOLA 4QYFA 3AXWA 1YHVA 2OJGA 3FLZA 4KIOA 3H4JA 4YPSA 5HX6A 3FC2A 4O0YA 4OR5A 4JBPA 5D9HA 4CZYB 4M7IA 3COMA 1XO2B 1CKIA 2REIA 3KVXA 1I44A 3WF6A 3BV2A 2OJ9A 5BQ0A 4IM0A 3RKBA 3IKAA 4DH5A 4EHGA 3R63A 4FTJA 3T3VA 4O0XA 4CYIA 3WIGA 3I60A 4YHJA 3HVCA 4EQUA 1U54B 4HYHA 2WTIA 4I6HA 5EKOA 4DGGA 3R9NA 4GVAA 3JS2A 3UOKA 4X2FA 3IOKA 3NNXA 4YSMA 5HE2A 3IGOA 4JDHA 4P4CA 4AW1A 2OK1A 5K4IA 4S32A 3AC4A 4HCTA 4UMQA 5AR4A 4AUAA 3S3IA 3DU8A 3F2AA 3LXNA 4NIFB 4ZK5A 2XIYA 4IVCA 4BZNA 4R3RA 1L8TA 2V5QA 3OWLA 4NTSA 3DXPA 2UW7A 4RJ8A 4M14A 4EQCA 3BYSA 3UIMA 4XJ0A 3W2OA 1FVRA 4ANQA 3R28A 4C7TA 2GFCA 3FY2A 4LV8A 4BN1A 3PVBA 3IW4A 2BIKB 2HY81 3RAWA 5C8KA 5M4FA 4RIYB 2YCFA 4IAIA 3NGAA 1GIJA 1RW8A 5JZNA 4YJVA 3NYOA 1WBOA 4IWDA 5AUTA 3AOXA 4DLIA 3FJQE 4AT4A 4CCUA 3PXQA 3ENHA 4JAJA 4BDCA 5E4HA 1GNGA 4IJ9A 4JIAA 2VWBA 4IB1A 4G2FA 4FR4A 3T9TA 5CAOA 3FMMA 3D4QA 1PXKA 4M69B 3O23A 5CZHA 4IAKA 5J8IA 4WNPA 4LG4A 4RSSA 2OF4A 5C03A 5KMMA 4WG5A 5IA4A 3PRFA 4HYIA 3TXOA 3V8WA 3D0EA 2YIYA 2XK4A 5AIRA 4RVTA 3V3VA 4UY9A 3K5VA 4ZP5A 4C59A 5A4CA 3DNEA 2B52A 3QQLA 4NCTC 5D12A 5DT3A 4U81A 4QMYA 4UMPA 4W4WA 5AP6A 4DFBA 3BKBA 4BCKA 3AG9A 2UZNA 5IQCA 2R3PA 2C4GA 4ANBA 1KV1A 4R1VA 5E90A 1Q5KA 5DRDA 5B0XA 4CEGA 4AE9A 5HTIA 3HEGA 2WO6A 4NU1A 4EH2A 2JDOA 4AE6A 4B99A 3PE1A 3I4BA 4NEUA 5CT7A 4F99A 3D5VA 4W4XA 4USFA 3U51A 3CE3A 4ANLA 2XKDA 3NW5A 3VS7A 3E93A 5TE0A 3EMGA 3MIYA 5C9CA 4BBFA 3OW4A 4U9AA 4DINA 1ZARA 4R7HA 5BX0A 3VS2A 5CF8A 4BICA 2IVSA 2OIQA 3OTVA 2Y4IC 4EUTA 4KB8A 5CI6A 3TNWA 3GCPA 3QTQA 4FIIA 4YTFA 4WA9A 4C4HA 3HP2A 4EH9A 4CLIA 4QTCA 5AR5A 3G0FA 3OXZA 1YOLA 3EQDA 3LVPA 4YC8A 3MBLA 3SV0A 3SQQA 4FNZA 4TYHA 2ZMCA 5LXMA 5G1XA 3S2PA 3MFRA 2WOUA 1OI9A 5ACBC 4F6WA 3REPA 4CLJA 3VJOA 4XP0A 3VS0A 4IAZA 5ANOA 4NZWB 1XQZA 1YHSA 4X2GA 4BCQA 5AJQA 2X4FA 4EKLA 4PWNA 3B2WA 4MXXA 1Z57A 1WMKA 3PXKA 3MA6A 4MEDA 3TJCA 5D1JA 5HESA 3BE2A 4O2PA 5HQ0A 1ND4A 4D2SA 2H9VA 3ZH8A 3B8QA 4D4SA 3V5WA 3SKCA 3KMUA 3Q9WA 3UJGA 2WMTA 4BZDA 4AW5A 3UO5A 2PUIA 3EZVA 5IQEA 2J0JA 5EG3A 2CKPA 2P4IA 2UVXA 3PPJA 3LQ5A 5CEMA 4Z3VA 3GENA 4MBIA 1IAJA 5L8KA 5FBOA 5AAGA 3I0QA 2R5TA 4BKJA 1YW2A 4IANA 4I0SA 1WBTA 3OF0A 5GJGA 5DLSA 2W96B 3GU8A 4E8AA 3AC5A 1NA7A 4X3FC 5M51A 3ODYX 4EHEA 3BLHA 3NAYA 1IR3A 2Y6MA 4J99A 4L46A 3R2YA 4P5ZA 5AP3A 3T3UA 4F0FA 4PMPA 4QMQA 4AW0A 1R0PA 3Q4TA 1JSVA 4QP8A 4QP4A 2WMBA 2XK7A 2QOOA 2VGOA 4K77A 2O63A 4LGHA 4XG9A 5I5ZA 3Q9XA 4IB3A 3F2NA 3G2FA 4NFNA 3MA3A 4RA4A 4RIXA 1ZZ2A 3BYMA 3UYSA 5JMSA 3EFJA 4F4PA 4K18A 3QRJA 2O65A 4JS8A 4USEA 4NM7A 4OAUC 3Q4CA 3OUNB 2RL5A 3DS6A 2ZM1A 4A7CA 3AQVA 3PSDA 3RCJA 3MVHA 3KXXA 5E8SA 4AGCA 4FSMA 4EOMA 3TN8A 3FYJX 4C33A 4FG7A 4JX3A 4E5WA 4DTAA 2ESMA 3IK3A 3P78A 4FVRA 5DG5A 4K6ZA 3GCQA 3BGQA 3EZRA 3ET7A 3IDBA 3N4UA 2YISA 2RFSA 3GOKA 2VTOA 5I3RA 3R7OA 3O8UA 4Z55A 3NUYA 1Q8ZA 5KMIA 2CKQA 4FTUA 3V01A 5JFSA 2YIRA 4ID7A 4JAIA 2YHVA 2HYYA 1CTPE 4FUXA 1JNKA 2J0KA 4AOJA 1V0PA 3Q4ZA 1JKSA 3OC1A 4IX3A 3Q2MA 3EJ1A 3F3WA 3BHHA 4HYUA 3EQGA 5CQWA 3RAIA 2OG8A 2JIVA 4GSBA 5GZAA 3PXZA 2PVKA 2EUFB 1S9JA 3BLRA 4RWLA 1VJYA 3R9DA 4FC0A 2PVRA 2XNMA 3FI3A 5JGAA 5FTGA 2QU5A 2GNFA 3BQCA 4MAOA 4FNWA 5EFQA 3D2IA 5LVNA 2YLEA 1KE6A 3ALNA 3A2CA 5HVJA 1V0OA 2J9MA 4M3QA 3EQPA 4R7IA 5CNOA 4YHTA 5KKRC 5HE1A 5IQFA 1ZY5A 3GBZA 2FVDA 3TG1A 3VUTA 5CU6A 5GNKA 5LVLA 2XIRA 1R1WA 4APCA 5B2LA 3F9NA 3P7CA 2ZM4A 4Y85A 2IN6A 4F1TA 2PWLA 3R21A 5F4NA 4YZCA 4EWQA 4QMNA 3GT8A 1LR4A 4AGUA 4EBVA 3QHRA 3FI8A 3RJCA 4FG8A 2W0JA 3B2TA 3C13A 3L9LA 4GS6A 3WZDA 5T68A 2GQSA 3NMUF 2VWVA 4EKKA 4QPAA 1M14A 2JDRA 4H36A 2A0CX 4YZNA 3RK5A 3W2SA 3OEFX 3C4WA 4FSTA 5EK7A 3O17A 4L01A 3ZYAA 1UNHA 4FSZA 3C0IA 5EYDA 4QOXA 4RX5A 2W05A 3KY2A 5A14A 2J0IA 4GMYA 4BDEA 2ZAZA 2XCKA 3DBQA 4BHZA 5K5NA 5LMAA 4E4MA 3DY7A 2O8YA 5A9UA 3R2BA 4O91A 3CQUA 3QL8A 3TNHA 4G34A 5L8JA 1NW1A 4PTGA 3MTLA 3ZBXA 3CTJA 4DCEA 2W5BA 2PE0A 4M12A 2ZM3A 5JGDA 4H58A 2QO9A 4ANOA 4AACA 3EWHA 4IQ6A 2XEYA 3V5QA 4TL0A 5BYZA 5C8MA 4IJPA 4EH6A 3SVVA 1SVHA 2W1HA 3FSKA 3MH1A 4MWHA 4O22A 1KSWA 4YC6A 3BWFA 4E7WA 4ENYA 2OIDA 3KRRA 4GT4A 3A4PA 4FODA 4PPCA 3HL7A 5AUVA 5AV1A 3QQGA 3QTRA 4FT9A 4JQ7A 4I6BA 3H9FA 3OOGA 4LL0A 1WVWA 2ACXA 1AGWA 2I0EA 2BRHA 4EC8A 1YKRA 3AT3A 3VUGA 3ZCLA 1T45A 4MX9A 4XG3A 2Q83A 4BDGA 3LCOA 1BKXA 4I41A 2X39A 3E3PA 3FEGA 4BIEA 1PXJA 5EHLA 1OPKA 2HAKA 4DH7A 3DXNA 3IS5A 5CQUA 4FKTA 3PYYA 4FEUA 1OKYA 4YTHA 3MVLA 4HZSA 5BVDA 4PL5A 1OVEA 2XVDA 5HBEA 3E8NA 1HCKA 2V62A 3HLLA 4NJ3A 5FEDA 3GQLA 4MH7A 5E92A 2CGUA 3QZGA 1OKZA 3EN7A 5FTQA 3QGYA 4FE2A 1Q24A 4NJDA 2YCRA 4QP6A 5M09A 1OUKA 4AN9A 2C5XA 3AMBA 3EB0A 3QQUA 4BCIA 5CSHA 3NUPA 4CYJA 3K3IA 2J5EA 3OMVA 4H1MA 3L1SA 3PXYA 4ZMEA 3A4OX 4N6ZA 5C01A 5CVGA 3VULA 4BWKA 2GNGA 4EOSA 3HECA 2QHMA 3TWJA 3V6SA 1FGKA 2KTYA 3A60A 3KULA 3LJ1A 3LXLA 3FMLA 3V6RA 4E4NA 3MFUA 2BRBA 4QNAA 2WD1A 2FGIA 2UV2A 2ITUA 4WG3A 3EHAA 1CM8A 4WUNA 2FB8A 4ZTRA 3KQ7A 4F7SA 4V0GA 3PIYA 2Y4PA 4FZDB 4Q2AA 2RFDA 2WMVA 3DBEA 3IOPA 4ERKA 5KX8A 4FKJA 5DPVA 3D7TA 3PJ2A 3VO3A 4O7LA 5BVOA 2JDTA 2XBAA 5HBJA 2O3PA 1J1BA 4FSRA 1U46A 4DEDA 4BTJA 4KSQA 4O86A 3P0MA 2PY3A 5GINE 2ZDUA 4YJTA 3HA6A 4BTFA 5DIAA 1SMHA 2YITA 2VX1A 3VWAA 3CJGA 2BZIB 1OM1A 3P23A 4XX9A 4BTMA 4C3FA 4UN0C 4FMQA 4G1WA 1QPJA 3ZLWA 2EXEA 2XS0A 5AP7A 4EHZA 1PYEA 3VN9A 2XIKA 2GSFA 4OBPA 3GQIA 3LJ0A 4O6LA 4WT6A 3ORLA 3E7VA 4K0YA 4LOPA 3ZU7A 2PVJA 3PA4A 2W5AA 4K9YA 4I0RA 4FTLA 2E9VA 4MNEB 2BZKB 1Z5MA 3WARA 4TW9A 2BKZA 2Z7SA 2CN5A 2JBPA 5M53A 5FXQA 4LMUA 4D0XA 3VQHA 3HP5A 1OITA 2NPQA 3UYTA 3KREA 3EH9A 1Y91A 3QGWA 5C8NA 5CEIA 5LJJA 3BBWA 1GY3A 4G3GA 3OEZA 2VTQA 4ITIA 3DOGA 2PU8A 3PLSA 1ZMWA 5AFVA 4MD9E 3SA0A 3QHWA 4QQTA 4UXQA 4PF4A 5L4QA 3BWJA 4O2ZA 5HG5A 4C58A 3QYZA 4ZAUA 2BFXA 2VWXA 4UYAA 4HW7A 3WE8A 2H96A 2P2IA 4W9WA 3HGKA 4RGJA 5H8BA 3KN5A 1ATPE 2YA9A 5CTPA 2PZ5A 4RPVA 5EM6A 3UMXA 2XCHA 4FKWA 3A8WA 3CBLA 3WE4A 2YIXA 1SZMA 4BDDA 4UMRA 3ZLXA 2VTTA 2YDKA 5DBXA 4BVUA 3RM6A 3EN5A 3R1QA 4S30A 4IFCA 5BPYA 1Y6AA 3EYHA 4FK6A 4MTAA 5L6WL 4RQVA 1REKA 5BVFA 2B7AA 4CG8A 2AYPA 3RM7A 1YDSE 5J7BA 4U40A 2X2MA 3ZRLA 4ZTSA 4RT7A 3E8CA 5H9BA 3TL8A 3W2PA 4CFWA 4U44A 3NNWA 1FPUA 4FVPA 4EC9A 3HX4A 1F0QA 4P90A 4RLKA 1F3MC 3A61A 3AT4A 4J96A 4IZAA 4FX3A 3NUSA 1DI9A 2YACA 2QR7A 4WNOA 4BCFA 3RPRA 4ZJJA 4KWPA 4MQ2A 4CT2A 1FMOE 4IH8A 5DRBA 3E5AA 1PMVA 3ELJA 3KVWA 4NWMA 3R6XA 4RJ3A 4O6EA 5IQIA 3QWKA 2XBJA 4FTNA 3QKKA 2CMWA 2W4JA 3EFLA 2ETRA 4PP7A 2JEDA 3C4XA 5GIOE 1A9UA 3R30A 2GFSA 2W1ZA 3UVQA 2OO8X 4DEAA 1J7UA 3KRJA 4F08A 2BALA 1U54A 4NFMA 5CF5A 2WZJA 2JGZA 5DVRA 2EB3A 3W18A 3P5KA 5F1ZA 1K9AA 2CLXA 3O2MA 3G15A 2W17A 1JLUE 3FHRA 3FZOA 3O51A 4AT3A 5JRSA 2YDJA 5F9EA 3QX4A 4YGAA 4RIWB 3RPOA 3O71A 3S0OA 5AR3A 4NIFA 3RNIA 2HIWA 4UWYA 4ANSA 4E6DA 3RPVA 3W33A 2FO0A 4NW6A 3HAMA 4EOPA 5K5XA 3QC9A 4FKRA 2RFEA 5AA9A 2HW6A 2X9EA 3PPKA 4UZDA 2WIPA 1SVEA 3D5UA 3R8UA 3F7ZA 5L6OA 3KA0A 4KIPA 4Z7HA 2NNWB 2R3MA 5A4TA 3MESA 5JQ8A 5E8UA 5TO8A 1PXPA 4W9XA 4MQ1A 3VUIA 4RIYA 4CNHA 3KK8A 3UC3A 3LXPA 3FQEA 4H3QA 5H2UA 3BIZA 4JXFA 3QD2B 3W2QA 3ZXTA 2O0UA 2UZLA 2W5HA 4FV6A 4USDA 4CV8A 1KWPA 2J0MB 3C0GA 3LOKA 3NNUA 5HU9A 5AV0A 5E8VA 4C38A 2Y9QA 3NLBA 2GNHA 3VBTA 3MY1A 5JEBA 5HE3A 1Q41A 4RBLA 2GS6A 4OW8A 3O7LB 1EH4A 4TKSA 4K1BA 4M69A 4RJ5A 5EDRA 4KSPA 5E8XA 4DITA 4YJRA 4FVQA 1JKLA 3H10A 2QG7A 3ACKA 3TUCA 3CPCA 3HDNA 3MFSA 4KINA 2XIZA 4QQCA 5M55A 3VF8A 2X6DA 4JR3A 4G6NA 3C50A 5KCVA 4D5HA 2WQMA 1RDQE 3M11A 4GK3A 5FLFA 3D94A 4WO5A 5I9ZA 3ENMA 3R02A 4IX6A 4J8MA 3OCTA 5DEYA 3RPYA 4Z9LA 4MNFA 4EK4A 4G5JA 4ZJVA 5CF4A 4UX9A 4DF3A 3OXTA 1PY5A 4FZ6A 4AOIA 4FTTA 4O0RA 1H1SA 4V05A 4ASXA 2PVYA 4F9CA 4I6QA 4FEQA 3QU0A 4ZZMA 3R9OA 4A9RA 2ZV9A 3KF7A 3RBWA 2FH9A 3G33A 3TZ8A 4O82A 2R2PA 4J53A 2XKCA 3U4WA 3W16A 1JWHA 4I3ZA 4YBKA 5IA3A 1OKWA 4QMZA 1OIYA 1XKKA 3II5A 3O0GA 3MVJA 2CNVA 3F69A 3OHTA 3BHVA 4XBUA 4OTDA 3DTCA 3S4QA 4EL9A 3NUAA 4HGSA 4U3ZA 2PMOX 2HZ0A 2UVZA 2W99B 3Q2JA 2IW9A 2R3QA 3TCPA 4YO6A 2WAJA 4RVLA 2J50A 3HRBA 4YZMA 3KB7A 4XRLA 4RMZA 4QP9A 4RX8A 2E9PA 3QX2A 4O81A 2ZMDA 2Z7RA 4AZEA 1MQBA 2VWWA 2Y0AA 5HOAA 2RG6A 1PXOA 2C6EA 3PJ8A 3CKWA 4NK9A 2ERKA 2OFUA 3LE6A 3UQGA 3EQBA 3UTOA 4C36A 5D11A 4QO9A 3POZA 5IDPA 4FG9A 5TKDA 1G8SA 4OTPA 1Y57A 5E7RA 3I7BA 4GW8A 2R3JA 4XLIA 3ROYA 4J95A 2I0HA 3ZSGA 4XG6A 4LRJA 4W4VA 1XJDA 4C4IA 4BCGA 4E3CA 2QG5A 4UEUA 5FEEA 4QP1A 4B8MA 3IDPA 2X7FA 1QPEA 3Q6UA 3MPTA 4L3PA 3S95A 4Y8DA 4R5YA 1H08A 5EW8A 4UB7A 4GEOA 1OL6A 4F65A 2VD5A 4YU2A 2X7OA 4XP2A 5HO8A 3RWQA 1M2PA 2WTDA 4G3CA 4CT1A 2UW8A 3P1AA 2UW0A 1WCCA 4O7WA 2Z2WA 3MS9A 3C4CA 3LCSA 4CRSA 1UA2A 2C5VA 2HZNA 4FV5A 4N4SA 4TYIA 1J7IA 3ODZX 4TPTA 3WF7A 2YM4A 4G3FA 4A9SA 4DFNA 2PUPA 4OTIA 3NW6A 3SXRA 2XK8A 4O7YA 4ZEGA 4RVKA 2YDIA 4YLJA 4D58A 5M06A 3R7UA 1PF8A 3DDPA 3VBXA 2OICA 3IDCA 5HNBA 1HOWA 5D10A 1PJKA 3NIZA 1XH7A 4CFMA 2NRUA 4ZTQA 2X8DA 4BYIA 5J87A 4ARKA 3LFFA 3DKGA 5DA3A 3KXNA 1SM2A 3BRBA 4GK4A 1YHWA 4R3CA 4RZVA 4XMOA 2XK3A 5FRIA 4BCOA 4J52A 4PMTA 4NH1A 4IDTA 2XJ1A 1OBDA 2X8IA 2GNLA 3LCTA 3TV7A 5AA8A 3FZTA 3CTHA 4CVAA 3K5UA 5L2IA 4V01A
chains in the Genus database with same CATH superfamily
3OWJA 3FV8A 4KBKA 4C37A 2R3GA 3AT2A 2JD5A 3CIKA 4OAVB 4AAAA 4GYIA 3Q32A 1UU9A 2B55A 3NUXA 5FQDC 3WZJA 3CP9A 3NUUA 1YXTA 3F5PA 5EDPA 1A06A 2YAAA 3CC6A 3HV7A 4X6RA 5F20A 4KS7A 1H0WA 2E9OA 2QHNA 3PWYA 4FYOA 2FYSA 5AUYA 1UNGA 4MF0A 3FYKX 3PZEA 4Y5QA 2VTAA 3S00A 3AC2A 5EOLA 3CY2A 5AP2A 1E9HA 4J98A 5BYLA 5EH0A 2AC5A 2I1MA 3A99A 2OXXA 3CJFA 4HVDA 4H05A 3HNGA 1APME 4JRNA 3FLSA 2A2AA 4HNIA 4BDFA 5DOSA 3V8TA 4LGDA 5K0XA 3DQWA 4CFFA 3HV5A 3BLQA 4QYGA 3BEAA 1ZRZA 4LGGA 4AZTA 2R3NA 3GU7A 2IZSA 5LMBA 1IAHA 3A7FA 4I5HA 2F7EE 5DNRA 4IVBA 1MUOA 4APPA 3QAME 4YMJA 4AA0A 4GH2A 4FOBA 5J5SA 4FKLA 4HGTA 4LMNA 3GEQA 4NW5A 4MCVA 1PXMA 3MV5A 3H9RA 3SRVB 1JAMA 5DGZA 5CALA 3L8SA 1H24A 2OH0E 3NSZA 1REJA 3QTWA 4OBOA 5IH6A 4CG9A 2QOHA 4IAAA 4I6LA 4ENXA 3N4VA 2PE2A 1PW2A 1STCE 3SXSA 2YIQA 3VS5A 5ITAA 1UKIA 1GJOA 4PDYA 2C5NA 2WEIA 4QTAA 4A9YA 3EYGA 3IPHA 4KIKB 1Z9XA 2R7IA 4YO4A 5CYIA 3ERKA 1L3RE 3DDQA 4WD5A 2RKUA 3R8LA 4EOQA 2Y4IB 3NX8A 4D9UA 1OL2A 4DAWA 2ITNA 1GIHA 2FSLX 2QO7A 3QCYA 4EONA 2PHKA 3RHKA 1IA8A 3ZBFA 3EN6A 1WBVA 3PLAE 4FL2A 3LIJA 1JQHA 2R64A 3ORMA 4X7QA 5JN2A 2XKFA 2YCQA 5JFXA 2UUEA 2VO7A 4RA5A 3UP2A 4D55A 3KXZA 3UP7A 1K3AA 5L2QA 3HKOA 3UZRA 4Y83A 1H28A 4EH4A 3CQEA 4BI1A 1YI6A 4PMSA 2YM7A 3COHA 4CQGA 2QLUA 3L8VA 1O6LA 3QTXA 4IC8A 3WF8A 5L2SA 1M2QA 4YTIA 2VWIA 3FKLA 3FE3A 3KRWA 3AGLA 4MBJA 3Q9ZA 5AM6A 3UNJA 3DTWA 2OKRA 4DC2A 4F0GA 2VV9A 3VS6A 3WF5A 5IQAA 4QMVA 4BYJA 2IF8A 1OGUA 2SRCA 3H30A 5CXZA 2PUNA 4ZOGA 3E7OA 5IMXA 4FT7A 4FICA 1G8KA 4O7ZA 2BDFA 3V04A 4QMWA 3PJ1A 3QFVA 4D4YA 1QL6A 2JDSA 4JQEA 2UZBA 2ZYBA 1BL7A 2YIWA 3TJDA 3GXLA 3QA0A 4ZSEA 1BMKA 2C68A 5CLPA 3UZPA 1J91A 3SHEA 4S2ZA 5FP6A 5LVPA 3ULIA 3O50A 5IQBA 2A4LA 5KMJA 3ZO2A 5K0KA 1V0BA 3EQFA 4QTBA 5D7AA 2BMCA 5HD4A 3R04A 4BGGA 3Q5IA 1GZKA 4CFUA 1OIUA 4C2VA 4CKRA 2CLQA 3OT3A 4XG2A 4FT5A 4IZYA 5HU3A 4B7TA 2A19B 3TMOA 3F66A 4QPSA 2UW3A 2WTKB 5AX3A 1NY3A 4DLJA 2WGJA 3E87A 4U7ZA 5CEKA 3LMHA 4NUSA 1Y8YA 5JH6A 2GHGA 1JKKA 4WUAA 4YURA 3PRIA 3EQCA 2GS7A 4IVDA 2GNJA 2XA4A 4UXLA 5AP5A 1KE7A 3FBVA 1OIQA 4XV2A 3AMYA 4L44A 4AWIA 3ZUUA 4EI4A 4EOKA 3TV4A 5AMNA 5C26A 3MPAA 3Q04A 4EJ7A 4FIEA 4YSJA 3TM0A 4DGOA 2JDVA 3IO7A 3PE2A 3UG1A 2R3OA 4G3EA 3IONA 3C4ZA 2HXQA 3BHUA 3TEIA 3C9WA 2XNBA 1OMWA 4W8EA 4BRXA 4AXEA 3OBGA 4FTAA 3NCGA 4ACCA 2EVAA 2WKMA 4YZDA 4IVAA 3SW4A 3TACA 5AP4A 2VO0A 4QP7A 1YXSA 4FNYA 4OTQA 5A6OA 5CU0A 5M44A 4O7TA 5ETFA 1P4FA 3NYNA 4XV3A 3NFGB 3NYVA 3C7QA 5HTBA 3QUEA 5I9VA 3EN4A 4YJNA 2YABA 3F3ZA 3ZC6A 3FI2A 1ZXEA 3G90X 5JZJA 3VVHA 2VNWA 1M7QA 4MKCA 2DWBA 3QRUA 2VTSA 3V5JA 3EOCA 4CFVA 4F9BA 5CY3A 4IW0A 5HD7A 4GKIA 5H8GA 3CD8A 3LFAA 2C6DA 4ZLZA 3W1FA 4MXYA 3ZLSA 5CEQA 2WTCA 4MNEA 3R7YA 2YLFA 1Y6BA 5HI2A 5IA0A 3I0OA 3UDTA 4ZIMA 4NM3A 2VGPA 3EIDA 5DN3A 3RNYA 4O83A 1H1WA 2H6DA 4IC7A 2ZV8A 5AR2A 2Z02A 4D1SA 2W1CA 5GZ8A 3UDSA 3GOPA 3TUBA 3ANQA 3GU6A 4FKIA 4MHAA 4BBEA 3PXFA 2QKWB 4E26A 4EK6A 2EXCX 4TY1A 3QWJA 3D9VA 4AZVA 4EYJA 2JBOA 3A7IA 3MN3A 3EQRA 3R73A 4JBQA 5DEWA 4AT5A 3FMJA 2ZB1A 4FJVA 5EHOA 3PFYA 2V55A 4RWIA 5J95A 3N51A 2WQOA 4JDIA 2JKQA 3F6XA 2XJ2A 4PMMA 4CRLA 4J8NA 4YJUA 5AAEA 1W8CA 3O96A 5KZIA 5L2TA 5JKGA 3FHIA 4TWNA 1BYGA 1W83A 4D9TA 3G0EA 4FTIA 3AC3A 5DH3A 3CY3A 4D5KA 1UU7A 2XNEA 3PWDA 3QKLA 2JLDA 5K3YA 3F2RA 4CTBA 3JR1A 4XNEA 3W2CA 2GMXA 2R3LA 4TN6A 5AUWA 2C6TA 4J1RA 3QQFA 4GG5A 4WNMA 1V1KA 1YOJA 2YERA 2YWPA 1UWHA 5KHXA 4RC3A 3OWKA 1W2FA 1VYWA 1LPUA 2YZAA 3BYUA 1JBPE 3DPKA 2R0UA 3DB6A 4IX4A 2UW5A 4PL3A 3NR9A 4AXAA 4L00A 5BUIA 3IW7A 5CANA 5EI6A 2C6OA 2O64A 5BMSA 1URWA 5FM3A 4EORA 2RF9A 3POOA 1TVOA 3MY5A 4TXCA 2J2IB 5JT2A 2BZHB 4FV7A 3SDJA 4I4FA 4HVIA 3KGAA 3EFKA 3R22A 2QOQA 3RVGA 4K11A 4KBCA 2ITXA 4LFIA 4E4XA 4YTCA 4ZS4A 2QCSA 3L9NA 4W8DA 3MJ1A 5J9ZA 3ZO3A 3ML1A 4KIQA 4N6YA 4ACHA 5HHWA 2VTIA 2EB2A 3I6WA 4E73A 4Y72A 4HGLA 2XM8A 4QMPA 2OWBA 5IU2A 5JFVA 2X2LA 5L8LA 1Q61A 2J4ZA 3CKXA 3FWQA 3OCGA 3E8EA 3AMAA 3HDMA 4ZSAA 4CFXA 4F9AA 2X2KA 3LHJA 5HORA 4LDTA 4RIWA 2ERZE 4IEBA 3FMHA 3QTIA 3LFCA 3LFNA 3N9XA 4I1ZA 4IM3A 4RX7A 4C3RA 3TKHA 2WTWA 4NTTA 5DR6A 1FOTA 5IH5A 4ZY6A 4DHJA 1W7HA 4A07A 5B2MA 4FSQA 1H25A 3V5PA 3R1YA 3HAVA 4AXDA 4XHKB 2CCIA 3FQHA 4EHVA 1PHKA 2H34A 2H8HA 4YLLA 2CKEA 2CCHA 5LOHA 4BKZA 4UMTA 4F1OA 4PDSA 4MBLA 3OY3A 4ANMA 1W2DA 3KF4A 4CZUA 5DR2A 3SD0A 3SOAA 2JKKA 4I21A 4BF2A 5A54A 3C4FA 3VBYA 4MXOA 5CS6A 1O9UA 5EI8A 3B8RA 3ORIA 4KUJA 2FSMX 3VNTA 4RJ4A 5IQGA 3IQ7A 4ZSLA 2V0DA 4BHNA 3PY3A 4FIFA 5HLPA 4FL3A 3ZM4A 4DEEA 2X7GA 2UZOA 3KRLA 4O27B 3UG2A 4QTDA 3NFFB 4AN2A 3VS3A 4ALWA 1PYXA 3MW1A 1O6KA 4QRCA 5DI1A 2WFYA 3MDYA 5JRQA 4ZSGA 3U87A 4KBAA 4UBAA 5I3OA 2ITTA 2A98A 3ZRMA 1VZOA 3TZ9A 4EZ7A 5KMLA 3H3CA 3SG8A 4IADA 1MRYA 2W1EA 3UE4A 4ONAA 4AP7A 3UBDA 2QO2A 2PZPA 3P08A 3QQJA 5IISA 2CN8A 4AFEA 3UZTA 4O7VA 4ZXTA 3WOWA 3I81A 2F7ZE 4CMUA 1TQIA 3MTFA 4I4EA 4ACDA 1ZAOA 4PNKA 2FSTX 4GFOA 3VF9A 2Q0NA 4FSWA 2PZIA 4IZ7A 3VHKA 4PP9A 3HMNA 3T8OA 2XK9A 3ULZA 3LCKA 4XG4A 1MP8A 4EUUA 4ZLOA 3OVVA 2C0TA 4RFMA 4YP8A 1BL6A 2X0OA 1ZOGA 5DFPA 4EK5A 4F7NA 1YWNA 4RLLA 2PULA 1DI8A 4I23A 4RIOA 4BBMA 3OTUA 4H39A 3FUPA 3Q5ZA 3GCSA 4M97A 4R5SA 5AEPA 2AUHA 3PSCA 3UPZA 2PMIA 3D2KA 4GFMA 5GHVA 5CASA 4U43A 2CKOA 2QURA 2WMQA 3KKVA 4FEXA 3G9NA 5BVKA 3FL5A 4TYJA 3BYOA 3DAJA 1PMEA 4IXPA 2J0LA 5HTCA 2YM6A 4PL4A 3CCNA 2PVNA 3PG1A 3GC8A 4RG0A 5CX9A 4IB5A 4B0GA 3L9MA 2F4JA 3BPRA 2JAVA 4EH3A 4V04A 3NS9A 5J7HA 4QYYA 3Q53A 3R7VA 2X0GA 2C1BA 5ETIA 3R00A 1ZLTA 4RIXB 5LCKA 4QMXA 4DG0E 3V5LA 5JGBA 3COKA 3R0TA 4FSNA 5CU2A 3HYHA 3ITZA 2F57A 4X3JA 4AGWA 3ZOSA 4FK3A 1H1RA 3LMGA 2WEVA 3U54A 2P3GX 4II5A 5JFWA 2XEZA 4LRMA 3AGMA 4U6RA 2GHMA 4YJPA 5GJDA 3MGYA 2EWAA 4ZJIA 1MQ4A 3DLSA 2XZSA 4XOZA 3ZO1A 3EQHA 3FL4A 1Y8GA 2I0VA 4QMSA 3HRFA 3PIZA 3GCUA 3H0ZA 3U4UA 4AQCA 4CKJA 3OBJA 4XV9A 1H07A 5KUPA 4XCUA 4GKHA 3DJ6A 4L45A 3F3TA 3UO4A 4U42A 4L3JA 4NM0A 3SOCA 1DM2A 1BLXA 3ORXA 4OTRA 2OFVA 4AS0A 2GTMA 2YEXA 3RHXA 3WZUA 4JRVA 2F2UA 2IZRA 2WQBA 4BGQA 5DE2A 2Z60A 2OBJA 4M13A 2VTPA 2CHLA 2CJMA 2HY0A 4N0SA 4AXFA 4TNBA 3PP1A 1KE9A 1ZYJA 4OBQA 4EK3A 2ITWA 3FY0A 2ZDTA 3HMOA 4U41A 5AP1A 4D1ZA 1JSUA 3IW5A 5AIKA 5IUHA 2WIHA 2I6LA 3DLZA 3EKNA 3QD3A 3SW7A 2ZB0A 4DCAA 3LPBA 5HG9A 3TKUA 4FSUA 3ZUVA 3TUDA 3SC1A 4CD0A 2OGVA 3CD3A 4CZTA 3VS1A 4JLCA 4ITJA 5FWKK 4DH1A 5M07A 4R77A 4IWPA 3PY1A 4E1ZA 4DT8A 4YLKA 1YQJA 2VRXA 4U80A 1H27A 3GP0A 4KD1A 3I79A 3GC7A 4RJ6A 3GGFA 1JOWB 3LZBA 2C5OA 4KAOA 3MVMA 3NZ0A 3U55A 5DT4A 2BUJA 2VAGA 3ID6C 2YJRA 2YM3A 4IFGA 4QMTA 4BDKA 1Q3WA 4O0SA 2OJFE 3ZRKA 1NT2A 2GU8A 3KL8A 4DTBA 3P86A 4D28A 2J90A 2WELA 2BRNA 3TV6A 3VUDA 4BCJA 3LFBA 1ERKA 1GZ8A 3GC9A 4B8LA 3QALE 4EH7A 4C61A 5EW9A 2VWUA 5A3XA 4EBWA 4D2VA 2BZJA 2VTMA 4AGDA 2C0OA 2X8EA 4RC2A 4XG7A 3HV6A 3R8MA 2VUWA 2VN9A 4PV0A 1TKIA 3KRXA 4FKQA 4UALA 4XYFA 3PJCA 3DQXA 4F09A 1I09A 4EOJA 4TYEA 3RAHA 3PSBA 5ANIA 3OD6X 3WIKA 3UQFA 1UVRA 4QDEA 1WBSA 2WMXA 1XH9A 3CXWA 4ZMFA 3KCFA 2IWIA 3SRVA 4K33A 3UNKA 4LV7A 4OTGA 3EL7A 4H1JA 2WQNA 4OGRA 2BPMA 5HX8A 4WSQA 5HICA 2OXDA 2CGWA 3ZFXA 4XP3A 3IECA 4OT6A 1CSNA 3QF9A 4GU9A 1IA9A 3HV4A 4KKHA 5LQFA 4MYGA 3W2RA 4KIKA 3UDBA 2QNJA 2ITVA 5HVKA 4U79A 2QOIA 2C30A 4FOCA 3C5IA 3NYXA 5CU4A 3QD0A 4RVMA 3WF9A 3RK7A 1PXNA 4Q5HA 2YAKA 4DG3E 4ASDA 4D0WA 2QOKA 2W1DA 3Q52A 3QUDA 1OZ1A 1ZMUA 5CVHA 1PXIA 1ZWSA 3R8PA 3RPSA 1XH4A 1AQ1A 2OZAB 3LFEA 4FT3A 3TNQB 4CFNA 5JSMA 1PKDA 3L8PA 1KE8A 4TWCA 3BGPA 3LCDA 5E8ZA 4D2WA 4EJNA 3DK7A 3EN9A 2OSCA 4I94A 1NVQA 1UU8A 1O6YA 1WVXA 2XRWA 4K2RA 4ZLYA 3PXRA 2QD9A 2XRUA 4PDOA 1JPAA 4FV0A 5BVWA 3TDWA 3SXFA 4QP3A 3A7JA 3OROA 3MFTA 5BNJA 4A4OA 3JVRA 1J1CA 3NUNA 4O1PA 5J1VA 1OL1A 4M0ZA 4EYMA 2B4SB 3LM0A 4G31A 4I93A 3ZO4A 5HZNA 3QCSA 3DCVA 3N4TA 1H0VA 2UZDA 3UNZA 2XKEA 2B54A 5AR8A 4OLIA 1UNLA 3QC4A 3TT0A 3DZQA 4IBMA 4MD7E 4AU8A 4BI2A 4IMYA 4F7LA 5ETCA 1PXLA 4C62A 1Q3DA 2Y8OA 4X21A 4B4LA 3MIAA 3AD6A 5ANKA 2G2FA 1XHAA 3D7TB 3CPBA 3R7GA 3OFMA 2X0QA 4I22A 2GHLA 4O7NA 1J3HA 2JITA 4A9UA 1WBPA 3L9PA 3P7BA 5J1WA 3KFAA 4LRKA 2BCJA 3G6GA 4PY1A 4QP2A 3DKFA 5HG8A 4CMTA 1B6CB 2RIOA 2OF2A 5I0BA 5CXHA 2BTRA 3HMIA 3MY0A 3VIDA 1YOMA 5EHYA 2UZWE 2GQRA 4DBNA 4DEIA 3BE9A 1G5SA 3LW0A 5HCYA 5B2KA 2VWZA 2W7XA 4ZTMA 2QONA 2C0IA 3O7LD 5CSWA 5F94A 4C4EA 4G9CA 4PTCA 4Q5EA 4C02A 2XUUA 1FVVA 3LQ8A 2BAQA 3MSSA 3UVRA 2JKMA 5C27A 2QOFA 3F61A 4DHZA 3ZTXA 3OG7A 4RWJA 3QQHA 4BB4A 1U4DA 4BR3A 4FIGA 3ZFMA 3MYGA 4P2KA 3QBNA 4JDJA 2UW4A 5ANJA 5IEYA 2C69A 2Z7QA 5DWRA 4QYHA 1H1PA 2QOBA 5E1EA 5BYYA 3C4EA 4FT0A 2HZIA 4WRGA 3QTZA 3I1AA 4HPTE 5JQ5A 1WVYA 4X0MA 4YJQA 3VUMA 2R3RA 1ZYSA 3KU2A 2W1IA 2PTKA 4YZBA 5AADA 4E20A 4BDHA 1Q8YA 4GJ3A 3OT8A 1QPDA 5L2WA 2PUUA 4XBRA 2UVYA 4ZS0A 3QLFA 4HPUE 4YNEA 2JIIA 2OJIA 2X6EA 4JT3A 4CV9A 4ZTHA 2QC6A 3CGOA 2RSVA 4MXZA 3NEWA 1P2AA 4Z7GA 3H9OA 4LOOA 5IEXA 4RWKA 1P4OA 4IHPA 2WPAA 4JVGA 1OKVA 3F88A 4QTEA 3LKMA 3F5XA 2BHHA 3PVGA 3JVSA 4FZFB 4L3LA 1Q8UA 5CENA 3DJ5A 3RINA 2J6MA 4S31A 4LUEA 4GT5A 2RG5A 5EOBA 4G16A 4A06A 3ORNA 4K8AA 5E1SA 4C34A 4EZ3A 3BL7A 4JBOA 4N70A 4NSTA 2DUVA 5IG1A 4CSVA 2HCKA 1NVRA 3ZSHA 4AOTA 2BVAA 4M67A 1OUYA 3UIBA 4BWPA 4IB0A 5EKNA 3FXZA 2O2UA 2IVVA 2PMNX 3ALOA 1UU3A 2W06A 2RGPA 5EM5A 1IG1A 3GC0A 4J7BA 3W0PA 3EL8A 3ZFYA 3DKCA 3LFSA 2X1NA 5EYKA 4ANNA 4HCUA 1ZYCA 3HUCA 4LOQA 2WQEA 4U45A 2YWVA 4M0YA 3D5WA 1ST4A 3SG9A 3W0OA 3PA3A 1QPCA 1GOLA 5CNNA 4ZZOA 4GG7A 2NRYA 1M52A 3EKKA 3JY9A 4GYGA 3UO6A 3RP9A 5CF6A 4KS8A 3JXWA 4M66A 5LWNA 4DH8A 4A4XA 4LYNA 5CU3A 3TIZA 5DMZA 1KV2A 2HW7A 4WG4A 5JK3A 3OS3A 4O21A 3AD5A 2DYLA 3CS9A 3BHYA 4WBBB 4M84A 1IRKA 4WSYA 4Y73A 2R3FA 3RALA 4ZY4A 5BUEA 5IF1A 4HCVA 5LVMA 1KUTA 3MH0A 5KNJA 3VONA 2A27A 1B39A 2ETKA 4S34A 4EEVA 2FUMA 2PVHA 2BILB 4JDKA 4IIRA 5IQDA 1FGIA 3PY0A 2ZV2A 2G01A 3QXOA 5M4CA 1NXKA 5HEZA 3L8XA 3VUKA 2BDWA 3ZZEA 1VYZA 1OPLA 5ICPA 2IG7A 3R9RA 4FZ7A 2I40A 2ZOQA 3VBQA 2OXYA 4L7FA 5AUXA 4ASEA 3LM5A 3VUHA 5CAVA 3F3VA 5HBHA 3ZEWA 3KK9A 4AZFA 5M4UA 4KRDA 4U0IA 5BV3A 4X2KA 3OP5A 3P5JC 3DK3A 2PVMA 4O7SA 2IZTA 1PRYA 3TTJA 5KZ0A 4AA5A 5BUJA 2QOLA 1TQMA 3I7CA 2NP8A 3RCDA 3LFDA 4FGBA 4TZRA 2VTJA 3QZIA 4UWCA 3UIUA 4CXAA 3U6IA 1VR2A 2UZUE 5CWZA 4PPAA 3HUBA 1B38A 3KC3A 5D7VA 5FD2A 1YXVA 3TDVA 2GTNA 3M42A 4DTKA 5A46A 2YCSA 4KA3A 2ONLA 3CLYA 3FLYA 3ATSA 3FMDA 5CEOA 4E5AX 2EU9A 4JX7A 5TOZA 2F2CB 3VJNA 2VZ6A 4BZOA 1H4LA 3P4KA 4ZY5A 2C47A 5HG7A 2WMUA 4BJJB 1NVSA 5T3QA 4PTEA 3VW8A 5A6NA 3JUHA 1Q99A 1RQQA 5KHWA 2C5YA 5LWMA 1YWRA 1BUHA 3KMWA 2R3HA 5FDPA 3BEGA 5HLWA 4IAYA 4IZ5A 3HZTA 5CZIA 3KIOC 1P5EA 4BKYA 4IWQA 2WB8A 1PMNA 2I0YA 5BVEA 2CDZA 5ACKA 2OJJA 4ASZA 4EQMA 5CEPA 4CGAA 5J9YA 4I0TA 4DBXA 3BI6A 4OTFA 1VEBA 5IMEA 4I5CA 4O1OA 4X3FB 2Q0BA 3LMIA 3FLQA 2VO3A 4G6LA 4RRVA 2P0CA 2R4BA 3V8SA 4QMOA 2PPQA 4RC4A 4FTKA 3QTUA 4O0TA 1CKPA 1K2PA 4FSYA 2Z8CA 4W4YA 4F0IA 3GUBA 4FIJA 2F7XE 4FYNA 2UZVA 3BU5A 4DFXE 5GJFA 2G2HA 1TZDA 3R9HA 3P79A 4XS2A 5CT0A 3TKIA 4GU6A 4A4LA 3AC1A 4YNOA 4FIHA 2BIYA 5BMMA 4JG7A 2JFMA 1CDKA 3M2WA 4JNWA 5EI2A 4DFUA 2IO6A 1YRPA 4FF8A 3MPMA 3AKKA 3LAUA 2VU3A 5FUTA 2G15A 3QXPA 2LAVA 4CTCA 4QQJA 4EK8A 1H01A 3FSFA 5I4NA 3E62A 4ORKA 2B0QA 1XH8A 1WAKA 5IA1A 1X8BA 5FEQA 4ALUA 3NCZA 4JQ8A 4F70A 3QZFA 4QQ5A 2F9GA 3BGZA 1FVTA 3BU6A 3VBWA 5HNGA 2W1FA 3PG3A 2W4OA 2E9UA 2QLQA 2Y7JA 5D41A 1G3NA 4FV8A 3UVPA 1Q8WA 5FXRA 5KMKA 3CSVA 1JSTA 1CMKE 5TT7A 3E3BX 5I9YA 5LMKC 4FEVA 5ANEA 4L42A 4L8MA 3CQWA 5FG8A 3ZLYA 4KNBA 3AD4A 4GL9A 3UOLA 4PPBA 3UGCA 1RE8A 4UZHA 2HK5A 4KRCA 3ROCA 4ITHA 2XJ0A 3ZONA 4ALVA 3PJ3A 3TTIA 3GI3A 5CAPA 1E1VA 2ZV7A 3PZHA 4FKPA 1R0EA 3FC1X 3DBDA 3WYXA 5EYMA 4O0WA 4I92A 2QI8A 2WTKC 2VX3A 1R39A 3EQIA 4XRJA 2HWPA 4EZ5A 4MF1A 3VHEA 2R3KA 3H0YA 4C4FA 3FAAA 2IJMA 3MWUA 1YDRE 2BAJA 3VC4A 4DGMA 2OU7A 4FTQA 3QCXA 3Q3BA 4OTHA 4FTRA 2CSNA 5KKRB 2XANA 5I9UA 3VRZA 4D1XA 4PNIA 5AM7A 3GU5A 5GIPE 2C1AA 2WU7A 4Q9SA 4BDJA 2VTHA 4O4EA 3ZDIA 3A62A 4WBOA 4F6SA 3HMPA 4E5BA 5TR6A 2XYUA 5CVFA 3F3UA 1KE5A 5CSPA 2IW6A 2B9IA 2HENA 5EM7A 2VTNA 3VS4A 4Y46A 2WMWA 1SVGA 4L9IA 5HGIA 4BI0A 5AV4A 1SNXA 3K3JA 3NW7A 2XNNA 2XK6A 2XIXA 2X81A 1WFCA 2R3IA 3W10A 3BHTA 2QQ7A 4FV2A 2C3LA 4QMUA 5CSXA 3TNIA 2PL0A 3KXHA 4GRBA 3FPMA 3VBVA 4B6LA 4E4LA 2LGCA 3JYAA 3W0MA 1FQ1B 2C3IB 2VTRA 4BL1A 3W8LA 3GCVA 2WMAA 3RZBA 3FZRA 2GQGA 1U59A 4Y5HA 5CI7A 2B9HA 3FZPA 3PTGA 2YM5A 5EM8A 1LUFA 5KBQA 3GFWA 4R3PA 3RTPA 3FDNA 2HWOA 3SLSA 3R1SA 5TF9A 3V5TA 5EQPA 5IQHA 2XF0A 5E8YA 4F7JA 3FZ1A 3G5DA 3G9LX 3W32A 4GK2A 3WZEA 4F9WA 3R8VA 5IA2A 3P9JA 4C57A 4TNDA 1IEPA 4WNKA 2PMLX 5KMOA 4YPDA 5AX9A 1XBCA 4R7BA 1RJBA 3QLGA 1YVJA 3OOMA 4ZZNA 4FGRA 1XBAA 3QCQA 4CQEA 4HZRA 3C51A 4FL1A 3NDMA 4JIKA 3RWPA 4A9TA 4FA2A 1OGYA 4LQMA 1QCFA 2E2BA 2Z7LA 3LQ3A 2UZTA 5J79A 5HO6A 4E6CA 2PYWA 5HIDA 3W55A 5KMNA 2G9XA 4TTHB 4DDGA 5K4JA 3OCSA 4FV4A 4CCBA 3IW8A 4ACMA 2GPHA 3BBTB 4YHFA 4D4VA 3E88A 2CGVA 4J97A 4XV1A 2V7AA 4NM5A 4RX9A 4O4DA 3K2LA 4P5QA 1GIIA 2XB7A 3R1NA 4ERWA 2QKRA 3I6UA 4KKGA 4ACGA 3GB2A 4F63A 4L53A 3HA8A 5FTOA 1WBNA 2G1TA 4GCJA 3DK6A 4EH8A 2IW8A 3SGCA 2YN8A 4FI1A 2YFXA 3PDTA 3I5NA 3FMNA 1M17A 3DFAA 3Q4UA 3UOHA 5IUGA 1DS5A 2WU6A 3PFQA 4JG8A 2GNIA 3FPQA 3U9CA 4WKQA 5EYCA 3COIA 3NNVA 4D2RA 4IE9A 2J5FA 1LEWA 4IDVA 2PVFA 2XP2A 4FZAB 5T6KA 5L3AA 3OZ6A 2ITQA 1YI3A 3UPXA 5FBNC 1P14A 2ZVAA 5FDXA 3ZM9A 4DFLA 2NO3A 5LARA 2P2HA 4TT7A 4AG8A 2R9SA 3PUPA 3WZKA 4LI5A 1PMUA 3NRMA 3ZDUA 3EFWA 2WTJA 4G3DA 3A7HA 4RQKA 4EOOA 4LUDA 4BCNA 2YJSA 4WRSA 4BGHA 2QR8A 1FINA 4RZWA 3T9IA 1FBNA 2VX0A 3OXIA 4TYHB 3UMWA 3MJ2A 4R6VA 2GDOA 3JPVA 2V7OA 2C3KA 3ORKA 2BDJA 4U97A 4HYSA 2ITYA 4FTMA 3RGFA 3F82A 5KE0A 2W9FB 4G6OA 5H8EA 4IM2A 5IA5A 4RFYA 2OZAA 3RMFA 5H3QA 3KEXA 4L68A 4ZTLA 3F5UA 4FTCA 4KKEA 1CKJA 3G51A 4OTWA 4NKAA 4D4RA 3KXMA 2ONLC 4DE4A 4YJSA 1ZY4A 2C6LA 3ETAA 3BU3A 2CNQA 1ZOHA 4FV9A 2P33A 5ANGA 3FZSA 3F5GA 1LEZA